F488907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1044 | 502 | 1031 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_11142656|Ga0163162_111426562 |
| Length | 158 |
| Sequence | MPGTRPGMTKVGKETIVRHAKTHRKFNRRSDHRRSMLANLAASLIKHEQITTTLPKAKDLRPVVEKLVTLGKRGDLHARRQAIAQMRDLAMVKKLFEVIGPRYKDRDGGYLRVLKAGFRYGDSAPVAVIEFVDRDVEAKGKDSGPVQARAEEAAPAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 2 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 3 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 4 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 5 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 6 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 7 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 8 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 9 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 10 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 11 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 12 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 13 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 23 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 25 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 110 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 125 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 156 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 157 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 246 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 248 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 249 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 252 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 254 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 255 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 259 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 260 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 264 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 265 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 275 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 277 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 286 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 287 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 295 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 298 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 299 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 300 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 301 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 302 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 306 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 307 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 308 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 309 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 310 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 312 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 313 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 314 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 315 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 316 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 317 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 318 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 319 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 320 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 321 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 322 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 323 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 324 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 404 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 405 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 406 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 407 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 408 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 409 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 412 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 413 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 418 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 419 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 420 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 421 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 460 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 461 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 462 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 463 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 478 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 479 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 480 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 482 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 483 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 485 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 486 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 489 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 490 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 502 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.5 |
| Metatranscriptomes | 3.26 |
| Isolates | 1.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.61 |
| Nodule | 0.38 |
| Rhizoplane | 8.81 |
| Rhizosphere | 80.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001137 | 3300001977 | Bacteria | 4200 |
| 2 | JGI24739J22299_10134223 | 3300001989 | Bacteria | 735 |
| 3 | JGI24750J21931_1000826 | 3300002070 | Bacteria | 4280 |
| 4 | JGI24748J21848_1001282 | 3300002074 | Bacteria | 2750 |
| 5 | JGI24738J21930_10018711 | 3300002075 | Bacteria | 1447 |
| 6 | JGI24744J21845_10000833 | 3300002077 | Bacteria | 5807 |
| 7 | JGI24033J26618_1000715 | 3300002155 | Bacteria | 3185 |
| 8 | JGI24034J26672_10000746 | 3300002239 | Bacteria | 4200 |
| 9 | JGI24742J22300_10002192 | 3300002244 | Bacteria | 3115 |
| 10 | JGI25162J39368_1000154 | 3300002737 | Bacteria | 75240 |
| 11 | JGI25164J39214_1018510 | 3300002772 | Bacteria | 623 |
| 12 | JGI25165J46597_1000239 | 3300003214 | Bacteria | 75240 |
| 13 | Ga0007429J51699_1104387 | 3300003579 | Bacteria | 516 |
| 14 | Ga0055538_1000094 | 3300003751 | Bacteria | 75240 |
| 15 | Ga0055539_1000136 | 3300003752 | Bacteria | 76284 |
| 16 | Ga0055533_1000143 | 3300003756 | Bacteria | 75240 |
| 17 | Ga0055525_1000188 | 3300003759 | Bacteria | 75240 |
| 18 | Ga0055524_1000024 | 3300003775 | Bacteria | 217953 |
| 19 | Ga0055531_10002421 | 3300003794 | Bacteria | 12498 |
| 20 | Ga0055541_1000092 | 3300003841 | Bacteria | 75240 |
| 21 | Ga0058860_12217134 | 3300004801 | Bacteria | 1295 |
| 22 | Ga0070658_10052412 | 3300005327 | Bacteria | 3309 |
| 23 | Ga0070658_10154512 | 3300005327 | Bacteria | 1923 |
| 24 | Ga0070658_11116623 | 3300005327 | Bacteria | 686 |
| 25 | Ga0070683_100665716 | 3300005329 | Bacteria | 997 |
| 26 | Ga0070690_100064687 | 3300005330 | Bacteria | 2363 |
| 27 | Ga0070670_100033818 | 3300005331 | Bacteria | 4402 |
| 28 | Ga0070670_100045376 | 3300005331 | Bacteria | 3778 |
| 29 | Ga0070677_10200448 | 3300005333 | Bacteria | 963 |
| 30 | Ga0068869_100104724 | 3300005334 | Bacteria | 2145 |
| 31 | Ga0070666_10114683 | 3300005335 | Bacteria | 1866 |
| 32 | Ga0070666_10423572 | 3300005335 | Bacteria | 959 |
| 33 | Ga0070680_100164388 | 3300005336 | Bacteria | 1866 |
| 34 | Ga0070680_100225381 | 3300005336 | Bacteria | 1582 |
| 35 | Ga0070682_100018452 | 3300005337 | Bacteria | 4078 |
| 36 | Ga0068868_100010692 | 3300005338 | Bacteria | 6651 |
| 37 | Ga0068868_101766949 | 3300005338 | Bacteria | 584 |
| 38 | Ga0070660_100023815 | 3300005339 | Bacteria | 4538 |
| 39 | Ga0070660_100337489 | 3300005339 | Bacteria | 1240 |
| 40 | Ga0070689_100044445 | 3300005340 | Bacteria | 3417 |
| 41 | Ga0070689_100278703 | 3300005340 | Bacteria | 1386 |
| 42 | Ga0070691_10216215 | 3300005341 | Bacteria | 1014 |
| 43 | Ga0070691_10869368 | 3300005341 | Bacteria | 554 |
| 44 | Ga0070687_100142255 | 3300005343 | Bacteria | 1398 |
| 45 | Ga0070687_101529520 | 3300005343 | Bacteria | 502 |
| 46 | Ga0070661_100545081 | 3300005344 | Bacteria | 933 |
| 47 | Ga0070661_101167973 | 3300005344 | Bacteria | 643 |
| 48 | Ga0070668_100043280 | 3300005347 | Bacteria | 3453 |
| 49 | Ga0070668_100276299 | 3300005347 | Bacteria | 1402 |
| 50 | Ga0070668_100520394 | 3300005347 | Bacteria | 1032 |
| 51 | Ga0070669_100078912 | 3300005353 | Bacteria | 2448 |
| 52 | Ga0070675_100004703 | 3300005354 | Bacteria | 10420 |
| 53 | Ga0070675_100487395 | 3300005354 | Bacteria | 1109 |
| 54 | Ga0070675_100890238 | 3300005354 | Bacteria | 816 |
| 55 | Ga0070671_100037107 | 3300005355 | Bacteria | 4042 |
| 56 | Ga0070671_100051674 | 3300005355 | Bacteria | 3418 |
| 57 | Ga0070671_100545240 | 3300005355 | Bacteria | 1000 |
| 58 | Ga0070671_101103474 | 3300005355 | Bacteria | 697 |
| 59 | Ga0070674_100586808 | 3300005356 | Bacteria | 940 |
| 60 | Ga0070674_100918020 | 3300005356 | Bacteria | 764 |
| 61 | Ga0070673_100015193 | 3300005364 | Bacteria | 5398 |
| 62 | Ga0070673_100018429 | 3300005364 | Bacteria | 4985 |
| 63 | Ga0070673_100566972 | 3300005364 | Bacteria | 1033 |
| 64 | Ga0070688_100063947 | 3300005365 | Bacteria | 2334 |
| 65 | Ga0070688_100367264 | 3300005365 | Bacteria | 1058 |
| 66 | Ga0070659_100207122 | 3300005366 | Bacteria | 1615 |
| 67 | Ga0070659_100400392 | 3300005366 | Bacteria | 1159 |
| 68 | Ga0070659_101012334 | 3300005366 | Bacteria | 730 |
| 69 | Ga0070667_100009241 | 3300005367 | Bacteria | 8164 |
| 70 | Ga0070703_10106276 | 3300005406 | Bacteria | 997 |
| 71 | Ga0070709_10015699 | 3300005434 | Bacteria | 4313 |
| 72 | Ga0070709_10226111 | 3300005434 | Bacteria | 1337 |
| 73 | Ga0070714_100024965 | 3300005435 | Bacteria | 4928 |
| 74 | Ga0070714_100599229 | 3300005435 | Bacteria | 1058 |
| 75 | Ga0070714_100979173 | 3300005435 | Bacteria | 823 |
| 76 | Ga0070714_101044381 | 3300005435 | Bacteria | 796 |
| 77 | Ga0070713_100003041 | 3300005436 | Bacteria | 11020 |
| 78 | Ga0070713_100011844 | 3300005436 | Bacteria | 6372 |
| 79 | Ga0070713_100191145 | 3300005436 | Bacteria | 1845 |
| 80 | Ga0070713_100872583 | 3300005436 | Bacteria | 865 |
| 81 | Ga0070710_10082005 | 3300005437 | Bacteria | 1885 |
| 82 | Ga0070710_10346611 | 3300005437 | Bacteria | 982 |
| 83 | Ga0070711_100074713 | 3300005439 | Bacteria | 2398 |
| 84 | Ga0070711_100310705 | 3300005439 | Bacteria | 1256 |
| 85 | Ga0070705_100279873 | 3300005440 | Bacteria | 1185 |
| 86 | Ga0070700_100060003 | 3300005441 | Bacteria | 2396 |
| 87 | Ga0070694_100250827 | 3300005444 | Bacteria | 1339 |
| 88 | Ga0070708_100063487 | 3300005445 | Bacteria | 3306 |
| 89 | Ga0070708_100556604 | 3300005445 | Bacteria | 1082 |
| 90 | Ga0070663_100899446 | 3300005455 | Bacteria | 764 |
| 91 | Ga0070678_100306391 | 3300005456 | Bacteria | 1351 |
| 92 | Ga0070662_100057865 | 3300005457 | Bacteria | 2818 |
| 93 | Ga0070681_10004121 | 3300005458 | Bacteria | 13747 |
| 94 | Ga0070681_10115719 | 3300005458 | Bacteria | 2619 |
| 95 | Ga0070681_10980726 | 3300005458 | Bacteria | 765 |
| 96 | Ga0068867_100268154 | 3300005459 | Bacteria | 1395 |
| 97 | Ga0070685_10020411 | 3300005466 | Bacteria | 3584 |
| 98 | Ga0070706_100187749 | 3300005467 | Bacteria | 1931 |
| 99 | Ga0070707_100006038 | 3300005468 | Bacteria | 11310 |
| 100 | Ga0070698_100086614 | 3300005471 | Bacteria | 3119 |
| 101 | Ga0070699_100003254 | 3300005518 | Bacteria | 14368 |
| 102 | Ga0070699_100644965 | 3300005518 | Bacteria | 966 |
| 103 | Ga0070679_100059322 | 3300005530 | Bacteria | 3814 |
| 104 | Ga0070679_100080701 | 3300005530 | Bacteria | 3242 |
| 105 | Ga0070679_100206200 | 3300005530 | Bacteria | 1930 |
| 106 | Ga0070697_100767954 | 3300005536 | Bacteria | 852 |
| 107 | Ga0068853_100120553 | 3300005539 | Bacteria | 2339 |
| 108 | Ga0068853_100166407 | 3300005539 | Bacteria | 1993 |
| 109 | Ga0070672_100124373 | 3300005543 | Bacteria | 2114 |
| 110 | Ga0070672_100131496 | 3300005543 | Bacteria | 2058 |
| 111 | Ga0070686_100054524 | 3300005544 | Bacteria | 2557 |
| 112 | Ga0070665_101114008 | 3300005548 | Bacteria | 801 |
| 113 | Ga0070665_101975470 | 3300005548 | Bacteria | 589 |
| 114 | Ga0070704_100059469 | 3300005549 | Bacteria | 2727 |
| 115 | Ga0070704_100682280 | 3300005549 | Bacteria | 910 |
| 116 | Ga0068855_100293663 | 3300005563 | Bacteria | 1801 |
| 117 | Ga0070702_100115730 | 3300005615 | Bacteria | 1670 |
| 118 | Ga0070702_100565389 | 3300005615 | Bacteria | 847 |
| 119 | Ga0068852_100393611 | 3300005616 | Bacteria | 1362 |
| 120 | Ga0068859_100021311 | 3300005617 | Bacteria | 6503 |
| 121 | Ga0068864_100023234 | 3300005618 | Bacteria | 5204 |
| 122 | Ga0068864_102305694 | 3300005618 | Bacteria | 545 |
| 123 | Ga0068866_10460426 | 3300005718 | Bacteria | 834 |
| 124 | Ga0068861_100061245 | 3300005719 | Bacteria | 2887 |
| 125 | Ga0068870_10452523 | 3300005840 | Bacteria | 847 |
| 126 | Ga0068863_100017228 | 3300005841 | Bacteria | 6929 |
| 127 | Ga0068863_100251746 | 3300005841 | Bacteria | 1706 |
| 128 | Ga0068858_100053731 | 3300005842 | Bacteria | 3725 |
| 129 | Ga0068858_100511509 | 3300005842 | Bacteria | 1161 |
| 130 | Ga0068860_100108790 | 3300005843 | Bacteria | 2649 |
| 131 | Ga0068862_100030508 | 3300005844 | Bacteria | 4545 |
| 132 | Ga0068862_100535296 | 3300005844 | Bacteria | 1117 |
| 133 | Ga0068862_100680860 | 3300005844 | Bacteria | 995 |
| 134 | Ga0081455_10002425 | 3300005937 | Bacteria | 22245 |
| 135 | Ga0081455_10015627 | 3300005937 | Bacteria | 7365 |
| 136 | Ga0081455_10097760 | 3300005937 | Bacteria | 2365 |
| 137 | Ga0081455_10283150 | 3300005937 | Bacteria | 1197 |
| 138 | Ga0081538_10001041 | 3300005981 | Bacteria | 29562 |
| 139 | Ga0081538_10024942 | 3300005981 | Bacteria | 4240 |
| 140 | Ga0081538_10033225 | 3300005981 | Bacteria | 3438 |
| 141 | Ga0081540_1003020 | 3300005983 | Bacteria | 13478 |
| 142 | Ga0081539_10116951 | 3300005985 | Bacteria | 1331 |
| 143 | Ga0070717_10066346 | 3300006028 | Bacteria | 3001 |
| 144 | Ga0070717_10083481 | 3300006028 | Bacteria | 2687 |
| 145 | Ga0070717_10384655 | 3300006028 | Bacteria | 1259 |
| 146 | Ga0070717_10569423 | 3300006028 | Bacteria | 1026 |
| 147 | Ga0070717_11369757 | 3300006028 | Bacteria | 643 |
| 148 | Ga0075365_10025404 | 3300006038 | Bacteria | 3749 |
| 149 | Ga0075365_10091294 | 3300006038 | Bacteria | 2075 |
| 150 | Ga0075368_10305832 | 3300006042 | Bacteria | 687 |
| 151 | Ga0075363_100438326 | 3300006048 | Bacteria | 771 |
| 152 | Ga0075364_10362453 | 3300006051 | Bacteria | 988 |
| 153 | Ga0075364_10534352 | 3300006051 | Bacteria | 801 |
| 154 | Ga0075364_10956726 | 3300006051 | Bacteria | 583 |
| 155 | Ga0070716_100217271 | 3300006173 | Bacteria | 1282 |
| 156 | Ga0070716_101096905 | 3300006173 | Bacteria | 634 |
| 157 | Ga0070712_100004635 | 3300006175 | Bacteria | 8499 |
| 158 | Ga0070712_100045106 | 3300006175 | Bacteria | 3042 |
| 159 | Ga0070712_100326657 | 3300006175 | Bacteria | 1249 |
| 160 | Ga0075367_10013649 | 3300006178 | Bacteria | 4375 |
| 161 | Ga0075367_10152081 | 3300006178 | Bacteria | 1436 |
| 162 | Ga0075367_10202684 | 3300006178 | Bacteria | 1240 |
| 163 | Ga0075369_10011962 | 3300006186 | Bacteria | 3421 |
| 164 | Ga0075369_10291742 | 3300006186 | Bacteria | 761 |
| 165 | Ga0075427_10032241 | 3300006194 | Bacteria | 863 |
| 166 | Ga0075366_10095293 | 3300006195 | Bacteria | 1784 |
| 167 | Ga0075366_10239679 | 3300006195 | Bacteria | 1106 |
| 168 | Ga0097621_100102942 | 3300006237 | Bacteria | 2405 |
| 169 | Ga0097621_100175675 | 3300006237 | Bacteria | 1848 |
| 170 | Ga0075370_10033357 | 3300006353 | Bacteria | 2882 |
| 171 | Ga0068871_100159329 | 3300006358 | Bacteria | 1929 |
| 172 | Ga0075428_100092978 | 3300006844 | Bacteria | 3288 |
| 173 | Ga0075428_100099017 | 3300006844 | Bacteria | 3179 |
| 174 | Ga0075428_100256103 | 3300006844 | Bacteria | 1885 |
| 175 | Ga0075428_100475503 | 3300006844 | Bacteria | 1337 |
| 176 | Ga0075428_101071610 | 3300006844 | Bacteria | 852 |
| 177 | Ga0075431_100012366 | 3300006847 | Bacteria | 8613 |
| 178 | Ga0075431_100030686 | 3300006847 | Bacteria | 5537 |
| 179 | Ga0075431_100102642 | 3300006847 | Bacteria | 2951 |
| 180 | Ga0075431_100113920 | 3300006847 | Bacteria | 2791 |
| 181 | Ga0075431_101284843 | 3300006847 | Bacteria | 693 |
| 182 | Ga0075433_11332470 | 3300006852 | Bacteria | 622 |
| 183 | Ga0075434_100116288 | 3300006871 | Bacteria | 2687 |
| 184 | Ga0075434_100157899 | 3300006871 | Bacteria | 2287 |
| 185 | Ga0075434_101495489 | 3300006871 | Bacteria | 684 |
| 186 | Ga0075429_100264985 | 3300006880 | Bacteria | 1505 |
| 187 | Ga0075429_100921396 | 3300006880 | Bacteria | 764 |
| 188 | Ga0075429_101122448 | 3300006880 | Bacteria | 687 |
| 189 | Ga0075436_100095184 | 3300006914 | Bacteria | 2072 |
| 190 | Ga0097620_100021311 | 3300006931 | Bacteria | 6503 |
| 191 | Ga0079104_1004902 | 3300006946 | Bacteria | 5529 |
| 192 | Ga0075435_100085297 | 3300007076 | Bacteria | 2599 |
| 193 | Ga0075435_100534415 | 3300007076 | Bacteria | 1015 |
| 194 | Ga0099794_10149209 | 3300007265 | Bacteria | 1186 |
| 195 | Ga0099795_10003005 | 3300007788 | Bacteria | 4102 |
| 196 | Ga0099795_10481088 | 3300007788 | Bacteria | 576 |
| 197 | Ga0105240_10473503 | 3300009093 | Bacteria | 1397 |
| 198 | Ga0105240_11460572 | 3300009093 | Bacteria | 718 |
| 199 | Ga0111539_10359025 | 3300009094 | Bacteria | 1696 |
| 200 | Ga0111539_10407003 | 3300009094 | Bacteria | 1585 |
| 201 | Ga0105245_10097208 | 3300009098 | Bacteria | 2719 |
| 202 | Ga0105245_11112738 | 3300009098 | Bacteria | 836 |
| 203 | Ga0105245_11689775 | 3300009098 | Bacteria | 685 |
| 204 | Ga0105247_10117745 | 3300009101 | Bacteria | 1717 |
| 205 | Ga0105247_10353983 | 3300009101 | Bacteria | 1033 |
| 206 | Ga0105247_10470091 | 3300009101 | Bacteria | 910 |
| 207 | Ga0114129_10083416 | 3300009147 | Bacteria | 4440 |
| 208 | Ga0114129_10092035 | 3300009147 | Bacteria | 4201 |
| 209 | Ga0114129_10248507 | 3300009147 | Bacteria | 2388 |
| 210 | Ga0114129_10431100 | 3300009147 | Bacteria | 1732 |
| 211 | Ga0114129_10544522 | 3300009147 | Bacteria | 1510 |
| 212 | Ga0114129_10732661 | 3300009147 | Bacteria | 1267 |
| 213 | Ga0105241_10429941 | 3300009174 | Bacteria | 1164 |
| 214 | Ga0105241_10992828 | 3300009174 | Bacteria | 785 |
| 215 | Ga0105242_10270438 | 3300009176 | Bacteria | 1539 |
| 216 | Ga0105242_11366899 | 3300009176 | Bacteria | 734 |
| 217 | Ga0105249_10318767 | 3300009553 | Bacteria | 1565 |
| 218 | Ga0105249_10745979 | 3300009553 | Bacteria | 1041 |
| 219 | Ga0099796_10539450 | 3300010159 | Bacteria | 524 |
| 220 | Ga0105239_10096716 | 3300010375 | Bacteria | 3262 |
| 221 | Ga0105239_10121682 | 3300010375 | Bacteria | 2899 |
| 222 | Ga0105239_10190771 | 3300010375 | Bacteria | 2294 |
| 223 | Ga0105239_10342018 | 3300010375 | Bacteria | 1688 |
| 224 | Ga0105239_10367401 | 3300010375 | Bacteria | 1626 |
| 225 | Ga0105239_12977552 | 3300010375 | Bacteria | 552 |
| 226 | Ga0105246_10043793 | 3300011119 | Bacteria | 3038 |
| 227 | Ga0105246_10455871 | 3300011119 | Bacteria | 1076 |
| 228 | Ga0105246_11814452 | 3300011119 | Bacteria | 583 |
| 229 | Ga0157371_10185602 | 3300013102 | Bacteria | 1488 |
| 230 | Ga0157370_10253447 | 3300013104 | Bacteria | 1628 |
| 231 | Ga0157369_10212075 | 3300013105 | Bacteria | 2029 |
| 232 | Ga0157374_10953973 | 3300013296 | Bacteria | 876 |
| 233 | Ga0157378_10919350 | 3300013297 | Bacteria | 906 |
| 234 | Ga0157378_11296527 | 3300013297 | Bacteria | 769 |
| 235 | Ga0163162_10785622 | 3300013306 | Bacteria | 1070 |
| 236 | Ga0163162_11142656 | 3300013306 | Bacteria | 883 |
| 237 | Ga0157375_10007761 | 3300013308 | Bacteria | 9385 |
| 238 | Ga0163163_10043637 | 3300014325 | Bacteria | 4397 |
| 239 | Ga0163163_10050450 | 3300014325 | Bacteria | 4098 |
| 240 | Ga0163163_10220411 | 3300014325 | Bacteria | 1946 |
| 241 | Ga0157380_10186027 | 3300014326 | Bacteria | 1829 |
| 242 | Ga0157380_10888444 | 3300014326 | Bacteria | 916 |
| 243 | Ga0157380_11513121 | 3300014326 | Bacteria | 724 |
| 244 | Ga0157380_11946444 | 3300014326 | Bacteria | 649 |
| 245 | Ga0157377_10001603 | 3300014745 | Bacteria | 9842 |
| 246 | Ga0157379_10471191 | 3300014968 | Bacteria | 1161 |
| 247 | Ga0157379_10673187 | 3300014968 | Bacteria | 970 |
| 248 | Ga0157379_10750918 | 3300014968 | Bacteria | 918 |
| 249 | Ga0157379_10878566 | 3300014968 | Bacteria | 849 |
| 250 | Ga0157379_12244788 | 3300014968 | Bacteria | 543 |
| 251 | Ga0157376_10035452 | 3300014969 | Bacteria | 4036 |
| 252 | Ga0157376_10042796 | 3300014969 | Bacteria | 3713 |
| 253 | Ga0182006_1000240 | 3300015261 | Bacteria | 51334 |
| 254 | Ga0182007_10045164 | 3300015262 | Bacteria | 1461 |
| 255 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 256 | Ga0182005_1000370 | 3300015265 | Bacteria | 24872 |
| 257 | Ga0163161_10081304 | 3300017792 | Bacteria | 2386 |
| 258 | Ga0163161_10462864 | 3300017792 | Bacteria | 1027 |
| 259 | Ga0163161_11739808 | 3300017792 | Bacteria | 553 |
| 260 | Ga0197907_10230911 | 3300020069 | Bacteria | 517 |
| 261 | Ga0213876_10003406 | 3300021384 | Bacteria | 9099 |
| 262 | Ga0213876_10100124 | 3300021384 | Bacteria | 1536 |
| 263 | Ga0224572_1020774 | 3300024225 | Bacteria | 1260 |
| 264 | Ga0228598_1000416 | 3300024227 | Bacteria | 8639 |
| 265 | Ga0228598_1010790 | 3300024227 | Bacteria | 1819 |
| 266 | Ga0228598_1017982 | 3300024227 | Bacteria | 1395 |
| 267 | Ga0209760_103118 | 3300025207 | Bacteria | 1491 |
| 268 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 269 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 270 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 271 | Ga0209672_107197 | 3300025228 | Bacteria | 1732 |
| 272 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 273 | Ga0207427_100342 | 3300025231 | Bacteria | 30270 |
| 274 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 275 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 276 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 277 | Ga0209256_1000054 | 3300025299 | Bacteria | 298431 |
| 278 | Ga0207697_10048666 | 3300025315 | Bacteria | 1749 |
| 279 | Ga0207682_10061155 | 3300025893 | Bacteria | 1577 |
| 280 | Ga0207692_10022644 | 3300025898 | Bacteria | 2894 |
| 281 | Ga0207692_10066259 | 3300025898 | Bacteria | 1887 |
| 282 | Ga0207692_10144451 | 3300025898 | Bacteria | 1356 |
| 283 | Ga0207710_10007582 | 3300025900 | Bacteria | 4590 |
| 284 | Ga0207688_10010927 | 3300025901 | Bacteria | 4941 |
| 285 | Ga0207680_10683396 | 3300025903 | Bacteria | 735 |
| 286 | Ga0207647_10021711 | 3300025904 | Bacteria | 4280 |
| 287 | Ga0207685_10048614 | 3300025905 | Bacteria | 1626 |
| 288 | Ga0207685_10092801 | 3300025905 | Bacteria | 1275 |
| 289 | Ga0207685_10263207 | 3300025905 | Bacteria | 839 |
| 290 | Ga0207685_10860690 | 3300025905 | Bacteria | 502 |
| 291 | Ga0207699_10005995 | 3300025906 | Bacteria | 5850 |
| 292 | Ga0207645_10171296 | 3300025907 | Bacteria | 1423 |
| 293 | Ga0207705_10156275 | 3300025909 | Bacteria | 1711 |
| 294 | Ga0207684_10093438 | 3300025910 | Bacteria | 2565 |
| 295 | Ga0207684_11475991 | 3300025910 | Bacteria | 554 |
| 296 | Ga0207654_10976915 | 3300025911 | Bacteria | 615 |
| 297 | Ga0207707_10034403 | 3300025912 | Bacteria | 4433 |
| 298 | Ga0207707_10122288 | 3300025912 | Bacteria | 2276 |
| 299 | Ga0207707_11567233 | 3300025912 | Bacteria | 520 |
| 300 | Ga0207695_10150615 | 3300025913 | Bacteria | 2266 |
| 301 | Ga0207671_10173312 | 3300025914 | Bacteria | 1676 |
| 302 | Ga0207693_10001042 | 3300025915 | Bacteria | 24811 |
| 303 | Ga0207693_10018656 | 3300025915 | Bacteria | 5522 |
| 304 | Ga0207693_10026097 | 3300025915 | Bacteria | 4626 |
| 305 | Ga0207693_10027985 | 3300025915 | Bacteria | 4456 |
| 306 | Ga0207693_10236545 | 3300025915 | Bacteria | 1434 |
| 307 | Ga0207693_10785899 | 3300025915 | Bacteria | 734 |
| 308 | Ga0207663_10092111 | 3300025916 | Bacteria | 2014 |
| 309 | Ga0207663_10338868 | 3300025916 | Bacteria | 1135 |
| 310 | Ga0207663_10504366 | 3300025916 | Bacteria | 940 |
| 311 | Ga0207663_10910732 | 3300025916 | Bacteria | 703 |
| 312 | Ga0207660_10054606 | 3300025917 | Bacteria | 2851 |
| 313 | Ga0207662_10000683 | 3300025918 | Bacteria | 15427 |
| 314 | Ga0207662_10220396 | 3300025918 | Bacteria | 1235 |
| 315 | Ga0207657_10036554 | 3300025919 | Bacteria | 4394 |
| 316 | Ga0207657_10152689 | 3300025919 | Bacteria | 1880 |
| 317 | Ga0207657_10647971 | 3300025919 | Bacteria | 822 |
| 318 | Ga0207649_10459430 | 3300025920 | Bacteria | 962 |
| 319 | Ga0207649_10617199 | 3300025920 | Bacteria | 835 |
| 320 | Ga0207649_10733741 | 3300025920 | Bacteria | 768 |
| 321 | Ga0207652_10058813 | 3300025921 | Bacteria | 3312 |
| 322 | Ga0207652_10130752 | 3300025921 | Bacteria | 2239 |
| 323 | Ga0207652_10227263 | 3300025921 | Bacteria | 1682 |
| 324 | Ga0207652_10548286 | 3300025921 | Bacteria | 1039 |
| 325 | Ga0207646_10007626 | 3300025922 | Bacteria | 10955 |
| 326 | Ga0207646_10045479 | 3300025922 | Bacteria | 3941 |
| 327 | Ga0207694_10179522 | 3300025924 | Bacteria | 1716 |
| 328 | Ga0207694_11168136 | 3300025924 | Bacteria | 651 |
| 329 | Ga0207650_10010954 | 3300025925 | Bacteria | 6232 |
| 330 | Ga0207650_10043647 | 3300025925 | Bacteria | 3292 |
| 331 | Ga0207650_10048048 | 3300025925 | Bacteria | 3146 |
| 332 | Ga0207659_10303959 | 3300025926 | Bacteria | 1311 |
| 333 | Ga0207659_10701414 | 3300025926 | Bacteria | 867 |
| 334 | Ga0207687_10046021 | 3300025927 | Bacteria | 3018 |
| 335 | Ga0207687_10138493 | 3300025927 | Bacteria | 1844 |
| 336 | Ga0207700_10071304 | 3300025928 | Bacteria | 2675 |
| 337 | Ga0207700_10144285 | 3300025928 | Bacteria | 1960 |
| 338 | Ga0207700_10177935 | 3300025928 | Bacteria | 1779 |
| 339 | Ga0207700_10183173 | 3300025928 | Bacteria | 1755 |
| 340 | Ga0207700_10384630 | 3300025928 | Bacteria | 1228 |
| 341 | Ga0207700_11374416 | 3300025928 | Bacteria | 628 |
| 342 | Ga0207664_10044723 | 3300025929 | Bacteria | 3469 |
| 343 | Ga0207664_10472073 | 3300025929 | Bacteria | 1122 |
| 344 | Ga0207644_10033822 | 3300025931 | Bacteria | 3575 |
| 345 | Ga0207690_10628302 | 3300025932 | Bacteria | 878 |
| 346 | Ga0207690_10718205 | 3300025932 | Bacteria | 822 |
| 347 | Ga0207706_10002966 | 3300025933 | Bacteria | 16372 |
| 348 | Ga0207706_11196905 | 3300025933 | Bacteria | 631 |
| 349 | Ga0207686_11221305 | 3300025934 | Bacteria | 616 |
| 350 | Ga0207709_11401091 | 3300025935 | Bacteria | 579 |
| 351 | Ga0207670_10048420 | 3300025936 | Bacteria | 2837 |
| 352 | Ga0207704_11048208 | 3300025938 | Bacteria | 691 |
| 353 | Ga0207665_10253370 | 3300025939 | Bacteria | 1302 |
| 354 | Ga0207665_10333192 | 3300025939 | Bacteria | 1142 |
| 355 | Ga0207665_11386972 | 3300025939 | Bacteria | 560 |
| 356 | Ga0207665_11631880 | 3300025939 | Bacteria | 511 |
| 357 | Ga0207691_10003332 | 3300025940 | Bacteria | 15636 |
| 358 | Ga0207691_10087732 | 3300025940 | Bacteria | 2791 |
| 359 | Ga0207689_10008393 | 3300025942 | Bacteria | 8995 |
| 360 | Ga0207661_10119254 | 3300025944 | Bacteria | 2244 |
| 361 | Ga0207679_10034779 | 3300025945 | Bacteria | 3558 |
| 362 | Ga0207667_10004001 | 3300025949 | Bacteria | 18104 |
| 363 | Ga0207651_10011035 | 3300025960 | Bacteria | 5035 |
| 364 | Ga0207651_10094608 | 3300025960 | Bacteria | 2197 |
| 365 | Ga0207651_10212938 | 3300025960 | Bacteria | 1557 |
| 366 | Ga0207712_10880455 | 3300025961 | Bacteria | 790 |
| 367 | Ga0207668_10010942 | 3300025972 | Bacteria | 5500 |
| 368 | Ga0207668_10240443 | 3300025972 | Bacteria | 1464 |
| 369 | Ga0207640_10556432 | 3300025981 | Bacteria | 964 |
| 370 | Ga0207640_11861848 | 3300025981 | Bacteria | 544 |
| 371 | Ga0207640_11940351 | 3300025981 | Bacteria | 533 |
| 372 | Ga0207658_10030585 | 3300025986 | Bacteria | 3814 |
| 373 | Ga0207658_10320989 | 3300025986 | Bacteria | 1341 |
| 374 | Ga0207677_10539774 | 3300026023 | Bacteria | 1015 |
| 375 | Ga0207703_10155281 | 3300026035 | Bacteria | 1999 |
| 376 | Ga0207639_10821507 | 3300026041 | Bacteria | 867 |
| 377 | Ga0207708_10030330 | 3300026075 | Bacteria | 4099 |
| 378 | Ga0207708_10390231 | 3300026075 | Bacteria | 1149 |
| 379 | Ga0207708_11060290 | 3300026075 | Bacteria | 706 |
| 380 | Ga0207702_10046706 | 3300026078 | Bacteria | 3646 |
| 381 | Ga0207702_10483675 | 3300026078 | Bacteria | 1205 |
| 382 | Ga0207702_11598250 | 3300026078 | Bacteria | 645 |
| 383 | Ga0207641_10051381 | 3300026088 | Bacteria | 3491 |
| 384 | Ga0207641_10058736 | 3300026088 | Bacteria | 3274 |
| 385 | Ga0207648_10011288 | 3300026089 | Bacteria | 8422 |
| 386 | Ga0207648_11383510 | 3300026089 | Bacteria | 661 |
| 387 | Ga0207676_10035850 | 3300026095 | Bacteria | 3769 |
| 388 | Ga0207675_100003007 | 3300026118 | Bacteria | 16534 |
| 389 | Ga0207683_10015654 | 3300026121 | Bacteria | 6455 |
| 390 | Ga0207698_10016350 | 3300026142 | Bacteria | 4997 |
| 391 | Ga0207698_10842250 | 3300026142 | Bacteria | 922 |
| 392 | Ga0209281_1004227 | 3300027111 | Bacteria | 4366 |
| 393 | Ga0209282_1000072 | 3300027666 | Bacteria | 81137 |
| 394 | Ga0209588_1076389 | 3300027671 | Bacteria | 1082 |
| 395 | Ga0209974_10105949 | 3300027876 | Bacteria | 986 |
| 396 | Ga0207428_10040253 | 3300027907 | Bacteria | 3793 |
| 397 | Ga0265357_1003756 | 3300028023 | Bacteria | 1334 |
| 398 | Ga0268266_10057954 | 3300028379 | Bacteria | 3334 |
| 399 | Ga0268266_11383439 | 3300028379 | Bacteria | 679 |
| 400 | Ga0268266_11463495 | 3300028379 | Bacteria | 659 |
| 401 | Ga0268265_10053404 | 3300028380 | Bacteria | 3062 |
| 402 | Ga0268265_10277735 | 3300028380 | Bacteria | 1497 |
| 403 | Ga0268265_10582116 | 3300028380 | Bacteria | 1067 |
| 404 | Ga0268264_10179743 | 3300028381 | Bacteria | 1920 |
| 405 | Ga0268264_12074500 | 3300028381 | Bacteria | 577 |
| 406 | Ga0307515_10790759 | 3300028794 | Bacteria | 571 |
| 407 | Ga0265338_10078200 | 3300028800 | Bacteria | 2791 |
| 408 | Ga0265338_10531168 | 3300028800 | Bacteria | 825 |
| 409 | Ga0265762_1032276 | 3300030760 | Bacteria | 999 |
| 410 | Ga0265763_1001116 | 3300030763 | Bacteria | 1843 |
| 411 | Ga0265770_1015363 | 3300030878 | Bacteria | 1164 |
| 412 | Ga0265770_1129891 | 3300030878 | Bacteria | 537 |
| 413 | Ga0265773_1005799 | 3300031018 | Bacteria | 911 |
| 414 | Ga0265760_10033681 | 3300031090 | Bacteria | 1514 |
| 415 | Ga0265760_10033778 | 3300031090 | Bacteria | 1512 |
| 416 | Ga0265760_10091086 | 3300031090 | Bacteria | 955 |
| 417 | Ga0265760_10237859 | 3300031090 | Bacteria | 626 |
| 418 | Ga0265330_10042093 | 3300031235 | Bacteria | 2024 |
| 419 | Ga0265332_10026242 | 3300031238 | Bacteria | 2555 |
| 420 | Ga0265332_10375051 | 3300031238 | Bacteria | 587 |
| 421 | Ga0265328_10003667 | 3300031239 | Bacteria | 6766 |
| 422 | Ga0265328_10126304 | 3300031239 | Bacteria | 956 |
| 423 | Ga0265328_10126657 | 3300031239 | Bacteria | 954 |
| 424 | Ga0265320_10023886 | 3300031240 | Bacteria | 3244 |
| 425 | Ga0265325_10000449 | 3300031241 | Bacteria | 29667 |
| 426 | Ga0265325_10018308 | 3300031241 | Bacteria | 3884 |
| 427 | Ga0265340_10016859 | 3300031247 | Bacteria | 3779 |
| 428 | Ga0265340_10189420 | 3300031247 | Bacteria | 928 |
| 429 | Ga0265339_10000053 | 3300031249 | Bacteria | 101277 |
| 430 | Ga0265339_10034939 | 3300031249 | Bacteria | 2822 |
| 431 | Ga0265331_10000090 | 3300031250 | Bacteria | 123628 |
| 432 | Ga0265331_10013159 | 3300031250 | Bacteria | 4456 |
| 433 | Ga0265331_10043884 | 3300031250 | Bacteria | 2163 |
| 434 | Ga0265331_10078977 | 3300031250 | Bacteria | 1531 |
| 435 | Ga0265327_10000218 | 3300031251 | Bacteria | 116690 |
| 436 | Ga0265327_10037439 | 3300031251 | Bacteria | 2655 |
| 437 | Ga0265327_10081747 | 3300031251 | Bacteria | 1594 |
| 438 | Ga0265327_10101632 | 3300031251 | Bacteria | 1386 |
| 439 | Ga0265316_10021166 | 3300031344 | Bacteria | 5517 |
| 440 | Ga0265316_10054706 | 3300031344 | Bacteria | 3124 |
| 441 | Ga0265316_10116081 | 3300031344 | Bacteria | 2023 |
| 442 | Ga0265316_10280285 | 3300031344 | Bacteria | 1218 |
| 443 | Ga0307513_10087877 | 3300031456 | Bacteria | 3179 |
| 444 | Ga0307513_10135600 | 3300031456 | Bacteria | 2398 |
| 445 | Ga0307513_10737988 | 3300031456 | Bacteria | 690 |
| 446 | Ga0307513_10832300 | 3300031456 | Bacteria | 629 |
| 447 | Ga0307509_10708167 | 3300031507 | Bacteria | 673 |
| 448 | Ga0265313_10000098 | 3300031595 | Bacteria | 89130 |
| 449 | Ga0265313_10003687 | 3300031595 | Bacteria | 12218 |
| 450 | Ga0265313_10027323 | 3300031595 | Bacteria | 2988 |
| 451 | Ga0265313_10085817 | 3300031595 | Bacteria | 1422 |
| 452 | Ga0265314_10188606 | 3300031711 | Bacteria | 1229 |
| 453 | Ga0265342_10034741 | 3300031712 | Bacteria | 3090 |
| 454 | Ga0265342_10093841 | 3300031712 | Bacteria | 1717 |
| 455 | Ga0265342_10311122 | 3300031712 | Bacteria | 827 |
| 456 | Ga0307516_10161320 | 3300031730 | Bacteria | 1992 |
| 457 | Ga0307413_11275995 | 3300031824 | Bacteria | 642 |
| 458 | Ga0307412_10843904 | 3300031911 | Bacteria | 799 |
| 459 | Ga0307409_101905305 | 3300031995 | Bacteria | 624 |
| 460 | Ga0307409_102383047 | 3300031995 | Bacteria | 558 |
| 461 | Ga0307411_10583210 | 3300032005 | Bacteria | 959 |
| 462 | Ga0316053_105626 | 3300032120 | Bacteria | 799 |
| 463 | Ga0307415_101261050 | 3300032126 | Bacteria | 699 |
| 464 | Ga0316592_1114322 | 3300033524 | Bacteria | 625 |
| 465 | Ga0316596_1136759 | 3300033541 | Bacteria | 670 |
| 466 | Ga0373926_0114711 | 3300035083 | Bacteria | 1013 |
| 467 | Ga0373926_0432410 | 3300035083 | Bacteria | 521 |
| 468 | Ga0373928_0252428 | 3300035084 | Bacteria | 526 |
| 469 | Ga0373934_0062611 | 3300035086 | Bacteria | 1483 |
| 470 | Ga0373934_0111077 | 3300035086 | Bacteria | 1112 |
| 471 | Ga0373934_0171807 | 3300035086 | Bacteria | 890 |
| 472 | Ga0373944_0030910 | 3300035089 | Bacteria | 1608 |
| 473 | Ga0373923_0073205 | 3300035111 | Bacteria | 1475 |
| 474 | Ga0373923_0152772 | 3300035111 | Bacteria | 1049 |
| 475 | Ga0373932_0041859 | 3300035112 | Bacteria | 1326 |
| 476 | Ga0373932_0245400 | 3300035112 | Bacteria | 652 |
| 477 | Ga0373936_0106729 | 3300035113 | Bacteria | 1186 |
| 478 | Ga0373939_0168225 | 3300035114 | Bacteria | 810 |
| 479 | Ga0373945_0007787 | 3300035116 | Bacteria | 3476 |
| 480 | Ga0373945_0041830 | 3300035116 | Bacteria | 1658 |
| 481 | Ga0373945_0080941 | 3300035116 | Bacteria | 1244 |
| 482 | Ga0373953_0421003 | 3300035117 | Bacteria | 589 |
| 483 | Ga0373954_0066947 | 3300035118 | Bacteria | 1701 |
| 484 | Ga0373954_0122786 | 3300035118 | Bacteria | 1261 |
| 485 | Ga0373954_0164172 | 3300035118 | Bacteria | 1087 |
| 486 | Ga0373956_0266738 | 3300035119 | Bacteria | 814 |
| 487 | Ga0373956_0293869 | 3300035119 | Bacteria | 774 |
| 488 | Ga0373956_0365115 | 3300035119 | Bacteria | 688 |
| 489 | Ga0373960_0005814 | 3300035121 | Bacteria | 2869 |
| 490 | Ga0373960_0294452 | 3300035121 | Bacteria | 602 |
| 491 | Ga0373943_0014346 | 3300035170 | Bacteria | 3586 |
| 492 | Ga0373943_0050131 | 3300035170 | Bacteria | 2050 |
| 493 | Ga0373943_0129148 | 3300035170 | Bacteria | 1351 |
| 494 | Ga0373943_0171044 | 3300035170 | Bacteria | 1189 |
| 495 | Ga0373943_0283015 | 3300035170 | Bacteria | 938 |
| 496 | Ga0373946_0027523 | 3300035171 | Bacteria | 2249 |
| 497 | Ga0373946_0062117 | 3300035171 | Bacteria | 1592 |
| 498 | Ga0373955_0549293 | 3300035172 | Bacteria | 707 |
| 499 | Ga0373942_0045451 | 3300035207 | Bacteria | 1213 |
| 500 | Ga0373961_0160078 | 3300035241 | Bacteria | 773 |
| 501 | Ga0373961_0206424 | 3300035241 | Bacteria | 695 |
| 502 | Ga0373962_0167214 | 3300035242 | Bacteria | 728 |
| 503 | Ga0316574_0384775 | 3300035398 | Bacteria | 885 |
| 504 | Ga0373924_0043824 | 3300035410 | Bacteria | 1838 |
| 505 | Ga0373924_0197979 | 3300035410 | Bacteria | 886 |
| 506 | Ga0373931_0080324 | 3300035691 | Bacteria | 1798 |
| 507 | Ga0373931_0154720 | 3300035691 | Bacteria | 1339 |
| 508 | Ga0373931_0200857 | 3300035691 | Bacteria | 1191 |
| 509 | Ga0373931_1149383 | 3300035691 | Bacteria | 530 |
| 510 | Ga0373935_0006630 | 3300035692 | Bacteria | 6916 |
| 511 | Ga0373935_0054512 | 3300035692 | Bacteria | 2546 |
| 512 | Ga0373935_0054795 | 3300035692 | Bacteria | 2541 |
| 513 | Ga0373935_0091399 | 3300035692 | Bacteria | 1993 |
| 514 | Ga0373935_0237512 | 3300035692 | Bacteria | 1271 |
| 515 | Ga0373935_0251032 | 3300035692 | Bacteria | 1238 |
| 516 | Ga0373927_0000971 | 3300035695 | Bacteria | 21800 |
| 517 | Ga0373927_0017276 | 3300035695 | Bacteria | 4749 |
| 518 | Ga0373927_0037358 | 3300035695 | Bacteria | 3156 |
| 519 | Ga0373927_0043686 | 3300035695 | Bacteria | 2900 |
| 520 | Ga0373927_0049295 | 3300035695 | Bacteria | 2723 |
| 521 | Ga0373927_0171364 | 3300035695 | Bacteria | 1423 |
| 522 | Ga0373933_0000858 | 3300035724 | Bacteria | 18640 |
| 523 | Ga0373933_1033357 | 3300035724 | Bacteria | 541 |
| 524 | Ga0373947_0000633 | 3300035725 | Bacteria | 20789 |
| 525 | Ga0373947_0011503 | 3300035725 | Bacteria | 5076 |
| 526 | Ga0373947_0040714 | 3300035725 | Bacteria | 2768 |
| 527 | Ga0373947_0093951 | 3300035725 | Bacteria | 1875 |
| 528 | Ga0373937_0002560 | 3300036401 | Bacteria | 15116 |
| 529 | Ga0373937_0017054 | 3300036401 | Bacteria | 6459 |
| 530 | Ga0372808_035557 | 3300036459 | Bacteria | 715 |
| 531 | Ga0316582_0120853 | 3300036647 | Bacteria | 1752 |
| 532 | Ga0316582_0809702 | 3300036647 | Unclassified | 642 |
| 533 | Ga0373925_0002443 | 3300037068 | Bacteria | 14891 |
| 534 | Ga0373925_0007434 | 3300037068 | Bacteria | 7992 |
| 535 | Ga0373925_0016615 | 3300037068 | Bacteria | 5332 |
| 536 | Ga0373925_0053531 | 3300037068 | Bacteria | 3017 |
| 537 | Ga0373925_0076265 | 3300037068 | Bacteria | 2542 |
| 538 | Ga0373925_0086532 | 3300037068 | Bacteria | 2391 |
| 539 | Ga0373925_0090548 | 3300037068 | Bacteria | 2338 |
| 540 | Ga0373925_0829984 | 3300037068 | Bacteria | 762 |
| 541 | Ga0373925_1007028 | 3300037068 | Bacteria | 686 |
| 542 | Ga0395899_0000073 | 3300037312 | Bacteria | 181387 |
| 543 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 544 | Ga0395900_0352109 | 3300037418 | Bacteria | 1446 |
| 545 | Ga0395900_1833653 | 3300037418 | Bacteria | 517 |
| 546 | Ga0395898_0000255 | 3300037466 | Bacteria | 131017 |
| 547 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 548 | Ga0395905_0008689 | 3300037471 | Bacteria | 9999 |
| 549 | Ga0395905_0082966 | 3300037471 | Bacteria | 3003 |
| 550 | Ga0436364_0979867 | 3300037853 | Bacteria | 1220 |
| 551 | Ga0436364_1047052 | 3300037853 | Bacteria | 758 |
| 552 | Ga0436364_1158099 | 3300037853 | Bacteria | 1246 |
| 553 | Ga0436364_1483415 | 3300037853 | Bacteria | 727 |
| 554 | Ga0436364_1537292 | 3300037853 | Bacteria | 1148 |
| 555 | Ga0395901_0000110 | 3300038443 | Bacteria | 112682 |
| 556 | Ga0395901_0160734 | 3300038443 | Bacteria | 2359 |
| 557 | Ga0395901_0808769 | 3300038443 | Bacteria | 926 |
| 558 | Ga0436365_0697746 | 3300039437 | Bacteria | 24050 |
| 559 | Ga0436365_1428905 | 3300039437 | Bacteria | 1465 |
| 560 | Ga0436360_0096403 | 3300039438 | Bacteria | 1410 |
| 561 | Ga0436360_1301919 | 3300039438 | Bacteria | 913 |
| 562 | Ga0436361_0496844 | 3300039447 | Bacteria | 3149 |
| 563 | Ga0436363_0177757 | 3300039450 | Bacteria | 938 |
| 564 | Ga0436363_0823825 | 3300039450 | Bacteria | 610 |
| 565 | Ga0436363_1509191 | 3300039450 | Bacteria | 2480 |
| 566 | Ga0436362_0617508 | 3300039453 | Bacteria | 857 |
| 567 | Ga0436362_0991724 | 3300039453 | Bacteria | 721 |
| 568 | Ga0439439_0159716 | 3300041406 | Bacteria | 643 |
| 569 | Ga0439453_0000173 | 3300041408 | Bacteria | 6005 |
| 570 | Ga0451793_0071024 | 3300041452 | Bacteria | 644 |
| 571 | Ga0451805_116338 | 3300041461 | Bacteria | 541 |
| 572 | Ga0451845_0368984 | 3300041501 | Bacteria | 523 |
| 573 | Ga0439441_041429 | 3300042001 | Bacteria | 924 |
| 574 | Ga0439441_051867 | 3300042001 | Bacteria | 847 |
| 575 | Ga0439443_015095 | 3300042003 | Bacteria | 1169 |
| 576 | Ga0439463_141242 | 3300042016 | Bacteria | 624 |
| 577 | Ga0439435_0032006 | 3300042436 | Bacteria | 1433 |
| 578 | Ga0466972_0372016 | 3300044658 | Bacteria | 669 |
| 579 | Ga0466966_0121358 | 3300044684 | Bacteria | 1605 |
| 580 | Ga0466963_0141593 | 3300044694 | Bacteria | 1666 |
| 581 | Ga0466957_0031161 | 3300044842 | Bacteria | 3186 |
| 582 | Ga0466957_0251445 | 3300044842 | Bacteria | 1175 |
| 583 | Ga0466959_0096694 | 3300045049 | Bacteria | 2117 |
| 584 | Ga0466958_0008139 | 3300045836 | Bacteria | 5804 |
| 585 | Ga0466967_1017772 | 3300045976 | Bacteria | 825 |
| 586 | Ga0495617_078200 | 3300046452 | Bacteria | 1085 |
| 587 | Ga0495617_214884 | 3300046452 | Bacteria | 599 |
| 588 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 589 | Ga0495592_0004065 | 3300046454 | Bacteria | 10637 |
| 590 | Ga0495592_0211814 | 3300046454 | Bacteria | 1301 |
| 591 | Ga0495603_0010786 | 3300046455 | Bacteria | 5542 |
| 592 | Ga0495603_0092189 | 3300046455 | Bacteria | 1771 |
| 593 | Ga0495603_0112616 | 3300046455 | Bacteria | 1587 |
| 594 | Ga0495629_0003502 | 3300046459 | Bacteria | 11866 |
| 595 | Ga0495629_0031003 | 3300046459 | Bacteria | 3787 |
| 596 | Ga0495629_0239737 | 3300046459 | Bacteria | 1249 |
| 597 | Ga0495629_0294172 | 3300046459 | Bacteria | 1112 |
| 598 | Ga0495641_0088498 | 3300046461 | Bacteria | 1385 |
| 599 | Ga0495641_0294711 | 3300046461 | Bacteria | 731 |
| 600 | Ga0495651_0001400 | 3300046462 | Bacteria | 18698 |
| 601 | Ga0495651_0019173 | 3300046462 | Bacteria | 5299 |
| 602 | Ga0495651_0104450 | 3300046462 | Bacteria | 2103 |
| 603 | Ga0495651_0202596 | 3300046462 | Bacteria | 1388 |
| 604 | Ga0495653_0026224 | 3300046463 | Bacteria | 4676 |
| 605 | Ga0495653_0031575 | 3300046463 | Bacteria | 4209 |
| 606 | Ga0495653_0312035 | 3300046463 | Bacteria | 1022 |
| 607 | Ga0495653_0352837 | 3300046463 | Bacteria | 945 |
| 608 | Ga0495580_0069341 | 3300046472 | Bacteria | 2464 |
| 609 | Ga0495580_0114226 | 3300046472 | Bacteria | 1875 |
| 610 | Ga0495580_0480008 | 3300046472 | Bacteria | 832 |
| 611 | Ga0495580_0605048 | 3300046472 | Bacteria | 724 |
| 612 | Ga0495582_0085444 | 3300046473 | Bacteria | 1755 |
| 613 | Ga0495605_0122840 | 3300046474 | Bacteria | 1176 |
| 614 | Ga0495605_0247420 | 3300046474 | Bacteria | 764 |
| 615 | Ga0495639_0022143 | 3300046475 | Bacteria | 2786 |
| 616 | Ga0495639_0091143 | 3300046475 | Bacteria | 1430 |
| 617 | Ga0495639_0110314 | 3300046475 | Bacteria | 1305 |
| 618 | Ga0495639_0329639 | 3300046475 | Bacteria | 764 |
| 619 | Ga0495662_0004886 | 3300046476 | Bacteria | 6715 |
| 620 | Ga0495662_0037859 | 3300046476 | Bacteria | 2330 |
| 621 | Ga0495664_0001699 | 3300046477 | Bacteria | 11697 |
| 622 | Ga0495664_0032998 | 3300046477 | Bacteria | 3041 |
| 623 | Ga0495664_0367224 | 3300046477 | Bacteria | 866 |
| 624 | Ga0495584_0026134 | 3300046491 | Bacteria | 2958 |
| 625 | Ga0495584_0062527 | 3300046491 | Bacteria | 1871 |
| 626 | Ga0495584_0255890 | 3300046491 | Bacteria | 890 |
| 627 | Ga0495585_0024577 | 3300046492 | Bacteria | 3453 |
| 628 | Ga0495594_0012384 | 3300046499 | Bacteria | 4442 |
| 629 | Ga0495594_0376546 | 3300046499 | Bacteria | 808 |
| 630 | Ga0495594_0552735 | 3300046499 | Bacteria | 653 |
| 631 | Ga0495594_0572743 | 3300046499 | Bacteria | 640 |
| 632 | Ga0495594_0698497 | 3300046499 | Bacteria | 573 |
| 633 | Ga0495596_0380556 | 3300046500 | Bacteria | 550 |
| 634 | Ga0495607_0050530 | 3300046501 | Bacteria | 2420 |
| 635 | Ga0495607_0242725 | 3300046501 | Bacteria | 871 |
| 636 | Ga0495606_0315616 | 3300046507 | Bacteria | 842 |
| 637 | Ga0495608_0359874 | 3300046511 | Bacteria | 894 |
| 638 | Ga0495618_0007630 | 3300046514 | Bacteria | 6542 |
| 639 | Ga0495618_0015533 | 3300046514 | Bacteria | 4647 |
| 640 | Ga0495618_0252297 | 3300046514 | Bacteria | 1106 |
| 641 | Ga0495628_0000109 | 3300046516 | Bacteria | 67425 |
| 642 | Ga0495628_0014171 | 3300046516 | Bacteria | 6691 |
| 643 | Ga0495628_0028002 | 3300046516 | Bacteria | 4582 |
| 644 | Ga0495628_0357439 | 3300046516 | Bacteria | 1073 |
| 645 | Ga0495630_0010798 | 3300046517 | Bacteria | 6592 |
| 646 | Ga0495630_0067408 | 3300046517 | Bacteria | 2690 |
| 647 | Ga0495630_0118472 | 3300046517 | Bacteria | 2008 |
| 648 | Ga0495630_0484732 | 3300046517 | Bacteria | 948 |
| 649 | Ga0495630_0693374 | 3300046517 | Bacteria | 779 |
| 650 | Ga0495631_0015770 | 3300046518 | Bacteria | 3614 |
| 651 | Ga0495644_0011541 | 3300046523 | Bacteria | 3401 |
| 652 | Ga0495648_0255409 | 3300046524 | Bacteria | 844 |
| 653 | Ga0495663_0015967 | 3300046525 | Bacteria | 2121 |
| 654 | Ga0495666_0193773 | 3300046526 | Bacteria | 936 |
| 655 | Ga0495666_0244274 | 3300046526 | Bacteria | 819 |
| 656 | Ga0495642_0438074 | 3300046528 | Bacteria | 577 |
| 657 | Ga0495652_0004294 | 3300046529 | Bacteria | 13663 |
| 658 | Ga0495652_0183098 | 3300046529 | Bacteria | 1605 |
| 659 | Ga0495652_0221140 | 3300046529 | Bacteria | 1423 |
| 660 | Ga0495654_0163164 | 3300046530 | Bacteria | 977 |
| 661 | Ga0495654_0205544 | 3300046530 | Bacteria | 840 |
| 662 | Ga0495654_0213446 | 3300046530 | Bacteria | 820 |
| 663 | Ga0495665_0035820 | 3300046531 | Bacteria | 2650 |
| 664 | Ga0495665_0042118 | 3300046531 | Bacteria | 2431 |
| 665 | Ga0495665_0147125 | 3300046531 | Bacteria | 1230 |
| 666 | Ga0495665_0162785 | 3300046531 | Bacteria | 1162 |
| 667 | Ga0495665_0395931 | 3300046531 | Bacteria | 701 |
| 668 | Ga0495640_0000385 | 3300046533 | Bacteria | 31316 |
| 669 | Ga0495640_0000769 | 3300046533 | Bacteria | 24154 |
| 670 | Ga0495640_0175170 | 3300046533 | Bacteria | 1369 |
| 671 | Ga0495640_0186675 | 3300046533 | Bacteria | 1319 |
| 672 | Ga0495587_0001283 | 3300046536 | Bacteria | 16691 |
| 673 | Ga0495587_0103577 | 3300046536 | Bacteria | 1638 |
| 674 | Ga0495587_0155381 | 3300046536 | Bacteria | 1303 |
| 675 | Ga0495587_0168412 | 3300046536 | Bacteria | 1245 |
| 676 | Ga0495598_0004029 | 3300046537 | Bacteria | 3155 |
| 677 | Ga0495609_0038054 | 3300046538 | Bacteria | 2170 |
| 678 | Ga0495609_0096531 | 3300046538 | Bacteria | 1282 |
| 679 | Ga0495621_0005293 | 3300046539 | Bacteria | 3697 |
| 680 | Ga0495645_0253438 | 3300046543 | Bacteria | 1169 |
| 681 | Ga0495633_0337541 | 3300046558 | Bacteria | 683 |
| 682 | Ga0495667_0001440 | 3300046559 | Bacteria | 15673 |
| 683 | Ga0495667_0041859 | 3300046559 | Bacteria | 3037 |
| 684 | Ga0495667_0539930 | 3300046559 | Bacteria | 729 |
| 685 | Ga0495656_0001605 | 3300046615 | Bacteria | 7402 |
| 686 | Ga0495656_0152103 | 3300046615 | Bacteria | 1118 |
| 687 | Ga0495668_0466225 | 3300046616 | Bacteria | 695 |
| 688 | Ga0495668_0586700 | 3300046616 | Bacteria | 615 |
| 689 | Ga0495634_0001491 | 3300046642 | Bacteria | 20709 |
| 690 | Ga0495634_0025557 | 3300046642 | Bacteria | 4129 |
| 691 | Ga0495634_0029771 | 3300046642 | Bacteria | 3778 |
| 692 | Ga0495634_0071769 | 3300046642 | Bacteria | 2278 |
| 693 | Ga0495634_0284262 | 3300046642 | Bacteria | 1004 |
| 694 | Ga0495634_0355697 | 3300046642 | Bacteria | 876 |
| 695 | Ga0495635_0035056 | 3300046663 | Bacteria | 3479 |
| 696 | Ga0495635_0113870 | 3300046663 | Bacteria | 1846 |
| 697 | Ga0495635_0138899 | 3300046663 | Bacteria | 1655 |
| 698 | Ga0495635_0531085 | 3300046663 | Bacteria | 772 |
| 699 | Ga0495659_0172206 | 3300046664 | Bacteria | 878 |
| 700 | Ga0495659_0346453 | 3300046664 | Bacteria | 634 |
| 701 | Ga0495661_0088488 | 3300046665 | Bacteria | 1768 |
| 702 | Ga0495588_0208708 | 3300046674 | Bacteria | 1031 |
| 703 | Ga0495657_0168449 | 3300046675 | Bacteria | 1350 |
| 704 | Ga0495599_0041684 | 3300046678 | Bacteria | 2881 |
| 705 | Ga0495599_0060382 | 3300046678 | Bacteria | 2370 |
| 706 | Ga0495599_0328331 | 3300046678 | Bacteria | 920 |
| 707 | Ga0495623_0013044 | 3300046679 | Bacteria | 5382 |
| 708 | Ga0495623_0080307 | 3300046679 | Bacteria | 2019 |
| 709 | Ga0495623_0098854 | 3300046679 | Bacteria | 1780 |
| 710 | Ga0495646_0004357 | 3300046680 | Bacteria | 8919 |
| 711 | Ga0495646_0010752 | 3300046680 | Bacteria | 5814 |
| 712 | Ga0495646_0041999 | 3300046680 | Bacteria | 2808 |
| 713 | Ga0495647_0010689 | 3300046681 | Bacteria | 3130 |
| 714 | Ga0495647_0243204 | 3300046681 | Bacteria | 799 |
| 715 | Ga0495658_0071370 | 3300046683 | Bacteria | 2017 |
| 716 | Ga0495658_0107141 | 3300046683 | Bacteria | 1676 |
| 717 | Ga0495658_0928818 | 3300046683 | Bacteria | 556 |
| 718 | Ga0495669_0223430 | 3300046684 | Bacteria | 903 |
| 719 | Ga0495669_0249240 | 3300046684 | Bacteria | 853 |
| 720 | Ga0495613_0042111 | 3300046689 | Bacteria | 3380 |
| 721 | Ga0495613_0057625 | 3300046689 | Bacteria | 2852 |
| 722 | Ga0495613_0073452 | 3300046689 | Bacteria | 2492 |
| 723 | Ga0495613_0239057 | 3300046689 | Bacteria | 1270 |
| 724 | Ga0495624_0021720 | 3300046690 | Bacteria | 4253 |
| 725 | Ga0495624_0045694 | 3300046690 | Bacteria | 2786 |
| 726 | Ga0495624_0066226 | 3300046690 | Bacteria | 2255 |
| 727 | Ga0495624_0159051 | 3300046690 | Bacteria | 1380 |
| 728 | Ga0495624_0302694 | 3300046690 | Bacteria | 964 |
| 729 | Ga0495624_0325699 | 3300046690 | Bacteria | 925 |
| 730 | Ga0495670_0406344 | 3300046691 | Bacteria | 736 |
| 731 | Ga0495671_0059860 | 3300046692 | Bacteria | 1881 |
| 732 | Ga0495671_0272001 | 3300046692 | Bacteria | 817 |
| 733 | Ga0495671_0487639 | 3300046692 | Bacteria | 588 |
| 734 | Ga0495649_0129597 | 3300046694 | Bacteria | 1331 |
| 735 | Ga0495589_0032938 | 3300046794 | Bacteria | 2604 |
| 736 | Ga0495600_0001398 | 3300046809 | Bacteria | 13308 |
| 737 | Ga0495600_0057506 | 3300046809 | Bacteria | 2540 |
| 738 | Ga0495660_0000905 | 3300046810 | Bacteria | 21932 |
| 739 | Ga0495581_0053605 | 3300047315 | Bacteria | 2329 |
| 740 | Ga0495581_0143063 | 3300047315 | Bacteria | 1395 |
| 741 | Ga0495581_0170366 | 3300047315 | Bacteria | 1273 |
| 742 | Ga0495581_0218811 | 3300047315 | Bacteria | 1113 |
| 743 | Ga0495581_0472033 | 3300047315 | Bacteria | 730 |
| 744 | Ga0495581_0760003 | 3300047315 | Bacteria | 557 |
| 745 | Ga0495604_0000406 | 3300047317 | Bacteria | 38847 |
| 746 | Ga0495604_0072447 | 3300047317 | Bacteria | 2603 |
| 747 | Ga0495604_0263671 | 3300047317 | Bacteria | 1170 |
| 748 | Ga0495636_0576654 | 3300047318 | Bacteria | 549 |
| 749 | Ga0495674_0001453 | 3300047319 | Bacteria | 23203 |
| 750 | Ga0495674_0023413 | 3300047319 | Bacteria | 5692 |
| 751 | Ga0495674_0203361 | 3300047319 | Bacteria | 1642 |
| 752 | Ga0495674_0264834 | 3300047319 | Bacteria | 1411 |
| 753 | Ga0495674_0663268 | 3300047319 | Bacteria | 821 |
| 754 | Ga0495674_1036281 | 3300047319 | Bacteria | 627 |
| 755 | Ga0495672_0081977 | 3300047320 | Bacteria | 1795 |
| 756 | Ga0495676_0135025 | 3300047321 | Bacteria | 1775 |
| 757 | Ga0495676_0198060 | 3300047321 | Bacteria | 1397 |
| 758 | Ga0495676_0878645 | 3300047321 | Bacteria | 575 |
| 759 | Ga0495680_0002267 | 3300047322 | Bacteria | 19822 |
| 760 | Ga0495680_0512258 | 3300047322 | Bacteria | 813 |
| 761 | Ga0495680_0658204 | 3300047322 | Bacteria | 695 |
| 762 | Ga0495675_0036422 | 3300047444 | Bacteria | 3138 |
| 763 | Ga0495675_0071301 | 3300047444 | Bacteria | 2193 |
| 764 | Ga0495675_0481078 | 3300047444 | Bacteria | 715 |
| 765 | Ga0495679_018436 | 3300047446 | Bacteria | 2478 |
| 766 | Ga0495681_0268683 | 3300047470 | Bacteria | 668 |
| 767 | Ga0495684_0002545 | 3300047471 | Bacteria | 14510 |
| 768 | Ga0495684_0027908 | 3300047471 | Bacteria | 4335 |
| 769 | Ga0495684_0042044 | 3300047471 | Bacteria | 3502 |
| 770 | Ga0495684_0083851 | 3300047471 | Bacteria | 2417 |
| 771 | Ga0495686_0315391 | 3300047472 | Bacteria | 859 |
| 772 | Ga0495593_0046845 | 3300047673 | Bacteria | 2303 |
| 773 | Ga0495593_0109761 | 3300047673 | Bacteria | 1409 |
| 774 | Ga0495593_0343085 | 3300047673 | Bacteria | 746 |
| 775 | Ga0495602_0014190 | 3300048088 | Bacteria | 8097 |
| 776 | Ga0495602_0094162 | 3300048088 | Bacteria | 2476 |
| 777 | Ga0495602_0110082 | 3300048088 | Bacteria | 2240 |
| 778 | Ga0495602_0189487 | 3300048088 | Bacteria | 1578 |
| 779 | Ga0495602_0272000 | 3300048088 | Bacteria | 1252 |
| 780 | Ga0496100_0006135 | 3300048903 | Bacteria | 6537 |
| 781 | Ga0496100_0045424 | 3300048903 | Bacteria | 2819 |
| 782 | Ga0496100_0090321 | 3300048903 | Bacteria | 2088 |
| 783 | Ga0496101_0003597 | 3300048904 | Bacteria | 9676 |
| 784 | Ga0496101_0019747 | 3300048904 | Bacteria | 4606 |
| 785 | Ga0496101_0137179 | 3300048904 | Bacteria | 1862 |
| 786 | Ga0496101_0269956 | 3300048904 | Bacteria | 1328 |
| 787 | Ga0496101_0393828 | 3300048904 | Bacteria | 1090 |
| 788 | Ga0496101_0662127 | 3300048904 | Bacteria | 825 |
| 789 | Ga0496102_0001868 | 3300048905 | Bacteria | 18139 |
| 790 | Ga0496102_0042907 | 3300048905 | Bacteria | 4099 |
| 791 | Ga0496102_0055582 | 3300048905 | Bacteria | 3609 |
| 792 | Ga0496102_0398632 | 3300048905 | Bacteria | 1294 |
| 793 | Ga0496102_0610837 | 3300048905 | Bacteria | 1013 |
| 794 | Ga0496102_1304300 | 3300048905 | Bacteria | 645 |
| 795 | Ga0496103_0004036 | 3300048906 | Bacteria | 8920 |
| 796 | Ga0496103_0005701 | 3300048906 | Bacteria | 7441 |
| 797 | Ga0496103_0014953 | 3300048906 | Bacteria | 4613 |
| 798 | Ga0496103_0358999 | 3300048906 | Bacteria | 937 |
| 799 | Ga0496104_0001826 | 3300048907 | Bacteria | 18406 |
| 800 | Ga0496104_0002521 | 3300048907 | Bacteria | 15773 |
| 801 | Ga0496104_0006531 | 3300048907 | Bacteria | 10255 |
| 802 | Ga0496104_0041724 | 3300048907 | Bacteria | 4303 |
| 803 | Ga0496104_0362727 | 3300048907 | Bacteria | 1361 |
| 804 | Ga0496104_0408852 | 3300048907 | Bacteria | 1269 |
| 805 | Ga0496104_0503731 | 3300048907 | Bacteria | 1122 |
| 806 | Ga0496104_1671496 | 3300048907 | Bacteria | 539 |
| 807 | Ga0496105_0013712 | 3300048908 | Bacteria | 6435 |
| 808 | Ga0496105_0023389 | 3300048908 | Bacteria | 5010 |
| 809 | Ga0496105_0025920 | 3300048908 | Bacteria | 4777 |
| 810 | Ga0496105_0053612 | 3300048908 | Bacteria | 3330 |
| 811 | Ga0496105_0113571 | 3300048908 | Bacteria | 2235 |
| 812 | Ga0496105_0957933 | 3300048908 | Bacteria | 642 |
| 813 | Ga0496105_0983536 | 3300048908 | Bacteria | 632 |
| 814 | Ga0496106_0001110 | 3300048909 | Bacteria | 19925 |
| 815 | Ga0496106_0013846 | 3300048909 | Bacteria | 5960 |
| 816 | Ga0496106_0023515 | 3300048909 | Bacteria | 4577 |
| 817 | Ga0496106_0065773 | 3300048909 | Bacteria | 2760 |
| 818 | Ga0496106_0197365 | 3300048909 | Bacteria | 1601 |
| 819 | Ga0496106_0228146 | 3300048909 | Bacteria | 1486 |
| 820 | Ga0496106_0460554 | 3300048909 | Bacteria | 1021 |
| 821 | Ga0496106_1201358 | 3300048909 | Bacteria | 591 |
| 822 | Ga0496107_0010686 | 3300048910 | Bacteria | 6384 |
| 823 | Ga0496107_0017863 | 3300048910 | Bacteria | 4992 |
| 824 | Ga0496107_0032302 | 3300048910 | Bacteria | 3741 |
| 825 | Ga0496107_0703659 | 3300048910 | Bacteria | 743 |
| 826 | Ga0496108_0004403 | 3300048911 | Bacteria | 11337 |
| 827 | Ga0496108_0017165 | 3300048911 | Bacteria | 5920 |
| 828 | Ga0496108_0018358 | 3300048911 | Bacteria | 5728 |
| 829 | Ga0496108_0185967 | 3300048911 | Bacteria | 1800 |
| 830 | Ga0496108_1733377 | 3300048911 | Bacteria | 513 |
| 831 | Ga0496109_0005037 | 3300048912 | Bacteria | 11039 |
| 832 | Ga0496109_0005827 | 3300048912 | Bacteria | 10325 |
| 833 | Ga0496109_0006780 | 3300048912 | Bacteria | 9646 |
| 834 | Ga0496109_0512580 | 3300048912 | Bacteria | 1132 |
| 835 | Ga0496109_0545945 | 3300048912 | Bacteria | 1093 |
| 836 | Ga0496109_0640136 | 3300048912 | Bacteria | 1000 |
| 837 | Ga0496110_0005009 | 3300048913 | Bacteria | 10350 |
| 838 | Ga0496110_0010524 | 3300048913 | Bacteria | 7530 |
| 839 | Ga0496110_0025880 | 3300048913 | Bacteria | 5017 |
| 840 | Ga0496110_0076837 | 3300048913 | Bacteria | 2969 |
| 841 | Ga0496110_0546916 | 3300048913 | Bacteria | 1052 |
| 842 | Ga0496110_0808728 | 3300048913 | Bacteria | 842 |
| 843 | Ga0496110_0899106 | 3300048913 | Bacteria | 791 |
| 844 | Ga0496111_0003448 | 3300048914 | Bacteria | 9778 |
| 845 | Ga0496111_0006735 | 3300048914 | Bacteria | 7481 |
| 846 | Ga0496111_0013724 | 3300048914 | Bacteria | 5518 |
| 847 | Ga0496111_0190545 | 3300048914 | Bacteria | 1524 |
| 848 | Ga0496111_0214300 | 3300048914 | Bacteria | 1430 |
| 849 | Ga0496111_1090571 | 3300048914 | Bacteria | 569 |
| 850 | Ga0496112_0002152 | 3300048915 | Bacteria | 15650 |
| 851 | Ga0496112_0005896 | 3300048915 | Bacteria | 10679 |
| 852 | Ga0496112_0086402 | 3300048915 | Bacteria | 3103 |
| 853 | Ga0496112_0350600 | 3300048915 | Bacteria | 1418 |
| 854 | Ga0496112_0559441 | 3300048915 | Bacteria | 1077 |
| 855 | Ga0496113_0017380 | 3300048916 | Bacteria | 4991 |
| 856 | Ga0496113_0103780 | 3300048916 | Bacteria | 2205 |
| 857 | Ga0496113_0122220 | 3300048916 | Bacteria | 2036 |
| 858 | Ga0496114_0011857 | 3300048917 | Bacteria | 6975 |
| 859 | Ga0496114_0116757 | 3300048917 | Bacteria | 2291 |
| 860 | Ga0496114_0658927 | 3300048917 | Bacteria | 920 |
| 861 | Ga0496115_0038794 | 3300048918 | Bacteria | 3781 |
| 862 | Ga0496115_0059777 | 3300048918 | Bacteria | 3070 |
| 863 | Ga0496115_0060309 | 3300048918 | Bacteria | 3056 |
| 864 | Ga0496115_0087721 | 3300048918 | Bacteria | 2539 |
| 865 | Ga0496115_0279137 | 3300048918 | Bacteria | 1372 |
| 866 | Ga0496115_0432183 | 3300048918 | Bacteria | 1065 |
| 867 | Ga0496115_0614127 | 3300048918 | Bacteria | 863 |
| 868 | Ga0496115_0802624 | 3300048918 | Bacteria | 732 |
| 869 | Ga0496118_0207542 | 3300048921 | Bacteria | 1153 |
| 870 | Ga0496121_0228399 | 3300048924 | Bacteria | 1305 |
| 871 | Ga0496121_0411816 | 3300048924 | Bacteria | 882 |
| 872 | Ga0496124_0037873 | 3300048927 | Bacteria | 4191 |
| 873 | Ga0496126_0143598 | 3300048929 | Bacteria | 2052 |
| 874 | Ga0496126_0197052 | 3300048929 | Bacteria | 1703 |
| 875 | Ga0496126_0510208 | 3300048929 | Bacteria | 960 |
| 876 | Ga0501306_071010 | 3300049127 | Bacteria | 588 |
| 877 | Ga0501305_037687 | 3300049161 | Bacteria | 777 |
| 878 | Ga0501307_002993 | 3300049162 | Bacteria | 1626 |
| 879 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 880 | Ga0501314_003548 | 3300049530 | Bacteria | 1261 |
| 881 | Ga0501320_007545 | 3300049536 | Bacteria | 1050 |
| 882 | Ga0501321_020521 | 3300049537 | Bacteria | 818 |
| 883 | Ga0501325_041690 | 3300049541 | Bacteria | 561 |
| 884 | Ga0501335_034801 | 3300049551 | Bacteria | 579 |
| 885 | Ga0501032_0561004 | 3300049569 | Bacteria | 728 |
| 886 | Ga0501033_0020312 | 3300049570 | Bacteria | 5018 |
| 887 | Ga0501033_0270826 | 3300049570 | Bacteria | 1200 |
| 888 | Ga0501034_0065637 | 3300049571 | Bacteria | 3642 |
| 889 | Ga0501034_0123559 | 3300049571 | Bacteria | 2574 |
| 890 | Ga0501034_0840754 | 3300049571 | Bacteria | 809 |
| 891 | Ga0501036_0237665 | 3300049572 | Bacteria | 1528 |
| 892 | Ga0501037_0166555 | 3300049573 | Bacteria | 1569 |
| 893 | Ga0501038_0234608 | 3300049574 | Bacteria | 1458 |
| 894 | Ga0501039_0081091 | 3300049575 | Bacteria | 2526 |
| 895 | Ga0501040_0416784 | 3300049576 | Bacteria | 965 |
| 896 | Ga0501041_0169046 | 3300049577 | Bacteria | 1368 |
| 897 | Ga0501046_0014121 | 3300049580 | Bacteria | 6745 |
| 898 | Ga0501047_0216277 | 3300049581 | Bacteria | 1773 |
| 899 | Ga0501047_0376219 | 3300049581 | Bacteria | 1255 |
| 900 | Ga0501047_0734332 | 3300049581 | Bacteria | 804 |
| 901 | Ga0501047_0934499 | 3300049581 | Bacteria | 680 |
| 902 | Ga0501048_0199921 | 3300049582 | Bacteria | 1417 |
| 903 | Ga0501048_1244655 | 3300049582 | Bacteria | 535 |
| 904 | Ga0501068_1114750 | 3300049584 | Bacteria | 522 |
| 905 | Ga0501069_0370577 | 3300049585 | Bacteria | 845 |
| 906 | Ga0501070_0112554 | 3300049586 | Bacteria | 2249 |
| 907 | Ga0501070_0413462 | 3300049586 | Bacteria | 1090 |
| 908 | Ga0501072_0001866 | 3300049588 | Bacteria | 15694 |
| 909 | Ga0501073_0047978 | 3300049589 | Bacteria | 2999 |
| 910 | Ga0501073_0603889 | 3300049589 | Bacteria | 758 |
| 911 | Ga0501073_0763852 | 3300049589 | Bacteria | 666 |
| 912 | Ga0501073_1070338 | 3300049589 | Bacteria | 554 |
| 913 | Ga0501076_0488686 | 3300049592 | Bacteria | 1014 |
| 914 | Ga0501077_0074021 | 3300049593 | Bacteria | 2158 |
| 915 | Ga0501077_0202831 | 3300049593 | Bacteria | 1260 |
| 916 | Ga0501077_0456946 | 3300049593 | Bacteria | 818 |
| 917 | Ga0501079_0904863 | 3300049741 | Bacteria | 695 |
| 918 | Ga0501080_0272607 | 3300049742 | Bacteria | 1540 |
| 919 | Ga0501080_1293859 | 3300049742 | Bacteria | 625 |
| 920 | Ga0501081_0581638 | 3300049743 | Bacteria | 838 |
| 921 | Ga0501083_0065092 | 3300049744 | Bacteria | 2428 |
| 922 | Ga0501083_0281053 | 3300049744 | Bacteria | 1083 |
| 923 | Ga0501083_0290557 | 3300049744 | Bacteria | 1063 |
| 924 | Ga0501044_0052273 | 3300049823 | Bacteria | 4211 |
| 925 | Ga0501044_0501280 | 3300049823 | Bacteria | 1115 |
| 926 | Ga0501045_0462192 | 3300049824 | Bacteria | 943 |
| 927 | nmdc:mga03683_229376_c1 | 3300050489 | Bacteria | 858 |
| 928 | nmdc:mga03n38_303995_c1 | 3300050490 | Bacteria | 857 |
| 929 | nmdc:mga00v17_161190_c1 | 3300050491 | Bacteria | 1444 |
| 930 | nmdc:mga00v17_494975_c1 | 3300050491 | Bacteria | 793 |
| 931 | nmdc:mga00v17_77970_c1 | 3300050491 | Bacteria | 2064 |
| 932 | nmdc:mga0yw44_1084417_c1 | 3300050492 | Bacteria | 541 |
| 933 | nmdc:mga0yw44_140149_c1 | 3300050492 | Bacteria | 1571 |
| 934 | nmdc:mga0yw44_14958_c1 | 3300050492 | Bacteria | 4140 |
| 935 | nmdc:mga0yw44_20287_c1 | 3300050492 | Bacteria | 3686 |
| 936 | nmdc:mga0yw44_570533_c1 | 3300050492 | Bacteria | 768 |
| 937 | nmdc:mga0yw44_9207_c1 | 3300050492 | Bacteria | 4972 |
| 938 | nmdc:mga0k408_103293_c1 | 3300050493 | Bacteria | 1681 |
| 939 | nmdc:mga0k408_732559_c1 | 3300050493 | Bacteria | 578 |
| 940 | nmdc:mga06z11_193982_c1 | 3300050494 | Bacteria | 1177 |
| 941 | nmdc:mga06z11_60447_c1 | 3300050494 | Bacteria | 1973 |
| 942 | nmdc:mga06z11_772336_c1 | 3300050494 | Bacteria | 585 |
| 943 | nmdc:mga04h51_25337_c1 | 3300050495 | Bacteria | 1825 |
| 944 | nmdc:mga07m45_342976_c1 | 3300050496 | Bacteria | 868 |
| 945 | nmdc:mga07m45_689723_c1 | 3300050496 | Bacteria | 588 |
| 946 | nmdc:mga05p37_14706_c1 | 3300050507 | Bacteria | 9402 |
| 947 | nmdc:mga05p37_1564195_c1 | 3300050507 | Bacteria | 652 |
| 948 | nmdc:mga05p37_1773_c1 | 3300050507 | Bacteria | 25196 |
| 949 | nmdc:mga05p37_196486_c1 | 3300050507 | Bacteria | 2446 |
| 950 | nmdc:mga05p37_2105657_c1 | 3300050507 | Bacteria | 528 |
| 951 | nmdc:mga05p37_596952_c1 | 3300050507 | Bacteria | 1247 |
| 952 | nmdc:mga05p37_8226_c1 | 3300050507 | Bacteria | 12336 |
| 953 | nmdc:mga09592_455567_c1 | 3300050508 | Bacteria | 1103 |
| 954 | nmdc:mga09592_758794_c1 | 3300050508 | Bacteria | 823 |
| 955 | nmdc:mga09592_8971_c1 | 3300050508 | Bacteria | 8131 |
| 956 | nmdc:mga0qj67_1019591_c1 | 3300050509 | Bacteria | 649 |
| 957 | nmdc:mga0qj67_12270_c1 | 3300050509 | Bacteria | 6454 |
| 958 | nmdc:mga0qj67_299_c1 | 3300050509 | Bacteria | 34404 |
| 959 | nmdc:mga0qj67_442834_c1 | 3300050509 | Bacteria | 1047 |
| 960 | nmdc:mga06r32_121597_c1 | 3300050510 | Bacteria | 2576 |
| 961 | nmdc:mga06r32_1234254_c1 | 3300050510 | Bacteria | 693 |
| 962 | nmdc:mga06r32_1378040_c1 | 3300050510 | Bacteria | 647 |
| 963 | nmdc:mga06r32_16932_c1 | 3300050510 | Bacteria | 5795 |
| 964 | nmdc:mga06r32_433662_c1 | 3300050510 | Bacteria | 1295 |
| 965 | nmdc:mga06r32_607061_c1 | 3300050510 | Bacteria | 1065 |
| 966 | nmdc:mga06r32_87514_c1 | 3300050510 | Bacteria | 3040 |
| 967 | nmdc:mga08y16_256541_c1 | 3300050511 | Bacteria | 1806 |
| 968 | nmdc:mga08y16_359174_c1 | 3300050511 | Bacteria | 1495 |
| 969 | nmdc:mga08y16_60080_c1 | 3300050511 | Bacteria | 3970 |
| 970 | nmdc:mga0n895_1377163_c1 | 3300050512 | Bacteria | 674 |
| 971 | nmdc:mga0n895_259878_c1 | 3300050512 | Bacteria | 1762 |
| 972 | nmdc:mga0n895_284643_c1 | 3300050512 | Bacteria | 1676 |
| 973 | nmdc:mga0n895_859334_c1 | 3300050512 | Bacteria | 895 |
| 974 | nmdc:mga0rr50_727548_c1 | 3300050513 | Bacteria | 847 |
| 975 | nmdc:mga08x19_533270_c1 | 3300050514 | Bacteria | 830 |
| 976 | nmdc:mga0a205_1173733_c1 | 3300050515 | Bacteria | 615 |
| 977 | nmdc:mga0a205_27812_c1 | 3300050515 | Bacteria | 5401 |
| 978 | Ga0495601_0010741 | 3300053077 | Bacteria | 5463 |
| 979 | Ga0495601_0013011 | 3300053077 | Bacteria | 4998 |
| 980 | Ga0495601_0120925 | 3300053077 | Bacteria | 1700 |
| 981 | Ga0495601_0155985 | 3300053077 | Bacteria | 1491 |
| 982 | Ga0495601_0408841 | 3300053077 | Bacteria | 879 |
| 983 | Ga0495612_0001890 | 3300053078 | Bacteria | 8615 |
| 984 | Ga0495612_0010224 | 3300053078 | Bacteria | 3795 |
| 985 | Ga0495612_0094439 | 3300053078 | Bacteria | 1269 |
| 986 | Ga0495612_0165009 | 3300053078 | Bacteria | 968 |
| 987 | Ga0495612_0253686 | 3300053078 | Bacteria | 783 |
| 988 | Ga0495612_0288383 | 3300053078 | Bacteria | 734 |
| 989 | Ga0495655_0017923 | 3300053083 | Bacteria | 1549 |
| 990 | Ga0495655_0025243 | 3300053083 | Bacteria | 1388 |
| 991 | Ga0495655_0101535 | 3300053083 | Bacteria | 852 |
| 992 | Ga0495595_0004844 | 3300053084 | Bacteria | 5423 |
| 993 | Ga0495595_0148044 | 3300053084 | Bacteria | 1154 |
| 994 | Ga0495595_0418241 | 3300053084 | Bacteria | 680 |
| 995 | Ga0495619_0000352 | 3300053085 | Bacteria | 32130 |
| 996 | Ga0495619_0010530 | 3300053085 | Bacteria | 5818 |
| 997 | Ga0495619_0045598 | 3300053085 | Bacteria | 2881 |
| 998 | Ga0495619_0045969 | 3300053085 | Bacteria | 2869 |
| 999 | Ga0495619_0166118 | 3300053085 | Bacteria | 1525 |
| 1000 | Ga0495619_0179612 | 3300053085 | Bacteria | 1464 |
| 1001 | Ga0495619_0191997 | 3300053085 | Bacteria | 1413 |
| 1002 | Ga0500641_0125834 | 3300053096 | Bacteria | 1105 |
| 1003 | Ga0500593_084718 | 3300053117 | Bacteria | 1351 |
| 1004 | Ga0500595_011107 | 3300053119 | Bacteria | 3542 |
| 1005 | Ga0500618_000860 | 3300053125 | Bacteria | 16314 |
| 1006 | Ga0500621_122208 | 3300053126 | Bacteria | 1007 |
| 1007 | Ga0500652_273294 | 3300053131 | Bacteria | 662 |
| 1008 | Ga0500658_0044982 | 3300053134 | Bacteria | 1783 |
| 1009 | Ga0500568_0042111 | 3300053139 | Bacteria | 1831 |
| 1010 | Ga0500568_0265441 | 3300053139 | Bacteria | 624 |
| 1011 | Ga0500588_0276142 | 3300053146 | Bacteria | 634 |
| 1012 | Ga0500616_0208584 | 3300053153 | Bacteria | 860 |
| 1013 | Ga0500627_0081919 | 3300053158 | Bacteria | 1439 |
| 1014 | Ga0500611_109547 | 3300053727 | Bacteria | 724 |
| 1015 | Ga0500645_154890 | 3300053730 | Bacteria | 630 |
| 1016 | Ga0501084_0188499 | 3300054114 | Bacteria | 1740 |
| 1017 | Ga0501084_0243069 | 3300054114 | Bacteria | 1519 |
| 1018 | Ga0501084_1178008 | 3300054114 | Bacteria | 643 |
| 1019 | Ga0587084_090543 | 3300059477 | Bacteria | 606 |
| 1020 | Ga0587093_062453 | 3300059478 | Bacteria | 611 |
| 1021 | Ga0587083_0113579 | 3300059505 | Bacteria | 691 |
| 1022 | Ga0587090_135814 | 3300059510 | Bacteria | 546 |
| 1023 | Ga0587098_043264 | 3300059604 | Bacteria | 662 |
| 1024 | Ga0587101_000419 | 3300059623 | Bacteria | 2969 |
| 1025 | Ga0587130_020096 | 3300059631 | Bacteria | 718 |
| 1026 | Ga0587072_104372 | 3300059643 | Bacteria | 640 |
| 1027 | Ga0587107_102817 | 3300059652 | Bacteria | 568 |
| 1028 | Ga0501082_0516650 | 3300060353 | Bacteria | 1044 |
| 1029 | Ga0501082_1207199 | 3300060353 | Bacteria | 661 |
| 1030 | Ga0530510_0136279 | 3300061734 | Bacteria | 1807 |
| 1031 | Ga0530510_0383972 | 3300061734 | Bacteria | 1057 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300015261 | Ga0182006_1000240 | Ga0182006_100024020 | 109 |
| 2 | 3300015262 | Ga0182007_10045164 | Ga0182007_100451642 | 109 |
| 3 | 3300015265 | Ga0182005_1000016 | Ga0182005_1000016276 | 109 |
| 4 | 3300046453 | Ga0495627_000011 | Ga0495627_000011_334214_334555 | 109 |
| 5 | 3300046530 | Ga0495654_0205544 | Ga0495654_0205544_338_679 | 109 |
| 6 | 3300046538 | Ga0495609_0096531 | Ga0495609_0096531_150_491 | 109 |
| 7 | 3300046810 | Ga0495660_0000905 | Ga0495660_0000905_616_957 | 109 |
| 8 | 3300047470 | Ga0495681_0268683 | Ga0495681_0268683_94_435 | 109 |
| 9 | 3300048927 | Ga0496124_0037873 | Ga0496124_0037873_3599_3940 | 109 |
| 10 | 3300049459 | Ga0495678_000010 | Ga0495678_000010_340638_340979 | 109 |
| 11 | 3300053125 | Ga0500618_000860 | Ga0500618_000860_15940_16281 | 109 |
| 12 | iso_pu_bacteria | 2857553236 | 2857556274 | 124 |
| 13 | iso_pu_bacteria | 2919476304 | 2919476964 | 124 |
| 14 | 3300031251 | Ga0265327_10000218 | Ga0265327_10000218114 | 125 |
| 15 | 3300036647 | Ga0316582_0809702 | Ga0316582_0809702_37_477 | 127 |
| 16 | 3300002737 | JGI25162J39368_1000154 | JGI25162J39368_100015459 | 128 |
| 17 | 3300002772 | JGI25164J39214_1018510 | JGI25164J39214_10185101 | 128 |
| 18 | 3300003214 | JGI25165J46597_1000239 | JGI25165J46597_100023929 | 128 |
| 19 | 3300003751 | Ga0055538_1000094 | Ga0055538_100009429 | 128 |
| 20 | 3300003752 | Ga0055539_1000136 | Ga0055539_100013629 | 128 |
| 21 | 3300003756 | Ga0055533_1000143 | Ga0055533_100014359 | 128 |
| 22 | 3300003759 | Ga0055525_1000188 | Ga0055525_100018859 | 128 |
| 23 | 3300003775 | Ga0055524_1000024 | Ga0055524_100002413 | 128 |
| 24 | 3300003841 | Ga0055541_1000092 | Ga0055541_100009259 | 128 |
| 25 | 3300006946 | Ga0079104_1004902 | Ga0079104_10049023 | 128 |
| 26 | 3300009101 | Ga0105247_10353983 | Ga0105247_103539832 | 128 |
| 27 | 3300009176 | Ga0105242_11366899 | Ga0105242_113668991 | 128 |
| 28 | 3300015265 | Ga0182005_1000370 | Ga0182005_10003709 | 128 |
| 29 | 3300025207 | Ga0209760_103118 | Ga0209760_1031182 | 128 |
| 30 | 3300025224 | Ga0209784_100010 | Ga0209784_100010324 | 128 |
| 31 | 3300025225 | Ga0209566_100008 | Ga0209566_100008324 | 128 |
| 32 | 3300025226 | Ga0209674_100019 | Ga0209674_100019324 | 128 |
| 33 | 3300025228 | Ga0209672_107197 | Ga0209672_1071972 | 128 |
| 34 | 3300025230 | Ga0209563_100021 | Ga0209563_100021324 | 128 |
| 35 | 3300025231 | Ga0207427_100342 | Ga0207427_10034219 | 128 |
| 36 | 3300025233 | Ga0209437_100019 | Ga0209437_100019324 | 128 |
| 37 | 3300025253 | Ga0209677_100011 | Ga0209677_100011324 | 128 |
| 38 | 3300025261 | Ga0209233_1000025 | Ga0209233_1000025324 | 128 |
| 39 | 3300025299 | Ga0209256_1000054 | Ga0209256_1000054238 | 128 |
| 40 | 3300025934 | Ga0207686_11221305 | Ga0207686_112213051 | 128 |
| 41 | 3300027111 | Ga0209281_1004227 | Ga0209281_10042272 | 128 |
| 42 | 3300027666 | Ga0209282_1000072 | Ga0209282_100007247 | 128 |
| 43 | 3300035691 | Ga0373931_1149383 | Ga0373931_1149383_124_519 | 128 |
| 44 | 3300039447 | Ga0436361_0496844 | Ga0436361_0496844_1159_1557 | 128 |
| 45 | 3300046462 | Ga0495651_0019173 | Ga0495651_0019173_1269_1664 | 128 |
| 46 | 3300046516 | Ga0495628_0000109 | Ga0495628_0000109_65874_66269 | 128 |
| 47 | 3300046529 | Ga0495652_0183098 | Ga0495652_0183098_268_663 | 128 |
| 48 | 3300046530 | Ga0495654_0213446 | Ga0495654_0213446_35_466 | 128 |
| 49 | 3300046679 | Ga0495623_0098854 | Ga0495623_0098854_1307_1702 | 128 |
| 50 | 3300046680 | Ga0495646_0004357 | Ga0495646_0004357_1233_1628 | 128 |
| 51 | 3300046690 | Ga0495624_0159051 | Ga0495624_0159051_158_553 | 128 |
| 52 | 3300047321 | Ga0495676_0878645 | Ga0495676_0878645_47_442 | 128 |
| 53 | 3300048088 | Ga0495602_0189487 | Ga0495602_0189487_689_1084 | 128 |
| 54 | 3300049161 | Ga0501305_037687 | Ga0501305_037687_12_407 | 128 |
| 55 | 3300049536 | Ga0501320_007545 | Ga0501320_007545_459_854 | 128 |
| 56 | 3300049551 | Ga0501335_034801 | Ga0501335_034801_19_414 | 128 |
| 57 | 3300053077 | Ga0495601_0155985 | Ga0495601_0155985_120_515 | 128 |
| 58 | 3300053078 | Ga0495612_0253686 | Ga0495612_0253686_68_463 | 128 |
| 59 | 3300006175 | Ga0070712_100045106 | Ga0070712_1000451063 | 129 |
| 60 | 3300025915 | Ga0207693_10026097 | Ga0207693_100260972 | 129 |
| 61 | 3300005435 | Ga0070714_100599229 | Ga0070714_1005992291 | 130 |
| 62 | 3300005436 | Ga0070713_100003041 | Ga0070713_10000304114 | 130 |
| 63 | 3300005437 | Ga0070710_10346611 | Ga0070710_103466112 | 130 |
| 64 | 3300005444 | Ga0070694_100250827 | Ga0070694_1002508272 | 130 |
| 65 | 3300005445 | Ga0070708_100063487 | Ga0070708_1000634872 | 130 |
| 66 | 3300005467 | Ga0070706_100187749 | Ga0070706_1001877492 | 130 |
| 67 | 3300005518 | Ga0070699_100644965 | Ga0070699_1006449652 | 130 |
| 68 | 3300006871 | Ga0075434_101495489 | Ga0075434_1014954891 | 130 |
| 69 | 3300007076 | Ga0075435_100085297 | Ga0075435_1000852972 | 130 |
| 70 | 3300007265 | Ga0099794_10149209 | Ga0099794_101492092 | 130 |
| 71 | 3300025910 | Ga0207684_10093438 | Ga0207684_100934382 | 130 |
| 72 | 3300025922 | Ga0207646_10045479 | Ga0207646_100454796 | 130 |
| 73 | 3300025928 | Ga0207700_10177935 | Ga0207700_101779352 | 130 |
| 74 | 3300027671 | Ga0209588_1076389 | Ga0209588_10763891 | 130 |
| 75 | 3300050515 | nmdc:mga0a205_27812_c1 | nmdc:mga0a205_27812_c1_691_1125 | 130 |
| 76 | 3300005518 | Ga0070699_100003254 | Ga0070699_10000325416 | 131 |
| 77 | 3300005937 | Ga0081455_10097760 | Ga0081455_100977602 | 131 |
| 78 | 3300006173 | Ga0070716_100217271 | Ga0070716_1002172712 | 131 |
| 79 | 3300009147 | Ga0114129_10732661 | Ga0114129_107326612 | 131 |
| 80 | 3300025939 | Ga0207665_10253370 | Ga0207665_102533702 | 131 |
| 81 | 3300048914 | Ga0496111_0190545 | Ga0496111_0190545_377_811 | 131 |
| 82 | 3300050512 | nmdc:mga0n895_859334_c1 | nmdc:mga0n895_859334_c1_412_846 | 131 |
| 83 | 3300005937 | Ga0081455_10283150 | Ga0081455_102831502 | 132 |
| 84 | 3300048929 | Ga0496126_0510208 | Ga0496126_0510208_391_792 | 133 |
| 85 | iso_pu_bacteria | 2891088606 | 2891092408 | 133 |
| 86 | iso_pu_bacteria | 8002060224 | 8002061423 | 133 |
| 87 | iso_pu_bacteria | 2842694124 | 2842694303 | 135 |
| 88 | 3300005841 | Ga0068863_100251746 | Ga0068863_1002517462 | 136 |
| 89 | 3300026088 | Ga0207641_10051381 | Ga0207641_100513812 | 136 |
| 90 | 3300028380 | Ga0268265_10582116 | Ga0268265_105821161 | 136 |
| 91 | 3300049577 | Ga0501041_0169046 | Ga0501041_0169046_835_1275 | 136 |
| 92 | 3300049593 | Ga0501077_0202831 | Ga0501077_0202831_704_1144 | 136 |
| 93 | 3300060353 | Ga0501082_0516650 | Ga0501082_0516650_130_546 | 136 |
| 94 | iso_pu_bacteria | 2828305725 | 2828309652 | 136 |
| 95 | 3300028379 | Ga0268266_11463495 | Ga0268266_114634951 | 137 |
| 96 | 3300031239 | Ga0265328_10003667 | Ga0265328_100036674 | 137 |
| 97 | 3300031239 | Ga0265328_10126304 | Ga0265328_101263041 | 137 |
| 98 | 3300031239 | Ga0265328_10126657 | Ga0265328_101266572 | 137 |
| 99 | 3300031250 | Ga0265331_10013159 | Ga0265331_100131593 | 137 |
| 100 | 3300031250 | Ga0265331_10078977 | Ga0265331_100789773 | 137 |
| 101 | 3300031251 | Ga0265327_10037439 | Ga0265327_100374392 | 137 |
| 102 | 3300031251 | Ga0265327_10081747 | Ga0265327_100817473 | 137 |
| 103 | 3300031251 | Ga0265327_10101632 | Ga0265327_101016322 | 137 |
| 104 | 3300031344 | Ga0265316_10021166 | Ga0265316_100211666 | 137 |
| 105 | 3300039437 | Ga0436365_0697746 | Ga0436365_0697746_9442_9855 | 137 |
| 106 | 3300039438 | Ga0436360_0096403 | Ga0436360_0096403_79_492 | 137 |
| 107 | 3300041452 | Ga0451793_0071024 | Ga0451793_0071024_166_579 | 137 |
| 108 | 3300048904 | Ga0496101_0662127 | Ga0496101_0662127_228_641 | 137 |
| 109 | 3300048906 | Ga0496103_0358999 | Ga0496103_0358999_25_438 | 137 |
| 110 | 3300049569 | Ga0501032_0561004 | Ga0501032_0561004_146_559 | 137 |
| 111 | 3300050492 | nmdc:mga0yw44_1084417_c1 | nmdc:mga0yw44_1084417_c1_94_507 | 137 |
| 112 | 3300053134 | Ga0500658_0044982 | Ga0500658_0044982_222_635 | 137 |
| 113 | 3300053139 | Ga0500568_0042111 | Ga0500568_0042111_154_567 | 137 |
| 114 | iso_pu_bacteria | 2599185236 | 2599721239 | 137 |
| 115 | iso_pu_bacteria | 2643221629 | 2644165877 | 137 |
| 116 | iso_pu_bacteria | 2643221662 | 2644347113 | 137 |
| 117 | iso_pu_bacteria | 2757320392 | 2757572036 | 137 |
| 118 | iso_pu_bacteria | 2932401849 | 2932403087 | 137 |
| 119 | 3300003579 | Ga0007429J51699_1104387 | Ga0007429J51699_11043871 | 138 |
| 120 | 3300005338 | Ga0068868_101766949 | Ga0068868_1017669491 | 138 |
| 121 | 3300006178 | Ga0075367_10202684 | Ga0075367_102026842 | 138 |
| 122 | 3300006186 | Ga0075369_10011962 | Ga0075369_100119624 | 138 |
| 123 | 3300006195 | Ga0075366_10239679 | Ga0075366_102396792 | 138 |
| 124 | 3300006871 | Ga0075434_100116288 | Ga0075434_1001162882 | 138 |
| 125 | 3300009093 | Ga0105240_11460572 | Ga0105240_114605722 | 138 |
| 126 | 3300026023 | Ga0207677_10539774 | Ga0207677_105397741 | 138 |
| 127 | 3300028381 | Ga0268264_12074500 | Ga0268264_120745002 | 138 |
| 128 | 3300031250 | Ga0265331_10000090 | Ga0265331_1000009030 | 138 |
| 129 | 3300031344 | Ga0265316_10280285 | Ga0265316_102802852 | 138 |
| 130 | 3300031456 | Ga0307513_10087877 | Ga0307513_100878775 | 138 |
| 131 | 3300031456 | Ga0307513_10832300 | Ga0307513_108323002 | 138 |
| 132 | 3300036459 | Ga0372808_035557 | Ga0372808_035557_121_537 | 138 |
| 133 | 3300037853 | Ga0436364_0979867 | Ga0436364_0979867_714_1130 | 138 |
| 134 | 3300037853 | Ga0436364_1483415 | Ga0436364_1483415_184_621 | 138 |
| 135 | 3300042016 | Ga0439463_141242 | Ga0439463_141242_56_472 | 138 |
| 136 | 3300046452 | Ga0495617_214884 | Ga0495617_214884_16_432 | 138 |
| 137 | 3300046499 | Ga0495594_0572743 | Ga0495594_0572743_195_611 | 138 |
| 138 | 3300046507 | Ga0495606_0315616 | Ga0495606_0315616_309_725 | 138 |
| 139 | 3300046524 | Ga0495648_0255409 | Ga0495648_0255409_337_753 | 138 |
| 140 | 3300047318 | Ga0495636_0576654 | Ga0495636_0576654_38_454 | 138 |
| 141 | 3300049744 | Ga0501083_0281053 | Ga0501083_0281053_595_1011 | 138 |
| 142 | 3300050494 | nmdc:mga06z11_193982_c1 | nmdc:mga06z11_193982_c1_196_612 | 138 |
| 143 | 3300050496 | nmdc:mga07m45_689723_c1 | nmdc:mga07m45_689723_c1_10_426 | 138 |
| 144 | 3300053096 | Ga0500641_0125834 | Ga0500641_0125834_655_1071 | 138 |
| 145 | 3300053126 | Ga0500621_122208 | Ga0500621_122208_183_599 | 138 |
| 146 | 3300053131 | Ga0500652_273294 | Ga0500652_273294_169_585 | 138 |
| 147 | 3300053139 | Ga0500568_0265441 | Ga0500568_0265441_34_450 | 138 |
| 148 | 3300053146 | Ga0500588_0276142 | Ga0500588_0276142_94_510 | 138 |
| 149 | 3300053730 | Ga0500645_154890 | Ga0500645_154890_70_486 | 138 |
| 150 | iso_pu_bacteria | 2837651117 | 2837653714 | 138 |
| 151 | iso_pu_bacteria | 2937843397 | 2937845895 | 138 |
| 152 | 3300021384 | Ga0213876_10100124 | Ga0213876_101001242 | 139 |
| 153 | 3300037068 | Ga0373925_0076265 | Ga0373925_0076265_1975_2394 | 139 |
| 154 | 3300037853 | Ga0436364_1047052 | Ga0436364_1047052_306_725 | 139 |
| 155 | 3300050494 | nmdc:mga06z11_772336_c1 | nmdc:mga06z11_772336_c1_44_466 | 139 |
| 156 | 3300005539 | Ga0068853_100166407 | Ga0068853_1001664072 | 140 |
| 157 | 3300006048 | Ga0075363_100438326 | Ga0075363_1004383261 | 140 |
| 158 | 3300010375 | Ga0105239_10190771 | Ga0105239_101907713 | 140 |
| 159 | 3300010375 | Ga0105239_12977552 | Ga0105239_129775521 | 140 |
| 160 | 3300025928 | Ga0207700_10071304 | Ga0207700_100713043 | 140 |
| 161 | 3300025939 | Ga0207665_11631880 | Ga0207665_116318801 | 140 |
| 162 | 3300026041 | Ga0207639_10821507 | Ga0207639_108215071 | 140 |
| 163 | 3300027876 | Ga0209974_10105949 | Ga0209974_101059492 | 140 |
| 164 | 3300031456 | Ga0307513_10737988 | Ga0307513_107379881 | 140 |
| 165 | 3300031507 | Ga0307509_10708167 | Ga0307509_107081671 | 140 |
| 166 | 3300031824 | Ga0307413_11275995 | Ga0307413_112759951 | 140 |
| 167 | 3300031911 | Ga0307412_10843904 | Ga0307412_108439041 | 140 |
| 168 | 3300031995 | Ga0307409_101905305 | Ga0307409_1019053051 | 140 |
| 169 | 3300035118 | Ga0373954_0164172 | Ga0373954_0164172_570_992 | 140 |
| 170 | 3300035170 | Ga0373943_0283015 | Ga0373943_0283015_308_730 | 140 |
| 171 | 3300035692 | Ga0373935_0054512 | Ga0373935_0054512_1081_1503 | 140 |
| 172 | 3300035695 | Ga0373927_0000971 | Ga0373927_0000971_6756_7178 | 140 |
| 173 | 3300037068 | Ga0373925_0002443 | Ga0373925_0002443_8037_8459 | 140 |
| 174 | 3300037471 | Ga0395905_0008689 | Ga0395905_0008689_6637_7059 | 140 |
| 175 | 3300037471 | Ga0395905_0082966 | Ga0395905_0082966_415_837 | 140 |
| 176 | 3300037853 | Ga0436364_1158099 | Ga0436364_1158099_755_1177 | 140 |
| 177 | 3300039450 | Ga0436363_0823825 | Ga0436363_0823825_145_567 | 140 |
| 178 | 3300039453 | Ga0436362_0991724 | Ga0436362_0991724_14_436 | 140 |
| 179 | 3300044658 | Ga0466972_0372016 | Ga0466972_0372016_102_524 | 140 |
| 180 | 3300046463 | Ga0495653_0312035 | Ga0495653_0312035_141_563 | 140 |
| 181 | 3300046536 | Ga0495587_0168412 | Ga0495587_0168412_789_1211 | 140 |
| 182 | 3300047444 | Ga0495675_0481078 | Ga0495675_0481078_170_592 | 140 |
| 183 | 3300048088 | Ga0495602_0272000 | Ga0495602_0272000_751_1173 | 140 |
| 184 | 3300048921 | Ga0496118_0207542 | Ga0496118_0207542_145_567 | 140 |
| 185 | 3300049127 | Ga0501306_071010 | Ga0501306_071010_151_573 | 140 |
| 186 | 3300049162 | Ga0501307_002993 | Ga0501307_002993_1188_1610 | 140 |
| 187 | 3300049530 | Ga0501314_003548 | Ga0501314_003548_824_1246 | 140 |
| 188 | 3300049571 | Ga0501034_0840754 | Ga0501034_0840754_25_447 | 140 |
| 189 | 3300049572 | Ga0501036_0237665 | Ga0501036_0237665_1003_1425 | 140 |
| 190 | 3300049573 | Ga0501037_0166555 | Ga0501037_0166555_726_1148 | 140 |
| 191 | 3300049574 | Ga0501038_0234608 | Ga0501038_0234608_122_544 | 140 |
| 192 | 3300049581 | Ga0501047_0216277 | Ga0501047_0216277_837_1259 | 140 |
| 193 | 3300049581 | Ga0501047_0376219 | Ga0501047_0376219_160_582 | 140 |
| 194 | 3300049586 | Ga0501070_0413462 | Ga0501070_0413462_155_577 | 140 |
| 195 | 3300049588 | Ga0501072_0001866 | Ga0501072_0001866_2337_2759 | 140 |
| 196 | 3300049589 | Ga0501073_0763852 | Ga0501073_0763852_53_475 | 140 |
| 197 | 3300049589 | Ga0501073_1070338 | Ga0501073_1070338_95_517 | 140 |
| 198 | 3300049744 | Ga0501083_0065092 | Ga0501083_0065092_1028_1450 | 140 |
| 199 | 3300050490 | nmdc:mga03n38_303995_c1 | nmdc:mga03n38_303995_c1_250_672 | 140 |
| 200 | 3300053078 | Ga0495612_0165009 | Ga0495612_0165009_80_502 | 140 |
| 201 | 3300053083 | Ga0495655_0017923 | Ga0495655_0017923_1082_1507 | 140 |
| 202 | 3300053085 | Ga0495619_0166118 | Ga0495619_0166118_505_927 | 140 |
| 203 | 3300053153 | Ga0500616_0208584 | Ga0500616_0208584_414_836 | 140 |
| 204 | 3300053727 | Ga0500611_109547 | Ga0500611_109547_96_542 | 140 |
| 205 | 3300054114 | Ga0501084_0188499 | Ga0501084_0188499_54_476 | 140 |
| 206 | 3300054114 | Ga0501084_1178008 | Ga0501084_1178008_68_490 | 140 |
| 207 | 3300059477 | Ga0587084_090543 | Ga0587084_090543_166_588 | 140 |
| 208 | 3300059478 | Ga0587093_062453 | Ga0587093_062453_165_587 | 140 |
| 209 | 3300059505 | Ga0587083_0113579 | Ga0587083_0113579_12_434 | 140 |
| 210 | 3300059652 | Ga0587107_102817 | Ga0587107_102817_16_438 | 140 |
| 211 | 3300060353 | Ga0501082_1207199 | Ga0501082_1207199_173_595 | 140 |
| 212 | 3300003794 | Ga0055531_10002421 | Ga0055531_1000242110 | 141 |
| 213 | 3300005327 | Ga0070658_11116623 | Ga0070658_111166232 | 141 |
| 214 | 3300005340 | Ga0070689_100278703 | Ga0070689_1002787032 | 141 |
| 215 | 3300005341 | Ga0070691_10869368 | Ga0070691_108693681 | 141 |
| 216 | 3300005347 | Ga0070668_100276299 | Ga0070668_1002762992 | 141 |
| 217 | 3300005347 | Ga0070668_100520394 | Ga0070668_1005203942 | 141 |
| 218 | 3300005354 | Ga0070675_100487395 | Ga0070675_1004873952 | 141 |
| 219 | 3300005356 | Ga0070674_100586808 | Ga0070674_1005868082 | 141 |
| 220 | 3300005356 | Ga0070674_100918020 | Ga0070674_1009180202 | 141 |
| 221 | 3300005364 | Ga0070673_100566972 | Ga0070673_1005669722 | 141 |
| 222 | 3300005471 | Ga0070698_100086614 | Ga0070698_1000866144 | 141 |
| 223 | 3300005548 | Ga0070665_101114008 | Ga0070665_1011140082 | 141 |
| 224 | 3300005549 | Ga0070704_100682280 | Ga0070704_1006822802 | 141 |
| 225 | 3300005618 | Ga0068864_102305694 | Ga0068864_1023056941 | 141 |
| 226 | 3300005840 | Ga0068870_10452523 | Ga0068870_104525231 | 141 |
| 227 | 3300005844 | Ga0068862_100680860 | Ga0068862_1006808602 | 141 |
| 228 | 3300005985 | Ga0081539_10116951 | Ga0081539_101169512 | 141 |
| 229 | 3300006051 | Ga0075364_10362453 | Ga0075364_103624531 | 141 |
| 230 | 3300006844 | Ga0075428_101071610 | Ga0075428_1010716102 | 141 |
| 231 | 3300006847 | Ga0075431_101284843 | Ga0075431_1012848431 | 141 |
| 232 | 3300006880 | Ga0075429_100921396 | Ga0075429_1009213962 | 141 |
| 233 | 3300007788 | Ga0099795_10481088 | Ga0099795_104810881 | 141 |
| 234 | 3300009094 | Ga0111539_10407003 | Ga0111539_104070032 | 141 |
| 235 | 3300009098 | Ga0105245_11689775 | Ga0105245_116897751 | 141 |
| 236 | 3300009553 | Ga0105249_10318767 | Ga0105249_103187672 | 141 |
| 237 | 3300013296 | Ga0157374_10953973 | Ga0157374_109539732 | 141 |
| 238 | 3300013306 | Ga0163162_10785622 | Ga0163162_107856221 | 141 |
| 239 | 3300014326 | Ga0157380_10888444 | Ga0157380_108884441 | 141 |
| 240 | 3300014326 | Ga0157380_11513121 | Ga0157380_115131212 | 141 |
| 241 | 3300014326 | Ga0157380_11946444 | Ga0157380_119464441 | 141 |
| 242 | 3300017792 | Ga0163161_10462864 | Ga0163161_104628642 | 141 |
| 243 | 3300020069 | Ga0197907_10230911 | Ga0197907_102309111 | 141 |
| 244 | 3300021384 | Ga0213876_10003406 | Ga0213876_100034065 | 141 |
| 245 | 3300025918 | Ga0207662_10220396 | Ga0207662_102203961 | 141 |
| 246 | 3300025924 | Ga0207694_11168136 | Ga0207694_111681362 | 141 |
| 247 | 3300025926 | Ga0207659_10303959 | Ga0207659_103039592 | 141 |
| 248 | 3300025929 | Ga0207664_10472073 | Ga0207664_104720732 | 141 |
| 249 | 3300025960 | Ga0207651_10212938 | Ga0207651_102129382 | 141 |
| 250 | 3300025972 | Ga0207668_10010942 | Ga0207668_100109422 | 141 |
| 251 | 3300026075 | Ga0207708_10390231 | Ga0207708_103902312 | 141 |
| 252 | 3300027907 | Ga0207428_10040253 | Ga0207428_100402536 | 141 |
| 253 | 3300028380 | Ga0268265_10053404 | Ga0268265_100534043 | 141 |
| 254 | 3300028794 | Ga0307515_10790759 | Ga0307515_107907591 | 141 |
| 255 | 3300031235 | Ga0265330_10042093 | Ga0265330_100420932 | 141 |
| 256 | 3300031238 | Ga0265332_10026242 | Ga0265332_100262422 | 141 |
| 257 | 3300031238 | Ga0265332_10375051 | Ga0265332_103750511 | 141 |
| 258 | 3300031240 | Ga0265320_10023886 | Ga0265320_100238863 | 141 |
| 259 | 3300031241 | Ga0265325_10018308 | Ga0265325_100183082 | 141 |
| 260 | 3300031247 | Ga0265340_10016859 | Ga0265340_100168592 | 141 |
| 261 | 3300031249 | Ga0265339_10034939 | Ga0265339_100349392 | 141 |
| 262 | 3300031250 | Ga0265331_10043884 | Ga0265331_100438842 | 141 |
| 263 | 3300031344 | Ga0265316_10054706 | Ga0265316_100547061 | 141 |
| 264 | 3300031344 | Ga0265316_10116081 | Ga0265316_101160812 | 141 |
| 265 | 3300031456 | Ga0307513_10135600 | Ga0307513_101356003 | 141 |
| 266 | 3300031595 | Ga0265313_10027323 | Ga0265313_100273233 | 141 |
| 267 | 3300031595 | Ga0265313_10085817 | Ga0265313_100858172 | 141 |
| 268 | 3300031711 | Ga0265314_10188606 | Ga0265314_101886062 | 141 |
| 269 | 3300031712 | Ga0265342_10034741 | Ga0265342_100347412 | 141 |
| 270 | 3300031712 | Ga0265342_10093841 | Ga0265342_100938412 | 141 |
| 271 | 3300032005 | Ga0307411_10583210 | Ga0307411_105832102 | 141 |
| 272 | 3300035084 | Ga0373928_0252428 | Ga0373928_0252428_18_443 | 141 |
| 273 | 3300035112 | Ga0373932_0041859 | Ga0373932_0041859_201_626 | 141 |
| 274 | 3300037853 | Ga0436364_1537292 | Ga0436364_1537292_315_740 | 141 |
| 275 | 3300041408 | Ga0439453_0000173 | Ga0439453_0000173_4486_4911 | 141 |
| 276 | 3300041461 | Ga0451805_116338 | Ga0451805_116338_18_443 | 141 |
| 277 | 3300042001 | Ga0439441_041429 | Ga0439441_041429_447_872 | 141 |
| 278 | 3300042003 | Ga0439443_015095 | Ga0439443_015095_151_576 | 141 |
| 279 | 3300042436 | Ga0439435_0032006 | Ga0439435_0032006_21_446 | 141 |
| 280 | 3300044842 | Ga0466957_0251445 | Ga0466957_0251445_361_786 | 141 |
| 281 | 3300046462 | Ga0495651_0202596 | Ga0495651_0202596_482_910 | 141 |
| 282 | 3300046536 | Ga0495587_0155381 | Ga0495587_0155381_442_870 | 141 |
| 283 | 3300046558 | Ga0495633_0337541 | Ga0495633_0337541_20_448 | 141 |
| 284 | 3300046642 | Ga0495634_0355697 | Ga0495634_0355697_89_517 | 141 |
| 285 | 3300046691 | Ga0495670_0406344 | Ga0495670_0406344_248_673 | 141 |
| 286 | 3300047322 | Ga0495680_0512258 | Ga0495680_0512258_22_450 | 141 |
| 287 | 3300048088 | Ga0495602_0110082 | Ga0495602_0110082_1568_1996 | 141 |
| 288 | 3300048907 | Ga0496104_0006531 | Ga0496104_0006531_420_851 | 141 |
| 289 | 3300048908 | Ga0496105_0025920 | Ga0496105_0025920_266_697 | 141 |
| 290 | 3300048909 | Ga0496106_0065773 | Ga0496106_0065773_547_978 | 141 |
| 291 | 3300048912 | Ga0496109_0512580 | Ga0496109_0512580_643_1074 | 141 |
| 292 | 3300048924 | Ga0496121_0228399 | Ga0496121_0228399_130_555 | 141 |
| 293 | 3300049537 | Ga0501321_020521 | Ga0501321_020521_18_443 | 141 |
| 294 | 3300049541 | Ga0501325_041690 | Ga0501325_041690_123_548 | 141 |
| 295 | 3300049570 | Ga0501033_0020312 | Ga0501033_0020312_3167_3598 | 141 |
| 296 | 3300049570 | Ga0501033_0270826 | Ga0501033_0270826_547_972 | 141 |
| 297 | 3300049580 | Ga0501046_0014121 | Ga0501046_0014121_4827_5258 | 141 |
| 298 | 3300049581 | Ga0501047_0734332 | Ga0501047_0734332_165_590 | 141 |
| 299 | 3300049581 | Ga0501047_0934499 | Ga0501047_0934499_110_535 | 141 |
| 300 | 3300049585 | Ga0501069_0370577 | Ga0501069_0370577_201_650 | 141 |
| 301 | 3300049586 | Ga0501070_0112554 | Ga0501070_0112554_381_812 | 141 |
| 302 | 3300049589 | Ga0501073_0603889 | Ga0501073_0603889_225_674 | 141 |
| 303 | 3300049742 | Ga0501080_1293859 | Ga0501080_1293859_94_525 | 141 |
| 304 | 3300049744 | Ga0501083_0290557 | Ga0501083_0290557_265_714 | 141 |
| 305 | 3300049823 | Ga0501044_0052273 | Ga0501044_0052273_612_1043 | 141 |
| 306 | 3300050489 | nmdc:mga03683_229376_c1 | nmdc:mga03683_229376_c1_273_698 | 141 |
| 307 | 3300050491 | nmdc:mga00v17_494975_c1 | nmdc:mga00v17_494975_c1_329_754 | 141 |
| 308 | 3300050492 | nmdc:mga0yw44_570533_c1 | nmdc:mga0yw44_570533_c1_293_721 | 141 |
| 309 | 3300050493 | nmdc:mga0k408_103293_c1 | nmdc:mga0k408_103293_c1_1096_1521 | 141 |
| 310 | 3300050507 | nmdc:mga05p37_2105657_c1 | nmdc:mga05p37_2105657_c1_23_448 | 141 |
| 311 | 3300050510 | nmdc:mga06r32_1234254_c1 | nmdc:mga06r32_1234254_c1_142_567 | 141 |
| 312 | 3300050511 | nmdc:mga08y16_256541_c1 | nmdc:mga08y16_256541_c1_478_903 | 141 |
| 313 | 3300053077 | Ga0495601_0010741 | Ga0495601_0010741_1338_1766 | 141 |
| 314 | 3300053078 | Ga0495612_0288383 | Ga0495612_0288383_15_443 | 141 |
| 315 | 3300053084 | Ga0495595_0148044 | Ga0495595_0148044_107_535 | 141 |
| 316 | 3300053085 | Ga0495619_0010530 | Ga0495619_0010530_899_1327 | 141 |
| 317 | 3300053119 | Ga0500595_011107 | Ga0500595_011107_2993_3424 | 141 |
| 318 | 3300059510 | Ga0587090_135814 | Ga0587090_135814_107_532 | 141 |
| 319 | 3300059604 | Ga0587098_043264 | Ga0587098_043264_221_646 | 141 |
| 320 | 3300059623 | Ga0587101_000419 | Ga0587101_000419_18_443 | 141 |
| 321 | 3300059631 | Ga0587130_020096 | Ga0587130_020096_280_705 | 141 |
| 322 | 3300059643 | Ga0587072_104372 | Ga0587072_104372_199_624 | 141 |
| 323 | 3300005327 | Ga0070658_10052412 | Ga0070658_100524124 | 142 |
| 324 | 3300005327 | Ga0070658_10154512 | Ga0070658_101545122 | 142 |
| 325 | 3300005336 | Ga0070680_100164388 | Ga0070680_1001643882 | 142 |
| 326 | 3300005336 | Ga0070680_100225381 | Ga0070680_1002253812 | 142 |
| 327 | 3300005339 | Ga0070660_100023815 | Ga0070660_1000238156 | 142 |
| 328 | 3300005344 | Ga0070661_101167973 | Ga0070661_1011679731 | 142 |
| 329 | 3300005355 | Ga0070671_101103474 | Ga0070671_1011034741 | 142 |
| 330 | 3300005435 | Ga0070714_101044381 | Ga0070714_1010443811 | 142 |
| 331 | 3300005436 | Ga0070713_100872583 | Ga0070713_1008725832 | 142 |
| 332 | 3300005458 | Ga0070681_10004121 | Ga0070681_100041214 | 142 |
| 333 | 3300005458 | Ga0070681_10115719 | Ga0070681_101157192 | 142 |
| 334 | 3300005458 | Ga0070681_10980726 | Ga0070681_109807261 | 142 |
| 335 | 3300005530 | Ga0070679_100059322 | Ga0070679_1000593222 | 142 |
| 336 | 3300005530 | Ga0070679_100080701 | Ga0070679_1000807012 | 142 |
| 337 | 3300005530 | Ga0070679_100206200 | Ga0070679_1002062002 | 142 |
| 338 | 3300005536 | Ga0070697_100767954 | Ga0070697_1007679541 | 142 |
| 339 | 3300005563 | Ga0068855_100293663 | Ga0068855_1002936633 | 142 |
| 340 | 3300005981 | Ga0081538_10001041 | Ga0081538_1000104135 | 142 |
| 341 | 3300006028 | Ga0070717_10384655 | Ga0070717_103846552 | 142 |
| 342 | 3300006028 | Ga0070717_10569423 | Ga0070717_105694231 | 142 |
| 343 | 3300006173 | Ga0070716_101096905 | Ga0070716_1010969051 | 142 |
| 344 | 3300006237 | Ga0097621_100175675 | Ga0097621_1001756752 | 142 |
| 345 | 3300006844 | Ga0075428_100475503 | Ga0075428_1004755032 | 142 |
| 346 | 3300006847 | Ga0075431_100113920 | Ga0075431_1001139202 | 142 |
| 347 | 3300006914 | Ga0075436_100095184 | Ga0075436_1000951842 | 142 |
| 348 | 3300007788 | Ga0099795_10003005 | Ga0099795_100030051 | 142 |
| 349 | 3300009093 | Ga0105240_10473503 | Ga0105240_104735032 | 142 |
| 350 | 3300009147 | Ga0114129_10544522 | Ga0114129_105445222 | 142 |
| 351 | 3300009553 | Ga0105249_10745979 | Ga0105249_107459791 | 142 |
| 352 | 3300010159 | Ga0099796_10539450 | Ga0099796_105394501 | 142 |
| 353 | 3300010375 | Ga0105239_10342018 | Ga0105239_103420182 | 142 |
| 354 | 3300013102 | Ga0157371_10185602 | Ga0157371_101856022 | 142 |
| 355 | 3300013104 | Ga0157370_10253447 | Ga0157370_102534472 | 142 |
| 356 | 3300013105 | Ga0157369_10212075 | Ga0157369_102120752 | 142 |
| 357 | 3300013306 | Ga0163162_11142656 | Ga0163162_111426562 | 142 |
| 358 | 3300014968 | Ga0157379_10750918 | Ga0157379_107509182 | 142 |
| 359 | 3300014968 | Ga0157379_12244788 | Ga0157379_122447881 | 142 |
| 360 | 3300014969 | Ga0157376_10035452 | Ga0157376_100354524 | 142 |
| 361 | 3300017792 | Ga0163161_11739808 | Ga0163161_117398081 | 142 |
| 362 | 3300024225 | Ga0224572_1020774 | Ga0224572_10207741 | 142 |
| 363 | 3300024227 | Ga0228598_1010790 | Ga0228598_10107902 | 142 |
| 364 | 3300024227 | Ga0228598_1017982 | Ga0228598_10179822 | 142 |
| 365 | 3300025898 | Ga0207692_10022644 | Ga0207692_100226444 | 142 |
| 366 | 3300025905 | Ga0207685_10263207 | Ga0207685_102632072 | 142 |
| 367 | 3300025909 | Ga0207705_10156275 | Ga0207705_101562752 | 142 |
| 368 | 3300025910 | Ga0207684_11475991 | Ga0207684_114759911 | 142 |
| 369 | 3300025912 | Ga0207707_10034403 | Ga0207707_100344035 | 142 |
| 370 | 3300025912 | Ga0207707_10122288 | Ga0207707_101222883 | 142 |
| 371 | 3300025913 | Ga0207695_10150615 | Ga0207695_101506154 | 142 |
| 372 | 3300025915 | Ga0207693_10001042 | Ga0207693_100010427 | 142 |
| 373 | 3300025915 | Ga0207693_10785899 | Ga0207693_107858991 | 142 |
| 374 | 3300025916 | Ga0207663_10910732 | Ga0207663_109107321 | 142 |
| 375 | 3300025917 | Ga0207660_10054606 | Ga0207660_100546062 | 142 |
| 376 | 3300025919 | Ga0207657_10152689 | Ga0207657_101526892 | 142 |
| 377 | 3300025919 | Ga0207657_10647971 | Ga0207657_106479712 | 142 |
| 378 | 3300025920 | Ga0207649_10733741 | Ga0207649_107337412 | 142 |
| 379 | 3300025921 | Ga0207652_10058813 | Ga0207652_100588133 | 142 |
| 380 | 3300025921 | Ga0207652_10130752 | Ga0207652_101307523 | 142 |
| 381 | 3300025921 | Ga0207652_10227263 | Ga0207652_102272632 | 142 |
| 382 | 3300025921 | Ga0207652_10548286 | Ga0207652_105482861 | 142 |
| 383 | 3300025926 | Ga0207659_10701414 | Ga0207659_107014142 | 142 |
| 384 | 3300025928 | Ga0207700_11374416 | Ga0207700_113744161 | 142 |
| 385 | 3300025933 | Ga0207706_11196905 | Ga0207706_111969051 | 142 |
| 386 | 3300025939 | Ga0207665_11386972 | Ga0207665_113869721 | 142 |
| 387 | 3300025949 | Ga0207667_10004001 | Ga0207667_100040012 | 142 |
| 388 | 3300025961 | Ga0207712_10880455 | Ga0207712_108804551 | 142 |
| 389 | 3300025981 | Ga0207640_10556432 | Ga0207640_105564322 | 142 |
| 390 | 3300026075 | Ga0207708_11060290 | Ga0207708_110602901 | 142 |
| 391 | 3300026078 | Ga0207702_10483675 | Ga0207702_104836751 | 142 |
| 392 | 3300026142 | Ga0207698_10842250 | Ga0207698_108422502 | 142 |
| 393 | 3300028023 | Ga0265357_1003756 | Ga0265357_10037561 | 142 |
| 394 | 3300028800 | Ga0265338_10078200 | Ga0265338_100782002 | 142 |
| 395 | 3300028800 | Ga0265338_10531168 | Ga0265338_105311681 | 142 |
| 396 | 3300030760 | Ga0265762_1032276 | Ga0265762_10322762 | 142 |
| 397 | 3300030763 | Ga0265763_1001116 | Ga0265763_10011162 | 142 |
| 398 | 3300030878 | Ga0265770_1015363 | Ga0265770_10153631 | 142 |
| 399 | 3300030878 | Ga0265770_1129891 | Ga0265770_11298911 | 142 |
| 400 | 3300031018 | Ga0265773_1005799 | Ga0265773_10057991 | 142 |
| 401 | 3300031090 | Ga0265760_10033681 | Ga0265760_100336812 | 142 |
| 402 | 3300031090 | Ga0265760_10033778 | Ga0265760_100337781 | 142 |
| 403 | 3300031090 | Ga0265760_10091086 | Ga0265760_100910862 | 142 |
| 404 | 3300031090 | Ga0265760_10237859 | Ga0265760_102378591 | 142 |
| 405 | 3300031241 | Ga0265325_10000449 | Ga0265325_1000044927 | 142 |
| 406 | 3300031247 | Ga0265340_10189420 | Ga0265340_101894202 | 142 |
| 407 | 3300031249 | Ga0265339_10000053 | Ga0265339_100000533 | 142 |
| 408 | 3300031595 | Ga0265313_10000098 | Ga0265313_1000009884 | 142 |
| 409 | 3300031595 | Ga0265313_10003687 | Ga0265313_100036874 | 142 |
| 410 | 3300031712 | Ga0265342_10311122 | Ga0265342_103111222 | 142 |
| 411 | 3300031730 | Ga0307516_10161320 | Ga0307516_101613202 | 142 |
| 412 | 3300032126 | Ga0307415_101261050 | Ga0307415_1012610502 | 142 |
| 413 | 3300033524 | Ga0316592_1114322 | Ga0316592_11143222 | 142 |
| 414 | 3300033541 | Ga0316596_1136759 | Ga0316596_11367591 | 142 |
| 415 | 3300035083 | Ga0373926_0432410 | Ga0373926_0432410_14_442 | 142 |
| 416 | 3300035086 | Ga0373934_0062611 | Ga0373934_0062611_233_661 | 142 |
| 417 | 3300035111 | Ga0373923_0152772 | Ga0373923_0152772_336_764 | 142 |
| 418 | 3300035112 | Ga0373932_0245400 | Ga0373932_0245400_187_627 | 142 |
| 419 | 3300035118 | Ga0373954_0066947 | Ga0373954_0066947_480_908 | 142 |
| 420 | 3300035119 | Ga0373956_0266738 | Ga0373956_0266738_364_792 | 142 |
| 421 | 3300035121 | Ga0373960_0005814 | Ga0373960_0005814_1072_1512 | 142 |
| 422 | 3300035207 | Ga0373942_0045451 | Ga0373942_0045451_635_1075 | 142 |
| 423 | 3300035241 | Ga0373961_0206424 | Ga0373961_0206424_157_591 | 142 |
| 424 | 3300035242 | Ga0373962_0167214 | Ga0373962_0167214_197_637 | 142 |
| 425 | 3300035398 | Ga0316574_0384775 | Ga0316574_0384775_352_780 | 142 |
| 426 | 3300035410 | Ga0373924_0043824 | Ga0373924_0043824_851_1279 | 142 |
| 427 | 3300035691 | Ga0373931_0154720 | Ga0373931_0154720_274_714 | 142 |
| 428 | 3300035692 | Ga0373935_0251032 | Ga0373935_0251032_23_451 | 142 |
| 429 | 3300035695 | Ga0373927_0017276 | Ga0373927_0017276_3691_4119 | 142 |
| 430 | 3300035724 | Ga0373933_0000858 | Ga0373933_0000858_8847_9275 | 142 |
| 431 | 3300035724 | Ga0373933_1033357 | Ga0373933_1033357_64_492 | 142 |
| 432 | 3300035725 | Ga0373947_0093951 | Ga0373947_0093951_666_1106 | 142 |
| 433 | 3300036401 | Ga0373937_0002560 | Ga0373937_0002560_47_475 | 142 |
| 434 | 3300036647 | Ga0316582_0120853 | Ga0316582_0120853_1089_1517 | 142 |
| 435 | 3300037068 | Ga0373925_0016615 | Ga0373925_0016615_4328_4756 | 142 |
| 436 | 3300037068 | Ga0373925_0086532 | Ga0373925_0086532_678_1118 | 142 |
| 437 | 3300037068 | Ga0373925_0829984 | Ga0373925_0829984_266_706 | 142 |
| 438 | 3300037312 | Ga0395899_0000073 | Ga0395899_0000073_83014_83442 | 142 |
| 439 | 3300037418 | Ga0395900_0000027 | Ga0395900_0000027_187584_188012 | 142 |
| 440 | 3300037466 | Ga0395898_0000255 | Ga0395898_0000255_32644_33072 | 142 |
| 441 | 3300037471 | Ga0395905_0000032 | Ga0395905_0000032_97921_98349 | 142 |
| 442 | 3300038443 | Ga0395901_0000110 | Ga0395901_0000110_97946_98374 | 142 |
| 443 | 3300039437 | Ga0436365_1428905 | Ga0436365_1428905_421_873 | 142 |
| 444 | 3300039438 | Ga0436360_1301919 | Ga0436360_1301919_389_817 | 142 |
| 445 | 3300039450 | Ga0436363_0177757 | Ga0436363_0177757_288_719 | 142 |
| 446 | 3300039453 | Ga0436362_0617508 | Ga0436362_0617508_103_531 | 142 |
| 447 | 3300041406 | Ga0439439_0159716 | Ga0439439_0159716_174_605 | 142 |
| 448 | 3300042001 | Ga0439441_051867 | Ga0439441_051867_384_815 | 142 |
| 449 | 3300044684 | Ga0466966_0121358 | Ga0466966_0121358_860_1288 | 142 |
| 450 | 3300044694 | Ga0466963_0141593 | Ga0466963_0141593_611_1039 | 142 |
| 451 | 3300044842 | Ga0466957_0031161 | Ga0466957_0031161_2607_3035 | 142 |
| 452 | 3300045049 | Ga0466959_0096694 | Ga0466959_0096694_658_1086 | 142 |
| 453 | 3300045836 | Ga0466958_0008139 | Ga0466958_0008139_2051_2479 | 142 |
| 454 | 3300045976 | Ga0466967_1017772 | Ga0466967_1017772_82_510 | 142 |
| 455 | 3300046454 | Ga0495592_0004065 | Ga0495592_0004065_5434_5862 | 142 |
| 456 | 3300046455 | Ga0495603_0092189 | Ga0495603_0092189_482_910 | 142 |
| 457 | 3300046459 | Ga0495629_0003502 | Ga0495629_0003502_11416_11844 | 142 |
| 458 | 3300046461 | Ga0495641_0294711 | Ga0495641_0294711_130_558 | 142 |
| 459 | 3300046462 | Ga0495651_0001400 | Ga0495651_0001400_5710_6138 | 142 |
| 460 | 3300046463 | Ga0495653_0026224 | Ga0495653_0026224_3247_3675 | 142 |
| 461 | 3300046472 | Ga0495580_0480008 | Ga0495580_0480008_153_584 | 142 |
| 462 | 3300046472 | Ga0495580_0605048 | Ga0495580_0605048_23_451 | 142 |
| 463 | 3300046474 | Ga0495605_0247420 | Ga0495605_0247420_145_585 | 142 |
| 464 | 3300046475 | Ga0495639_0329639 | Ga0495639_0329639_72_512 | 142 |
| 465 | 3300046477 | Ga0495664_0032998 | Ga0495664_0032998_1950_2378 | 142 |
| 466 | 3300046491 | Ga0495584_0255890 | Ga0495584_0255890_342_782 | 142 |
| 467 | 3300046499 | Ga0495594_0376546 | Ga0495594_0376546_95_535 | 142 |
| 468 | 3300046499 | Ga0495594_0698497 | Ga0495594_0698497_10_438 | 142 |
| 469 | 3300046511 | Ga0495608_0359874 | Ga0495608_0359874_16_447 | 142 |
| 470 | 3300046514 | Ga0495618_0015533 | Ga0495618_0015533_1804_2232 | 142 |
| 471 | 3300046516 | Ga0495628_0014171 | Ga0495628_0014171_4534_4962 | 142 |
| 472 | 3300046517 | Ga0495630_0118472 | Ga0495630_0118472_983_1411 | 142 |
| 473 | 3300046517 | Ga0495630_0484732 | Ga0495630_0484732_441_881 | 142 |
| 474 | 3300046526 | Ga0495666_0193773 | Ga0495666_0193773_209_649 | 142 |
| 475 | 3300046528 | Ga0495642_0438074 | Ga0495642_0438074_109_549 | 142 |
| 476 | 3300046529 | Ga0495652_0004294 | Ga0495652_0004294_11389_11817 | 142 |
| 477 | 3300046531 | Ga0495665_0042118 | Ga0495665_0042118_1942_2370 | 142 |
| 478 | 3300046533 | Ga0495640_0000769 | Ga0495640_0000769_3193_3621 | 142 |
| 479 | 3300046536 | Ga0495587_0001283 | Ga0495587_0001283_5047_5475 | 142 |
| 480 | 3300046559 | Ga0495667_0001440 | Ga0495667_0001440_11727_12155 | 142 |
| 481 | 3300046642 | Ga0495634_0029771 | Ga0495634_0029771_234_668 | 142 |
| 482 | 3300046663 | Ga0495635_0531085 | Ga0495635_0531085_86_514 | 142 |
| 483 | 3300046675 | Ga0495657_0168449 | Ga0495657_0168449_308_736 | 142 |
| 484 | 3300046678 | Ga0495599_0041684 | Ga0495599_0041684_1592_2020 | 142 |
| 485 | 3300046679 | Ga0495623_0013044 | Ga0495623_0013044_3730_4158 | 142 |
| 486 | 3300046680 | Ga0495646_0010752 | Ga0495646_0010752_2498_2926 | 142 |
| 487 | 3300046681 | Ga0495647_0243204 | Ga0495647_0243204_277_705 | 142 |
| 488 | 3300046683 | Ga0495658_0071370 | Ga0495658_0071370_382_822 | 142 |
| 489 | 3300046684 | Ga0495669_0249240 | Ga0495669_0249240_169_609 | 142 |
| 490 | 3300046689 | Ga0495613_0057625 | Ga0495613_0057625_1514_1942 | 142 |
| 491 | 3300046690 | Ga0495624_0325699 | Ga0495624_0325699_149_589 | 142 |
| 492 | 3300046692 | Ga0495671_0487639 | Ga0495671_0487639_40_480 | 142 |
| 493 | 3300046809 | Ga0495600_0001398 | Ga0495600_0001398_794_1222 | 142 |
| 494 | 3300047315 | Ga0495581_0472033 | Ga0495581_0472033_23_451 | 142 |
| 495 | 3300047315 | Ga0495581_0760003 | Ga0495581_0760003_76_516 | 142 |
| 496 | 3300047317 | Ga0495604_0000406 | Ga0495604_0000406_5088_5516 | 142 |
| 497 | 3300047319 | Ga0495674_0023413 | Ga0495674_0023413_2757_3185 | 142 |
| 498 | 3300047321 | Ga0495676_0198060 | Ga0495676_0198060_78_506 | 142 |
| 499 | 3300047322 | Ga0495680_0002267 | Ga0495680_0002267_37_465 | 142 |
| 500 | 3300047444 | Ga0495675_0036422 | Ga0495675_0036422_83_511 | 142 |
| 501 | 3300047471 | Ga0495684_0002545 | Ga0495684_0002545_2980_3408 | 142 |
| 502 | 3300048088 | Ga0495602_0014190 | Ga0495602_0014190_7237_7665 | 142 |
| 503 | 3300048905 | Ga0496102_0398632 | Ga0496102_0398632_672_1112 | 142 |
| 504 | 3300048907 | Ga0496104_0362727 | Ga0496104_0362727_26_466 | 142 |
| 505 | 3300048907 | Ga0496104_0503731 | Ga0496104_0503731_173_601 | 142 |
| 506 | 3300048907 | Ga0496104_1671496 | Ga0496104_1671496_32_466 | 142 |
| 507 | 3300048908 | Ga0496105_0113571 | Ga0496105_0113571_183_623 | 142 |
| 508 | 3300048909 | Ga0496106_0228146 | Ga0496106_0228146_328_768 | 142 |
| 509 | 3300048912 | Ga0496109_0640136 | Ga0496109_0640136_415_843 | 142 |
| 510 | 3300048913 | Ga0496110_0546916 | Ga0496110_0546916_344_772 | 142 |
| 511 | 3300048914 | Ga0496111_1090571 | Ga0496111_1090571_23_457 | 142 |
| 512 | 3300048915 | Ga0496112_0559441 | Ga0496112_0559441_274_702 | 142 |
| 513 | 3300048918 | Ga0496115_0087721 | Ga0496115_0087721_1164_1604 | 142 |
| 514 | 3300048918 | Ga0496115_0614127 | Ga0496115_0614127_114_548 | 142 |
| 515 | 3300048918 | Ga0496115_0802624 | Ga0496115_0802624_75_503 | 142 |
| 516 | 3300048924 | Ga0496121_0411816 | Ga0496121_0411816_380_808 | 142 |
| 517 | 3300048929 | Ga0496126_0143598 | Ga0496126_0143598_1083_1511 | 142 |
| 518 | 3300049571 | Ga0501034_0065637 | Ga0501034_0065637_2747_3175 | 142 |
| 519 | 3300049575 | Ga0501039_0081091 | Ga0501039_0081091_192_620 | 142 |
| 520 | 3300049576 | Ga0501040_0416784 | Ga0501040_0416784_451_879 | 142 |
| 521 | 3300049589 | Ga0501073_0047978 | Ga0501073_0047978_2266_2694 | 142 |
| 522 | 3300049593 | Ga0501077_0456946 | Ga0501077_0456946_38_469 | 142 |
| 523 | 3300049741 | Ga0501079_0904863 | Ga0501079_0904863_184_624 | 142 |
| 524 | 3300049743 | Ga0501081_0581638 | Ga0501081_0581638_229_660 | 142 |
| 525 | 3300049823 | Ga0501044_0501280 | Ga0501044_0501280_676_1104 | 142 |
| 526 | 3300050507 | nmdc:mga05p37_1564195_c1 | nmdc:mga05p37_1564195_c1_59_493 | 142 |
| 527 | 3300050507 | nmdc:mga05p37_1773_c1 | nmdc:mga05p37_1773_c1_19972_20412 | 142 |
| 528 | 3300050507 | nmdc:mga05p37_596952_c1 | nmdc:mga05p37_596952_c1_345_785 | 142 |
| 529 | 3300050509 | nmdc:mga0qj67_299_c1 | nmdc:mga0qj67_299_c1_21330_21770 | 142 |
| 530 | 3300050510 | nmdc:mga06r32_1378040_c1 | nmdc:mga06r32_1378040_c1_51_485 | 142 |
| 531 | 3300050510 | nmdc:mga06r32_607061_c1 | nmdc:mga06r32_607061_c1_611_1042 | 142 |
| 532 | 3300050511 | nmdc:mga08y16_359174_c1 | nmdc:mga08y16_359174_c1_620_1054 | 142 |
| 533 | 3300053077 | Ga0495601_0013011 | Ga0495601_0013011_3390_3818 | 142 |
| 534 | 3300053078 | Ga0495612_0001890 | Ga0495612_0001890_2850_3278 | 142 |
| 535 | 3300053084 | Ga0495595_0004844 | Ga0495595_0004844_131_559 | 142 |
| 536 | 3300053085 | Ga0495619_0000352 | Ga0495619_0000352_31447_31875 | 142 |
| 537 | 3300053117 | Ga0500593_084718 | Ga0500593_084718_193_621 | 142 |
| 538 | 3300053158 | Ga0500627_0081919 | Ga0500627_0081919_549_980 | 142 |
| 539 | 3300005445 | Ga0070708_100556604 | Ga0070708_1005566041 | 143 |
| 540 | 3300005468 | Ga0070707_100006038 | Ga0070707_1000060387 | 143 |
| 541 | 3300006038 | Ga0075365_10025404 | Ga0075365_100254043 | 143 |
| 542 | 3300006051 | Ga0075364_10534352 | Ga0075364_105343522 | 143 |
| 543 | 3300006847 | Ga0075431_100012366 | Ga0075431_1000123662 | 143 |
| 544 | 3300009147 | Ga0114129_10431100 | Ga0114129_104311001 | 143 |
| 545 | 3300024227 | Ga0228598_1000416 | Ga0228598_100041610 | 143 |
| 546 | 3300025905 | Ga0207685_10860690 | Ga0207685_108606901 | 143 |
| 547 | 3300025922 | Ga0207646_10007626 | Ga0207646_100076266 | 143 |
| 548 | 3300025935 | Ga0207709_11401091 | Ga0207709_114010912 | 143 |
| 549 | 3300025986 | Ga0207658_10320989 | Ga0207658_103209891 | 143 |
| 550 | 3300026089 | Ga0207648_11383510 | Ga0207648_113835101 | 143 |
| 551 | 3300032120 | Ga0316053_105626 | Ga0316053_1056262 | 143 |
| 552 | 3300035086 | Ga0373934_0111077 | Ga0373934_0111077_369_800 | 143 |
| 553 | 3300035111 | Ga0373923_0073205 | Ga0373923_0073205_241_672 | 143 |
| 554 | 3300035117 | Ga0373953_0421003 | Ga0373953_0421003_106_537 | 143 |
| 555 | 3300035118 | Ga0373954_0122786 | Ga0373954_0122786_260_691 | 143 |
| 556 | 3300035119 | Ga0373956_0365115 | Ga0373956_0365115_154_585 | 143 |
| 557 | 3300035170 | Ga0373943_0129148 | Ga0373943_0129148_798_1229 | 143 |
| 558 | 3300036401 | Ga0373937_0017054 | Ga0373937_0017054_4492_4923 | 143 |
| 559 | 3300037068 | Ga0373925_1007028 | Ga0373925_1007028_25_456 | 143 |
| 560 | 3300046462 | Ga0495651_0104450 | Ga0495651_0104450_318_749 | 143 |
| 561 | 3300046463 | Ga0495653_0352837 | Ga0495653_0352837_146_577 | 143 |
| 562 | 3300046477 | Ga0495664_0367224 | Ga0495664_0367224_378_809 | 143 |
| 563 | 3300046516 | Ga0495628_0028002 | Ga0495628_0028002_2550_2981 | 143 |
| 564 | 3300046531 | Ga0495665_0395931 | Ga0495665_0395931_251_682 | 143 |
| 565 | 3300046533 | Ga0495640_0186675 | Ga0495640_0186675_289_720 | 143 |
| 566 | 3300046536 | Ga0495587_0103577 | Ga0495587_0103577_621_1052 | 143 |
| 567 | 3300046559 | Ga0495667_0041859 | Ga0495667_0041859_839_1270 | 143 |
| 568 | 3300046663 | Ga0495635_0138899 | Ga0495635_0138899_430_861 | 143 |
| 569 | 3300046678 | Ga0495599_0060382 | Ga0495599_0060382_1864_2295 | 143 |
| 570 | 3300046679 | Ga0495623_0080307 | Ga0495623_0080307_937_1368 | 143 |
| 571 | 3300046809 | Ga0495600_0057506 | Ga0495600_0057506_915_1346 | 143 |
| 572 | 3300047317 | Ga0495604_0072447 | Ga0495604_0072447_1344_1775 | 143 |
| 573 | 3300047319 | Ga0495674_0663268 | Ga0495674_0663268_29_460 | 143 |
| 574 | 3300047320 | Ga0495672_0081977 | Ga0495672_0081977_138_569 | 143 |
| 575 | 3300047444 | Ga0495675_0071301 | Ga0495675_0071301_373_804 | 143 |
| 576 | 3300047673 | Ga0495593_0343085 | Ga0495593_0343085_136_567 | 143 |
| 577 | 3300048088 | Ga0495602_0094162 | Ga0495602_0094162_981_1412 | 143 |
| 578 | 3300048908 | Ga0496105_0983536 | Ga0496105_0983536_20_460 | 143 |
| 579 | 3300048910 | Ga0496107_0703659 | Ga0496107_0703659_261_701 | 143 |
| 580 | 3300048917 | Ga0496114_0116757 | Ga0496114_0116757_631_1071 | 143 |
| 581 | 3300048929 | Ga0496126_0197052 | Ga0496126_0197052_790_1221 | 143 |
| 582 | 3300049571 | Ga0501034_0123559 | Ga0501034_0123559_269_700 | 143 |
| 583 | 3300050491 | nmdc:mga00v17_77970_c1 | nmdc:mga00v17_77970_c1_1124_1561 | 143 |
| 584 | 3300050492 | nmdc:mga0yw44_9207_c1 | nmdc:mga0yw44_9207_c1_4032_4469 | 143 |
| 585 | 3300050508 | nmdc:mga09592_455567_c1 | nmdc:mga09592_455567_c1_314_751 | 143 |
| 586 | 3300050509 | nmdc:mga0qj67_442834_c1 | nmdc:mga0qj67_442834_c1_184_618 | 143 |
| 587 | 3300050510 | nmdc:mga06r32_121597_c1 | nmdc:mga06r32_121597_c1_245_682 | 143 |
| 588 | 3300053077 | Ga0495601_0120925 | Ga0495601_0120925_200_631 | 143 |
| 589 | 3300053078 | Ga0495612_0094439 | Ga0495612_0094439_301_732 | 143 |
| 590 | 3300053084 | Ga0495595_0418241 | Ga0495595_0418241_178_618 | 143 |
| 591 | 3300053085 | Ga0495619_0045598 | Ga0495619_0045598_2078_2518 | 143 |
| 592 | 3300053085 | Ga0495619_0191997 | Ga0495619_0191997_810_1241 | 143 |
| 593 | 3300001977 | JGI24746J21847_1001137 | JGI24746J21847_10011375 | 144 |
| 594 | 3300001989 | JGI24739J22299_10134223 | JGI24739J22299_101342231 | 144 |
| 595 | 3300002070 | JGI24750J21931_1000826 | JGI24750J21931_10008264 | 144 |
| 596 | 3300002074 | JGI24748J21848_1001282 | JGI24748J21848_10012821 | 144 |
| 597 | 3300002075 | JGI24738J21930_10018711 | JGI24738J21930_100187111 | 144 |
| 598 | 3300002077 | JGI24744J21845_10000833 | JGI24744J21845_100008334 | 144 |
| 599 | 3300002155 | JGI24033J26618_1000715 | JGI24033J26618_10007152 | 144 |
| 600 | 3300002239 | JGI24034J26672_10000746 | JGI24034J26672_100007465 | 144 |
| 601 | 3300002244 | JGI24742J22300_10002192 | JGI24742J22300_100021923 | 144 |
| 602 | 3300004801 | Ga0058860_12217134 | Ga0058860_122171342 | 144 |
| 603 | 3300005329 | Ga0070683_100665716 | Ga0070683_1006657162 | 144 |
| 604 | 3300005330 | Ga0070690_100064687 | Ga0070690_1000646872 | 144 |
| 605 | 3300005331 | Ga0070670_100033818 | Ga0070670_1000338182 | 144 |
| 606 | 3300005331 | Ga0070670_100045376 | Ga0070670_1000453763 | 144 |
| 607 | 3300005333 | Ga0070677_10200448 | Ga0070677_102004482 | 144 |
| 608 | 3300005334 | Ga0068869_100104724 | Ga0068869_1001047242 | 144 |
| 609 | 3300005335 | Ga0070666_10114683 | Ga0070666_101146832 | 144 |
| 610 | 3300005335 | Ga0070666_10423572 | Ga0070666_104235722 | 144 |
| 611 | 3300005337 | Ga0070682_100018452 | Ga0070682_1000184522 | 144 |
| 612 | 3300005338 | Ga0068868_100010692 | Ga0068868_1000106926 | 144 |
| 613 | 3300005339 | Ga0070660_100337489 | Ga0070660_1003374892 | 144 |
| 614 | 3300005340 | Ga0070689_100044445 | Ga0070689_1000444452 | 144 |
| 615 | 3300005341 | Ga0070691_10216215 | Ga0070691_102162152 | 144 |
| 616 | 3300005343 | Ga0070687_100142255 | Ga0070687_1001422552 | 144 |
| 617 | 3300005343 | Ga0070687_101529520 | Ga0070687_1015295201 | 144 |
| 618 | 3300005344 | Ga0070661_100545081 | Ga0070661_1005450812 | 144 |
| 619 | 3300005347 | Ga0070668_100043280 | Ga0070668_1000432802 | 144 |
| 620 | 3300005353 | Ga0070669_100078912 | Ga0070669_1000789121 | 144 |
| 621 | 3300005354 | Ga0070675_100004703 | Ga0070675_1000047033 | 144 |
| 622 | 3300005354 | Ga0070675_100890238 | Ga0070675_1008902381 | 144 |
| 623 | 3300005355 | Ga0070671_100037107 | Ga0070671_1000371072 | 144 |
| 624 | 3300005355 | Ga0070671_100051674 | Ga0070671_1000516743 | 144 |
| 625 | 3300005355 | Ga0070671_100545240 | Ga0070671_1005452402 | 144 |
| 626 | 3300005364 | Ga0070673_100015193 | Ga0070673_1000151934 | 144 |
| 627 | 3300005364 | Ga0070673_100018429 | Ga0070673_1000184292 | 144 |
| 628 | 3300005365 | Ga0070688_100063947 | Ga0070688_1000639473 | 144 |
| 629 | 3300005365 | Ga0070688_100367264 | Ga0070688_1003672642 | 144 |
| 630 | 3300005366 | Ga0070659_100207122 | Ga0070659_1002071222 | 144 |
| 631 | 3300005366 | Ga0070659_100400392 | Ga0070659_1004003921 | 144 |
| 632 | 3300005366 | Ga0070659_101012334 | Ga0070659_1010123341 | 144 |
| 633 | 3300005367 | Ga0070667_100009241 | Ga0070667_1000092416 | 144 |
| 634 | 3300005406 | Ga0070703_10106276 | Ga0070703_101062761 | 144 |
| 635 | 3300005434 | Ga0070709_10015699 | Ga0070709_100156996 | 144 |
| 636 | 3300005434 | Ga0070709_10226111 | Ga0070709_102261111 | 144 |
| 637 | 3300005435 | Ga0070714_100024965 | Ga0070714_1000249652 | 144 |
| 638 | 3300005435 | Ga0070714_100979173 | Ga0070714_1009791731 | 144 |
| 639 | 3300005436 | Ga0070713_100011844 | Ga0070713_1000118449 | 144 |
| 640 | 3300005436 | Ga0070713_100191145 | Ga0070713_1001911452 | 144 |
| 641 | 3300005437 | Ga0070710_10082005 | Ga0070710_100820053 | 144 |
| 642 | 3300005439 | Ga0070711_100074713 | Ga0070711_1000747131 | 144 |
| 643 | 3300005439 | Ga0070711_100310705 | Ga0070711_1003107052 | 144 |
| 644 | 3300005440 | Ga0070705_100279873 | Ga0070705_1002798731 | 144 |
| 645 | 3300005441 | Ga0070700_100060003 | Ga0070700_1000600033 | 144 |
| 646 | 3300005455 | Ga0070663_100899446 | Ga0070663_1008994461 | 144 |
| 647 | 3300005456 | Ga0070678_100306391 | Ga0070678_1003063911 | 144 |
| 648 | 3300005457 | Ga0070662_100057865 | Ga0070662_1000578653 | 144 |
| 649 | 3300005459 | Ga0068867_100268154 | Ga0068867_1002681542 | 144 |
| 650 | 3300005466 | Ga0070685_10020411 | Ga0070685_100204112 | 144 |
| 651 | 3300005539 | Ga0068853_100120553 | Ga0068853_1001205532 | 144 |
| 652 | 3300005543 | Ga0070672_100124373 | Ga0070672_1001243732 | 144 |
| 653 | 3300005543 | Ga0070672_100131496 | Ga0070672_1001314962 | 144 |
| 654 | 3300005544 | Ga0070686_100054524 | Ga0070686_1000545242 | 144 |
| 655 | 3300005548 | Ga0070665_101975470 | Ga0070665_1019754701 | 144 |
| 656 | 3300005549 | Ga0070704_100059469 | Ga0070704_1000594693 | 144 |
| 657 | 3300005615 | Ga0070702_100115730 | Ga0070702_1001157302 | 144 |
| 658 | 3300005615 | Ga0070702_100565389 | Ga0070702_1005653891 | 144 |
| 659 | 3300005616 | Ga0068852_100393611 | Ga0068852_1003936112 | 144 |
| 660 | 3300005617 | Ga0068859_100021311 | Ga0068859_1000213112 | 144 |
| 661 | 3300005618 | Ga0068864_100023234 | Ga0068864_1000232346 | 144 |
| 662 | 3300005718 | Ga0068866_10460426 | Ga0068866_104604262 | 144 |
| 663 | 3300005719 | Ga0068861_100061245 | Ga0068861_1000612453 | 144 |
| 664 | 3300005841 | Ga0068863_100017228 | Ga0068863_1000172286 | 144 |
| 665 | 3300005842 | Ga0068858_100053731 | Ga0068858_1000537313 | 144 |
| 666 | 3300005842 | Ga0068858_100511509 | Ga0068858_1005115092 | 144 |
| 667 | 3300005843 | Ga0068860_100108790 | Ga0068860_1001087903 | 144 |
| 668 | 3300005844 | Ga0068862_100030508 | Ga0068862_1000305084 | 144 |
| 669 | 3300005844 | Ga0068862_100535296 | Ga0068862_1005352962 | 144 |
| 670 | 3300005937 | Ga0081455_10002425 | Ga0081455_1000242520 | 144 |
| 671 | 3300005937 | Ga0081455_10015627 | Ga0081455_100156277 | 144 |
| 672 | 3300005981 | Ga0081538_10024942 | Ga0081538_100249423 | 144 |
| 673 | 3300005981 | Ga0081538_10033225 | Ga0081538_100332252 | 144 |
| 674 | 3300005983 | Ga0081540_1003020 | Ga0081540_10030208 | 144 |
| 675 | 3300006028 | Ga0070717_10066346 | Ga0070717_100663463 | 144 |
| 676 | 3300006028 | Ga0070717_10083481 | Ga0070717_100834812 | 144 |
| 677 | 3300006028 | Ga0070717_11369757 | Ga0070717_113697572 | 144 |
| 678 | 3300006038 | Ga0075365_10091294 | Ga0075365_100912942 | 144 |
| 679 | 3300006042 | Ga0075368_10305832 | Ga0075368_103058321 | 144 |
| 680 | 3300006051 | Ga0075364_10956726 | Ga0075364_109567261 | 144 |
| 681 | 3300006175 | Ga0070712_100004635 | Ga0070712_1000046356 | 144 |
| 682 | 3300006175 | Ga0070712_100326657 | Ga0070712_1003266572 | 144 |
| 683 | 3300006178 | Ga0075367_10013649 | Ga0075367_100136495 | 144 |
| 684 | 3300006178 | Ga0075367_10152081 | Ga0075367_101520812 | 144 |
| 685 | 3300006186 | Ga0075369_10291742 | Ga0075369_102917422 | 144 |
| 686 | 3300006194 | Ga0075427_10032241 | Ga0075427_100322411 | 144 |
| 687 | 3300006195 | Ga0075366_10095293 | Ga0075366_100952932 | 144 |
| 688 | 3300006237 | Ga0097621_100102942 | Ga0097621_1001029423 | 144 |
| 689 | 3300006353 | Ga0075370_10033357 | Ga0075370_100333573 | 144 |
| 690 | 3300006358 | Ga0068871_100159329 | Ga0068871_1001593293 | 144 |
| 691 | 3300006844 | Ga0075428_100092978 | Ga0075428_1000929783 | 144 |
| 692 | 3300006844 | Ga0075428_100099017 | Ga0075428_1000990173 | 144 |
| 693 | 3300006844 | Ga0075428_100256103 | Ga0075428_1002561033 | 144 |
| 694 | 3300006847 | Ga0075431_100030686 | Ga0075431_1000306863 | 144 |
| 695 | 3300006847 | Ga0075431_100102642 | Ga0075431_1001026422 | 144 |
| 696 | 3300006852 | Ga0075433_11332470 | Ga0075433_113324701 | 144 |
| 697 | 3300006871 | Ga0075434_100157899 | Ga0075434_1001578992 | 144 |
| 698 | 3300006880 | Ga0075429_100264985 | Ga0075429_1002649852 | 144 |
| 699 | 3300006880 | Ga0075429_101122448 | Ga0075429_1011224482 | 144 |
| 700 | 3300006931 | Ga0097620_100021311 | Ga0097620_1000213112 | 144 |
| 701 | 3300007076 | Ga0075435_100534415 | Ga0075435_1005344152 | 144 |
| 702 | 3300009094 | Ga0111539_10359025 | Ga0111539_103590252 | 144 |
| 703 | 3300009098 | Ga0105245_10097208 | Ga0105245_100972083 | 144 |
| 704 | 3300009098 | Ga0105245_11112738 | Ga0105245_111127382 | 144 |
| 705 | 3300009101 | Ga0105247_10117745 | Ga0105247_101177452 | 144 |
| 706 | 3300009101 | Ga0105247_10470091 | Ga0105247_104700912 | 144 |
| 707 | 3300009147 | Ga0114129_10083416 | Ga0114129_100834166 | 144 |
| 708 | 3300009147 | Ga0114129_10092035 | Ga0114129_100920355 | 144 |
| 709 | 3300009147 | Ga0114129_10248507 | Ga0114129_102485072 | 144 |
| 710 | 3300009174 | Ga0105241_10429941 | Ga0105241_104299412 | 144 |
| 711 | 3300009174 | Ga0105241_10992828 | Ga0105241_109928281 | 144 |
| 712 | 3300009176 | Ga0105242_10270438 | Ga0105242_102704382 | 144 |
| 713 | 3300010375 | Ga0105239_10096716 | Ga0105239_100967163 | 144 |
| 714 | 3300010375 | Ga0105239_10121682 | Ga0105239_101216824 | 144 |
| 715 | 3300010375 | Ga0105239_10367401 | Ga0105239_103674012 | 144 |
| 716 | 3300011119 | Ga0105246_10043793 | Ga0105246_100437932 | 144 |
| 717 | 3300011119 | Ga0105246_10455871 | Ga0105246_104558712 | 144 |
| 718 | 3300011119 | Ga0105246_11814452 | Ga0105246_118144521 | 144 |
| 719 | 3300013297 | Ga0157378_10919350 | Ga0157378_109193502 | 144 |
| 720 | 3300013297 | Ga0157378_11296527 | Ga0157378_112965271 | 144 |
| 721 | 3300013308 | Ga0157375_10007761 | Ga0157375_100077617 | 144 |
| 722 | 3300014325 | Ga0163163_10043637 | Ga0163163_100436374 | 144 |
| 723 | 3300014325 | Ga0163163_10050450 | Ga0163163_100504502 | 144 |
| 724 | 3300014325 | Ga0163163_10220411 | Ga0163163_102204112 | 144 |
| 725 | 3300014326 | Ga0157380_10186027 | Ga0157380_101860272 | 144 |
| 726 | 3300014745 | Ga0157377_10001603 | Ga0157377_1000160312 | 144 |
| 727 | 3300014968 | Ga0157379_10471191 | Ga0157379_104711912 | 144 |
| 728 | 3300014968 | Ga0157379_10673187 | Ga0157379_106731872 | 144 |
| 729 | 3300014968 | Ga0157379_10878566 | Ga0157379_108785662 | 144 |
| 730 | 3300014969 | Ga0157376_10042796 | Ga0157376_100427962 | 144 |
| 731 | 3300017792 | Ga0163161_10081304 | Ga0163161_100813043 | 144 |
| 732 | 3300025315 | Ga0207697_10048666 | Ga0207697_100486662 | 144 |
| 733 | 3300025893 | Ga0207682_10061155 | Ga0207682_100611552 | 144 |
| 734 | 3300025898 | Ga0207692_10066259 | Ga0207692_100662592 | 144 |
| 735 | 3300025898 | Ga0207692_10144451 | Ga0207692_101444512 | 144 |
| 736 | 3300025900 | Ga0207710_10007582 | Ga0207710_100075824 | 144 |
| 737 | 3300025901 | Ga0207688_10010927 | Ga0207688_100109271 | 144 |
| 738 | 3300025903 | Ga0207680_10683396 | Ga0207680_106833962 | 144 |
| 739 | 3300025904 | Ga0207647_10021711 | Ga0207647_100217113 | 144 |
| 740 | 3300025905 | Ga0207685_10048614 | Ga0207685_100486142 | 144 |
| 741 | 3300025905 | Ga0207685_10092801 | Ga0207685_100928012 | 144 |
| 742 | 3300025906 | Ga0207699_10005995 | Ga0207699_100059955 | 144 |
| 743 | 3300025907 | Ga0207645_10171296 | Ga0207645_101712962 | 144 |
| 744 | 3300025911 | Ga0207654_10976915 | Ga0207654_109769151 | 144 |
| 745 | 3300025912 | Ga0207707_11567233 | Ga0207707_115672331 | 144 |
| 746 | 3300025914 | Ga0207671_10173312 | Ga0207671_101733122 | 144 |
| 747 | 3300025915 | Ga0207693_10018656 | Ga0207693_100186562 | 144 |
| 748 | 3300025915 | Ga0207693_10027985 | Ga0207693_100279853 | 144 |
| 749 | 3300025915 | Ga0207693_10236545 | Ga0207693_102365452 | 144 |
| 750 | 3300025916 | Ga0207663_10092111 | Ga0207663_100921112 | 144 |
| 751 | 3300025916 | Ga0207663_10338868 | Ga0207663_103388682 | 144 |
| 752 | 3300025916 | Ga0207663_10504366 | Ga0207663_105043662 | 144 |
| 753 | 3300025918 | Ga0207662_10000683 | Ga0207662_1000068312 | 144 |
| 754 | 3300025919 | Ga0207657_10036554 | Ga0207657_100365542 | 144 |
| 755 | 3300025920 | Ga0207649_10459430 | Ga0207649_104594302 | 144 |
| 756 | 3300025920 | Ga0207649_10617199 | Ga0207649_106171991 | 144 |
| 757 | 3300025924 | Ga0207694_10179522 | Ga0207694_101795221 | 144 |
| 758 | 3300025925 | Ga0207650_10010954 | Ga0207650_100109545 | 144 |
| 759 | 3300025925 | Ga0207650_10043647 | Ga0207650_100436472 | 144 |
| 760 | 3300025925 | Ga0207650_10048048 | Ga0207650_100480482 | 144 |
| 761 | 3300025927 | Ga0207687_10046021 | Ga0207687_100460213 | 144 |
| 762 | 3300025927 | Ga0207687_10138493 | Ga0207687_101384932 | 144 |
| 763 | 3300025928 | Ga0207700_10144285 | Ga0207700_101442853 | 144 |
| 764 | 3300025928 | Ga0207700_10183173 | Ga0207700_101831732 | 144 |
| 765 | 3300025928 | Ga0207700_10384630 | Ga0207700_103846302 | 144 |
| 766 | 3300025929 | Ga0207664_10044723 | Ga0207664_100447232 | 144 |
| 767 | 3300025931 | Ga0207644_10033822 | Ga0207644_100338223 | 144 |
| 768 | 3300025932 | Ga0207690_10628302 | Ga0207690_106283022 | 144 |
| 769 | 3300025932 | Ga0207690_10718205 | Ga0207690_107182051 | 144 |
| 770 | 3300025933 | Ga0207706_10002966 | Ga0207706_1000296624 | 144 |
| 771 | 3300025936 | Ga0207670_10048420 | Ga0207670_100484203 | 144 |
| 772 | 3300025938 | Ga0207704_11048208 | Ga0207704_110482081 | 144 |
| 773 | 3300025939 | Ga0207665_10333192 | Ga0207665_103331922 | 144 |
| 774 | 3300025940 | Ga0207691_10003332 | Ga0207691_100033326 | 144 |
| 775 | 3300025940 | Ga0207691_10087732 | Ga0207691_100877324 | 144 |
| 776 | 3300025942 | Ga0207689_10008393 | Ga0207689_100083939 | 144 |
| 777 | 3300025944 | Ga0207661_10119254 | Ga0207661_101192543 | 144 |
| 778 | 3300025945 | Ga0207679_10034779 | Ga0207679_100347791 | 144 |
| 779 | 3300025960 | Ga0207651_10011035 | Ga0207651_100110352 | 144 |
| 780 | 3300025960 | Ga0207651_10094608 | Ga0207651_100946082 | 144 |
| 781 | 3300025972 | Ga0207668_10240443 | Ga0207668_102404432 | 144 |
| 782 | 3300025981 | Ga0207640_11861848 | Ga0207640_118618481 | 144 |
| 783 | 3300025981 | Ga0207640_11940351 | Ga0207640_119403511 | 144 |
| 784 | 3300025986 | Ga0207658_10030585 | Ga0207658_100305852 | 144 |
| 785 | 3300026035 | Ga0207703_10155281 | Ga0207703_101552811 | 144 |
| 786 | 3300026075 | Ga0207708_10030330 | Ga0207708_100303303 | 144 |
| 787 | 3300026078 | Ga0207702_10046706 | Ga0207702_100467062 | 144 |
| 788 | 3300026078 | Ga0207702_11598250 | Ga0207702_115982501 | 144 |
| 789 | 3300026088 | Ga0207641_10058736 | Ga0207641_100587364 | 144 |
| 790 | 3300026089 | Ga0207648_10011288 | Ga0207648_100112888 | 144 |
| 791 | 3300026095 | Ga0207676_10035850 | Ga0207676_100358503 | 144 |
| 792 | 3300026118 | Ga0207675_100003007 | Ga0207675_10000300711 | 144 |
| 793 | 3300026121 | Ga0207683_10015654 | Ga0207683_100156547 | 144 |
| 794 | 3300026142 | Ga0207698_10016350 | Ga0207698_100163504 | 144 |
| 795 | 3300028379 | Ga0268266_10057954 | Ga0268266_100579542 | 144 |
| 796 | 3300028379 | Ga0268266_11383439 | Ga0268266_113834391 | 144 |
| 797 | 3300028380 | Ga0268265_10277735 | Ga0268265_102777352 | 144 |
| 798 | 3300028381 | Ga0268264_10179743 | Ga0268264_101797432 | 144 |
| 799 | 3300031995 | Ga0307409_102383047 | Ga0307409_1023830471 | 144 |
| 800 | 3300035083 | Ga0373926_0114711 | Ga0373926_0114711_20_454 | 144 |
| 801 | 3300035086 | Ga0373934_0171807 | Ga0373934_0171807_138_572 | 144 |
| 802 | 3300035089 | Ga0373944_0030910 | Ga0373944_0030910_782_1216 | 144 |
| 803 | 3300035113 | Ga0373936_0106729 | Ga0373936_0106729_256_690 | 144 |
| 804 | 3300035114 | Ga0373939_0168225 | Ga0373939_0168225_297_731 | 144 |
| 805 | 3300035116 | Ga0373945_0007787 | Ga0373945_0007787_308_742 | 144 |
| 806 | 3300035116 | Ga0373945_0041830 | Ga0373945_0041830_315_749 | 144 |
| 807 | 3300035116 | Ga0373945_0080941 | Ga0373945_0080941_219_653 | 144 |
| 808 | 3300035119 | Ga0373956_0293869 | Ga0373956_0293869_275_709 | 144 |
| 809 | 3300035121 | Ga0373960_0294452 | Ga0373960_0294452_120_554 | 144 |
| 810 | 3300035170 | Ga0373943_0014346 | Ga0373943_0014346_2088_2522 | 144 |
| 811 | 3300035170 | Ga0373943_0050131 | Ga0373943_0050131_1049_1483 | 144 |
| 812 | 3300035170 | Ga0373943_0171044 | Ga0373943_0171044_60_494 | 144 |
| 813 | 3300035171 | Ga0373946_0027523 | Ga0373946_0027523_1636_2070 | 144 |
| 814 | 3300035171 | Ga0373946_0062117 | Ga0373946_0062117_479_913 | 144 |
| 815 | 3300035172 | Ga0373955_0549293 | Ga0373955_0549293_203_637 | 144 |
| 816 | 3300035241 | Ga0373961_0160078 | Ga0373961_0160078_21_455 | 144 |
| 817 | 3300035410 | Ga0373924_0197979 | Ga0373924_0197979_92_526 | 144 |
| 818 | 3300035691 | Ga0373931_0080324 | Ga0373931_0080324_633_1067 | 144 |
| 819 | 3300035691 | Ga0373931_0200857 | Ga0373931_0200857_682_1116 | 144 |
| 820 | 3300035692 | Ga0373935_0006630 | Ga0373935_0006630_2927_3361 | 144 |
| 821 | 3300035692 | Ga0373935_0054795 | Ga0373935_0054795_1794_2228 | 144 |
| 822 | 3300035692 | Ga0373935_0091399 | Ga0373935_0091399_590_1024 | 144 |
| 823 | 3300035692 | Ga0373935_0237512 | Ga0373935_0237512_590_1024 | 144 |
| 824 | 3300035695 | Ga0373927_0037358 | Ga0373927_0037358_1674_2108 | 144 |
| 825 | 3300035695 | Ga0373927_0043686 | Ga0373927_0043686_760_1194 | 144 |
| 826 | 3300035695 | Ga0373927_0049295 | Ga0373927_0049295_1427_1861 | 144 |
| 827 | 3300035695 | Ga0373927_0171364 | Ga0373927_0171364_88_522 | 144 |
| 828 | 3300035725 | Ga0373947_0000633 | Ga0373947_0000633_1049_1483 | 144 |
| 829 | 3300035725 | Ga0373947_0011503 | Ga0373947_0011503_3814_4248 | 144 |
| 830 | 3300035725 | Ga0373947_0040714 | Ga0373947_0040714_227_661 | 144 |
| 831 | 3300037068 | Ga0373925_0007434 | Ga0373925_0007434_1721_2155 | 144 |
| 832 | 3300037068 | Ga0373925_0053531 | Ga0373925_0053531_1754_2188 | 144 |
| 833 | 3300037068 | Ga0373925_0090548 | Ga0373925_0090548_251_685 | 144 |
| 834 | 3300037418 | Ga0395900_0352109 | Ga0395900_0352109_673_1107 | 144 |
| 835 | 3300037418 | Ga0395900_1833653 | Ga0395900_1833653_42_476 | 144 |
| 836 | 3300038443 | Ga0395901_0160734 | Ga0395901_0160734_1612_2046 | 144 |
| 837 | 3300038443 | Ga0395901_0808769 | Ga0395901_0808769_302_736 | 144 |
| 838 | 3300039450 | Ga0436363_1509191 | Ga0436363_1509191_1682_2116 | 144 |
| 839 | 3300041501 | Ga0451845_0368984 | Ga0451845_0368984_11_445 | 144 |
| 840 | 3300046452 | Ga0495617_078200 | Ga0495617_078200_429_863 | 144 |
| 841 | 3300046454 | Ga0495592_0211814 | Ga0495592_0211814_40_474 | 144 |
| 842 | 3300046455 | Ga0495603_0010786 | Ga0495603_0010786_1634_2068 | 144 |
| 843 | 3300046455 | Ga0495603_0112616 | Ga0495603_0112616_852_1286 | 144 |
| 844 | 3300046459 | Ga0495629_0031003 | Ga0495629_0031003_2144_2578 | 144 |
| 845 | 3300046459 | Ga0495629_0239737 | Ga0495629_0239737_376_810 | 144 |
| 846 | 3300046459 | Ga0495629_0294172 | Ga0495629_0294172_384_818 | 144 |
| 847 | 3300046461 | Ga0495641_0088498 | Ga0495641_0088498_575_1009 | 144 |
| 848 | 3300046463 | Ga0495653_0031575 | Ga0495653_0031575_1618_2052 | 144 |
| 849 | 3300046472 | Ga0495580_0069341 | Ga0495580_0069341_1227_1661 | 144 |
| 850 | 3300046472 | Ga0495580_0114226 | Ga0495580_0114226_700_1134 | 144 |
| 851 | 3300046473 | Ga0495582_0085444 | Ga0495582_0085444_327_761 | 144 |
| 852 | 3300046474 | Ga0495605_0122840 | Ga0495605_0122840_604_1038 | 144 |
| 853 | 3300046475 | Ga0495639_0022143 | Ga0495639_0022143_1717_2151 | 144 |
| 854 | 3300046475 | Ga0495639_0091143 | Ga0495639_0091143_753_1187 | 144 |
| 855 | 3300046475 | Ga0495639_0110314 | Ga0495639_0110314_665_1099 | 144 |
| 856 | 3300046476 | Ga0495662_0004886 | Ga0495662_0004886_3929_4363 | 144 |
| 857 | 3300046476 | Ga0495662_0037859 | Ga0495662_0037859_1196_1630 | 144 |
| 858 | 3300046477 | Ga0495664_0001699 | Ga0495664_0001699_4864_5298 | 144 |
| 859 | 3300046491 | Ga0495584_0026134 | Ga0495584_0026134_1834_2268 | 144 |
| 860 | 3300046491 | Ga0495584_0062527 | Ga0495584_0062527_1404_1838 | 144 |
| 861 | 3300046492 | Ga0495585_0024577 | Ga0495585_0024577_1203_1637 | 144 |
| 862 | 3300046499 | Ga0495594_0012384 | Ga0495594_0012384_3637_4071 | 144 |
| 863 | 3300046499 | Ga0495594_0552735 | Ga0495594_0552735_179_613 | 144 |
| 864 | 3300046500 | Ga0495596_0380556 | Ga0495596_0380556_10_444 | 144 |
| 865 | 3300046501 | Ga0495607_0050530 | Ga0495607_0050530_1483_1917 | 144 |
| 866 | 3300046501 | Ga0495607_0242725 | Ga0495607_0242725_359_793 | 144 |
| 867 | 3300046514 | Ga0495618_0007630 | Ga0495618_0007630_1258_1692 | 144 |
| 868 | 3300046514 | Ga0495618_0252297 | Ga0495618_0252297_446_880 | 144 |
| 869 | 3300046516 | Ga0495628_0357439 | Ga0495628_0357439_228_662 | 144 |
| 870 | 3300046517 | Ga0495630_0010798 | Ga0495630_0010798_1406_1840 | 144 |
| 871 | 3300046517 | Ga0495630_0067408 | Ga0495630_0067408_647_1081 | 144 |
| 872 | 3300046517 | Ga0495630_0693374 | Ga0495630_0693374_263_697 | 144 |
| 873 | 3300046518 | Ga0495631_0015770 | Ga0495631_0015770_740_1174 | 144 |
| 874 | 3300046523 | Ga0495644_0011541 | Ga0495644_0011541_713_1147 | 144 |
| 875 | 3300046525 | Ga0495663_0015967 | Ga0495663_0015967_528_962 | 144 |
| 876 | 3300046526 | Ga0495666_0244274 | Ga0495666_0244274_208_642 | 144 |
| 877 | 3300046529 | Ga0495652_0221140 | Ga0495652_0221140_406_840 | 144 |
| 878 | 3300046530 | Ga0495654_0163164 | Ga0495654_0163164_518_952 | 144 |
| 879 | 3300046531 | Ga0495665_0035820 | Ga0495665_0035820_553_987 | 144 |
| 880 | 3300046531 | Ga0495665_0147125 | Ga0495665_0147125_773_1207 | 144 |
| 881 | 3300046531 | Ga0495665_0162785 | Ga0495665_0162785_263_697 | 144 |
| 882 | 3300046533 | Ga0495640_0000385 | Ga0495640_0000385_853_1287 | 144 |
| 883 | 3300046533 | Ga0495640_0175170 | Ga0495640_0175170_806_1240 | 144 |
| 884 | 3300046537 | Ga0495598_0004029 | Ga0495598_0004029_1525_1959 | 144 |
| 885 | 3300046538 | Ga0495609_0038054 | Ga0495609_0038054_724_1158 | 144 |
| 886 | 3300046539 | Ga0495621_0005293 | Ga0495621_0005293_2098_2532 | 144 |
| 887 | 3300046543 | Ga0495645_0253438 | Ga0495645_0253438_37_471 | 144 |
| 888 | 3300046559 | Ga0495667_0539930 | Ga0495667_0539930_264_698 | 144 |
| 889 | 3300046615 | Ga0495656_0001605 | Ga0495656_0001605_5165_5599 | 144 |
| 890 | 3300046615 | Ga0495656_0152103 | Ga0495656_0152103_644_1078 | 144 |
| 891 | 3300046616 | Ga0495668_0466225 | Ga0495668_0466225_72_506 | 144 |
| 892 | 3300046616 | Ga0495668_0586700 | Ga0495668_0586700_122_556 | 144 |
| 893 | 3300046642 | Ga0495634_0001491 | Ga0495634_0001491_932_1366 | 144 |
| 894 | 3300046642 | Ga0495634_0025557 | Ga0495634_0025557_1571_2005 | 144 |
| 895 | 3300046642 | Ga0495634_0071769 | Ga0495634_0071769_1250_1684 | 144 |
| 896 | 3300046642 | Ga0495634_0284262 | Ga0495634_0284262_367_801 | 144 |
| 897 | 3300046663 | Ga0495635_0035056 | Ga0495635_0035056_2065_2499 | 144 |
| 898 | 3300046663 | Ga0495635_0113870 | Ga0495635_0113870_757_1191 | 144 |
| 899 | 3300046664 | Ga0495659_0172206 | Ga0495659_0172206_378_812 | 144 |
| 900 | 3300046664 | Ga0495659_0346453 | Ga0495659_0346453_100_534 | 144 |
| 901 | 3300046665 | Ga0495661_0088488 | Ga0495661_0088488_907_1341 | 144 |
| 902 | 3300046674 | Ga0495588_0208708 | Ga0495588_0208708_373_807 | 144 |
| 903 | 3300046678 | Ga0495599_0328331 | Ga0495599_0328331_103_537 | 144 |
| 904 | 3300046680 | Ga0495646_0041999 | Ga0495646_0041999_863_1297 | 144 |
| 905 | 3300046681 | Ga0495647_0010689 | Ga0495647_0010689_1064_1498 | 144 |
| 906 | 3300046683 | Ga0495658_0107141 | Ga0495658_0107141_593_1027 | 144 |
| 907 | 3300046683 | Ga0495658_0928818 | Ga0495658_0928818_92_526 | 144 |
| 908 | 3300046684 | Ga0495669_0223430 | Ga0495669_0223430_253_687 | 144 |
| 909 | 3300046689 | Ga0495613_0042111 | Ga0495613_0042111_2453_2887 | 144 |
| 910 | 3300046689 | Ga0495613_0073452 | Ga0495613_0073452_1910_2344 | 144 |
| 911 | 3300046689 | Ga0495613_0239057 | Ga0495613_0239057_111_545 | 144 |
| 912 | 3300046690 | Ga0495624_0021720 | Ga0495624_0021720_1312_1746 | 144 |
| 913 | 3300046690 | Ga0495624_0045694 | Ga0495624_0045694_685_1119 | 144 |
| 914 | 3300046690 | Ga0495624_0066226 | Ga0495624_0066226_1720_2154 | 144 |
| 915 | 3300046690 | Ga0495624_0302694 | Ga0495624_0302694_381_815 | 144 |
| 916 | 3300046692 | Ga0495671_0059860 | Ga0495671_0059860_1186_1620 | 144 |
| 917 | 3300046692 | Ga0495671_0272001 | Ga0495671_0272001_280_714 | 144 |
| 918 | 3300046694 | Ga0495649_0129597 | Ga0495649_0129597_602_1036 | 144 |
| 919 | 3300046794 | Ga0495589_0032938 | Ga0495589_0032938_908_1342 | 144 |
| 920 | 3300047315 | Ga0495581_0053605 | Ga0495581_0053605_1402_1836 | 144 |
| 921 | 3300047315 | Ga0495581_0143063 | Ga0495581_0143063_803_1237 | 144 |
| 922 | 3300047315 | Ga0495581_0170366 | Ga0495581_0170366_451_885 | 144 |
| 923 | 3300047315 | Ga0495581_0218811 | Ga0495581_0218811_526_960 | 144 |
| 924 | 3300047317 | Ga0495604_0263671 | Ga0495604_0263671_212_646 | 144 |
| 925 | 3300047319 | Ga0495674_0001453 | Ga0495674_0001453_13290_13724 | 144 |
| 926 | 3300047319 | Ga0495674_0203361 | Ga0495674_0203361_1025_1459 | 144 |
| 927 | 3300047319 | Ga0495674_0264834 | Ga0495674_0264834_109_543 | 144 |
| 928 | 3300047319 | Ga0495674_1036281 | Ga0495674_1036281_74_508 | 144 |
| 929 | 3300047321 | Ga0495676_0135025 | Ga0495676_0135025_863_1297 | 144 |
| 930 | 3300047322 | Ga0495680_0658204 | Ga0495680_0658204_27_461 | 144 |
| 931 | 3300047446 | Ga0495679_018436 | Ga0495679_018436_1907_2341 | 144 |
| 932 | 3300047471 | Ga0495684_0027908 | Ga0495684_0027908_3077_3511 | 144 |
| 933 | 3300047471 | Ga0495684_0042044 | Ga0495684_0042044_934_1368 | 144 |
| 934 | 3300047471 | Ga0495684_0083851 | Ga0495684_0083851_882_1316 | 144 |
| 935 | 3300047472 | Ga0495686_0315391 | Ga0495686_0315391_73_507 | 144 |
| 936 | 3300047673 | Ga0495593_0046845 | Ga0495593_0046845_262_696 | 144 |
| 937 | 3300047673 | Ga0495593_0109761 | Ga0495593_0109761_372_806 | 144 |
| 938 | 3300048903 | Ga0496100_0006135 | Ga0496100_0006135_2552_2986 | 144 |
| 939 | 3300048903 | Ga0496100_0045424 | Ga0496100_0045424_1655_2095 | 144 |
| 940 | 3300048903 | Ga0496100_0090321 | Ga0496100_0090321_738_1172 | 144 |
| 941 | 3300048904 | Ga0496101_0003597 | Ga0496101_0003597_237_677 | 144 |
| 942 | 3300048904 | Ga0496101_0019747 | Ga0496101_0019747_1669_2103 | 144 |
| 943 | 3300048904 | Ga0496101_0137179 | Ga0496101_0137179_788_1222 | 144 |
| 944 | 3300048904 | Ga0496101_0269956 | Ga0496101_0269956_551_985 | 144 |
| 945 | 3300048904 | Ga0496101_0393828 | Ga0496101_0393828_270_704 | 144 |
| 946 | 3300048905 | Ga0496102_0001868 | Ga0496102_0001868_3086_3526 | 144 |
| 947 | 3300048905 | Ga0496102_0042907 | Ga0496102_0042907_2067_2501 | 144 |
| 948 | 3300048905 | Ga0496102_0055582 | Ga0496102_0055582_2401_2835 | 144 |
| 949 | 3300048905 | Ga0496102_0610837 | Ga0496102_0610837_275_709 | 144 |
| 950 | 3300048905 | Ga0496102_1304300 | Ga0496102_1304300_136_570 | 144 |
| 951 | 3300048906 | Ga0496103_0004036 | Ga0496103_0004036_2181_2615 | 144 |
| 952 | 3300048906 | Ga0496103_0005701 | Ga0496103_0005701_5830_6264 | 144 |
| 953 | 3300048906 | Ga0496103_0014953 | Ga0496103_0014953_48_488 | 144 |
| 954 | 3300048907 | Ga0496104_0001826 | Ga0496104_0001826_16330_16770 | 144 |
| 955 | 3300048907 | Ga0496104_0002521 | Ga0496104_0002521_13391_13825 | 144 |
| 956 | 3300048907 | Ga0496104_0041724 | Ga0496104_0041724_35_469 | 144 |
| 957 | 3300048907 | Ga0496104_0408852 | Ga0496104_0408852_100_540 | 144 |
| 958 | 3300048908 | Ga0496105_0013712 | Ga0496105_0013712_1826_2260 | 144 |
| 959 | 3300048908 | Ga0496105_0023389 | Ga0496105_0023389_870_1304 | 144 |
| 960 | 3300048908 | Ga0496105_0053612 | Ga0496105_0053612_2013_2453 | 144 |
| 961 | 3300048908 | Ga0496105_0957933 | Ga0496105_0957933_175_609 | 144 |
| 962 | 3300048909 | Ga0496106_0001110 | Ga0496106_0001110_9771_10211 | 144 |
| 963 | 3300048909 | Ga0496106_0013846 | Ga0496106_0013846_1319_1753 | 144 |
| 964 | 3300048909 | Ga0496106_0023515 | Ga0496106_0023515_1749_2183 | 144 |
| 965 | 3300048909 | Ga0496106_0197365 | Ga0496106_0197365_646_1080 | 144 |
| 966 | 3300048909 | Ga0496106_0460554 | Ga0496106_0460554_248_682 | 144 |
| 967 | 3300048909 | Ga0496106_1201358 | Ga0496106_1201358_42_482 | 144 |
| 968 | 3300048910 | Ga0496107_0010686 | Ga0496107_0010686_2399_2833 | 144 |
| 969 | 3300048910 | Ga0496107_0017863 | Ga0496107_0017863_3326_3766 | 144 |
| 970 | 3300048910 | Ga0496107_0032302 | Ga0496107_0032302_2085_2519 | 144 |
| 971 | 3300048911 | Ga0496108_0004403 | Ga0496108_0004403_2839_3279 | 144 |
| 972 | 3300048911 | Ga0496108_0017165 | Ga0496108_0017165_1270_1710 | 144 |
| 973 | 3300048911 | Ga0496108_0018358 | Ga0496108_0018358_2864_3298 | 144 |
| 974 | 3300048911 | Ga0496108_0185967 | Ga0496108_0185967_307_741 | 144 |
| 975 | 3300048911 | Ga0496108_1733377 | Ga0496108_1733377_30_464 | 144 |
| 976 | 3300048912 | Ga0496109_0005037 | Ga0496109_0005037_6663_7097 | 144 |
| 977 | 3300048912 | Ga0496109_0005827 | Ga0496109_0005827_3223_3663 | 144 |
| 978 | 3300048912 | Ga0496109_0006780 | Ga0496109_0006780_6229_6663 | 144 |
| 979 | 3300048912 | Ga0496109_0545945 | Ga0496109_0545945_554_988 | 144 |
| 980 | 3300048913 | Ga0496110_0005009 | Ga0496110_0005009_3021_3461 | 144 |
| 981 | 3300048913 | Ga0496110_0010524 | Ga0496110_0010524_1213_1647 | 144 |
| 982 | 3300048913 | Ga0496110_0025880 | Ga0496110_0025880_1652_2086 | 144 |
| 983 | 3300048913 | Ga0496110_0076837 | Ga0496110_0076837_2508_2948 | 144 |
| 984 | 3300048913 | Ga0496110_0808728 | Ga0496110_0808728_17_451 | 144 |
| 985 | 3300048913 | Ga0496110_0899106 | Ga0496110_0899106_55_489 | 144 |
| 986 | 3300048914 | Ga0496111_0003448 | Ga0496111_0003448_1193_1633 | 144 |
| 987 | 3300048914 | Ga0496111_0006735 | Ga0496111_0006735_6386_6820 | 144 |
| 988 | 3300048914 | Ga0496111_0013724 | Ga0496111_0013724_1165_1605 | 144 |
| 989 | 3300048914 | Ga0496111_0214300 | Ga0496111_0214300_870_1304 | 144 |
| 990 | 3300048915 | Ga0496112_0002152 | Ga0496112_0002152_10795_11229 | 144 |
| 991 | 3300048915 | Ga0496112_0005896 | Ga0496112_0005896_5885_6325 | 144 |
| 992 | 3300048915 | Ga0496112_0086402 | Ga0496112_0086402_140_580 | 144 |
| 993 | 3300048915 | Ga0496112_0350600 | Ga0496112_0350600_542_976 | 144 |
| 994 | 3300048916 | Ga0496113_0017380 | Ga0496113_0017380_1965_2399 | 144 |
| 995 | 3300048916 | Ga0496113_0103780 | Ga0496113_0103780_307_747 | 144 |
| 996 | 3300048916 | Ga0496113_0122220 | Ga0496113_0122220_528_962 | 144 |
| 997 | 3300048917 | Ga0496114_0011857 | Ga0496114_0011857_617_1057 | 144 |
| 998 | 3300048917 | Ga0496114_0658927 | Ga0496114_0658927_247_681 | 144 |
| 999 | 3300048918 | Ga0496115_0038794 | Ga0496115_0038794_796_1230 | 144 |
| 1000 | 3300048918 | Ga0496115_0059777 | Ga0496115_0059777_1031_1471 | 144 |
| 1001 | 3300048918 | Ga0496115_0060309 | Ga0496115_0060309_2034_2468 | 144 |
| 1002 | 3300048918 | Ga0496115_0279137 | Ga0496115_0279137_401_835 | 144 |
| 1003 | 3300048918 | Ga0496115_0432183 | Ga0496115_0432183_346_780 | 144 |
| 1004 | 3300049582 | Ga0501048_0199921 | Ga0501048_0199921_853_1287 | 144 |
| 1005 | 3300049582 | Ga0501048_1244655 | Ga0501048_1244655_58_492 | 144 |
| 1006 | 3300049584 | Ga0501068_1114750 | Ga0501068_1114750_10_444 | 144 |
| 1007 | 3300049592 | Ga0501076_0488686 | Ga0501076_0488686_344_778 | 144 |
| 1008 | 3300049593 | Ga0501077_0074021 | Ga0501077_0074021_643_1077 | 144 |
| 1009 | 3300049742 | Ga0501080_0272607 | Ga0501080_0272607_700_1134 | 144 |
| 1010 | 3300049824 | Ga0501045_0462192 | Ga0501045_0462192_376_810 | 144 |
| 1011 | 3300050491 | nmdc:mga00v17_161190_c1 | nmdc:mga00v17_161190_c1_73_507 | 144 |
| 1012 | 3300050492 | nmdc:mga0yw44_140149_c1 | nmdc:mga0yw44_140149_c1_357_791 | 144 |
| 1013 | 3300050492 | nmdc:mga0yw44_14958_c1 | nmdc:mga0yw44_14958_c1_2517_2951 | 144 |
| 1014 | 3300050492 | nmdc:mga0yw44_20287_c1 | nmdc:mga0yw44_20287_c1_2129_2563 | 144 |
| 1015 | 3300050493 | nmdc:mga0k408_732559_c1 | nmdc:mga0k408_732559_c1_81_515 | 144 |
| 1016 | 3300050494 | nmdc:mga06z11_60447_c1 | nmdc:mga06z11_60447_c1_108_542 | 144 |
| 1017 | 3300050495 | nmdc:mga04h51_25337_c1 | nmdc:mga04h51_25337_c1_713_1147 | 144 |
| 1018 | 3300050496 | nmdc:mga07m45_342976_c1 | nmdc:mga07m45_342976_c1_386_820 | 144 |
| 1019 | 3300050507 | nmdc:mga05p37_14706_c1 | nmdc:mga05p37_14706_c1_158_592 | 144 |
| 1020 | 3300050507 | nmdc:mga05p37_196486_c1 | nmdc:mga05p37_196486_c1_1157_1591 | 144 |
| 1021 | 3300050507 | nmdc:mga05p37_8226_c1 | nmdc:mga05p37_8226_c1_1352_1786 | 144 |
| 1022 | 3300050508 | nmdc:mga09592_758794_c1 | nmdc:mga09592_758794_c1_87_521 | 144 |
| 1023 | 3300050508 | nmdc:mga09592_8971_c1 | nmdc:mga09592_8971_c1_5131_5565 | 144 |
| 1024 | 3300050509 | nmdc:mga0qj67_1019591_c1 | nmdc:mga0qj67_1019591_c1_20_454 | 144 |
| 1025 | 3300050509 | nmdc:mga0qj67_12270_c1 | nmdc:mga0qj67_12270_c1_5737_6171 | 144 |
| 1026 | 3300050510 | nmdc:mga06r32_16932_c1 | nmdc:mga06r32_16932_c1_5129_5563 | 144 |
| 1027 | 3300050510 | nmdc:mga06r32_433662_c1 | nmdc:mga06r32_433662_c1_228_662 | 144 |
| 1028 | 3300050510 | nmdc:mga06r32_87514_c1 | nmdc:mga06r32_87514_c1_81_515 | 144 |
| 1029 | 3300050511 | nmdc:mga08y16_60080_c1 | nmdc:mga08y16_60080_c1_3375_3809 | 144 |
| 1030 | 3300050512 | nmdc:mga0n895_1377163_c1 | nmdc:mga0n895_1377163_c1_140_574 | 144 |
| 1031 | 3300050512 | nmdc:mga0n895_259878_c1 | nmdc:mga0n895_259878_c1_845_1279 | 144 |
| 1032 | 3300050512 | nmdc:mga0n895_284643_c1 | nmdc:mga0n895_284643_c1_1161_1595 | 144 |
| 1033 | 3300050513 | nmdc:mga0rr50_727548_c1 | nmdc:mga0rr50_727548_c1_47_481 | 144 |
| 1034 | 3300050514 | nmdc:mga08x19_533270_c1 | nmdc:mga08x19_533270_c1_19_453 | 144 |
| 1035 | 3300050515 | nmdc:mga0a205_1173733_c1 | nmdc:mga0a205_1173733_c1_138_572 | 144 |
| 1036 | 3300053077 | Ga0495601_0408841 | Ga0495601_0408841_70_504 | 144 |
| 1037 | 3300053078 | Ga0495612_0010224 | Ga0495612_0010224_825_1259 | 144 |
| 1038 | 3300053083 | Ga0495655_0025243 | Ga0495655_0025243_66_500 | 144 |
| 1039 | 3300053083 | Ga0495655_0101535 | Ga0495655_0101535_183_617 | 144 |
| 1040 | 3300053085 | Ga0495619_0045969 | Ga0495619_0045969_814_1248 | 144 |
| 1041 | 3300053085 | Ga0495619_0179612 | Ga0495619_0179612_799_1233 | 144 |
| 1042 | 3300054114 | Ga0501084_0243069 | Ga0501084_0243069_732_1166 | 144 |
| 1043 | 3300061734 | Ga0530510_0136279 | Ga0530510_0136279_663_1097 | 144 |
| 1044 | 3300061734 | Ga0530510_0383972 | Ga0530510_0383972_188_622 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sfr-assembly1.cif.gz_N | unmethylated mtb ribosome 50s with seq-9 | 0.9819 | 13 | 116 |
| 5xym-assembly1.cif.gz_N | large subunit of mycobacterium smegmatis | 0.9677 | 6 | 116 |
| 4v4p-assembly1.cif.gz_A0 | crystal structure of 70s ribosome with thrs operator and trnas. | 0.955 | 15 | 116 |
| 8cvm-assembly1.cif.gz_m | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9493 | 10 | 119 |
| 7as8-assembly1.cif.gz_R | bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo | 0.9424 | 6 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vt2N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9735 | 13 | 114 | 3.90.1030.10 |
| 5v7qN00 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9661 | 6 | 116 | 3.90.1030.10 |
| 1vs8N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.956 | 13 | 114 | 3.90.1030.10 |
| 1vt2N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9552 | 13 | 114 | 3.90.1030.10 |
| af_Q4DPQ0_51_164_3.90.1030.10 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9525 | 11 | 114 | 3.90.1030.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354B6G4-F1-model_v4 | 50S ribosomal protein L17 | 1.001 | 13 | 88 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A1F9ENG3-F1-model_v4 | 50S ribosomal protein L17 | 1 | 20 | 113 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A545AYL0-F1-model_v4 | Large ribosomal subunit protein bL17 | 0.9942 | 13 | 116 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2E0WCX0-F1-model_v4 | Large ribosomal subunit protein bL17 | 0.9904 | 13 | 116 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A1V5DEQ6-F1-model_v4 | 50S ribosomal protein L17 | 0.9883 | 24 | 116 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar