F488907

General Info

Members Datasets Scaffolds Average Seq Length
1044 502 1031 142

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_11142656|Ga0163162_111426562
Length 158
Sequence MPGTRPGMTKVGKETIVRHAKTHRKFNRRSDHRRSMLANLAASLIKHEQITTTLPKAKDLRPVVEKLVTLGKRGDLHARRQAIAQMRDLAMVKKLFEVIGPRYKDRDGGYLRVLKAGFRYGDSAPVAVIEFVDRDVEAKGKDSGPVQARAEEAAPAAA

Samples

Sample ID Description Type Environment
1 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
2 2643221629 Devosia sp. Root105 Isolate Unclassified
3 2643221662 Devosia sp. Root413D1 Isolate Unclassified
4 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
5 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
6 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
7 2842694124 Methylopila sp. R-72369 Isolate Unclassified
8 2857553236 Duganella sp. R-74557 Isolate Unclassified
9 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
10 2919476304 Duganella sp. 3397 Isolate Unclassified
11 2932401849 Devosia sp. 2618 Isolate Rhizosphere
12 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
13 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
27 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
28 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
125 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
151 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
156 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
157 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
167 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
228 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
229 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
246 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
247 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
248 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
249 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
250 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
264 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
265 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
271 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
275 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
276 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
277 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
278 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
279 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
280 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
281 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
284 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
285 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
286 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
287 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
295 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
302 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
308 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
309 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
310 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
311 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
312 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
313 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
314 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
315 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
316 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
317 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
318 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
319 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
320 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
321 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
322 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
325 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
326 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
327 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
330 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
331 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
332 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
339 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
344 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
345 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
349 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
350 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
351 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
354 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
355 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
356 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
357 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
360 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
361 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
362 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
366 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
367 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
370 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
379 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
380 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
381 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
382 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
383 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
384 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
387 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
394 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
395 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
396 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
397 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
398 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
399 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
400 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
421 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
425 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
443 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
444 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
445 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
446 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
447 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
448 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
456 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
460 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
461 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
462 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
463 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
464 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
465 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
466 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
467 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
468 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
469 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
470 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
471 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
472 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
473 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
474 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
475 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
476 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
477 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
478 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
479 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
480 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
481 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
482 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
483 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
484 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
485 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
486 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
487 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
488 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
489 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
490 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
491 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
501 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
502 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 3.26
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.61
Nodule 0.38
Rhizoplane 8.81
Rhizosphere 80.65
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001137 3300001977 Bacteria 4200
2 JGI24739J22299_10134223 3300001989 Bacteria 735
3 JGI24750J21931_1000826 3300002070 Bacteria 4280
4 JGI24748J21848_1001282 3300002074 Bacteria 2750
5 JGI24738J21930_10018711 3300002075 Bacteria 1447
6 JGI24744J21845_10000833 3300002077 Bacteria 5807
7 JGI24033J26618_1000715 3300002155 Bacteria 3185
8 JGI24034J26672_10000746 3300002239 Bacteria 4200
9 JGI24742J22300_10002192 3300002244 Bacteria 3115
10 JGI25162J39368_1000154 3300002737 Bacteria 75240
11 JGI25164J39214_1018510 3300002772 Bacteria 623
12 JGI25165J46597_1000239 3300003214 Bacteria 75240
13 Ga0007429J51699_1104387 3300003579 Bacteria 516
14 Ga0055538_1000094 3300003751 Bacteria 75240
15 Ga0055539_1000136 3300003752 Bacteria 76284
16 Ga0055533_1000143 3300003756 Bacteria 75240
17 Ga0055525_1000188 3300003759 Bacteria 75240
18 Ga0055524_1000024 3300003775 Bacteria 217953
19 Ga0055531_10002421 3300003794 Bacteria 12498
20 Ga0055541_1000092 3300003841 Bacteria 75240
21 Ga0058860_12217134 3300004801 Bacteria 1295
22 Ga0070658_10052412 3300005327 Bacteria 3309
23 Ga0070658_10154512 3300005327 Bacteria 1923
24 Ga0070658_11116623 3300005327 Bacteria 686
25 Ga0070683_100665716 3300005329 Bacteria 997
26 Ga0070690_100064687 3300005330 Bacteria 2363
27 Ga0070670_100033818 3300005331 Bacteria 4402
28 Ga0070670_100045376 3300005331 Bacteria 3778
29 Ga0070677_10200448 3300005333 Bacteria 963
30 Ga0068869_100104724 3300005334 Bacteria 2145
31 Ga0070666_10114683 3300005335 Bacteria 1866
32 Ga0070666_10423572 3300005335 Bacteria 959
33 Ga0070680_100164388 3300005336 Bacteria 1866
34 Ga0070680_100225381 3300005336 Bacteria 1582
35 Ga0070682_100018452 3300005337 Bacteria 4078
36 Ga0068868_100010692 3300005338 Bacteria 6651
37 Ga0068868_101766949 3300005338 Bacteria 584
38 Ga0070660_100023815 3300005339 Bacteria 4538
39 Ga0070660_100337489 3300005339 Bacteria 1240
40 Ga0070689_100044445 3300005340 Bacteria 3417
41 Ga0070689_100278703 3300005340 Bacteria 1386
42 Ga0070691_10216215 3300005341 Bacteria 1014
43 Ga0070691_10869368 3300005341 Bacteria 554
44 Ga0070687_100142255 3300005343 Bacteria 1398
45 Ga0070687_101529520 3300005343 Bacteria 502
46 Ga0070661_100545081 3300005344 Bacteria 933
47 Ga0070661_101167973 3300005344 Bacteria 643
48 Ga0070668_100043280 3300005347 Bacteria 3453
49 Ga0070668_100276299 3300005347 Bacteria 1402
50 Ga0070668_100520394 3300005347 Bacteria 1032
51 Ga0070669_100078912 3300005353 Bacteria 2448
52 Ga0070675_100004703 3300005354 Bacteria 10420
53 Ga0070675_100487395 3300005354 Bacteria 1109
54 Ga0070675_100890238 3300005354 Bacteria 816
55 Ga0070671_100037107 3300005355 Bacteria 4042
56 Ga0070671_100051674 3300005355 Bacteria 3418
57 Ga0070671_100545240 3300005355 Bacteria 1000
58 Ga0070671_101103474 3300005355 Bacteria 697
59 Ga0070674_100586808 3300005356 Bacteria 940
60 Ga0070674_100918020 3300005356 Bacteria 764
61 Ga0070673_100015193 3300005364 Bacteria 5398
62 Ga0070673_100018429 3300005364 Bacteria 4985
63 Ga0070673_100566972 3300005364 Bacteria 1033
64 Ga0070688_100063947 3300005365 Bacteria 2334
65 Ga0070688_100367264 3300005365 Bacteria 1058
66 Ga0070659_100207122 3300005366 Bacteria 1615
67 Ga0070659_100400392 3300005366 Bacteria 1159
68 Ga0070659_101012334 3300005366 Bacteria 730
69 Ga0070667_100009241 3300005367 Bacteria 8164
70 Ga0070703_10106276 3300005406 Bacteria 997
71 Ga0070709_10015699 3300005434 Bacteria 4313
72 Ga0070709_10226111 3300005434 Bacteria 1337
73 Ga0070714_100024965 3300005435 Bacteria 4928
74 Ga0070714_100599229 3300005435 Bacteria 1058
75 Ga0070714_100979173 3300005435 Bacteria 823
76 Ga0070714_101044381 3300005435 Bacteria 796
77 Ga0070713_100003041 3300005436 Bacteria 11020
78 Ga0070713_100011844 3300005436 Bacteria 6372
79 Ga0070713_100191145 3300005436 Bacteria 1845
80 Ga0070713_100872583 3300005436 Bacteria 865
81 Ga0070710_10082005 3300005437 Bacteria 1885
82 Ga0070710_10346611 3300005437 Bacteria 982
83 Ga0070711_100074713 3300005439 Bacteria 2398
84 Ga0070711_100310705 3300005439 Bacteria 1256
85 Ga0070705_100279873 3300005440 Bacteria 1185
86 Ga0070700_100060003 3300005441 Bacteria 2396
87 Ga0070694_100250827 3300005444 Bacteria 1339
88 Ga0070708_100063487 3300005445 Bacteria 3306
89 Ga0070708_100556604 3300005445 Bacteria 1082
90 Ga0070663_100899446 3300005455 Bacteria 764
91 Ga0070678_100306391 3300005456 Bacteria 1351
92 Ga0070662_100057865 3300005457 Bacteria 2818
93 Ga0070681_10004121 3300005458 Bacteria 13747
94 Ga0070681_10115719 3300005458 Bacteria 2619
95 Ga0070681_10980726 3300005458 Bacteria 765
96 Ga0068867_100268154 3300005459 Bacteria 1395
97 Ga0070685_10020411 3300005466 Bacteria 3584
98 Ga0070706_100187749 3300005467 Bacteria 1931
99 Ga0070707_100006038 3300005468 Bacteria 11310
100 Ga0070698_100086614 3300005471 Bacteria 3119
101 Ga0070699_100003254 3300005518 Bacteria 14368
102 Ga0070699_100644965 3300005518 Bacteria 966
103 Ga0070679_100059322 3300005530 Bacteria 3814
104 Ga0070679_100080701 3300005530 Bacteria 3242
105 Ga0070679_100206200 3300005530 Bacteria 1930
106 Ga0070697_100767954 3300005536 Bacteria 852
107 Ga0068853_100120553 3300005539 Bacteria 2339
108 Ga0068853_100166407 3300005539 Bacteria 1993
109 Ga0070672_100124373 3300005543 Bacteria 2114
110 Ga0070672_100131496 3300005543 Bacteria 2058
111 Ga0070686_100054524 3300005544 Bacteria 2557
112 Ga0070665_101114008 3300005548 Bacteria 801
113 Ga0070665_101975470 3300005548 Bacteria 589
114 Ga0070704_100059469 3300005549 Bacteria 2727
115 Ga0070704_100682280 3300005549 Bacteria 910
116 Ga0068855_100293663 3300005563 Bacteria 1801
117 Ga0070702_100115730 3300005615 Bacteria 1670
118 Ga0070702_100565389 3300005615 Bacteria 847
119 Ga0068852_100393611 3300005616 Bacteria 1362
120 Ga0068859_100021311 3300005617 Bacteria 6503
121 Ga0068864_100023234 3300005618 Bacteria 5204
122 Ga0068864_102305694 3300005618 Bacteria 545
123 Ga0068866_10460426 3300005718 Bacteria 834
124 Ga0068861_100061245 3300005719 Bacteria 2887
125 Ga0068870_10452523 3300005840 Bacteria 847
126 Ga0068863_100017228 3300005841 Bacteria 6929
127 Ga0068863_100251746 3300005841 Bacteria 1706
128 Ga0068858_100053731 3300005842 Bacteria 3725
129 Ga0068858_100511509 3300005842 Bacteria 1161
130 Ga0068860_100108790 3300005843 Bacteria 2649
131 Ga0068862_100030508 3300005844 Bacteria 4545
132 Ga0068862_100535296 3300005844 Bacteria 1117
133 Ga0068862_100680860 3300005844 Bacteria 995
134 Ga0081455_10002425 3300005937 Bacteria 22245
135 Ga0081455_10015627 3300005937 Bacteria 7365
136 Ga0081455_10097760 3300005937 Bacteria 2365
137 Ga0081455_10283150 3300005937 Bacteria 1197
138 Ga0081538_10001041 3300005981 Bacteria 29562
139 Ga0081538_10024942 3300005981 Bacteria 4240
140 Ga0081538_10033225 3300005981 Bacteria 3438
141 Ga0081540_1003020 3300005983 Bacteria 13478
142 Ga0081539_10116951 3300005985 Bacteria 1331
143 Ga0070717_10066346 3300006028 Bacteria 3001
144 Ga0070717_10083481 3300006028 Bacteria 2687
145 Ga0070717_10384655 3300006028 Bacteria 1259
146 Ga0070717_10569423 3300006028 Bacteria 1026
147 Ga0070717_11369757 3300006028 Bacteria 643
148 Ga0075365_10025404 3300006038 Bacteria 3749
149 Ga0075365_10091294 3300006038 Bacteria 2075
150 Ga0075368_10305832 3300006042 Bacteria 687
151 Ga0075363_100438326 3300006048 Bacteria 771
152 Ga0075364_10362453 3300006051 Bacteria 988
153 Ga0075364_10534352 3300006051 Bacteria 801
154 Ga0075364_10956726 3300006051 Bacteria 583
155 Ga0070716_100217271 3300006173 Bacteria 1282
156 Ga0070716_101096905 3300006173 Bacteria 634
157 Ga0070712_100004635 3300006175 Bacteria 8499
158 Ga0070712_100045106 3300006175 Bacteria 3042
159 Ga0070712_100326657 3300006175 Bacteria 1249
160 Ga0075367_10013649 3300006178 Bacteria 4375
161 Ga0075367_10152081 3300006178 Bacteria 1436
162 Ga0075367_10202684 3300006178 Bacteria 1240
163 Ga0075369_10011962 3300006186 Bacteria 3421
164 Ga0075369_10291742 3300006186 Bacteria 761
165 Ga0075427_10032241 3300006194 Bacteria 863
166 Ga0075366_10095293 3300006195 Bacteria 1784
167 Ga0075366_10239679 3300006195 Bacteria 1106
168 Ga0097621_100102942 3300006237 Bacteria 2405
169 Ga0097621_100175675 3300006237 Bacteria 1848
170 Ga0075370_10033357 3300006353 Bacteria 2882
171 Ga0068871_100159329 3300006358 Bacteria 1929
172 Ga0075428_100092978 3300006844 Bacteria 3288
173 Ga0075428_100099017 3300006844 Bacteria 3179
174 Ga0075428_100256103 3300006844 Bacteria 1885
175 Ga0075428_100475503 3300006844 Bacteria 1337
176 Ga0075428_101071610 3300006844 Bacteria 852
177 Ga0075431_100012366 3300006847 Bacteria 8613
178 Ga0075431_100030686 3300006847 Bacteria 5537
179 Ga0075431_100102642 3300006847 Bacteria 2951
180 Ga0075431_100113920 3300006847 Bacteria 2791
181 Ga0075431_101284843 3300006847 Bacteria 693
182 Ga0075433_11332470 3300006852 Bacteria 622
183 Ga0075434_100116288 3300006871 Bacteria 2687
184 Ga0075434_100157899 3300006871 Bacteria 2287
185 Ga0075434_101495489 3300006871 Bacteria 684
186 Ga0075429_100264985 3300006880 Bacteria 1505
187 Ga0075429_100921396 3300006880 Bacteria 764
188 Ga0075429_101122448 3300006880 Bacteria 687
189 Ga0075436_100095184 3300006914 Bacteria 2072
190 Ga0097620_100021311 3300006931 Bacteria 6503
191 Ga0079104_1004902 3300006946 Bacteria 5529
192 Ga0075435_100085297 3300007076 Bacteria 2599
193 Ga0075435_100534415 3300007076 Bacteria 1015
194 Ga0099794_10149209 3300007265 Bacteria 1186
195 Ga0099795_10003005 3300007788 Bacteria 4102
196 Ga0099795_10481088 3300007788 Bacteria 576
197 Ga0105240_10473503 3300009093 Bacteria 1397
198 Ga0105240_11460572 3300009093 Bacteria 718
199 Ga0111539_10359025 3300009094 Bacteria 1696
200 Ga0111539_10407003 3300009094 Bacteria 1585
201 Ga0105245_10097208 3300009098 Bacteria 2719
202 Ga0105245_11112738 3300009098 Bacteria 836
203 Ga0105245_11689775 3300009098 Bacteria 685
204 Ga0105247_10117745 3300009101 Bacteria 1717
205 Ga0105247_10353983 3300009101 Bacteria 1033
206 Ga0105247_10470091 3300009101 Bacteria 910
207 Ga0114129_10083416 3300009147 Bacteria 4440
208 Ga0114129_10092035 3300009147 Bacteria 4201
209 Ga0114129_10248507 3300009147 Bacteria 2388
210 Ga0114129_10431100 3300009147 Bacteria 1732
211 Ga0114129_10544522 3300009147 Bacteria 1510
212 Ga0114129_10732661 3300009147 Bacteria 1267
213 Ga0105241_10429941 3300009174 Bacteria 1164
214 Ga0105241_10992828 3300009174 Bacteria 785
215 Ga0105242_10270438 3300009176 Bacteria 1539
216 Ga0105242_11366899 3300009176 Bacteria 734
217 Ga0105249_10318767 3300009553 Bacteria 1565
218 Ga0105249_10745979 3300009553 Bacteria 1041
219 Ga0099796_10539450 3300010159 Bacteria 524
220 Ga0105239_10096716 3300010375 Bacteria 3262
221 Ga0105239_10121682 3300010375 Bacteria 2899
222 Ga0105239_10190771 3300010375 Bacteria 2294
223 Ga0105239_10342018 3300010375 Bacteria 1688
224 Ga0105239_10367401 3300010375 Bacteria 1626
225 Ga0105239_12977552 3300010375 Bacteria 552
226 Ga0105246_10043793 3300011119 Bacteria 3038
227 Ga0105246_10455871 3300011119 Bacteria 1076
228 Ga0105246_11814452 3300011119 Bacteria 583
229 Ga0157371_10185602 3300013102 Bacteria 1488
230 Ga0157370_10253447 3300013104 Bacteria 1628
231 Ga0157369_10212075 3300013105 Bacteria 2029
232 Ga0157374_10953973 3300013296 Bacteria 876
233 Ga0157378_10919350 3300013297 Bacteria 906
234 Ga0157378_11296527 3300013297 Bacteria 769
235 Ga0163162_10785622 3300013306 Bacteria 1070
236 Ga0163162_11142656 3300013306 Bacteria 883
237 Ga0157375_10007761 3300013308 Bacteria 9385
238 Ga0163163_10043637 3300014325 Bacteria 4397
239 Ga0163163_10050450 3300014325 Bacteria 4098
240 Ga0163163_10220411 3300014325 Bacteria 1946
241 Ga0157380_10186027 3300014326 Bacteria 1829
242 Ga0157380_10888444 3300014326 Bacteria 916
243 Ga0157380_11513121 3300014326 Bacteria 724
244 Ga0157380_11946444 3300014326 Bacteria 649
245 Ga0157377_10001603 3300014745 Bacteria 9842
246 Ga0157379_10471191 3300014968 Bacteria 1161
247 Ga0157379_10673187 3300014968 Bacteria 970
248 Ga0157379_10750918 3300014968 Bacteria 918
249 Ga0157379_10878566 3300014968 Bacteria 849
250 Ga0157379_12244788 3300014968 Bacteria 543
251 Ga0157376_10035452 3300014969 Bacteria 4036
252 Ga0157376_10042796 3300014969 Bacteria 3713
253 Ga0182006_1000240 3300015261 Bacteria 51334
254 Ga0182007_10045164 3300015262 Bacteria 1461
255 Ga0182005_1000016 3300015265 Bacteria 346889
256 Ga0182005_1000370 3300015265 Bacteria 24872
257 Ga0163161_10081304 3300017792 Bacteria 2386
258 Ga0163161_10462864 3300017792 Bacteria 1027
259 Ga0163161_11739808 3300017792 Bacteria 553
260 Ga0197907_10230911 3300020069 Bacteria 517
261 Ga0213876_10003406 3300021384 Bacteria 9099
262 Ga0213876_10100124 3300021384 Bacteria 1536
263 Ga0224572_1020774 3300024225 Bacteria 1260
264 Ga0228598_1000416 3300024227 Bacteria 8639
265 Ga0228598_1010790 3300024227 Bacteria 1819
266 Ga0228598_1017982 3300024227 Bacteria 1395
267 Ga0209760_103118 3300025207 Bacteria 1491
268 Ga0209784_100010 3300025224 Bacteria 683664
269 Ga0209566_100008 3300025225 Bacteria 683664
270 Ga0209674_100019 3300025226 Bacteria 683664
271 Ga0209672_107197 3300025228 Bacteria 1732
272 Ga0209563_100021 3300025230 Bacteria 683764
273 Ga0207427_100342 3300025231 Bacteria 30270
274 Ga0209437_100019 3300025233 Bacteria 683764
275 Ga0209677_100011 3300025253 Bacteria 683664
276 Ga0209233_1000025 3300025261 Bacteria 683764
277 Ga0209256_1000054 3300025299 Bacteria 298431
278 Ga0207697_10048666 3300025315 Bacteria 1749
279 Ga0207682_10061155 3300025893 Bacteria 1577
280 Ga0207692_10022644 3300025898 Bacteria 2894
281 Ga0207692_10066259 3300025898 Bacteria 1887
282 Ga0207692_10144451 3300025898 Bacteria 1356
283 Ga0207710_10007582 3300025900 Bacteria 4590
284 Ga0207688_10010927 3300025901 Bacteria 4941
285 Ga0207680_10683396 3300025903 Bacteria 735
286 Ga0207647_10021711 3300025904 Bacteria 4280
287 Ga0207685_10048614 3300025905 Bacteria 1626
288 Ga0207685_10092801 3300025905 Bacteria 1275
289 Ga0207685_10263207 3300025905 Bacteria 839
290 Ga0207685_10860690 3300025905 Bacteria 502
291 Ga0207699_10005995 3300025906 Bacteria 5850
292 Ga0207645_10171296 3300025907 Bacteria 1423
293 Ga0207705_10156275 3300025909 Bacteria 1711
294 Ga0207684_10093438 3300025910 Bacteria 2565
295 Ga0207684_11475991 3300025910 Bacteria 554
296 Ga0207654_10976915 3300025911 Bacteria 615
297 Ga0207707_10034403 3300025912 Bacteria 4433
298 Ga0207707_10122288 3300025912 Bacteria 2276
299 Ga0207707_11567233 3300025912 Bacteria 520
300 Ga0207695_10150615 3300025913 Bacteria 2266
301 Ga0207671_10173312 3300025914 Bacteria 1676
302 Ga0207693_10001042 3300025915 Bacteria 24811
303 Ga0207693_10018656 3300025915 Bacteria 5522
304 Ga0207693_10026097 3300025915 Bacteria 4626
305 Ga0207693_10027985 3300025915 Bacteria 4456
306 Ga0207693_10236545 3300025915 Bacteria 1434
307 Ga0207693_10785899 3300025915 Bacteria 734
308 Ga0207663_10092111 3300025916 Bacteria 2014
309 Ga0207663_10338868 3300025916 Bacteria 1135
310 Ga0207663_10504366 3300025916 Bacteria 940
311 Ga0207663_10910732 3300025916 Bacteria 703
312 Ga0207660_10054606 3300025917 Bacteria 2851
313 Ga0207662_10000683 3300025918 Bacteria 15427
314 Ga0207662_10220396 3300025918 Bacteria 1235
315 Ga0207657_10036554 3300025919 Bacteria 4394
316 Ga0207657_10152689 3300025919 Bacteria 1880
317 Ga0207657_10647971 3300025919 Bacteria 822
318 Ga0207649_10459430 3300025920 Bacteria 962
319 Ga0207649_10617199 3300025920 Bacteria 835
320 Ga0207649_10733741 3300025920 Bacteria 768
321 Ga0207652_10058813 3300025921 Bacteria 3312
322 Ga0207652_10130752 3300025921 Bacteria 2239
323 Ga0207652_10227263 3300025921 Bacteria 1682
324 Ga0207652_10548286 3300025921 Bacteria 1039
325 Ga0207646_10007626 3300025922 Bacteria 10955
326 Ga0207646_10045479 3300025922 Bacteria 3941
327 Ga0207694_10179522 3300025924 Bacteria 1716
328 Ga0207694_11168136 3300025924 Bacteria 651
329 Ga0207650_10010954 3300025925 Bacteria 6232
330 Ga0207650_10043647 3300025925 Bacteria 3292
331 Ga0207650_10048048 3300025925 Bacteria 3146
332 Ga0207659_10303959 3300025926 Bacteria 1311
333 Ga0207659_10701414 3300025926 Bacteria 867
334 Ga0207687_10046021 3300025927 Bacteria 3018
335 Ga0207687_10138493 3300025927 Bacteria 1844
336 Ga0207700_10071304 3300025928 Bacteria 2675
337 Ga0207700_10144285 3300025928 Bacteria 1960
338 Ga0207700_10177935 3300025928 Bacteria 1779
339 Ga0207700_10183173 3300025928 Bacteria 1755
340 Ga0207700_10384630 3300025928 Bacteria 1228
341 Ga0207700_11374416 3300025928 Bacteria 628
342 Ga0207664_10044723 3300025929 Bacteria 3469
343 Ga0207664_10472073 3300025929 Bacteria 1122
344 Ga0207644_10033822 3300025931 Bacteria 3575
345 Ga0207690_10628302 3300025932 Bacteria 878
346 Ga0207690_10718205 3300025932 Bacteria 822
347 Ga0207706_10002966 3300025933 Bacteria 16372
348 Ga0207706_11196905 3300025933 Bacteria 631
349 Ga0207686_11221305 3300025934 Bacteria 616
350 Ga0207709_11401091 3300025935 Bacteria 579
351 Ga0207670_10048420 3300025936 Bacteria 2837
352 Ga0207704_11048208 3300025938 Bacteria 691
353 Ga0207665_10253370 3300025939 Bacteria 1302
354 Ga0207665_10333192 3300025939 Bacteria 1142
355 Ga0207665_11386972 3300025939 Bacteria 560
356 Ga0207665_11631880 3300025939 Bacteria 511
357 Ga0207691_10003332 3300025940 Bacteria 15636
358 Ga0207691_10087732 3300025940 Bacteria 2791
359 Ga0207689_10008393 3300025942 Bacteria 8995
360 Ga0207661_10119254 3300025944 Bacteria 2244
361 Ga0207679_10034779 3300025945 Bacteria 3558
362 Ga0207667_10004001 3300025949 Bacteria 18104
363 Ga0207651_10011035 3300025960 Bacteria 5035
364 Ga0207651_10094608 3300025960 Bacteria 2197
365 Ga0207651_10212938 3300025960 Bacteria 1557
366 Ga0207712_10880455 3300025961 Bacteria 790
367 Ga0207668_10010942 3300025972 Bacteria 5500
368 Ga0207668_10240443 3300025972 Bacteria 1464
369 Ga0207640_10556432 3300025981 Bacteria 964
370 Ga0207640_11861848 3300025981 Bacteria 544
371 Ga0207640_11940351 3300025981 Bacteria 533
372 Ga0207658_10030585 3300025986 Bacteria 3814
373 Ga0207658_10320989 3300025986 Bacteria 1341
374 Ga0207677_10539774 3300026023 Bacteria 1015
375 Ga0207703_10155281 3300026035 Bacteria 1999
376 Ga0207639_10821507 3300026041 Bacteria 867
377 Ga0207708_10030330 3300026075 Bacteria 4099
378 Ga0207708_10390231 3300026075 Bacteria 1149
379 Ga0207708_11060290 3300026075 Bacteria 706
380 Ga0207702_10046706 3300026078 Bacteria 3646
381 Ga0207702_10483675 3300026078 Bacteria 1205
382 Ga0207702_11598250 3300026078 Bacteria 645
383 Ga0207641_10051381 3300026088 Bacteria 3491
384 Ga0207641_10058736 3300026088 Bacteria 3274
385 Ga0207648_10011288 3300026089 Bacteria 8422
386 Ga0207648_11383510 3300026089 Bacteria 661
387 Ga0207676_10035850 3300026095 Bacteria 3769
388 Ga0207675_100003007 3300026118 Bacteria 16534
389 Ga0207683_10015654 3300026121 Bacteria 6455
390 Ga0207698_10016350 3300026142 Bacteria 4997
391 Ga0207698_10842250 3300026142 Bacteria 922
392 Ga0209281_1004227 3300027111 Bacteria 4366
393 Ga0209282_1000072 3300027666 Bacteria 81137
394 Ga0209588_1076389 3300027671 Bacteria 1082
395 Ga0209974_10105949 3300027876 Bacteria 986
396 Ga0207428_10040253 3300027907 Bacteria 3793
397 Ga0265357_1003756 3300028023 Bacteria 1334
398 Ga0268266_10057954 3300028379 Bacteria 3334
399 Ga0268266_11383439 3300028379 Bacteria 679
400 Ga0268266_11463495 3300028379 Bacteria 659
401 Ga0268265_10053404 3300028380 Bacteria 3062
402 Ga0268265_10277735 3300028380 Bacteria 1497
403 Ga0268265_10582116 3300028380 Bacteria 1067
404 Ga0268264_10179743 3300028381 Bacteria 1920
405 Ga0268264_12074500 3300028381 Bacteria 577
406 Ga0307515_10790759 3300028794 Bacteria 571
407 Ga0265338_10078200 3300028800 Bacteria 2791
408 Ga0265338_10531168 3300028800 Bacteria 825
409 Ga0265762_1032276 3300030760 Bacteria 999
410 Ga0265763_1001116 3300030763 Bacteria 1843
411 Ga0265770_1015363 3300030878 Bacteria 1164
412 Ga0265770_1129891 3300030878 Bacteria 537
413 Ga0265773_1005799 3300031018 Bacteria 911
414 Ga0265760_10033681 3300031090 Bacteria 1514
415 Ga0265760_10033778 3300031090 Bacteria 1512
416 Ga0265760_10091086 3300031090 Bacteria 955
417 Ga0265760_10237859 3300031090 Bacteria 626
418 Ga0265330_10042093 3300031235 Bacteria 2024
419 Ga0265332_10026242 3300031238 Bacteria 2555
420 Ga0265332_10375051 3300031238 Bacteria 587
421 Ga0265328_10003667 3300031239 Bacteria 6766
422 Ga0265328_10126304 3300031239 Bacteria 956
423 Ga0265328_10126657 3300031239 Bacteria 954
424 Ga0265320_10023886 3300031240 Bacteria 3244
425 Ga0265325_10000449 3300031241 Bacteria 29667
426 Ga0265325_10018308 3300031241 Bacteria 3884
427 Ga0265340_10016859 3300031247 Bacteria 3779
428 Ga0265340_10189420 3300031247 Bacteria 928
429 Ga0265339_10000053 3300031249 Bacteria 101277
430 Ga0265339_10034939 3300031249 Bacteria 2822
431 Ga0265331_10000090 3300031250 Bacteria 123628
432 Ga0265331_10013159 3300031250 Bacteria 4456
433 Ga0265331_10043884 3300031250 Bacteria 2163
434 Ga0265331_10078977 3300031250 Bacteria 1531
435 Ga0265327_10000218 3300031251 Bacteria 116690
436 Ga0265327_10037439 3300031251 Bacteria 2655
437 Ga0265327_10081747 3300031251 Bacteria 1594
438 Ga0265327_10101632 3300031251 Bacteria 1386
439 Ga0265316_10021166 3300031344 Bacteria 5517
440 Ga0265316_10054706 3300031344 Bacteria 3124
441 Ga0265316_10116081 3300031344 Bacteria 2023
442 Ga0265316_10280285 3300031344 Bacteria 1218
443 Ga0307513_10087877 3300031456 Bacteria 3179
444 Ga0307513_10135600 3300031456 Bacteria 2398
445 Ga0307513_10737988 3300031456 Bacteria 690
446 Ga0307513_10832300 3300031456 Bacteria 629
447 Ga0307509_10708167 3300031507 Bacteria 673
448 Ga0265313_10000098 3300031595 Bacteria 89130
449 Ga0265313_10003687 3300031595 Bacteria 12218
450 Ga0265313_10027323 3300031595 Bacteria 2988
451 Ga0265313_10085817 3300031595 Bacteria 1422
452 Ga0265314_10188606 3300031711 Bacteria 1229
453 Ga0265342_10034741 3300031712 Bacteria 3090
454 Ga0265342_10093841 3300031712 Bacteria 1717
455 Ga0265342_10311122 3300031712 Bacteria 827
456 Ga0307516_10161320 3300031730 Bacteria 1992
457 Ga0307413_11275995 3300031824 Bacteria 642
458 Ga0307412_10843904 3300031911 Bacteria 799
459 Ga0307409_101905305 3300031995 Bacteria 624
460 Ga0307409_102383047 3300031995 Bacteria 558
461 Ga0307411_10583210 3300032005 Bacteria 959
462 Ga0316053_105626 3300032120 Bacteria 799
463 Ga0307415_101261050 3300032126 Bacteria 699
464 Ga0316592_1114322 3300033524 Bacteria 625
465 Ga0316596_1136759 3300033541 Bacteria 670
466 Ga0373926_0114711 3300035083 Bacteria 1013
467 Ga0373926_0432410 3300035083 Bacteria 521
468 Ga0373928_0252428 3300035084 Bacteria 526
469 Ga0373934_0062611 3300035086 Bacteria 1483
470 Ga0373934_0111077 3300035086 Bacteria 1112
471 Ga0373934_0171807 3300035086 Bacteria 890
472 Ga0373944_0030910 3300035089 Bacteria 1608
473 Ga0373923_0073205 3300035111 Bacteria 1475
474 Ga0373923_0152772 3300035111 Bacteria 1049
475 Ga0373932_0041859 3300035112 Bacteria 1326
476 Ga0373932_0245400 3300035112 Bacteria 652
477 Ga0373936_0106729 3300035113 Bacteria 1186
478 Ga0373939_0168225 3300035114 Bacteria 810
479 Ga0373945_0007787 3300035116 Bacteria 3476
480 Ga0373945_0041830 3300035116 Bacteria 1658
481 Ga0373945_0080941 3300035116 Bacteria 1244
482 Ga0373953_0421003 3300035117 Bacteria 589
483 Ga0373954_0066947 3300035118 Bacteria 1701
484 Ga0373954_0122786 3300035118 Bacteria 1261
485 Ga0373954_0164172 3300035118 Bacteria 1087
486 Ga0373956_0266738 3300035119 Bacteria 814
487 Ga0373956_0293869 3300035119 Bacteria 774
488 Ga0373956_0365115 3300035119 Bacteria 688
489 Ga0373960_0005814 3300035121 Bacteria 2869
490 Ga0373960_0294452 3300035121 Bacteria 602
491 Ga0373943_0014346 3300035170 Bacteria 3586
492 Ga0373943_0050131 3300035170 Bacteria 2050
493 Ga0373943_0129148 3300035170 Bacteria 1351
494 Ga0373943_0171044 3300035170 Bacteria 1189
495 Ga0373943_0283015 3300035170 Bacteria 938
496 Ga0373946_0027523 3300035171 Bacteria 2249
497 Ga0373946_0062117 3300035171 Bacteria 1592
498 Ga0373955_0549293 3300035172 Bacteria 707
499 Ga0373942_0045451 3300035207 Bacteria 1213
500 Ga0373961_0160078 3300035241 Bacteria 773
501 Ga0373961_0206424 3300035241 Bacteria 695
502 Ga0373962_0167214 3300035242 Bacteria 728
503 Ga0316574_0384775 3300035398 Bacteria 885
504 Ga0373924_0043824 3300035410 Bacteria 1838
505 Ga0373924_0197979 3300035410 Bacteria 886
506 Ga0373931_0080324 3300035691 Bacteria 1798
507 Ga0373931_0154720 3300035691 Bacteria 1339
508 Ga0373931_0200857 3300035691 Bacteria 1191
509 Ga0373931_1149383 3300035691 Bacteria 530
510 Ga0373935_0006630 3300035692 Bacteria 6916
511 Ga0373935_0054512 3300035692 Bacteria 2546
512 Ga0373935_0054795 3300035692 Bacteria 2541
513 Ga0373935_0091399 3300035692 Bacteria 1993
514 Ga0373935_0237512 3300035692 Bacteria 1271
515 Ga0373935_0251032 3300035692 Bacteria 1238
516 Ga0373927_0000971 3300035695 Bacteria 21800
517 Ga0373927_0017276 3300035695 Bacteria 4749
518 Ga0373927_0037358 3300035695 Bacteria 3156
519 Ga0373927_0043686 3300035695 Bacteria 2900
520 Ga0373927_0049295 3300035695 Bacteria 2723
521 Ga0373927_0171364 3300035695 Bacteria 1423
522 Ga0373933_0000858 3300035724 Bacteria 18640
523 Ga0373933_1033357 3300035724 Bacteria 541
524 Ga0373947_0000633 3300035725 Bacteria 20789
525 Ga0373947_0011503 3300035725 Bacteria 5076
526 Ga0373947_0040714 3300035725 Bacteria 2768
527 Ga0373947_0093951 3300035725 Bacteria 1875
528 Ga0373937_0002560 3300036401 Bacteria 15116
529 Ga0373937_0017054 3300036401 Bacteria 6459
530 Ga0372808_035557 3300036459 Bacteria 715
531 Ga0316582_0120853 3300036647 Bacteria 1752
532 Ga0316582_0809702 3300036647 Unclassified 642
533 Ga0373925_0002443 3300037068 Bacteria 14891
534 Ga0373925_0007434 3300037068 Bacteria 7992
535 Ga0373925_0016615 3300037068 Bacteria 5332
536 Ga0373925_0053531 3300037068 Bacteria 3017
537 Ga0373925_0076265 3300037068 Bacteria 2542
538 Ga0373925_0086532 3300037068 Bacteria 2391
539 Ga0373925_0090548 3300037068 Bacteria 2338
540 Ga0373925_0829984 3300037068 Bacteria 762
541 Ga0373925_1007028 3300037068 Bacteria 686
542 Ga0395899_0000073 3300037312 Bacteria 181387
543 Ga0395900_0000027 3300037418 Bacteria 285957
544 Ga0395900_0352109 3300037418 Bacteria 1446
545 Ga0395900_1833653 3300037418 Bacteria 517
546 Ga0395898_0000255 3300037466 Bacteria 131017
547 Ga0395905_0000032 3300037471 Bacteria 285932
548 Ga0395905_0008689 3300037471 Bacteria 9999
549 Ga0395905_0082966 3300037471 Bacteria 3003
550 Ga0436364_0979867 3300037853 Bacteria 1220
551 Ga0436364_1047052 3300037853 Bacteria 758
552 Ga0436364_1158099 3300037853 Bacteria 1246
553 Ga0436364_1483415 3300037853 Bacteria 727
554 Ga0436364_1537292 3300037853 Bacteria 1148
555 Ga0395901_0000110 3300038443 Bacteria 112682
556 Ga0395901_0160734 3300038443 Bacteria 2359
557 Ga0395901_0808769 3300038443 Bacteria 926
558 Ga0436365_0697746 3300039437 Bacteria 24050
559 Ga0436365_1428905 3300039437 Bacteria 1465
560 Ga0436360_0096403 3300039438 Bacteria 1410
561 Ga0436360_1301919 3300039438 Bacteria 913
562 Ga0436361_0496844 3300039447 Bacteria 3149
563 Ga0436363_0177757 3300039450 Bacteria 938
564 Ga0436363_0823825 3300039450 Bacteria 610
565 Ga0436363_1509191 3300039450 Bacteria 2480
566 Ga0436362_0617508 3300039453 Bacteria 857
567 Ga0436362_0991724 3300039453 Bacteria 721
568 Ga0439439_0159716 3300041406 Bacteria 643
569 Ga0439453_0000173 3300041408 Bacteria 6005
570 Ga0451793_0071024 3300041452 Bacteria 644
571 Ga0451805_116338 3300041461 Bacteria 541
572 Ga0451845_0368984 3300041501 Bacteria 523
573 Ga0439441_041429 3300042001 Bacteria 924
574 Ga0439441_051867 3300042001 Bacteria 847
575 Ga0439443_015095 3300042003 Bacteria 1169
576 Ga0439463_141242 3300042016 Bacteria 624
577 Ga0439435_0032006 3300042436 Bacteria 1433
578 Ga0466972_0372016 3300044658 Bacteria 669
579 Ga0466966_0121358 3300044684 Bacteria 1605
580 Ga0466963_0141593 3300044694 Bacteria 1666
581 Ga0466957_0031161 3300044842 Bacteria 3186
582 Ga0466957_0251445 3300044842 Bacteria 1175
583 Ga0466959_0096694 3300045049 Bacteria 2117
584 Ga0466958_0008139 3300045836 Bacteria 5804
585 Ga0466967_1017772 3300045976 Bacteria 825
586 Ga0495617_078200 3300046452 Bacteria 1085
587 Ga0495617_214884 3300046452 Bacteria 599
588 Ga0495627_000011 3300046453 Bacteria 354522
589 Ga0495592_0004065 3300046454 Bacteria 10637
590 Ga0495592_0211814 3300046454 Bacteria 1301
591 Ga0495603_0010786 3300046455 Bacteria 5542
592 Ga0495603_0092189 3300046455 Bacteria 1771
593 Ga0495603_0112616 3300046455 Bacteria 1587
594 Ga0495629_0003502 3300046459 Bacteria 11866
595 Ga0495629_0031003 3300046459 Bacteria 3787
596 Ga0495629_0239737 3300046459 Bacteria 1249
597 Ga0495629_0294172 3300046459 Bacteria 1112
598 Ga0495641_0088498 3300046461 Bacteria 1385
599 Ga0495641_0294711 3300046461 Bacteria 731
600 Ga0495651_0001400 3300046462 Bacteria 18698
601 Ga0495651_0019173 3300046462 Bacteria 5299
602 Ga0495651_0104450 3300046462 Bacteria 2103
603 Ga0495651_0202596 3300046462 Bacteria 1388
604 Ga0495653_0026224 3300046463 Bacteria 4676
605 Ga0495653_0031575 3300046463 Bacteria 4209
606 Ga0495653_0312035 3300046463 Bacteria 1022
607 Ga0495653_0352837 3300046463 Bacteria 945
608 Ga0495580_0069341 3300046472 Bacteria 2464
609 Ga0495580_0114226 3300046472 Bacteria 1875
610 Ga0495580_0480008 3300046472 Bacteria 832
611 Ga0495580_0605048 3300046472 Bacteria 724
612 Ga0495582_0085444 3300046473 Bacteria 1755
613 Ga0495605_0122840 3300046474 Bacteria 1176
614 Ga0495605_0247420 3300046474 Bacteria 764
615 Ga0495639_0022143 3300046475 Bacteria 2786
616 Ga0495639_0091143 3300046475 Bacteria 1430
617 Ga0495639_0110314 3300046475 Bacteria 1305
618 Ga0495639_0329639 3300046475 Bacteria 764
619 Ga0495662_0004886 3300046476 Bacteria 6715
620 Ga0495662_0037859 3300046476 Bacteria 2330
621 Ga0495664_0001699 3300046477 Bacteria 11697
622 Ga0495664_0032998 3300046477 Bacteria 3041
623 Ga0495664_0367224 3300046477 Bacteria 866
624 Ga0495584_0026134 3300046491 Bacteria 2958
625 Ga0495584_0062527 3300046491 Bacteria 1871
626 Ga0495584_0255890 3300046491 Bacteria 890
627 Ga0495585_0024577 3300046492 Bacteria 3453
628 Ga0495594_0012384 3300046499 Bacteria 4442
629 Ga0495594_0376546 3300046499 Bacteria 808
630 Ga0495594_0552735 3300046499 Bacteria 653
631 Ga0495594_0572743 3300046499 Bacteria 640
632 Ga0495594_0698497 3300046499 Bacteria 573
633 Ga0495596_0380556 3300046500 Bacteria 550
634 Ga0495607_0050530 3300046501 Bacteria 2420
635 Ga0495607_0242725 3300046501 Bacteria 871
636 Ga0495606_0315616 3300046507 Bacteria 842
637 Ga0495608_0359874 3300046511 Bacteria 894
638 Ga0495618_0007630 3300046514 Bacteria 6542
639 Ga0495618_0015533 3300046514 Bacteria 4647
640 Ga0495618_0252297 3300046514 Bacteria 1106
641 Ga0495628_0000109 3300046516 Bacteria 67425
642 Ga0495628_0014171 3300046516 Bacteria 6691
643 Ga0495628_0028002 3300046516 Bacteria 4582
644 Ga0495628_0357439 3300046516 Bacteria 1073
645 Ga0495630_0010798 3300046517 Bacteria 6592
646 Ga0495630_0067408 3300046517 Bacteria 2690
647 Ga0495630_0118472 3300046517 Bacteria 2008
648 Ga0495630_0484732 3300046517 Bacteria 948
649 Ga0495630_0693374 3300046517 Bacteria 779
650 Ga0495631_0015770 3300046518 Bacteria 3614
651 Ga0495644_0011541 3300046523 Bacteria 3401
652 Ga0495648_0255409 3300046524 Bacteria 844
653 Ga0495663_0015967 3300046525 Bacteria 2121
654 Ga0495666_0193773 3300046526 Bacteria 936
655 Ga0495666_0244274 3300046526 Bacteria 819
656 Ga0495642_0438074 3300046528 Bacteria 577
657 Ga0495652_0004294 3300046529 Bacteria 13663
658 Ga0495652_0183098 3300046529 Bacteria 1605
659 Ga0495652_0221140 3300046529 Bacteria 1423
660 Ga0495654_0163164 3300046530 Bacteria 977
661 Ga0495654_0205544 3300046530 Bacteria 840
662 Ga0495654_0213446 3300046530 Bacteria 820
663 Ga0495665_0035820 3300046531 Bacteria 2650
664 Ga0495665_0042118 3300046531 Bacteria 2431
665 Ga0495665_0147125 3300046531 Bacteria 1230
666 Ga0495665_0162785 3300046531 Bacteria 1162
667 Ga0495665_0395931 3300046531 Bacteria 701
668 Ga0495640_0000385 3300046533 Bacteria 31316
669 Ga0495640_0000769 3300046533 Bacteria 24154
670 Ga0495640_0175170 3300046533 Bacteria 1369
671 Ga0495640_0186675 3300046533 Bacteria 1319
672 Ga0495587_0001283 3300046536 Bacteria 16691
673 Ga0495587_0103577 3300046536 Bacteria 1638
674 Ga0495587_0155381 3300046536 Bacteria 1303
675 Ga0495587_0168412 3300046536 Bacteria 1245
676 Ga0495598_0004029 3300046537 Bacteria 3155
677 Ga0495609_0038054 3300046538 Bacteria 2170
678 Ga0495609_0096531 3300046538 Bacteria 1282
679 Ga0495621_0005293 3300046539 Bacteria 3697
680 Ga0495645_0253438 3300046543 Bacteria 1169
681 Ga0495633_0337541 3300046558 Bacteria 683
682 Ga0495667_0001440 3300046559 Bacteria 15673
683 Ga0495667_0041859 3300046559 Bacteria 3037
684 Ga0495667_0539930 3300046559 Bacteria 729
685 Ga0495656_0001605 3300046615 Bacteria 7402
686 Ga0495656_0152103 3300046615 Bacteria 1118
687 Ga0495668_0466225 3300046616 Bacteria 695
688 Ga0495668_0586700 3300046616 Bacteria 615
689 Ga0495634_0001491 3300046642 Bacteria 20709
690 Ga0495634_0025557 3300046642 Bacteria 4129
691 Ga0495634_0029771 3300046642 Bacteria 3778
692 Ga0495634_0071769 3300046642 Bacteria 2278
693 Ga0495634_0284262 3300046642 Bacteria 1004
694 Ga0495634_0355697 3300046642 Bacteria 876
695 Ga0495635_0035056 3300046663 Bacteria 3479
696 Ga0495635_0113870 3300046663 Bacteria 1846
697 Ga0495635_0138899 3300046663 Bacteria 1655
698 Ga0495635_0531085 3300046663 Bacteria 772
699 Ga0495659_0172206 3300046664 Bacteria 878
700 Ga0495659_0346453 3300046664 Bacteria 634
701 Ga0495661_0088488 3300046665 Bacteria 1768
702 Ga0495588_0208708 3300046674 Bacteria 1031
703 Ga0495657_0168449 3300046675 Bacteria 1350
704 Ga0495599_0041684 3300046678 Bacteria 2881
705 Ga0495599_0060382 3300046678 Bacteria 2370
706 Ga0495599_0328331 3300046678 Bacteria 920
707 Ga0495623_0013044 3300046679 Bacteria 5382
708 Ga0495623_0080307 3300046679 Bacteria 2019
709 Ga0495623_0098854 3300046679 Bacteria 1780
710 Ga0495646_0004357 3300046680 Bacteria 8919
711 Ga0495646_0010752 3300046680 Bacteria 5814
712 Ga0495646_0041999 3300046680 Bacteria 2808
713 Ga0495647_0010689 3300046681 Bacteria 3130
714 Ga0495647_0243204 3300046681 Bacteria 799
715 Ga0495658_0071370 3300046683 Bacteria 2017
716 Ga0495658_0107141 3300046683 Bacteria 1676
717 Ga0495658_0928818 3300046683 Bacteria 556
718 Ga0495669_0223430 3300046684 Bacteria 903
719 Ga0495669_0249240 3300046684 Bacteria 853
720 Ga0495613_0042111 3300046689 Bacteria 3380
721 Ga0495613_0057625 3300046689 Bacteria 2852
722 Ga0495613_0073452 3300046689 Bacteria 2492
723 Ga0495613_0239057 3300046689 Bacteria 1270
724 Ga0495624_0021720 3300046690 Bacteria 4253
725 Ga0495624_0045694 3300046690 Bacteria 2786
726 Ga0495624_0066226 3300046690 Bacteria 2255
727 Ga0495624_0159051 3300046690 Bacteria 1380
728 Ga0495624_0302694 3300046690 Bacteria 964
729 Ga0495624_0325699 3300046690 Bacteria 925
730 Ga0495670_0406344 3300046691 Bacteria 736
731 Ga0495671_0059860 3300046692 Bacteria 1881
732 Ga0495671_0272001 3300046692 Bacteria 817
733 Ga0495671_0487639 3300046692 Bacteria 588
734 Ga0495649_0129597 3300046694 Bacteria 1331
735 Ga0495589_0032938 3300046794 Bacteria 2604
736 Ga0495600_0001398 3300046809 Bacteria 13308
737 Ga0495600_0057506 3300046809 Bacteria 2540
738 Ga0495660_0000905 3300046810 Bacteria 21932
739 Ga0495581_0053605 3300047315 Bacteria 2329
740 Ga0495581_0143063 3300047315 Bacteria 1395
741 Ga0495581_0170366 3300047315 Bacteria 1273
742 Ga0495581_0218811 3300047315 Bacteria 1113
743 Ga0495581_0472033 3300047315 Bacteria 730
744 Ga0495581_0760003 3300047315 Bacteria 557
745 Ga0495604_0000406 3300047317 Bacteria 38847
746 Ga0495604_0072447 3300047317 Bacteria 2603
747 Ga0495604_0263671 3300047317 Bacteria 1170
748 Ga0495636_0576654 3300047318 Bacteria 549
749 Ga0495674_0001453 3300047319 Bacteria 23203
750 Ga0495674_0023413 3300047319 Bacteria 5692
751 Ga0495674_0203361 3300047319 Bacteria 1642
752 Ga0495674_0264834 3300047319 Bacteria 1411
753 Ga0495674_0663268 3300047319 Bacteria 821
754 Ga0495674_1036281 3300047319 Bacteria 627
755 Ga0495672_0081977 3300047320 Bacteria 1795
756 Ga0495676_0135025 3300047321 Bacteria 1775
757 Ga0495676_0198060 3300047321 Bacteria 1397
758 Ga0495676_0878645 3300047321 Bacteria 575
759 Ga0495680_0002267 3300047322 Bacteria 19822
760 Ga0495680_0512258 3300047322 Bacteria 813
761 Ga0495680_0658204 3300047322 Bacteria 695
762 Ga0495675_0036422 3300047444 Bacteria 3138
763 Ga0495675_0071301 3300047444 Bacteria 2193
764 Ga0495675_0481078 3300047444 Bacteria 715
765 Ga0495679_018436 3300047446 Bacteria 2478
766 Ga0495681_0268683 3300047470 Bacteria 668
767 Ga0495684_0002545 3300047471 Bacteria 14510
768 Ga0495684_0027908 3300047471 Bacteria 4335
769 Ga0495684_0042044 3300047471 Bacteria 3502
770 Ga0495684_0083851 3300047471 Bacteria 2417
771 Ga0495686_0315391 3300047472 Bacteria 859
772 Ga0495593_0046845 3300047673 Bacteria 2303
773 Ga0495593_0109761 3300047673 Bacteria 1409
774 Ga0495593_0343085 3300047673 Bacteria 746
775 Ga0495602_0014190 3300048088 Bacteria 8097
776 Ga0495602_0094162 3300048088 Bacteria 2476
777 Ga0495602_0110082 3300048088 Bacteria 2240
778 Ga0495602_0189487 3300048088 Bacteria 1578
779 Ga0495602_0272000 3300048088 Bacteria 1252
780 Ga0496100_0006135 3300048903 Bacteria 6537
781 Ga0496100_0045424 3300048903 Bacteria 2819
782 Ga0496100_0090321 3300048903 Bacteria 2088
783 Ga0496101_0003597 3300048904 Bacteria 9676
784 Ga0496101_0019747 3300048904 Bacteria 4606
785 Ga0496101_0137179 3300048904 Bacteria 1862
786 Ga0496101_0269956 3300048904 Bacteria 1328
787 Ga0496101_0393828 3300048904 Bacteria 1090
788 Ga0496101_0662127 3300048904 Bacteria 825
789 Ga0496102_0001868 3300048905 Bacteria 18139
790 Ga0496102_0042907 3300048905 Bacteria 4099
791 Ga0496102_0055582 3300048905 Bacteria 3609
792 Ga0496102_0398632 3300048905 Bacteria 1294
793 Ga0496102_0610837 3300048905 Bacteria 1013
794 Ga0496102_1304300 3300048905 Bacteria 645
795 Ga0496103_0004036 3300048906 Bacteria 8920
796 Ga0496103_0005701 3300048906 Bacteria 7441
797 Ga0496103_0014953 3300048906 Bacteria 4613
798 Ga0496103_0358999 3300048906 Bacteria 937
799 Ga0496104_0001826 3300048907 Bacteria 18406
800 Ga0496104_0002521 3300048907 Bacteria 15773
801 Ga0496104_0006531 3300048907 Bacteria 10255
802 Ga0496104_0041724 3300048907 Bacteria 4303
803 Ga0496104_0362727 3300048907 Bacteria 1361
804 Ga0496104_0408852 3300048907 Bacteria 1269
805 Ga0496104_0503731 3300048907 Bacteria 1122
806 Ga0496104_1671496 3300048907 Bacteria 539
807 Ga0496105_0013712 3300048908 Bacteria 6435
808 Ga0496105_0023389 3300048908 Bacteria 5010
809 Ga0496105_0025920 3300048908 Bacteria 4777
810 Ga0496105_0053612 3300048908 Bacteria 3330
811 Ga0496105_0113571 3300048908 Bacteria 2235
812 Ga0496105_0957933 3300048908 Bacteria 642
813 Ga0496105_0983536 3300048908 Bacteria 632
814 Ga0496106_0001110 3300048909 Bacteria 19925
815 Ga0496106_0013846 3300048909 Bacteria 5960
816 Ga0496106_0023515 3300048909 Bacteria 4577
817 Ga0496106_0065773 3300048909 Bacteria 2760
818 Ga0496106_0197365 3300048909 Bacteria 1601
819 Ga0496106_0228146 3300048909 Bacteria 1486
820 Ga0496106_0460554 3300048909 Bacteria 1021
821 Ga0496106_1201358 3300048909 Bacteria 591
822 Ga0496107_0010686 3300048910 Bacteria 6384
823 Ga0496107_0017863 3300048910 Bacteria 4992
824 Ga0496107_0032302 3300048910 Bacteria 3741
825 Ga0496107_0703659 3300048910 Bacteria 743
826 Ga0496108_0004403 3300048911 Bacteria 11337
827 Ga0496108_0017165 3300048911 Bacteria 5920
828 Ga0496108_0018358 3300048911 Bacteria 5728
829 Ga0496108_0185967 3300048911 Bacteria 1800
830 Ga0496108_1733377 3300048911 Bacteria 513
831 Ga0496109_0005037 3300048912 Bacteria 11039
832 Ga0496109_0005827 3300048912 Bacteria 10325
833 Ga0496109_0006780 3300048912 Bacteria 9646
834 Ga0496109_0512580 3300048912 Bacteria 1132
835 Ga0496109_0545945 3300048912 Bacteria 1093
836 Ga0496109_0640136 3300048912 Bacteria 1000
837 Ga0496110_0005009 3300048913 Bacteria 10350
838 Ga0496110_0010524 3300048913 Bacteria 7530
839 Ga0496110_0025880 3300048913 Bacteria 5017
840 Ga0496110_0076837 3300048913 Bacteria 2969
841 Ga0496110_0546916 3300048913 Bacteria 1052
842 Ga0496110_0808728 3300048913 Bacteria 842
843 Ga0496110_0899106 3300048913 Bacteria 791
844 Ga0496111_0003448 3300048914 Bacteria 9778
845 Ga0496111_0006735 3300048914 Bacteria 7481
846 Ga0496111_0013724 3300048914 Bacteria 5518
847 Ga0496111_0190545 3300048914 Bacteria 1524
848 Ga0496111_0214300 3300048914 Bacteria 1430
849 Ga0496111_1090571 3300048914 Bacteria 569
850 Ga0496112_0002152 3300048915 Bacteria 15650
851 Ga0496112_0005896 3300048915 Bacteria 10679
852 Ga0496112_0086402 3300048915 Bacteria 3103
853 Ga0496112_0350600 3300048915 Bacteria 1418
854 Ga0496112_0559441 3300048915 Bacteria 1077
855 Ga0496113_0017380 3300048916 Bacteria 4991
856 Ga0496113_0103780 3300048916 Bacteria 2205
857 Ga0496113_0122220 3300048916 Bacteria 2036
858 Ga0496114_0011857 3300048917 Bacteria 6975
859 Ga0496114_0116757 3300048917 Bacteria 2291
860 Ga0496114_0658927 3300048917 Bacteria 920
861 Ga0496115_0038794 3300048918 Bacteria 3781
862 Ga0496115_0059777 3300048918 Bacteria 3070
863 Ga0496115_0060309 3300048918 Bacteria 3056
864 Ga0496115_0087721 3300048918 Bacteria 2539
865 Ga0496115_0279137 3300048918 Bacteria 1372
866 Ga0496115_0432183 3300048918 Bacteria 1065
867 Ga0496115_0614127 3300048918 Bacteria 863
868 Ga0496115_0802624 3300048918 Bacteria 732
869 Ga0496118_0207542 3300048921 Bacteria 1153
870 Ga0496121_0228399 3300048924 Bacteria 1305
871 Ga0496121_0411816 3300048924 Bacteria 882
872 Ga0496124_0037873 3300048927 Bacteria 4191
873 Ga0496126_0143598 3300048929 Bacteria 2052
874 Ga0496126_0197052 3300048929 Bacteria 1703
875 Ga0496126_0510208 3300048929 Bacteria 960
876 Ga0501306_071010 3300049127 Bacteria 588
877 Ga0501305_037687 3300049161 Bacteria 777
878 Ga0501307_002993 3300049162 Bacteria 1626
879 Ga0495678_000010 3300049459 Bacteria 357896
880 Ga0501314_003548 3300049530 Bacteria 1261
881 Ga0501320_007545 3300049536 Bacteria 1050
882 Ga0501321_020521 3300049537 Bacteria 818
883 Ga0501325_041690 3300049541 Bacteria 561
884 Ga0501335_034801 3300049551 Bacteria 579
885 Ga0501032_0561004 3300049569 Bacteria 728
886 Ga0501033_0020312 3300049570 Bacteria 5018
887 Ga0501033_0270826 3300049570 Bacteria 1200
888 Ga0501034_0065637 3300049571 Bacteria 3642
889 Ga0501034_0123559 3300049571 Bacteria 2574
890 Ga0501034_0840754 3300049571 Bacteria 809
891 Ga0501036_0237665 3300049572 Bacteria 1528
892 Ga0501037_0166555 3300049573 Bacteria 1569
893 Ga0501038_0234608 3300049574 Bacteria 1458
894 Ga0501039_0081091 3300049575 Bacteria 2526
895 Ga0501040_0416784 3300049576 Bacteria 965
896 Ga0501041_0169046 3300049577 Bacteria 1368
897 Ga0501046_0014121 3300049580 Bacteria 6745
898 Ga0501047_0216277 3300049581 Bacteria 1773
899 Ga0501047_0376219 3300049581 Bacteria 1255
900 Ga0501047_0734332 3300049581 Bacteria 804
901 Ga0501047_0934499 3300049581 Bacteria 680
902 Ga0501048_0199921 3300049582 Bacteria 1417
903 Ga0501048_1244655 3300049582 Bacteria 535
904 Ga0501068_1114750 3300049584 Bacteria 522
905 Ga0501069_0370577 3300049585 Bacteria 845
906 Ga0501070_0112554 3300049586 Bacteria 2249
907 Ga0501070_0413462 3300049586 Bacteria 1090
908 Ga0501072_0001866 3300049588 Bacteria 15694
909 Ga0501073_0047978 3300049589 Bacteria 2999
910 Ga0501073_0603889 3300049589 Bacteria 758
911 Ga0501073_0763852 3300049589 Bacteria 666
912 Ga0501073_1070338 3300049589 Bacteria 554
913 Ga0501076_0488686 3300049592 Bacteria 1014
914 Ga0501077_0074021 3300049593 Bacteria 2158
915 Ga0501077_0202831 3300049593 Bacteria 1260
916 Ga0501077_0456946 3300049593 Bacteria 818
917 Ga0501079_0904863 3300049741 Bacteria 695
918 Ga0501080_0272607 3300049742 Bacteria 1540
919 Ga0501080_1293859 3300049742 Bacteria 625
920 Ga0501081_0581638 3300049743 Bacteria 838
921 Ga0501083_0065092 3300049744 Bacteria 2428
922 Ga0501083_0281053 3300049744 Bacteria 1083
923 Ga0501083_0290557 3300049744 Bacteria 1063
924 Ga0501044_0052273 3300049823 Bacteria 4211
925 Ga0501044_0501280 3300049823 Bacteria 1115
926 Ga0501045_0462192 3300049824 Bacteria 943
927 nmdc:mga03683_229376_c1 3300050489 Bacteria 858
928 nmdc:mga03n38_303995_c1 3300050490 Bacteria 857
929 nmdc:mga00v17_161190_c1 3300050491 Bacteria 1444
930 nmdc:mga00v17_494975_c1 3300050491 Bacteria 793
931 nmdc:mga00v17_77970_c1 3300050491 Bacteria 2064
932 nmdc:mga0yw44_1084417_c1 3300050492 Bacteria 541
933 nmdc:mga0yw44_140149_c1 3300050492 Bacteria 1571
934 nmdc:mga0yw44_14958_c1 3300050492 Bacteria 4140
935 nmdc:mga0yw44_20287_c1 3300050492 Bacteria 3686
936 nmdc:mga0yw44_570533_c1 3300050492 Bacteria 768
937 nmdc:mga0yw44_9207_c1 3300050492 Bacteria 4972
938 nmdc:mga0k408_103293_c1 3300050493 Bacteria 1681
939 nmdc:mga0k408_732559_c1 3300050493 Bacteria 578
940 nmdc:mga06z11_193982_c1 3300050494 Bacteria 1177
941 nmdc:mga06z11_60447_c1 3300050494 Bacteria 1973
942 nmdc:mga06z11_772336_c1 3300050494 Bacteria 585
943 nmdc:mga04h51_25337_c1 3300050495 Bacteria 1825
944 nmdc:mga07m45_342976_c1 3300050496 Bacteria 868
945 nmdc:mga07m45_689723_c1 3300050496 Bacteria 588
946 nmdc:mga05p37_14706_c1 3300050507 Bacteria 9402
947 nmdc:mga05p37_1564195_c1 3300050507 Bacteria 652
948 nmdc:mga05p37_1773_c1 3300050507 Bacteria 25196
949 nmdc:mga05p37_196486_c1 3300050507 Bacteria 2446
950 nmdc:mga05p37_2105657_c1 3300050507 Bacteria 528
951 nmdc:mga05p37_596952_c1 3300050507 Bacteria 1247
952 nmdc:mga05p37_8226_c1 3300050507 Bacteria 12336
953 nmdc:mga09592_455567_c1 3300050508 Bacteria 1103
954 nmdc:mga09592_758794_c1 3300050508 Bacteria 823
955 nmdc:mga09592_8971_c1 3300050508 Bacteria 8131
956 nmdc:mga0qj67_1019591_c1 3300050509 Bacteria 649
957 nmdc:mga0qj67_12270_c1 3300050509 Bacteria 6454
958 nmdc:mga0qj67_299_c1 3300050509 Bacteria 34404
959 nmdc:mga0qj67_442834_c1 3300050509 Bacteria 1047
960 nmdc:mga06r32_121597_c1 3300050510 Bacteria 2576
961 nmdc:mga06r32_1234254_c1 3300050510 Bacteria 693
962 nmdc:mga06r32_1378040_c1 3300050510 Bacteria 647
963 nmdc:mga06r32_16932_c1 3300050510 Bacteria 5795
964 nmdc:mga06r32_433662_c1 3300050510 Bacteria 1295
965 nmdc:mga06r32_607061_c1 3300050510 Bacteria 1065
966 nmdc:mga06r32_87514_c1 3300050510 Bacteria 3040
967 nmdc:mga08y16_256541_c1 3300050511 Bacteria 1806
968 nmdc:mga08y16_359174_c1 3300050511 Bacteria 1495
969 nmdc:mga08y16_60080_c1 3300050511 Bacteria 3970
970 nmdc:mga0n895_1377163_c1 3300050512 Bacteria 674
971 nmdc:mga0n895_259878_c1 3300050512 Bacteria 1762
972 nmdc:mga0n895_284643_c1 3300050512 Bacteria 1676
973 nmdc:mga0n895_859334_c1 3300050512 Bacteria 895
974 nmdc:mga0rr50_727548_c1 3300050513 Bacteria 847
975 nmdc:mga08x19_533270_c1 3300050514 Bacteria 830
976 nmdc:mga0a205_1173733_c1 3300050515 Bacteria 615
977 nmdc:mga0a205_27812_c1 3300050515 Bacteria 5401
978 Ga0495601_0010741 3300053077 Bacteria 5463
979 Ga0495601_0013011 3300053077 Bacteria 4998
980 Ga0495601_0120925 3300053077 Bacteria 1700
981 Ga0495601_0155985 3300053077 Bacteria 1491
982 Ga0495601_0408841 3300053077 Bacteria 879
983 Ga0495612_0001890 3300053078 Bacteria 8615
984 Ga0495612_0010224 3300053078 Bacteria 3795
985 Ga0495612_0094439 3300053078 Bacteria 1269
986 Ga0495612_0165009 3300053078 Bacteria 968
987 Ga0495612_0253686 3300053078 Bacteria 783
988 Ga0495612_0288383 3300053078 Bacteria 734
989 Ga0495655_0017923 3300053083 Bacteria 1549
990 Ga0495655_0025243 3300053083 Bacteria 1388
991 Ga0495655_0101535 3300053083 Bacteria 852
992 Ga0495595_0004844 3300053084 Bacteria 5423
993 Ga0495595_0148044 3300053084 Bacteria 1154
994 Ga0495595_0418241 3300053084 Bacteria 680
995 Ga0495619_0000352 3300053085 Bacteria 32130
996 Ga0495619_0010530 3300053085 Bacteria 5818
997 Ga0495619_0045598 3300053085 Bacteria 2881
998 Ga0495619_0045969 3300053085 Bacteria 2869
999 Ga0495619_0166118 3300053085 Bacteria 1525
1000 Ga0495619_0179612 3300053085 Bacteria 1464
1001 Ga0495619_0191997 3300053085 Bacteria 1413
1002 Ga0500641_0125834 3300053096 Bacteria 1105
1003 Ga0500593_084718 3300053117 Bacteria 1351
1004 Ga0500595_011107 3300053119 Bacteria 3542
1005 Ga0500618_000860 3300053125 Bacteria 16314
1006 Ga0500621_122208 3300053126 Bacteria 1007
1007 Ga0500652_273294 3300053131 Bacteria 662
1008 Ga0500658_0044982 3300053134 Bacteria 1783
1009 Ga0500568_0042111 3300053139 Bacteria 1831
1010 Ga0500568_0265441 3300053139 Bacteria 624
1011 Ga0500588_0276142 3300053146 Bacteria 634
1012 Ga0500616_0208584 3300053153 Bacteria 860
1013 Ga0500627_0081919 3300053158 Bacteria 1439
1014 Ga0500611_109547 3300053727 Bacteria 724
1015 Ga0500645_154890 3300053730 Bacteria 630
1016 Ga0501084_0188499 3300054114 Bacteria 1740
1017 Ga0501084_0243069 3300054114 Bacteria 1519
1018 Ga0501084_1178008 3300054114 Bacteria 643
1019 Ga0587084_090543 3300059477 Bacteria 606
1020 Ga0587093_062453 3300059478 Bacteria 611
1021 Ga0587083_0113579 3300059505 Bacteria 691
1022 Ga0587090_135814 3300059510 Bacteria 546
1023 Ga0587098_043264 3300059604 Bacteria 662
1024 Ga0587101_000419 3300059623 Bacteria 2969
1025 Ga0587130_020096 3300059631 Bacteria 718
1026 Ga0587072_104372 3300059643 Bacteria 640
1027 Ga0587107_102817 3300059652 Bacteria 568
1028 Ga0501082_0516650 3300060353 Bacteria 1044
1029 Ga0501082_1207199 3300060353 Bacteria 661
1030 Ga0530510_0136279 3300061734 Bacteria 1807
1031 Ga0530510_0383972 3300061734 Bacteria 1057

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015261 Ga0182006_1000240 Ga0182006_100024020 109
2 3300015262 Ga0182007_10045164 Ga0182007_100451642 109
3 3300015265 Ga0182005_1000016 Ga0182005_1000016276 109
4 3300046453 Ga0495627_000011 Ga0495627_000011_334214_334555 109
5 3300046530 Ga0495654_0205544 Ga0495654_0205544_338_679 109
6 3300046538 Ga0495609_0096531 Ga0495609_0096531_150_491 109
7 3300046810 Ga0495660_0000905 Ga0495660_0000905_616_957 109
8 3300047470 Ga0495681_0268683 Ga0495681_0268683_94_435 109
9 3300048927 Ga0496124_0037873 Ga0496124_0037873_3599_3940 109
10 3300049459 Ga0495678_000010 Ga0495678_000010_340638_340979 109
11 3300053125 Ga0500618_000860 Ga0500618_000860_15940_16281 109
12 iso_pu_bacteria 2857553236 2857556274 124
13 iso_pu_bacteria 2919476304 2919476964 124
14 3300031251 Ga0265327_10000218 Ga0265327_10000218114 125
15 3300036647 Ga0316582_0809702 Ga0316582_0809702_37_477 127
16 3300002737 JGI25162J39368_1000154 JGI25162J39368_100015459 128
17 3300002772 JGI25164J39214_1018510 JGI25164J39214_10185101 128
18 3300003214 JGI25165J46597_1000239 JGI25165J46597_100023929 128
19 3300003751 Ga0055538_1000094 Ga0055538_100009429 128
20 3300003752 Ga0055539_1000136 Ga0055539_100013629 128
21 3300003756 Ga0055533_1000143 Ga0055533_100014359 128
22 3300003759 Ga0055525_1000188 Ga0055525_100018859 128
23 3300003775 Ga0055524_1000024 Ga0055524_100002413 128
24 3300003841 Ga0055541_1000092 Ga0055541_100009259 128
25 3300006946 Ga0079104_1004902 Ga0079104_10049023 128
26 3300009101 Ga0105247_10353983 Ga0105247_103539832 128
27 3300009176 Ga0105242_11366899 Ga0105242_113668991 128
28 3300015265 Ga0182005_1000370 Ga0182005_10003709 128
29 3300025207 Ga0209760_103118 Ga0209760_1031182 128
30 3300025224 Ga0209784_100010 Ga0209784_100010324 128
31 3300025225 Ga0209566_100008 Ga0209566_100008324 128
32 3300025226 Ga0209674_100019 Ga0209674_100019324 128
33 3300025228 Ga0209672_107197 Ga0209672_1071972 128
34 3300025230 Ga0209563_100021 Ga0209563_100021324 128
35 3300025231 Ga0207427_100342 Ga0207427_10034219 128
36 3300025233 Ga0209437_100019 Ga0209437_100019324 128
37 3300025253 Ga0209677_100011 Ga0209677_100011324 128
38 3300025261 Ga0209233_1000025 Ga0209233_1000025324 128
39 3300025299 Ga0209256_1000054 Ga0209256_1000054238 128
40 3300025934 Ga0207686_11221305 Ga0207686_112213051 128
41 3300027111 Ga0209281_1004227 Ga0209281_10042272 128
42 3300027666 Ga0209282_1000072 Ga0209282_100007247 128
43 3300035691 Ga0373931_1149383 Ga0373931_1149383_124_519 128
44 3300039447 Ga0436361_0496844 Ga0436361_0496844_1159_1557 128
45 3300046462 Ga0495651_0019173 Ga0495651_0019173_1269_1664 128
46 3300046516 Ga0495628_0000109 Ga0495628_0000109_65874_66269 128
47 3300046529 Ga0495652_0183098 Ga0495652_0183098_268_663 128
48 3300046530 Ga0495654_0213446 Ga0495654_0213446_35_466 128
49 3300046679 Ga0495623_0098854 Ga0495623_0098854_1307_1702 128
50 3300046680 Ga0495646_0004357 Ga0495646_0004357_1233_1628 128
51 3300046690 Ga0495624_0159051 Ga0495624_0159051_158_553 128
52 3300047321 Ga0495676_0878645 Ga0495676_0878645_47_442 128
53 3300048088 Ga0495602_0189487 Ga0495602_0189487_689_1084 128
54 3300049161 Ga0501305_037687 Ga0501305_037687_12_407 128
55 3300049536 Ga0501320_007545 Ga0501320_007545_459_854 128
56 3300049551 Ga0501335_034801 Ga0501335_034801_19_414 128
57 3300053077 Ga0495601_0155985 Ga0495601_0155985_120_515 128
58 3300053078 Ga0495612_0253686 Ga0495612_0253686_68_463 128
59 3300006175 Ga0070712_100045106 Ga0070712_1000451063 129
60 3300025915 Ga0207693_10026097 Ga0207693_100260972 129
61 3300005435 Ga0070714_100599229 Ga0070714_1005992291 130
62 3300005436 Ga0070713_100003041 Ga0070713_10000304114 130
63 3300005437 Ga0070710_10346611 Ga0070710_103466112 130
64 3300005444 Ga0070694_100250827 Ga0070694_1002508272 130
65 3300005445 Ga0070708_100063487 Ga0070708_1000634872 130
66 3300005467 Ga0070706_100187749 Ga0070706_1001877492 130
67 3300005518 Ga0070699_100644965 Ga0070699_1006449652 130
68 3300006871 Ga0075434_101495489 Ga0075434_1014954891 130
69 3300007076 Ga0075435_100085297 Ga0075435_1000852972 130
70 3300007265 Ga0099794_10149209 Ga0099794_101492092 130
71 3300025910 Ga0207684_10093438 Ga0207684_100934382 130
72 3300025922 Ga0207646_10045479 Ga0207646_100454796 130
73 3300025928 Ga0207700_10177935 Ga0207700_101779352 130
74 3300027671 Ga0209588_1076389 Ga0209588_10763891 130
75 3300050515 nmdc:mga0a205_27812_c1 nmdc:mga0a205_27812_c1_691_1125 130
76 3300005518 Ga0070699_100003254 Ga0070699_10000325416 131
77 3300005937 Ga0081455_10097760 Ga0081455_100977602 131
78 3300006173 Ga0070716_100217271 Ga0070716_1002172712 131
79 3300009147 Ga0114129_10732661 Ga0114129_107326612 131
80 3300025939 Ga0207665_10253370 Ga0207665_102533702 131
81 3300048914 Ga0496111_0190545 Ga0496111_0190545_377_811 131
82 3300050512 nmdc:mga0n895_859334_c1 nmdc:mga0n895_859334_c1_412_846 131
83 3300005937 Ga0081455_10283150 Ga0081455_102831502 132
84 3300048929 Ga0496126_0510208 Ga0496126_0510208_391_792 133
85 iso_pu_bacteria 2891088606 2891092408 133
86 iso_pu_bacteria 8002060224 8002061423 133
87 iso_pu_bacteria 2842694124 2842694303 135
88 3300005841 Ga0068863_100251746 Ga0068863_1002517462 136
89 3300026088 Ga0207641_10051381 Ga0207641_100513812 136
90 3300028380 Ga0268265_10582116 Ga0268265_105821161 136
91 3300049577 Ga0501041_0169046 Ga0501041_0169046_835_1275 136
92 3300049593 Ga0501077_0202831 Ga0501077_0202831_704_1144 136
93 3300060353 Ga0501082_0516650 Ga0501082_0516650_130_546 136
94 iso_pu_bacteria 2828305725 2828309652 136
95 3300028379 Ga0268266_11463495 Ga0268266_114634951 137
96 3300031239 Ga0265328_10003667 Ga0265328_100036674 137
97 3300031239 Ga0265328_10126304 Ga0265328_101263041 137
98 3300031239 Ga0265328_10126657 Ga0265328_101266572 137
99 3300031250 Ga0265331_10013159 Ga0265331_100131593 137
100 3300031250 Ga0265331_10078977 Ga0265331_100789773 137
101 3300031251 Ga0265327_10037439 Ga0265327_100374392 137
102 3300031251 Ga0265327_10081747 Ga0265327_100817473 137
103 3300031251 Ga0265327_10101632 Ga0265327_101016322 137
104 3300031344 Ga0265316_10021166 Ga0265316_100211666 137
105 3300039437 Ga0436365_0697746 Ga0436365_0697746_9442_9855 137
106 3300039438 Ga0436360_0096403 Ga0436360_0096403_79_492 137
107 3300041452 Ga0451793_0071024 Ga0451793_0071024_166_579 137
108 3300048904 Ga0496101_0662127 Ga0496101_0662127_228_641 137
109 3300048906 Ga0496103_0358999 Ga0496103_0358999_25_438 137
110 3300049569 Ga0501032_0561004 Ga0501032_0561004_146_559 137
111 3300050492 nmdc:mga0yw44_1084417_c1 nmdc:mga0yw44_1084417_c1_94_507 137
112 3300053134 Ga0500658_0044982 Ga0500658_0044982_222_635 137
113 3300053139 Ga0500568_0042111 Ga0500568_0042111_154_567 137
114 iso_pu_bacteria 2599185236 2599721239 137
115 iso_pu_bacteria 2643221629 2644165877 137
116 iso_pu_bacteria 2643221662 2644347113 137
117 iso_pu_bacteria 2757320392 2757572036 137
118 iso_pu_bacteria 2932401849 2932403087 137
119 3300003579 Ga0007429J51699_1104387 Ga0007429J51699_11043871 138
120 3300005338 Ga0068868_101766949 Ga0068868_1017669491 138
121 3300006178 Ga0075367_10202684 Ga0075367_102026842 138
122 3300006186 Ga0075369_10011962 Ga0075369_100119624 138
123 3300006195 Ga0075366_10239679 Ga0075366_102396792 138
124 3300006871 Ga0075434_100116288 Ga0075434_1001162882 138
125 3300009093 Ga0105240_11460572 Ga0105240_114605722 138
126 3300026023 Ga0207677_10539774 Ga0207677_105397741 138
127 3300028381 Ga0268264_12074500 Ga0268264_120745002 138
128 3300031250 Ga0265331_10000090 Ga0265331_1000009030 138
129 3300031344 Ga0265316_10280285 Ga0265316_102802852 138
130 3300031456 Ga0307513_10087877 Ga0307513_100878775 138
131 3300031456 Ga0307513_10832300 Ga0307513_108323002 138
132 3300036459 Ga0372808_035557 Ga0372808_035557_121_537 138
133 3300037853 Ga0436364_0979867 Ga0436364_0979867_714_1130 138
134 3300037853 Ga0436364_1483415 Ga0436364_1483415_184_621 138
135 3300042016 Ga0439463_141242 Ga0439463_141242_56_472 138
136 3300046452 Ga0495617_214884 Ga0495617_214884_16_432 138
137 3300046499 Ga0495594_0572743 Ga0495594_0572743_195_611 138
138 3300046507 Ga0495606_0315616 Ga0495606_0315616_309_725 138
139 3300046524 Ga0495648_0255409 Ga0495648_0255409_337_753 138
140 3300047318 Ga0495636_0576654 Ga0495636_0576654_38_454 138
141 3300049744 Ga0501083_0281053 Ga0501083_0281053_595_1011 138
142 3300050494 nmdc:mga06z11_193982_c1 nmdc:mga06z11_193982_c1_196_612 138
143 3300050496 nmdc:mga07m45_689723_c1 nmdc:mga07m45_689723_c1_10_426 138
144 3300053096 Ga0500641_0125834 Ga0500641_0125834_655_1071 138
145 3300053126 Ga0500621_122208 Ga0500621_122208_183_599 138
146 3300053131 Ga0500652_273294 Ga0500652_273294_169_585 138
147 3300053139 Ga0500568_0265441 Ga0500568_0265441_34_450 138
148 3300053146 Ga0500588_0276142 Ga0500588_0276142_94_510 138
149 3300053730 Ga0500645_154890 Ga0500645_154890_70_486 138
150 iso_pu_bacteria 2837651117 2837653714 138
151 iso_pu_bacteria 2937843397 2937845895 138
152 3300021384 Ga0213876_10100124 Ga0213876_101001242 139
153 3300037068 Ga0373925_0076265 Ga0373925_0076265_1975_2394 139
154 3300037853 Ga0436364_1047052 Ga0436364_1047052_306_725 139
155 3300050494 nmdc:mga06z11_772336_c1 nmdc:mga06z11_772336_c1_44_466 139
156 3300005539 Ga0068853_100166407 Ga0068853_1001664072 140
157 3300006048 Ga0075363_100438326 Ga0075363_1004383261 140
158 3300010375 Ga0105239_10190771 Ga0105239_101907713 140
159 3300010375 Ga0105239_12977552 Ga0105239_129775521 140
160 3300025928 Ga0207700_10071304 Ga0207700_100713043 140
161 3300025939 Ga0207665_11631880 Ga0207665_116318801 140
162 3300026041 Ga0207639_10821507 Ga0207639_108215071 140
163 3300027876 Ga0209974_10105949 Ga0209974_101059492 140
164 3300031456 Ga0307513_10737988 Ga0307513_107379881 140
165 3300031507 Ga0307509_10708167 Ga0307509_107081671 140
166 3300031824 Ga0307413_11275995 Ga0307413_112759951 140
167 3300031911 Ga0307412_10843904 Ga0307412_108439041 140
168 3300031995 Ga0307409_101905305 Ga0307409_1019053051 140
169 3300035118 Ga0373954_0164172 Ga0373954_0164172_570_992 140
170 3300035170 Ga0373943_0283015 Ga0373943_0283015_308_730 140
171 3300035692 Ga0373935_0054512 Ga0373935_0054512_1081_1503 140
172 3300035695 Ga0373927_0000971 Ga0373927_0000971_6756_7178 140
173 3300037068 Ga0373925_0002443 Ga0373925_0002443_8037_8459 140
174 3300037471 Ga0395905_0008689 Ga0395905_0008689_6637_7059 140
175 3300037471 Ga0395905_0082966 Ga0395905_0082966_415_837 140
176 3300037853 Ga0436364_1158099 Ga0436364_1158099_755_1177 140
177 3300039450 Ga0436363_0823825 Ga0436363_0823825_145_567 140
178 3300039453 Ga0436362_0991724 Ga0436362_0991724_14_436 140
179 3300044658 Ga0466972_0372016 Ga0466972_0372016_102_524 140
180 3300046463 Ga0495653_0312035 Ga0495653_0312035_141_563 140
181 3300046536 Ga0495587_0168412 Ga0495587_0168412_789_1211 140
182 3300047444 Ga0495675_0481078 Ga0495675_0481078_170_592 140
183 3300048088 Ga0495602_0272000 Ga0495602_0272000_751_1173 140
184 3300048921 Ga0496118_0207542 Ga0496118_0207542_145_567 140
185 3300049127 Ga0501306_071010 Ga0501306_071010_151_573 140
186 3300049162 Ga0501307_002993 Ga0501307_002993_1188_1610 140
187 3300049530 Ga0501314_003548 Ga0501314_003548_824_1246 140
188 3300049571 Ga0501034_0840754 Ga0501034_0840754_25_447 140
189 3300049572 Ga0501036_0237665 Ga0501036_0237665_1003_1425 140
190 3300049573 Ga0501037_0166555 Ga0501037_0166555_726_1148 140
191 3300049574 Ga0501038_0234608 Ga0501038_0234608_122_544 140
192 3300049581 Ga0501047_0216277 Ga0501047_0216277_837_1259 140
193 3300049581 Ga0501047_0376219 Ga0501047_0376219_160_582 140
194 3300049586 Ga0501070_0413462 Ga0501070_0413462_155_577 140
195 3300049588 Ga0501072_0001866 Ga0501072_0001866_2337_2759 140
196 3300049589 Ga0501073_0763852 Ga0501073_0763852_53_475 140
197 3300049589 Ga0501073_1070338 Ga0501073_1070338_95_517 140
198 3300049744 Ga0501083_0065092 Ga0501083_0065092_1028_1450 140
199 3300050490 nmdc:mga03n38_303995_c1 nmdc:mga03n38_303995_c1_250_672 140
200 3300053078 Ga0495612_0165009 Ga0495612_0165009_80_502 140
201 3300053083 Ga0495655_0017923 Ga0495655_0017923_1082_1507 140
202 3300053085 Ga0495619_0166118 Ga0495619_0166118_505_927 140
203 3300053153 Ga0500616_0208584 Ga0500616_0208584_414_836 140
204 3300053727 Ga0500611_109547 Ga0500611_109547_96_542 140
205 3300054114 Ga0501084_0188499 Ga0501084_0188499_54_476 140
206 3300054114 Ga0501084_1178008 Ga0501084_1178008_68_490 140
207 3300059477 Ga0587084_090543 Ga0587084_090543_166_588 140
208 3300059478 Ga0587093_062453 Ga0587093_062453_165_587 140
209 3300059505 Ga0587083_0113579 Ga0587083_0113579_12_434 140
210 3300059652 Ga0587107_102817 Ga0587107_102817_16_438 140
211 3300060353 Ga0501082_1207199 Ga0501082_1207199_173_595 140
212 3300003794 Ga0055531_10002421 Ga0055531_1000242110 141
213 3300005327 Ga0070658_11116623 Ga0070658_111166232 141
214 3300005340 Ga0070689_100278703 Ga0070689_1002787032 141
215 3300005341 Ga0070691_10869368 Ga0070691_108693681 141
216 3300005347 Ga0070668_100276299 Ga0070668_1002762992 141
217 3300005347 Ga0070668_100520394 Ga0070668_1005203942 141
218 3300005354 Ga0070675_100487395 Ga0070675_1004873952 141
219 3300005356 Ga0070674_100586808 Ga0070674_1005868082 141
220 3300005356 Ga0070674_100918020 Ga0070674_1009180202 141
221 3300005364 Ga0070673_100566972 Ga0070673_1005669722 141
222 3300005471 Ga0070698_100086614 Ga0070698_1000866144 141
223 3300005548 Ga0070665_101114008 Ga0070665_1011140082 141
224 3300005549 Ga0070704_100682280 Ga0070704_1006822802 141
225 3300005618 Ga0068864_102305694 Ga0068864_1023056941 141
226 3300005840 Ga0068870_10452523 Ga0068870_104525231 141
227 3300005844 Ga0068862_100680860 Ga0068862_1006808602 141
228 3300005985 Ga0081539_10116951 Ga0081539_101169512 141
229 3300006051 Ga0075364_10362453 Ga0075364_103624531 141
230 3300006844 Ga0075428_101071610 Ga0075428_1010716102 141
231 3300006847 Ga0075431_101284843 Ga0075431_1012848431 141
232 3300006880 Ga0075429_100921396 Ga0075429_1009213962 141
233 3300007788 Ga0099795_10481088 Ga0099795_104810881 141
234 3300009094 Ga0111539_10407003 Ga0111539_104070032 141
235 3300009098 Ga0105245_11689775 Ga0105245_116897751 141
236 3300009553 Ga0105249_10318767 Ga0105249_103187672 141
237 3300013296 Ga0157374_10953973 Ga0157374_109539732 141
238 3300013306 Ga0163162_10785622 Ga0163162_107856221 141
239 3300014326 Ga0157380_10888444 Ga0157380_108884441 141
240 3300014326 Ga0157380_11513121 Ga0157380_115131212 141
241 3300014326 Ga0157380_11946444 Ga0157380_119464441 141
242 3300017792 Ga0163161_10462864 Ga0163161_104628642 141
243 3300020069 Ga0197907_10230911 Ga0197907_102309111 141
244 3300021384 Ga0213876_10003406 Ga0213876_100034065 141
245 3300025918 Ga0207662_10220396 Ga0207662_102203961 141
246 3300025924 Ga0207694_11168136 Ga0207694_111681362 141
247 3300025926 Ga0207659_10303959 Ga0207659_103039592 141
248 3300025929 Ga0207664_10472073 Ga0207664_104720732 141
249 3300025960 Ga0207651_10212938 Ga0207651_102129382 141
250 3300025972 Ga0207668_10010942 Ga0207668_100109422 141
251 3300026075 Ga0207708_10390231 Ga0207708_103902312 141
252 3300027907 Ga0207428_10040253 Ga0207428_100402536 141
253 3300028380 Ga0268265_10053404 Ga0268265_100534043 141
254 3300028794 Ga0307515_10790759 Ga0307515_107907591 141
255 3300031235 Ga0265330_10042093 Ga0265330_100420932 141
256 3300031238 Ga0265332_10026242 Ga0265332_100262422 141
257 3300031238 Ga0265332_10375051 Ga0265332_103750511 141
258 3300031240 Ga0265320_10023886 Ga0265320_100238863 141
259 3300031241 Ga0265325_10018308 Ga0265325_100183082 141
260 3300031247 Ga0265340_10016859 Ga0265340_100168592 141
261 3300031249 Ga0265339_10034939 Ga0265339_100349392 141
262 3300031250 Ga0265331_10043884 Ga0265331_100438842 141
263 3300031344 Ga0265316_10054706 Ga0265316_100547061 141
264 3300031344 Ga0265316_10116081 Ga0265316_101160812 141
265 3300031456 Ga0307513_10135600 Ga0307513_101356003 141
266 3300031595 Ga0265313_10027323 Ga0265313_100273233 141
267 3300031595 Ga0265313_10085817 Ga0265313_100858172 141
268 3300031711 Ga0265314_10188606 Ga0265314_101886062 141
269 3300031712 Ga0265342_10034741 Ga0265342_100347412 141
270 3300031712 Ga0265342_10093841 Ga0265342_100938412 141
271 3300032005 Ga0307411_10583210 Ga0307411_105832102 141
272 3300035084 Ga0373928_0252428 Ga0373928_0252428_18_443 141
273 3300035112 Ga0373932_0041859 Ga0373932_0041859_201_626 141
274 3300037853 Ga0436364_1537292 Ga0436364_1537292_315_740 141
275 3300041408 Ga0439453_0000173 Ga0439453_0000173_4486_4911 141
276 3300041461 Ga0451805_116338 Ga0451805_116338_18_443 141
277 3300042001 Ga0439441_041429 Ga0439441_041429_447_872 141
278 3300042003 Ga0439443_015095 Ga0439443_015095_151_576 141
279 3300042436 Ga0439435_0032006 Ga0439435_0032006_21_446 141
280 3300044842 Ga0466957_0251445 Ga0466957_0251445_361_786 141
281 3300046462 Ga0495651_0202596 Ga0495651_0202596_482_910 141
282 3300046536 Ga0495587_0155381 Ga0495587_0155381_442_870 141
283 3300046558 Ga0495633_0337541 Ga0495633_0337541_20_448 141
284 3300046642 Ga0495634_0355697 Ga0495634_0355697_89_517 141
285 3300046691 Ga0495670_0406344 Ga0495670_0406344_248_673 141
286 3300047322 Ga0495680_0512258 Ga0495680_0512258_22_450 141
287 3300048088 Ga0495602_0110082 Ga0495602_0110082_1568_1996 141
288 3300048907 Ga0496104_0006531 Ga0496104_0006531_420_851 141
289 3300048908 Ga0496105_0025920 Ga0496105_0025920_266_697 141
290 3300048909 Ga0496106_0065773 Ga0496106_0065773_547_978 141
291 3300048912 Ga0496109_0512580 Ga0496109_0512580_643_1074 141
292 3300048924 Ga0496121_0228399 Ga0496121_0228399_130_555 141
293 3300049537 Ga0501321_020521 Ga0501321_020521_18_443 141
294 3300049541 Ga0501325_041690 Ga0501325_041690_123_548 141
295 3300049570 Ga0501033_0020312 Ga0501033_0020312_3167_3598 141
296 3300049570 Ga0501033_0270826 Ga0501033_0270826_547_972 141
297 3300049580 Ga0501046_0014121 Ga0501046_0014121_4827_5258 141
298 3300049581 Ga0501047_0734332 Ga0501047_0734332_165_590 141
299 3300049581 Ga0501047_0934499 Ga0501047_0934499_110_535 141
300 3300049585 Ga0501069_0370577 Ga0501069_0370577_201_650 141
301 3300049586 Ga0501070_0112554 Ga0501070_0112554_381_812 141
302 3300049589 Ga0501073_0603889 Ga0501073_0603889_225_674 141
303 3300049742 Ga0501080_1293859 Ga0501080_1293859_94_525 141
304 3300049744 Ga0501083_0290557 Ga0501083_0290557_265_714 141
305 3300049823 Ga0501044_0052273 Ga0501044_0052273_612_1043 141
306 3300050489 nmdc:mga03683_229376_c1 nmdc:mga03683_229376_c1_273_698 141
307 3300050491 nmdc:mga00v17_494975_c1 nmdc:mga00v17_494975_c1_329_754 141
308 3300050492 nmdc:mga0yw44_570533_c1 nmdc:mga0yw44_570533_c1_293_721 141
309 3300050493 nmdc:mga0k408_103293_c1 nmdc:mga0k408_103293_c1_1096_1521 141
310 3300050507 nmdc:mga05p37_2105657_c1 nmdc:mga05p37_2105657_c1_23_448 141
311 3300050510 nmdc:mga06r32_1234254_c1 nmdc:mga06r32_1234254_c1_142_567 141
312 3300050511 nmdc:mga08y16_256541_c1 nmdc:mga08y16_256541_c1_478_903 141
313 3300053077 Ga0495601_0010741 Ga0495601_0010741_1338_1766 141
314 3300053078 Ga0495612_0288383 Ga0495612_0288383_15_443 141
315 3300053084 Ga0495595_0148044 Ga0495595_0148044_107_535 141
316 3300053085 Ga0495619_0010530 Ga0495619_0010530_899_1327 141
317 3300053119 Ga0500595_011107 Ga0500595_011107_2993_3424 141
318 3300059510 Ga0587090_135814 Ga0587090_135814_107_532 141
319 3300059604 Ga0587098_043264 Ga0587098_043264_221_646 141
320 3300059623 Ga0587101_000419 Ga0587101_000419_18_443 141
321 3300059631 Ga0587130_020096 Ga0587130_020096_280_705 141
322 3300059643 Ga0587072_104372 Ga0587072_104372_199_624 141
323 3300005327 Ga0070658_10052412 Ga0070658_100524124 142
324 3300005327 Ga0070658_10154512 Ga0070658_101545122 142
325 3300005336 Ga0070680_100164388 Ga0070680_1001643882 142
326 3300005336 Ga0070680_100225381 Ga0070680_1002253812 142
327 3300005339 Ga0070660_100023815 Ga0070660_1000238156 142
328 3300005344 Ga0070661_101167973 Ga0070661_1011679731 142
329 3300005355 Ga0070671_101103474 Ga0070671_1011034741 142
330 3300005435 Ga0070714_101044381 Ga0070714_1010443811 142
331 3300005436 Ga0070713_100872583 Ga0070713_1008725832 142
332 3300005458 Ga0070681_10004121 Ga0070681_100041214 142
333 3300005458 Ga0070681_10115719 Ga0070681_101157192 142
334 3300005458 Ga0070681_10980726 Ga0070681_109807261 142
335 3300005530 Ga0070679_100059322 Ga0070679_1000593222 142
336 3300005530 Ga0070679_100080701 Ga0070679_1000807012 142
337 3300005530 Ga0070679_100206200 Ga0070679_1002062002 142
338 3300005536 Ga0070697_100767954 Ga0070697_1007679541 142
339 3300005563 Ga0068855_100293663 Ga0068855_1002936633 142
340 3300005981 Ga0081538_10001041 Ga0081538_1000104135 142
341 3300006028 Ga0070717_10384655 Ga0070717_103846552 142
342 3300006028 Ga0070717_10569423 Ga0070717_105694231 142
343 3300006173 Ga0070716_101096905 Ga0070716_1010969051 142
344 3300006237 Ga0097621_100175675 Ga0097621_1001756752 142
345 3300006844 Ga0075428_100475503 Ga0075428_1004755032 142
346 3300006847 Ga0075431_100113920 Ga0075431_1001139202 142
347 3300006914 Ga0075436_100095184 Ga0075436_1000951842 142
348 3300007788 Ga0099795_10003005 Ga0099795_100030051 142
349 3300009093 Ga0105240_10473503 Ga0105240_104735032 142
350 3300009147 Ga0114129_10544522 Ga0114129_105445222 142
351 3300009553 Ga0105249_10745979 Ga0105249_107459791 142
352 3300010159 Ga0099796_10539450 Ga0099796_105394501 142
353 3300010375 Ga0105239_10342018 Ga0105239_103420182 142
354 3300013102 Ga0157371_10185602 Ga0157371_101856022 142
355 3300013104 Ga0157370_10253447 Ga0157370_102534472 142
356 3300013105 Ga0157369_10212075 Ga0157369_102120752 142
357 3300013306 Ga0163162_11142656 Ga0163162_111426562 142
358 3300014968 Ga0157379_10750918 Ga0157379_107509182 142
359 3300014968 Ga0157379_12244788 Ga0157379_122447881 142
360 3300014969 Ga0157376_10035452 Ga0157376_100354524 142
361 3300017792 Ga0163161_11739808 Ga0163161_117398081 142
362 3300024225 Ga0224572_1020774 Ga0224572_10207741 142
363 3300024227 Ga0228598_1010790 Ga0228598_10107902 142
364 3300024227 Ga0228598_1017982 Ga0228598_10179822 142
365 3300025898 Ga0207692_10022644 Ga0207692_100226444 142
366 3300025905 Ga0207685_10263207 Ga0207685_102632072 142
367 3300025909 Ga0207705_10156275 Ga0207705_101562752 142
368 3300025910 Ga0207684_11475991 Ga0207684_114759911 142
369 3300025912 Ga0207707_10034403 Ga0207707_100344035 142
370 3300025912 Ga0207707_10122288 Ga0207707_101222883 142
371 3300025913 Ga0207695_10150615 Ga0207695_101506154 142
372 3300025915 Ga0207693_10001042 Ga0207693_100010427 142
373 3300025915 Ga0207693_10785899 Ga0207693_107858991 142
374 3300025916 Ga0207663_10910732 Ga0207663_109107321 142
375 3300025917 Ga0207660_10054606 Ga0207660_100546062 142
376 3300025919 Ga0207657_10152689 Ga0207657_101526892 142
377 3300025919 Ga0207657_10647971 Ga0207657_106479712 142
378 3300025920 Ga0207649_10733741 Ga0207649_107337412 142
379 3300025921 Ga0207652_10058813 Ga0207652_100588133 142
380 3300025921 Ga0207652_10130752 Ga0207652_101307523 142
381 3300025921 Ga0207652_10227263 Ga0207652_102272632 142
382 3300025921 Ga0207652_10548286 Ga0207652_105482861 142
383 3300025926 Ga0207659_10701414 Ga0207659_107014142 142
384 3300025928 Ga0207700_11374416 Ga0207700_113744161 142
385 3300025933 Ga0207706_11196905 Ga0207706_111969051 142
386 3300025939 Ga0207665_11386972 Ga0207665_113869721 142
387 3300025949 Ga0207667_10004001 Ga0207667_100040012 142
388 3300025961 Ga0207712_10880455 Ga0207712_108804551 142
389 3300025981 Ga0207640_10556432 Ga0207640_105564322 142
390 3300026075 Ga0207708_11060290 Ga0207708_110602901 142
391 3300026078 Ga0207702_10483675 Ga0207702_104836751 142
392 3300026142 Ga0207698_10842250 Ga0207698_108422502 142
393 3300028023 Ga0265357_1003756 Ga0265357_10037561 142
394 3300028800 Ga0265338_10078200 Ga0265338_100782002 142
395 3300028800 Ga0265338_10531168 Ga0265338_105311681 142
396 3300030760 Ga0265762_1032276 Ga0265762_10322762 142
397 3300030763 Ga0265763_1001116 Ga0265763_10011162 142
398 3300030878 Ga0265770_1015363 Ga0265770_10153631 142
399 3300030878 Ga0265770_1129891 Ga0265770_11298911 142
400 3300031018 Ga0265773_1005799 Ga0265773_10057991 142
401 3300031090 Ga0265760_10033681 Ga0265760_100336812 142
402 3300031090 Ga0265760_10033778 Ga0265760_100337781 142
403 3300031090 Ga0265760_10091086 Ga0265760_100910862 142
404 3300031090 Ga0265760_10237859 Ga0265760_102378591 142
405 3300031241 Ga0265325_10000449 Ga0265325_1000044927 142
406 3300031247 Ga0265340_10189420 Ga0265340_101894202 142
407 3300031249 Ga0265339_10000053 Ga0265339_100000533 142
408 3300031595 Ga0265313_10000098 Ga0265313_1000009884 142
409 3300031595 Ga0265313_10003687 Ga0265313_100036874 142
410 3300031712 Ga0265342_10311122 Ga0265342_103111222 142
411 3300031730 Ga0307516_10161320 Ga0307516_101613202 142
412 3300032126 Ga0307415_101261050 Ga0307415_1012610502 142
413 3300033524 Ga0316592_1114322 Ga0316592_11143222 142
414 3300033541 Ga0316596_1136759 Ga0316596_11367591 142
415 3300035083 Ga0373926_0432410 Ga0373926_0432410_14_442 142
416 3300035086 Ga0373934_0062611 Ga0373934_0062611_233_661 142
417 3300035111 Ga0373923_0152772 Ga0373923_0152772_336_764 142
418 3300035112 Ga0373932_0245400 Ga0373932_0245400_187_627 142
419 3300035118 Ga0373954_0066947 Ga0373954_0066947_480_908 142
420 3300035119 Ga0373956_0266738 Ga0373956_0266738_364_792 142
421 3300035121 Ga0373960_0005814 Ga0373960_0005814_1072_1512 142
422 3300035207 Ga0373942_0045451 Ga0373942_0045451_635_1075 142
423 3300035241 Ga0373961_0206424 Ga0373961_0206424_157_591 142
424 3300035242 Ga0373962_0167214 Ga0373962_0167214_197_637 142
425 3300035398 Ga0316574_0384775 Ga0316574_0384775_352_780 142
426 3300035410 Ga0373924_0043824 Ga0373924_0043824_851_1279 142
427 3300035691 Ga0373931_0154720 Ga0373931_0154720_274_714 142
428 3300035692 Ga0373935_0251032 Ga0373935_0251032_23_451 142
429 3300035695 Ga0373927_0017276 Ga0373927_0017276_3691_4119 142
430 3300035724 Ga0373933_0000858 Ga0373933_0000858_8847_9275 142
431 3300035724 Ga0373933_1033357 Ga0373933_1033357_64_492 142
432 3300035725 Ga0373947_0093951 Ga0373947_0093951_666_1106 142
433 3300036401 Ga0373937_0002560 Ga0373937_0002560_47_475 142
434 3300036647 Ga0316582_0120853 Ga0316582_0120853_1089_1517 142
435 3300037068 Ga0373925_0016615 Ga0373925_0016615_4328_4756 142
436 3300037068 Ga0373925_0086532 Ga0373925_0086532_678_1118 142
437 3300037068 Ga0373925_0829984 Ga0373925_0829984_266_706 142
438 3300037312 Ga0395899_0000073 Ga0395899_0000073_83014_83442 142
439 3300037418 Ga0395900_0000027 Ga0395900_0000027_187584_188012 142
440 3300037466 Ga0395898_0000255 Ga0395898_0000255_32644_33072 142
441 3300037471 Ga0395905_0000032 Ga0395905_0000032_97921_98349 142
442 3300038443 Ga0395901_0000110 Ga0395901_0000110_97946_98374 142
443 3300039437 Ga0436365_1428905 Ga0436365_1428905_421_873 142
444 3300039438 Ga0436360_1301919 Ga0436360_1301919_389_817 142
445 3300039450 Ga0436363_0177757 Ga0436363_0177757_288_719 142
446 3300039453 Ga0436362_0617508 Ga0436362_0617508_103_531 142
447 3300041406 Ga0439439_0159716 Ga0439439_0159716_174_605 142
448 3300042001 Ga0439441_051867 Ga0439441_051867_384_815 142
449 3300044684 Ga0466966_0121358 Ga0466966_0121358_860_1288 142
450 3300044694 Ga0466963_0141593 Ga0466963_0141593_611_1039 142
451 3300044842 Ga0466957_0031161 Ga0466957_0031161_2607_3035 142
452 3300045049 Ga0466959_0096694 Ga0466959_0096694_658_1086 142
453 3300045836 Ga0466958_0008139 Ga0466958_0008139_2051_2479 142
454 3300045976 Ga0466967_1017772 Ga0466967_1017772_82_510 142
455 3300046454 Ga0495592_0004065 Ga0495592_0004065_5434_5862 142
456 3300046455 Ga0495603_0092189 Ga0495603_0092189_482_910 142
457 3300046459 Ga0495629_0003502 Ga0495629_0003502_11416_11844 142
458 3300046461 Ga0495641_0294711 Ga0495641_0294711_130_558 142
459 3300046462 Ga0495651_0001400 Ga0495651_0001400_5710_6138 142
460 3300046463 Ga0495653_0026224 Ga0495653_0026224_3247_3675 142
461 3300046472 Ga0495580_0480008 Ga0495580_0480008_153_584 142
462 3300046472 Ga0495580_0605048 Ga0495580_0605048_23_451 142
463 3300046474 Ga0495605_0247420 Ga0495605_0247420_145_585 142
464 3300046475 Ga0495639_0329639 Ga0495639_0329639_72_512 142
465 3300046477 Ga0495664_0032998 Ga0495664_0032998_1950_2378 142
466 3300046491 Ga0495584_0255890 Ga0495584_0255890_342_782 142
467 3300046499 Ga0495594_0376546 Ga0495594_0376546_95_535 142
468 3300046499 Ga0495594_0698497 Ga0495594_0698497_10_438 142
469 3300046511 Ga0495608_0359874 Ga0495608_0359874_16_447 142
470 3300046514 Ga0495618_0015533 Ga0495618_0015533_1804_2232 142
471 3300046516 Ga0495628_0014171 Ga0495628_0014171_4534_4962 142
472 3300046517 Ga0495630_0118472 Ga0495630_0118472_983_1411 142
473 3300046517 Ga0495630_0484732 Ga0495630_0484732_441_881 142
474 3300046526 Ga0495666_0193773 Ga0495666_0193773_209_649 142
475 3300046528 Ga0495642_0438074 Ga0495642_0438074_109_549 142
476 3300046529 Ga0495652_0004294 Ga0495652_0004294_11389_11817 142
477 3300046531 Ga0495665_0042118 Ga0495665_0042118_1942_2370 142
478 3300046533 Ga0495640_0000769 Ga0495640_0000769_3193_3621 142
479 3300046536 Ga0495587_0001283 Ga0495587_0001283_5047_5475 142
480 3300046559 Ga0495667_0001440 Ga0495667_0001440_11727_12155 142
481 3300046642 Ga0495634_0029771 Ga0495634_0029771_234_668 142
482 3300046663 Ga0495635_0531085 Ga0495635_0531085_86_514 142
483 3300046675 Ga0495657_0168449 Ga0495657_0168449_308_736 142
484 3300046678 Ga0495599_0041684 Ga0495599_0041684_1592_2020 142
485 3300046679 Ga0495623_0013044 Ga0495623_0013044_3730_4158 142
486 3300046680 Ga0495646_0010752 Ga0495646_0010752_2498_2926 142
487 3300046681 Ga0495647_0243204 Ga0495647_0243204_277_705 142
488 3300046683 Ga0495658_0071370 Ga0495658_0071370_382_822 142
489 3300046684 Ga0495669_0249240 Ga0495669_0249240_169_609 142
490 3300046689 Ga0495613_0057625 Ga0495613_0057625_1514_1942 142
491 3300046690 Ga0495624_0325699 Ga0495624_0325699_149_589 142
492 3300046692 Ga0495671_0487639 Ga0495671_0487639_40_480 142
493 3300046809 Ga0495600_0001398 Ga0495600_0001398_794_1222 142
494 3300047315 Ga0495581_0472033 Ga0495581_0472033_23_451 142
495 3300047315 Ga0495581_0760003 Ga0495581_0760003_76_516 142
496 3300047317 Ga0495604_0000406 Ga0495604_0000406_5088_5516 142
497 3300047319 Ga0495674_0023413 Ga0495674_0023413_2757_3185 142
498 3300047321 Ga0495676_0198060 Ga0495676_0198060_78_506 142
499 3300047322 Ga0495680_0002267 Ga0495680_0002267_37_465 142
500 3300047444 Ga0495675_0036422 Ga0495675_0036422_83_511 142
501 3300047471 Ga0495684_0002545 Ga0495684_0002545_2980_3408 142
502 3300048088 Ga0495602_0014190 Ga0495602_0014190_7237_7665 142
503 3300048905 Ga0496102_0398632 Ga0496102_0398632_672_1112 142
504 3300048907 Ga0496104_0362727 Ga0496104_0362727_26_466 142
505 3300048907 Ga0496104_0503731 Ga0496104_0503731_173_601 142
506 3300048907 Ga0496104_1671496 Ga0496104_1671496_32_466 142
507 3300048908 Ga0496105_0113571 Ga0496105_0113571_183_623 142
508 3300048909 Ga0496106_0228146 Ga0496106_0228146_328_768 142
509 3300048912 Ga0496109_0640136 Ga0496109_0640136_415_843 142
510 3300048913 Ga0496110_0546916 Ga0496110_0546916_344_772 142
511 3300048914 Ga0496111_1090571 Ga0496111_1090571_23_457 142
512 3300048915 Ga0496112_0559441 Ga0496112_0559441_274_702 142
513 3300048918 Ga0496115_0087721 Ga0496115_0087721_1164_1604 142
514 3300048918 Ga0496115_0614127 Ga0496115_0614127_114_548 142
515 3300048918 Ga0496115_0802624 Ga0496115_0802624_75_503 142
516 3300048924 Ga0496121_0411816 Ga0496121_0411816_380_808 142
517 3300048929 Ga0496126_0143598 Ga0496126_0143598_1083_1511 142
518 3300049571 Ga0501034_0065637 Ga0501034_0065637_2747_3175 142
519 3300049575 Ga0501039_0081091 Ga0501039_0081091_192_620 142
520 3300049576 Ga0501040_0416784 Ga0501040_0416784_451_879 142
521 3300049589 Ga0501073_0047978 Ga0501073_0047978_2266_2694 142
522 3300049593 Ga0501077_0456946 Ga0501077_0456946_38_469 142
523 3300049741 Ga0501079_0904863 Ga0501079_0904863_184_624 142
524 3300049743 Ga0501081_0581638 Ga0501081_0581638_229_660 142
525 3300049823 Ga0501044_0501280 Ga0501044_0501280_676_1104 142
526 3300050507 nmdc:mga05p37_1564195_c1 nmdc:mga05p37_1564195_c1_59_493 142
527 3300050507 nmdc:mga05p37_1773_c1 nmdc:mga05p37_1773_c1_19972_20412 142
528 3300050507 nmdc:mga05p37_596952_c1 nmdc:mga05p37_596952_c1_345_785 142
529 3300050509 nmdc:mga0qj67_299_c1 nmdc:mga0qj67_299_c1_21330_21770 142
530 3300050510 nmdc:mga06r32_1378040_c1 nmdc:mga06r32_1378040_c1_51_485 142
531 3300050510 nmdc:mga06r32_607061_c1 nmdc:mga06r32_607061_c1_611_1042 142
532 3300050511 nmdc:mga08y16_359174_c1 nmdc:mga08y16_359174_c1_620_1054 142
533 3300053077 Ga0495601_0013011 Ga0495601_0013011_3390_3818 142
534 3300053078 Ga0495612_0001890 Ga0495612_0001890_2850_3278 142
535 3300053084 Ga0495595_0004844 Ga0495595_0004844_131_559 142
536 3300053085 Ga0495619_0000352 Ga0495619_0000352_31447_31875 142
537 3300053117 Ga0500593_084718 Ga0500593_084718_193_621 142
538 3300053158 Ga0500627_0081919 Ga0500627_0081919_549_980 142
539 3300005445 Ga0070708_100556604 Ga0070708_1005566041 143
540 3300005468 Ga0070707_100006038 Ga0070707_1000060387 143
541 3300006038 Ga0075365_10025404 Ga0075365_100254043 143
542 3300006051 Ga0075364_10534352 Ga0075364_105343522 143
543 3300006847 Ga0075431_100012366 Ga0075431_1000123662 143
544 3300009147 Ga0114129_10431100 Ga0114129_104311001 143
545 3300024227 Ga0228598_1000416 Ga0228598_100041610 143
546 3300025905 Ga0207685_10860690 Ga0207685_108606901 143
547 3300025922 Ga0207646_10007626 Ga0207646_100076266 143
548 3300025935 Ga0207709_11401091 Ga0207709_114010912 143
549 3300025986 Ga0207658_10320989 Ga0207658_103209891 143
550 3300026089 Ga0207648_11383510 Ga0207648_113835101 143
551 3300032120 Ga0316053_105626 Ga0316053_1056262 143
552 3300035086 Ga0373934_0111077 Ga0373934_0111077_369_800 143
553 3300035111 Ga0373923_0073205 Ga0373923_0073205_241_672 143
554 3300035117 Ga0373953_0421003 Ga0373953_0421003_106_537 143
555 3300035118 Ga0373954_0122786 Ga0373954_0122786_260_691 143
556 3300035119 Ga0373956_0365115 Ga0373956_0365115_154_585 143
557 3300035170 Ga0373943_0129148 Ga0373943_0129148_798_1229 143
558 3300036401 Ga0373937_0017054 Ga0373937_0017054_4492_4923 143
559 3300037068 Ga0373925_1007028 Ga0373925_1007028_25_456 143
560 3300046462 Ga0495651_0104450 Ga0495651_0104450_318_749 143
561 3300046463 Ga0495653_0352837 Ga0495653_0352837_146_577 143
562 3300046477 Ga0495664_0367224 Ga0495664_0367224_378_809 143
563 3300046516 Ga0495628_0028002 Ga0495628_0028002_2550_2981 143
564 3300046531 Ga0495665_0395931 Ga0495665_0395931_251_682 143
565 3300046533 Ga0495640_0186675 Ga0495640_0186675_289_720 143
566 3300046536 Ga0495587_0103577 Ga0495587_0103577_621_1052 143
567 3300046559 Ga0495667_0041859 Ga0495667_0041859_839_1270 143
568 3300046663 Ga0495635_0138899 Ga0495635_0138899_430_861 143
569 3300046678 Ga0495599_0060382 Ga0495599_0060382_1864_2295 143
570 3300046679 Ga0495623_0080307 Ga0495623_0080307_937_1368 143
571 3300046809 Ga0495600_0057506 Ga0495600_0057506_915_1346 143
572 3300047317 Ga0495604_0072447 Ga0495604_0072447_1344_1775 143
573 3300047319 Ga0495674_0663268 Ga0495674_0663268_29_460 143
574 3300047320 Ga0495672_0081977 Ga0495672_0081977_138_569 143
575 3300047444 Ga0495675_0071301 Ga0495675_0071301_373_804 143
576 3300047673 Ga0495593_0343085 Ga0495593_0343085_136_567 143
577 3300048088 Ga0495602_0094162 Ga0495602_0094162_981_1412 143
578 3300048908 Ga0496105_0983536 Ga0496105_0983536_20_460 143
579 3300048910 Ga0496107_0703659 Ga0496107_0703659_261_701 143
580 3300048917 Ga0496114_0116757 Ga0496114_0116757_631_1071 143
581 3300048929 Ga0496126_0197052 Ga0496126_0197052_790_1221 143
582 3300049571 Ga0501034_0123559 Ga0501034_0123559_269_700 143
583 3300050491 nmdc:mga00v17_77970_c1 nmdc:mga00v17_77970_c1_1124_1561 143
584 3300050492 nmdc:mga0yw44_9207_c1 nmdc:mga0yw44_9207_c1_4032_4469 143
585 3300050508 nmdc:mga09592_455567_c1 nmdc:mga09592_455567_c1_314_751 143
586 3300050509 nmdc:mga0qj67_442834_c1 nmdc:mga0qj67_442834_c1_184_618 143
587 3300050510 nmdc:mga06r32_121597_c1 nmdc:mga06r32_121597_c1_245_682 143
588 3300053077 Ga0495601_0120925 Ga0495601_0120925_200_631 143
589 3300053078 Ga0495612_0094439 Ga0495612_0094439_301_732 143
590 3300053084 Ga0495595_0418241 Ga0495595_0418241_178_618 143
591 3300053085 Ga0495619_0045598 Ga0495619_0045598_2078_2518 143
592 3300053085 Ga0495619_0191997 Ga0495619_0191997_810_1241 143
593 3300001977 JGI24746J21847_1001137 JGI24746J21847_10011375 144
594 3300001989 JGI24739J22299_10134223 JGI24739J22299_101342231 144
595 3300002070 JGI24750J21931_1000826 JGI24750J21931_10008264 144
596 3300002074 JGI24748J21848_1001282 JGI24748J21848_10012821 144
597 3300002075 JGI24738J21930_10018711 JGI24738J21930_100187111 144
598 3300002077 JGI24744J21845_10000833 JGI24744J21845_100008334 144
599 3300002155 JGI24033J26618_1000715 JGI24033J26618_10007152 144
600 3300002239 JGI24034J26672_10000746 JGI24034J26672_100007465 144
601 3300002244 JGI24742J22300_10002192 JGI24742J22300_100021923 144
602 3300004801 Ga0058860_12217134 Ga0058860_122171342 144
603 3300005329 Ga0070683_100665716 Ga0070683_1006657162 144
604 3300005330 Ga0070690_100064687 Ga0070690_1000646872 144
605 3300005331 Ga0070670_100033818 Ga0070670_1000338182 144
606 3300005331 Ga0070670_100045376 Ga0070670_1000453763 144
607 3300005333 Ga0070677_10200448 Ga0070677_102004482 144
608 3300005334 Ga0068869_100104724 Ga0068869_1001047242 144
609 3300005335 Ga0070666_10114683 Ga0070666_101146832 144
610 3300005335 Ga0070666_10423572 Ga0070666_104235722 144
611 3300005337 Ga0070682_100018452 Ga0070682_1000184522 144
612 3300005338 Ga0068868_100010692 Ga0068868_1000106926 144
613 3300005339 Ga0070660_100337489 Ga0070660_1003374892 144
614 3300005340 Ga0070689_100044445 Ga0070689_1000444452 144
615 3300005341 Ga0070691_10216215 Ga0070691_102162152 144
616 3300005343 Ga0070687_100142255 Ga0070687_1001422552 144
617 3300005343 Ga0070687_101529520 Ga0070687_1015295201 144
618 3300005344 Ga0070661_100545081 Ga0070661_1005450812 144
619 3300005347 Ga0070668_100043280 Ga0070668_1000432802 144
620 3300005353 Ga0070669_100078912 Ga0070669_1000789121 144
621 3300005354 Ga0070675_100004703 Ga0070675_1000047033 144
622 3300005354 Ga0070675_100890238 Ga0070675_1008902381 144
623 3300005355 Ga0070671_100037107 Ga0070671_1000371072 144
624 3300005355 Ga0070671_100051674 Ga0070671_1000516743 144
625 3300005355 Ga0070671_100545240 Ga0070671_1005452402 144
626 3300005364 Ga0070673_100015193 Ga0070673_1000151934 144
627 3300005364 Ga0070673_100018429 Ga0070673_1000184292 144
628 3300005365 Ga0070688_100063947 Ga0070688_1000639473 144
629 3300005365 Ga0070688_100367264 Ga0070688_1003672642 144
630 3300005366 Ga0070659_100207122 Ga0070659_1002071222 144
631 3300005366 Ga0070659_100400392 Ga0070659_1004003921 144
632 3300005366 Ga0070659_101012334 Ga0070659_1010123341 144
633 3300005367 Ga0070667_100009241 Ga0070667_1000092416 144
634 3300005406 Ga0070703_10106276 Ga0070703_101062761 144
635 3300005434 Ga0070709_10015699 Ga0070709_100156996 144
636 3300005434 Ga0070709_10226111 Ga0070709_102261111 144
637 3300005435 Ga0070714_100024965 Ga0070714_1000249652 144
638 3300005435 Ga0070714_100979173 Ga0070714_1009791731 144
639 3300005436 Ga0070713_100011844 Ga0070713_1000118449 144
640 3300005436 Ga0070713_100191145 Ga0070713_1001911452 144
641 3300005437 Ga0070710_10082005 Ga0070710_100820053 144
642 3300005439 Ga0070711_100074713 Ga0070711_1000747131 144
643 3300005439 Ga0070711_100310705 Ga0070711_1003107052 144
644 3300005440 Ga0070705_100279873 Ga0070705_1002798731 144
645 3300005441 Ga0070700_100060003 Ga0070700_1000600033 144
646 3300005455 Ga0070663_100899446 Ga0070663_1008994461 144
647 3300005456 Ga0070678_100306391 Ga0070678_1003063911 144
648 3300005457 Ga0070662_100057865 Ga0070662_1000578653 144
649 3300005459 Ga0068867_100268154 Ga0068867_1002681542 144
650 3300005466 Ga0070685_10020411 Ga0070685_100204112 144
651 3300005539 Ga0068853_100120553 Ga0068853_1001205532 144
652 3300005543 Ga0070672_100124373 Ga0070672_1001243732 144
653 3300005543 Ga0070672_100131496 Ga0070672_1001314962 144
654 3300005544 Ga0070686_100054524 Ga0070686_1000545242 144
655 3300005548 Ga0070665_101975470 Ga0070665_1019754701 144
656 3300005549 Ga0070704_100059469 Ga0070704_1000594693 144
657 3300005615 Ga0070702_100115730 Ga0070702_1001157302 144
658 3300005615 Ga0070702_100565389 Ga0070702_1005653891 144
659 3300005616 Ga0068852_100393611 Ga0068852_1003936112 144
660 3300005617 Ga0068859_100021311 Ga0068859_1000213112 144
661 3300005618 Ga0068864_100023234 Ga0068864_1000232346 144
662 3300005718 Ga0068866_10460426 Ga0068866_104604262 144
663 3300005719 Ga0068861_100061245 Ga0068861_1000612453 144
664 3300005841 Ga0068863_100017228 Ga0068863_1000172286 144
665 3300005842 Ga0068858_100053731 Ga0068858_1000537313 144
666 3300005842 Ga0068858_100511509 Ga0068858_1005115092 144
667 3300005843 Ga0068860_100108790 Ga0068860_1001087903 144
668 3300005844 Ga0068862_100030508 Ga0068862_1000305084 144
669 3300005844 Ga0068862_100535296 Ga0068862_1005352962 144
670 3300005937 Ga0081455_10002425 Ga0081455_1000242520 144
671 3300005937 Ga0081455_10015627 Ga0081455_100156277 144
672 3300005981 Ga0081538_10024942 Ga0081538_100249423 144
673 3300005981 Ga0081538_10033225 Ga0081538_100332252 144
674 3300005983 Ga0081540_1003020 Ga0081540_10030208 144
675 3300006028 Ga0070717_10066346 Ga0070717_100663463 144
676 3300006028 Ga0070717_10083481 Ga0070717_100834812 144
677 3300006028 Ga0070717_11369757 Ga0070717_113697572 144
678 3300006038 Ga0075365_10091294 Ga0075365_100912942 144
679 3300006042 Ga0075368_10305832 Ga0075368_103058321 144
680 3300006051 Ga0075364_10956726 Ga0075364_109567261 144
681 3300006175 Ga0070712_100004635 Ga0070712_1000046356 144
682 3300006175 Ga0070712_100326657 Ga0070712_1003266572 144
683 3300006178 Ga0075367_10013649 Ga0075367_100136495 144
684 3300006178 Ga0075367_10152081 Ga0075367_101520812 144
685 3300006186 Ga0075369_10291742 Ga0075369_102917422 144
686 3300006194 Ga0075427_10032241 Ga0075427_100322411 144
687 3300006195 Ga0075366_10095293 Ga0075366_100952932 144
688 3300006237 Ga0097621_100102942 Ga0097621_1001029423 144
689 3300006353 Ga0075370_10033357 Ga0075370_100333573 144
690 3300006358 Ga0068871_100159329 Ga0068871_1001593293 144
691 3300006844 Ga0075428_100092978 Ga0075428_1000929783 144
692 3300006844 Ga0075428_100099017 Ga0075428_1000990173 144
693 3300006844 Ga0075428_100256103 Ga0075428_1002561033 144
694 3300006847 Ga0075431_100030686 Ga0075431_1000306863 144
695 3300006847 Ga0075431_100102642 Ga0075431_1001026422 144
696 3300006852 Ga0075433_11332470 Ga0075433_113324701 144
697 3300006871 Ga0075434_100157899 Ga0075434_1001578992 144
698 3300006880 Ga0075429_100264985 Ga0075429_1002649852 144
699 3300006880 Ga0075429_101122448 Ga0075429_1011224482 144
700 3300006931 Ga0097620_100021311 Ga0097620_1000213112 144
701 3300007076 Ga0075435_100534415 Ga0075435_1005344152 144
702 3300009094 Ga0111539_10359025 Ga0111539_103590252 144
703 3300009098 Ga0105245_10097208 Ga0105245_100972083 144
704 3300009098 Ga0105245_11112738 Ga0105245_111127382 144
705 3300009101 Ga0105247_10117745 Ga0105247_101177452 144
706 3300009101 Ga0105247_10470091 Ga0105247_104700912 144
707 3300009147 Ga0114129_10083416 Ga0114129_100834166 144
708 3300009147 Ga0114129_10092035 Ga0114129_100920355 144
709 3300009147 Ga0114129_10248507 Ga0114129_102485072 144
710 3300009174 Ga0105241_10429941 Ga0105241_104299412 144
711 3300009174 Ga0105241_10992828 Ga0105241_109928281 144
712 3300009176 Ga0105242_10270438 Ga0105242_102704382 144
713 3300010375 Ga0105239_10096716 Ga0105239_100967163 144
714 3300010375 Ga0105239_10121682 Ga0105239_101216824 144
715 3300010375 Ga0105239_10367401 Ga0105239_103674012 144
716 3300011119 Ga0105246_10043793 Ga0105246_100437932 144
717 3300011119 Ga0105246_10455871 Ga0105246_104558712 144
718 3300011119 Ga0105246_11814452 Ga0105246_118144521 144
719 3300013297 Ga0157378_10919350 Ga0157378_109193502 144
720 3300013297 Ga0157378_11296527 Ga0157378_112965271 144
721 3300013308 Ga0157375_10007761 Ga0157375_100077617 144
722 3300014325 Ga0163163_10043637 Ga0163163_100436374 144
723 3300014325 Ga0163163_10050450 Ga0163163_100504502 144
724 3300014325 Ga0163163_10220411 Ga0163163_102204112 144
725 3300014326 Ga0157380_10186027 Ga0157380_101860272 144
726 3300014745 Ga0157377_10001603 Ga0157377_1000160312 144
727 3300014968 Ga0157379_10471191 Ga0157379_104711912 144
728 3300014968 Ga0157379_10673187 Ga0157379_106731872 144
729 3300014968 Ga0157379_10878566 Ga0157379_108785662 144
730 3300014969 Ga0157376_10042796 Ga0157376_100427962 144
731 3300017792 Ga0163161_10081304 Ga0163161_100813043 144
732 3300025315 Ga0207697_10048666 Ga0207697_100486662 144
733 3300025893 Ga0207682_10061155 Ga0207682_100611552 144
734 3300025898 Ga0207692_10066259 Ga0207692_100662592 144
735 3300025898 Ga0207692_10144451 Ga0207692_101444512 144
736 3300025900 Ga0207710_10007582 Ga0207710_100075824 144
737 3300025901 Ga0207688_10010927 Ga0207688_100109271 144
738 3300025903 Ga0207680_10683396 Ga0207680_106833962 144
739 3300025904 Ga0207647_10021711 Ga0207647_100217113 144
740 3300025905 Ga0207685_10048614 Ga0207685_100486142 144
741 3300025905 Ga0207685_10092801 Ga0207685_100928012 144
742 3300025906 Ga0207699_10005995 Ga0207699_100059955 144
743 3300025907 Ga0207645_10171296 Ga0207645_101712962 144
744 3300025911 Ga0207654_10976915 Ga0207654_109769151 144
745 3300025912 Ga0207707_11567233 Ga0207707_115672331 144
746 3300025914 Ga0207671_10173312 Ga0207671_101733122 144
747 3300025915 Ga0207693_10018656 Ga0207693_100186562 144
748 3300025915 Ga0207693_10027985 Ga0207693_100279853 144
749 3300025915 Ga0207693_10236545 Ga0207693_102365452 144
750 3300025916 Ga0207663_10092111 Ga0207663_100921112 144
751 3300025916 Ga0207663_10338868 Ga0207663_103388682 144
752 3300025916 Ga0207663_10504366 Ga0207663_105043662 144
753 3300025918 Ga0207662_10000683 Ga0207662_1000068312 144
754 3300025919 Ga0207657_10036554 Ga0207657_100365542 144
755 3300025920 Ga0207649_10459430 Ga0207649_104594302 144
756 3300025920 Ga0207649_10617199 Ga0207649_106171991 144
757 3300025924 Ga0207694_10179522 Ga0207694_101795221 144
758 3300025925 Ga0207650_10010954 Ga0207650_100109545 144
759 3300025925 Ga0207650_10043647 Ga0207650_100436472 144
760 3300025925 Ga0207650_10048048 Ga0207650_100480482 144
761 3300025927 Ga0207687_10046021 Ga0207687_100460213 144
762 3300025927 Ga0207687_10138493 Ga0207687_101384932 144
763 3300025928 Ga0207700_10144285 Ga0207700_101442853 144
764 3300025928 Ga0207700_10183173 Ga0207700_101831732 144
765 3300025928 Ga0207700_10384630 Ga0207700_103846302 144
766 3300025929 Ga0207664_10044723 Ga0207664_100447232 144
767 3300025931 Ga0207644_10033822 Ga0207644_100338223 144
768 3300025932 Ga0207690_10628302 Ga0207690_106283022 144
769 3300025932 Ga0207690_10718205 Ga0207690_107182051 144
770 3300025933 Ga0207706_10002966 Ga0207706_1000296624 144
771 3300025936 Ga0207670_10048420 Ga0207670_100484203 144
772 3300025938 Ga0207704_11048208 Ga0207704_110482081 144
773 3300025939 Ga0207665_10333192 Ga0207665_103331922 144
774 3300025940 Ga0207691_10003332 Ga0207691_100033326 144
775 3300025940 Ga0207691_10087732 Ga0207691_100877324 144
776 3300025942 Ga0207689_10008393 Ga0207689_100083939 144
777 3300025944 Ga0207661_10119254 Ga0207661_101192543 144
778 3300025945 Ga0207679_10034779 Ga0207679_100347791 144
779 3300025960 Ga0207651_10011035 Ga0207651_100110352 144
780 3300025960 Ga0207651_10094608 Ga0207651_100946082 144
781 3300025972 Ga0207668_10240443 Ga0207668_102404432 144
782 3300025981 Ga0207640_11861848 Ga0207640_118618481 144
783 3300025981 Ga0207640_11940351 Ga0207640_119403511 144
784 3300025986 Ga0207658_10030585 Ga0207658_100305852 144
785 3300026035 Ga0207703_10155281 Ga0207703_101552811 144
786 3300026075 Ga0207708_10030330 Ga0207708_100303303 144
787 3300026078 Ga0207702_10046706 Ga0207702_100467062 144
788 3300026078 Ga0207702_11598250 Ga0207702_115982501 144
789 3300026088 Ga0207641_10058736 Ga0207641_100587364 144
790 3300026089 Ga0207648_10011288 Ga0207648_100112888 144
791 3300026095 Ga0207676_10035850 Ga0207676_100358503 144
792 3300026118 Ga0207675_100003007 Ga0207675_10000300711 144
793 3300026121 Ga0207683_10015654 Ga0207683_100156547 144
794 3300026142 Ga0207698_10016350 Ga0207698_100163504 144
795 3300028379 Ga0268266_10057954 Ga0268266_100579542 144
796 3300028379 Ga0268266_11383439 Ga0268266_113834391 144
797 3300028380 Ga0268265_10277735 Ga0268265_102777352 144
798 3300028381 Ga0268264_10179743 Ga0268264_101797432 144
799 3300031995 Ga0307409_102383047 Ga0307409_1023830471 144
800 3300035083 Ga0373926_0114711 Ga0373926_0114711_20_454 144
801 3300035086 Ga0373934_0171807 Ga0373934_0171807_138_572 144
802 3300035089 Ga0373944_0030910 Ga0373944_0030910_782_1216 144
803 3300035113 Ga0373936_0106729 Ga0373936_0106729_256_690 144
804 3300035114 Ga0373939_0168225 Ga0373939_0168225_297_731 144
805 3300035116 Ga0373945_0007787 Ga0373945_0007787_308_742 144
806 3300035116 Ga0373945_0041830 Ga0373945_0041830_315_749 144
807 3300035116 Ga0373945_0080941 Ga0373945_0080941_219_653 144
808 3300035119 Ga0373956_0293869 Ga0373956_0293869_275_709 144
809 3300035121 Ga0373960_0294452 Ga0373960_0294452_120_554 144
810 3300035170 Ga0373943_0014346 Ga0373943_0014346_2088_2522 144
811 3300035170 Ga0373943_0050131 Ga0373943_0050131_1049_1483 144
812 3300035170 Ga0373943_0171044 Ga0373943_0171044_60_494 144
813 3300035171 Ga0373946_0027523 Ga0373946_0027523_1636_2070 144
814 3300035171 Ga0373946_0062117 Ga0373946_0062117_479_913 144
815 3300035172 Ga0373955_0549293 Ga0373955_0549293_203_637 144
816 3300035241 Ga0373961_0160078 Ga0373961_0160078_21_455 144
817 3300035410 Ga0373924_0197979 Ga0373924_0197979_92_526 144
818 3300035691 Ga0373931_0080324 Ga0373931_0080324_633_1067 144
819 3300035691 Ga0373931_0200857 Ga0373931_0200857_682_1116 144
820 3300035692 Ga0373935_0006630 Ga0373935_0006630_2927_3361 144
821 3300035692 Ga0373935_0054795 Ga0373935_0054795_1794_2228 144
822 3300035692 Ga0373935_0091399 Ga0373935_0091399_590_1024 144
823 3300035692 Ga0373935_0237512 Ga0373935_0237512_590_1024 144
824 3300035695 Ga0373927_0037358 Ga0373927_0037358_1674_2108 144
825 3300035695 Ga0373927_0043686 Ga0373927_0043686_760_1194 144
826 3300035695 Ga0373927_0049295 Ga0373927_0049295_1427_1861 144
827 3300035695 Ga0373927_0171364 Ga0373927_0171364_88_522 144
828 3300035725 Ga0373947_0000633 Ga0373947_0000633_1049_1483 144
829 3300035725 Ga0373947_0011503 Ga0373947_0011503_3814_4248 144
830 3300035725 Ga0373947_0040714 Ga0373947_0040714_227_661 144
831 3300037068 Ga0373925_0007434 Ga0373925_0007434_1721_2155 144
832 3300037068 Ga0373925_0053531 Ga0373925_0053531_1754_2188 144
833 3300037068 Ga0373925_0090548 Ga0373925_0090548_251_685 144
834 3300037418 Ga0395900_0352109 Ga0395900_0352109_673_1107 144
835 3300037418 Ga0395900_1833653 Ga0395900_1833653_42_476 144
836 3300038443 Ga0395901_0160734 Ga0395901_0160734_1612_2046 144
837 3300038443 Ga0395901_0808769 Ga0395901_0808769_302_736 144
838 3300039450 Ga0436363_1509191 Ga0436363_1509191_1682_2116 144
839 3300041501 Ga0451845_0368984 Ga0451845_0368984_11_445 144
840 3300046452 Ga0495617_078200 Ga0495617_078200_429_863 144
841 3300046454 Ga0495592_0211814 Ga0495592_0211814_40_474 144
842 3300046455 Ga0495603_0010786 Ga0495603_0010786_1634_2068 144
843 3300046455 Ga0495603_0112616 Ga0495603_0112616_852_1286 144
844 3300046459 Ga0495629_0031003 Ga0495629_0031003_2144_2578 144
845 3300046459 Ga0495629_0239737 Ga0495629_0239737_376_810 144
846 3300046459 Ga0495629_0294172 Ga0495629_0294172_384_818 144
847 3300046461 Ga0495641_0088498 Ga0495641_0088498_575_1009 144
848 3300046463 Ga0495653_0031575 Ga0495653_0031575_1618_2052 144
849 3300046472 Ga0495580_0069341 Ga0495580_0069341_1227_1661 144
850 3300046472 Ga0495580_0114226 Ga0495580_0114226_700_1134 144
851 3300046473 Ga0495582_0085444 Ga0495582_0085444_327_761 144
852 3300046474 Ga0495605_0122840 Ga0495605_0122840_604_1038 144
853 3300046475 Ga0495639_0022143 Ga0495639_0022143_1717_2151 144
854 3300046475 Ga0495639_0091143 Ga0495639_0091143_753_1187 144
855 3300046475 Ga0495639_0110314 Ga0495639_0110314_665_1099 144
856 3300046476 Ga0495662_0004886 Ga0495662_0004886_3929_4363 144
857 3300046476 Ga0495662_0037859 Ga0495662_0037859_1196_1630 144
858 3300046477 Ga0495664_0001699 Ga0495664_0001699_4864_5298 144
859 3300046491 Ga0495584_0026134 Ga0495584_0026134_1834_2268 144
860 3300046491 Ga0495584_0062527 Ga0495584_0062527_1404_1838 144
861 3300046492 Ga0495585_0024577 Ga0495585_0024577_1203_1637 144
862 3300046499 Ga0495594_0012384 Ga0495594_0012384_3637_4071 144
863 3300046499 Ga0495594_0552735 Ga0495594_0552735_179_613 144
864 3300046500 Ga0495596_0380556 Ga0495596_0380556_10_444 144
865 3300046501 Ga0495607_0050530 Ga0495607_0050530_1483_1917 144
866 3300046501 Ga0495607_0242725 Ga0495607_0242725_359_793 144
867 3300046514 Ga0495618_0007630 Ga0495618_0007630_1258_1692 144
868 3300046514 Ga0495618_0252297 Ga0495618_0252297_446_880 144
869 3300046516 Ga0495628_0357439 Ga0495628_0357439_228_662 144
870 3300046517 Ga0495630_0010798 Ga0495630_0010798_1406_1840 144
871 3300046517 Ga0495630_0067408 Ga0495630_0067408_647_1081 144
872 3300046517 Ga0495630_0693374 Ga0495630_0693374_263_697 144
873 3300046518 Ga0495631_0015770 Ga0495631_0015770_740_1174 144
874 3300046523 Ga0495644_0011541 Ga0495644_0011541_713_1147 144
875 3300046525 Ga0495663_0015967 Ga0495663_0015967_528_962 144
876 3300046526 Ga0495666_0244274 Ga0495666_0244274_208_642 144
877 3300046529 Ga0495652_0221140 Ga0495652_0221140_406_840 144
878 3300046530 Ga0495654_0163164 Ga0495654_0163164_518_952 144
879 3300046531 Ga0495665_0035820 Ga0495665_0035820_553_987 144
880 3300046531 Ga0495665_0147125 Ga0495665_0147125_773_1207 144
881 3300046531 Ga0495665_0162785 Ga0495665_0162785_263_697 144
882 3300046533 Ga0495640_0000385 Ga0495640_0000385_853_1287 144
883 3300046533 Ga0495640_0175170 Ga0495640_0175170_806_1240 144
884 3300046537 Ga0495598_0004029 Ga0495598_0004029_1525_1959 144
885 3300046538 Ga0495609_0038054 Ga0495609_0038054_724_1158 144
886 3300046539 Ga0495621_0005293 Ga0495621_0005293_2098_2532 144
887 3300046543 Ga0495645_0253438 Ga0495645_0253438_37_471 144
888 3300046559 Ga0495667_0539930 Ga0495667_0539930_264_698 144
889 3300046615 Ga0495656_0001605 Ga0495656_0001605_5165_5599 144
890 3300046615 Ga0495656_0152103 Ga0495656_0152103_644_1078 144
891 3300046616 Ga0495668_0466225 Ga0495668_0466225_72_506 144
892 3300046616 Ga0495668_0586700 Ga0495668_0586700_122_556 144
893 3300046642 Ga0495634_0001491 Ga0495634_0001491_932_1366 144
894 3300046642 Ga0495634_0025557 Ga0495634_0025557_1571_2005 144
895 3300046642 Ga0495634_0071769 Ga0495634_0071769_1250_1684 144
896 3300046642 Ga0495634_0284262 Ga0495634_0284262_367_801 144
897 3300046663 Ga0495635_0035056 Ga0495635_0035056_2065_2499 144
898 3300046663 Ga0495635_0113870 Ga0495635_0113870_757_1191 144
899 3300046664 Ga0495659_0172206 Ga0495659_0172206_378_812 144
900 3300046664 Ga0495659_0346453 Ga0495659_0346453_100_534 144
901 3300046665 Ga0495661_0088488 Ga0495661_0088488_907_1341 144
902 3300046674 Ga0495588_0208708 Ga0495588_0208708_373_807 144
903 3300046678 Ga0495599_0328331 Ga0495599_0328331_103_537 144
904 3300046680 Ga0495646_0041999 Ga0495646_0041999_863_1297 144
905 3300046681 Ga0495647_0010689 Ga0495647_0010689_1064_1498 144
906 3300046683 Ga0495658_0107141 Ga0495658_0107141_593_1027 144
907 3300046683 Ga0495658_0928818 Ga0495658_0928818_92_526 144
908 3300046684 Ga0495669_0223430 Ga0495669_0223430_253_687 144
909 3300046689 Ga0495613_0042111 Ga0495613_0042111_2453_2887 144
910 3300046689 Ga0495613_0073452 Ga0495613_0073452_1910_2344 144
911 3300046689 Ga0495613_0239057 Ga0495613_0239057_111_545 144
912 3300046690 Ga0495624_0021720 Ga0495624_0021720_1312_1746 144
913 3300046690 Ga0495624_0045694 Ga0495624_0045694_685_1119 144
914 3300046690 Ga0495624_0066226 Ga0495624_0066226_1720_2154 144
915 3300046690 Ga0495624_0302694 Ga0495624_0302694_381_815 144
916 3300046692 Ga0495671_0059860 Ga0495671_0059860_1186_1620 144
917 3300046692 Ga0495671_0272001 Ga0495671_0272001_280_714 144
918 3300046694 Ga0495649_0129597 Ga0495649_0129597_602_1036 144
919 3300046794 Ga0495589_0032938 Ga0495589_0032938_908_1342 144
920 3300047315 Ga0495581_0053605 Ga0495581_0053605_1402_1836 144
921 3300047315 Ga0495581_0143063 Ga0495581_0143063_803_1237 144
922 3300047315 Ga0495581_0170366 Ga0495581_0170366_451_885 144
923 3300047315 Ga0495581_0218811 Ga0495581_0218811_526_960 144
924 3300047317 Ga0495604_0263671 Ga0495604_0263671_212_646 144
925 3300047319 Ga0495674_0001453 Ga0495674_0001453_13290_13724 144
926 3300047319 Ga0495674_0203361 Ga0495674_0203361_1025_1459 144
927 3300047319 Ga0495674_0264834 Ga0495674_0264834_109_543 144
928 3300047319 Ga0495674_1036281 Ga0495674_1036281_74_508 144
929 3300047321 Ga0495676_0135025 Ga0495676_0135025_863_1297 144
930 3300047322 Ga0495680_0658204 Ga0495680_0658204_27_461 144
931 3300047446 Ga0495679_018436 Ga0495679_018436_1907_2341 144
932 3300047471 Ga0495684_0027908 Ga0495684_0027908_3077_3511 144
933 3300047471 Ga0495684_0042044 Ga0495684_0042044_934_1368 144
934 3300047471 Ga0495684_0083851 Ga0495684_0083851_882_1316 144
935 3300047472 Ga0495686_0315391 Ga0495686_0315391_73_507 144
936 3300047673 Ga0495593_0046845 Ga0495593_0046845_262_696 144
937 3300047673 Ga0495593_0109761 Ga0495593_0109761_372_806 144
938 3300048903 Ga0496100_0006135 Ga0496100_0006135_2552_2986 144
939 3300048903 Ga0496100_0045424 Ga0496100_0045424_1655_2095 144
940 3300048903 Ga0496100_0090321 Ga0496100_0090321_738_1172 144
941 3300048904 Ga0496101_0003597 Ga0496101_0003597_237_677 144
942 3300048904 Ga0496101_0019747 Ga0496101_0019747_1669_2103 144
943 3300048904 Ga0496101_0137179 Ga0496101_0137179_788_1222 144
944 3300048904 Ga0496101_0269956 Ga0496101_0269956_551_985 144
945 3300048904 Ga0496101_0393828 Ga0496101_0393828_270_704 144
946 3300048905 Ga0496102_0001868 Ga0496102_0001868_3086_3526 144
947 3300048905 Ga0496102_0042907 Ga0496102_0042907_2067_2501 144
948 3300048905 Ga0496102_0055582 Ga0496102_0055582_2401_2835 144
949 3300048905 Ga0496102_0610837 Ga0496102_0610837_275_709 144
950 3300048905 Ga0496102_1304300 Ga0496102_1304300_136_570 144
951 3300048906 Ga0496103_0004036 Ga0496103_0004036_2181_2615 144
952 3300048906 Ga0496103_0005701 Ga0496103_0005701_5830_6264 144
953 3300048906 Ga0496103_0014953 Ga0496103_0014953_48_488 144
954 3300048907 Ga0496104_0001826 Ga0496104_0001826_16330_16770 144
955 3300048907 Ga0496104_0002521 Ga0496104_0002521_13391_13825 144
956 3300048907 Ga0496104_0041724 Ga0496104_0041724_35_469 144
957 3300048907 Ga0496104_0408852 Ga0496104_0408852_100_540 144
958 3300048908 Ga0496105_0013712 Ga0496105_0013712_1826_2260 144
959 3300048908 Ga0496105_0023389 Ga0496105_0023389_870_1304 144
960 3300048908 Ga0496105_0053612 Ga0496105_0053612_2013_2453 144
961 3300048908 Ga0496105_0957933 Ga0496105_0957933_175_609 144
962 3300048909 Ga0496106_0001110 Ga0496106_0001110_9771_10211 144
963 3300048909 Ga0496106_0013846 Ga0496106_0013846_1319_1753 144
964 3300048909 Ga0496106_0023515 Ga0496106_0023515_1749_2183 144
965 3300048909 Ga0496106_0197365 Ga0496106_0197365_646_1080 144
966 3300048909 Ga0496106_0460554 Ga0496106_0460554_248_682 144
967 3300048909 Ga0496106_1201358 Ga0496106_1201358_42_482 144
968 3300048910 Ga0496107_0010686 Ga0496107_0010686_2399_2833 144
969 3300048910 Ga0496107_0017863 Ga0496107_0017863_3326_3766 144
970 3300048910 Ga0496107_0032302 Ga0496107_0032302_2085_2519 144
971 3300048911 Ga0496108_0004403 Ga0496108_0004403_2839_3279 144
972 3300048911 Ga0496108_0017165 Ga0496108_0017165_1270_1710 144
973 3300048911 Ga0496108_0018358 Ga0496108_0018358_2864_3298 144
974 3300048911 Ga0496108_0185967 Ga0496108_0185967_307_741 144
975 3300048911 Ga0496108_1733377 Ga0496108_1733377_30_464 144
976 3300048912 Ga0496109_0005037 Ga0496109_0005037_6663_7097 144
977 3300048912 Ga0496109_0005827 Ga0496109_0005827_3223_3663 144
978 3300048912 Ga0496109_0006780 Ga0496109_0006780_6229_6663 144
979 3300048912 Ga0496109_0545945 Ga0496109_0545945_554_988 144
980 3300048913 Ga0496110_0005009 Ga0496110_0005009_3021_3461 144
981 3300048913 Ga0496110_0010524 Ga0496110_0010524_1213_1647 144
982 3300048913 Ga0496110_0025880 Ga0496110_0025880_1652_2086 144
983 3300048913 Ga0496110_0076837 Ga0496110_0076837_2508_2948 144
984 3300048913 Ga0496110_0808728 Ga0496110_0808728_17_451 144
985 3300048913 Ga0496110_0899106 Ga0496110_0899106_55_489 144
986 3300048914 Ga0496111_0003448 Ga0496111_0003448_1193_1633 144
987 3300048914 Ga0496111_0006735 Ga0496111_0006735_6386_6820 144
988 3300048914 Ga0496111_0013724 Ga0496111_0013724_1165_1605 144
989 3300048914 Ga0496111_0214300 Ga0496111_0214300_870_1304 144
990 3300048915 Ga0496112_0002152 Ga0496112_0002152_10795_11229 144
991 3300048915 Ga0496112_0005896 Ga0496112_0005896_5885_6325 144
992 3300048915 Ga0496112_0086402 Ga0496112_0086402_140_580 144
993 3300048915 Ga0496112_0350600 Ga0496112_0350600_542_976 144
994 3300048916 Ga0496113_0017380 Ga0496113_0017380_1965_2399 144
995 3300048916 Ga0496113_0103780 Ga0496113_0103780_307_747 144
996 3300048916 Ga0496113_0122220 Ga0496113_0122220_528_962 144
997 3300048917 Ga0496114_0011857 Ga0496114_0011857_617_1057 144
998 3300048917 Ga0496114_0658927 Ga0496114_0658927_247_681 144
999 3300048918 Ga0496115_0038794 Ga0496115_0038794_796_1230 144
1000 3300048918 Ga0496115_0059777 Ga0496115_0059777_1031_1471 144
1001 3300048918 Ga0496115_0060309 Ga0496115_0060309_2034_2468 144
1002 3300048918 Ga0496115_0279137 Ga0496115_0279137_401_835 144
1003 3300048918 Ga0496115_0432183 Ga0496115_0432183_346_780 144
1004 3300049582 Ga0501048_0199921 Ga0501048_0199921_853_1287 144
1005 3300049582 Ga0501048_1244655 Ga0501048_1244655_58_492 144
1006 3300049584 Ga0501068_1114750 Ga0501068_1114750_10_444 144
1007 3300049592 Ga0501076_0488686 Ga0501076_0488686_344_778 144
1008 3300049593 Ga0501077_0074021 Ga0501077_0074021_643_1077 144
1009 3300049742 Ga0501080_0272607 Ga0501080_0272607_700_1134 144
1010 3300049824 Ga0501045_0462192 Ga0501045_0462192_376_810 144
1011 3300050491 nmdc:mga00v17_161190_c1 nmdc:mga00v17_161190_c1_73_507 144
1012 3300050492 nmdc:mga0yw44_140149_c1 nmdc:mga0yw44_140149_c1_357_791 144
1013 3300050492 nmdc:mga0yw44_14958_c1 nmdc:mga0yw44_14958_c1_2517_2951 144
1014 3300050492 nmdc:mga0yw44_20287_c1 nmdc:mga0yw44_20287_c1_2129_2563 144
1015 3300050493 nmdc:mga0k408_732559_c1 nmdc:mga0k408_732559_c1_81_515 144
1016 3300050494 nmdc:mga06z11_60447_c1 nmdc:mga06z11_60447_c1_108_542 144
1017 3300050495 nmdc:mga04h51_25337_c1 nmdc:mga04h51_25337_c1_713_1147 144
1018 3300050496 nmdc:mga07m45_342976_c1 nmdc:mga07m45_342976_c1_386_820 144
1019 3300050507 nmdc:mga05p37_14706_c1 nmdc:mga05p37_14706_c1_158_592 144
1020 3300050507 nmdc:mga05p37_196486_c1 nmdc:mga05p37_196486_c1_1157_1591 144
1021 3300050507 nmdc:mga05p37_8226_c1 nmdc:mga05p37_8226_c1_1352_1786 144
1022 3300050508 nmdc:mga09592_758794_c1 nmdc:mga09592_758794_c1_87_521 144
1023 3300050508 nmdc:mga09592_8971_c1 nmdc:mga09592_8971_c1_5131_5565 144
1024 3300050509 nmdc:mga0qj67_1019591_c1 nmdc:mga0qj67_1019591_c1_20_454 144
1025 3300050509 nmdc:mga0qj67_12270_c1 nmdc:mga0qj67_12270_c1_5737_6171 144
1026 3300050510 nmdc:mga06r32_16932_c1 nmdc:mga06r32_16932_c1_5129_5563 144
1027 3300050510 nmdc:mga06r32_433662_c1 nmdc:mga06r32_433662_c1_228_662 144
1028 3300050510 nmdc:mga06r32_87514_c1 nmdc:mga06r32_87514_c1_81_515 144
1029 3300050511 nmdc:mga08y16_60080_c1 nmdc:mga08y16_60080_c1_3375_3809 144
1030 3300050512 nmdc:mga0n895_1377163_c1 nmdc:mga0n895_1377163_c1_140_574 144
1031 3300050512 nmdc:mga0n895_259878_c1 nmdc:mga0n895_259878_c1_845_1279 144
1032 3300050512 nmdc:mga0n895_284643_c1 nmdc:mga0n895_284643_c1_1161_1595 144
1033 3300050513 nmdc:mga0rr50_727548_c1 nmdc:mga0rr50_727548_c1_47_481 144
1034 3300050514 nmdc:mga08x19_533270_c1 nmdc:mga08x19_533270_c1_19_453 144
1035 3300050515 nmdc:mga0a205_1173733_c1 nmdc:mga0a205_1173733_c1_138_572 144
1036 3300053077 Ga0495601_0408841 Ga0495601_0408841_70_504 144
1037 3300053078 Ga0495612_0010224 Ga0495612_0010224_825_1259 144
1038 3300053083 Ga0495655_0025243 Ga0495655_0025243_66_500 144
1039 3300053083 Ga0495655_0101535 Ga0495655_0101535_183_617 144
1040 3300053085 Ga0495619_0045969 Ga0495619_0045969_814_1248 144
1041 3300053085 Ga0495619_0179612 Ga0495619_0179612_799_1233 144
1042 3300054114 Ga0501084_0243069 Ga0501084_0243069_732_1166 144
1043 3300061734 Ga0530510_0136279 Ga0530510_0136279_663_1097 144
1044 3300061734 Ga0530510_0383972 Ga0530510_0383972_188_622 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

36

132

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfr-assembly1.cif.gz_N unmethylated mtb ribosome 50s with seq-9 0.9819 13 116
5xym-assembly1.cif.gz_N large subunit of mycobacterium smegmatis 0.9677 6 116
4v4p-assembly1.cif.gz_A0 crystal structure of 70s ribosome with thrs operator and trnas. 0.955 15 116
8cvm-assembly1.cif.gz_m cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9493 10 119
7as8-assembly1.cif.gz_R bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9424 6 115
ID Description Score Start End Superfamily
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9735 13 114 3.90.1030.10
5v7qN00 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9661 6 116 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.956 13 114 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9552 13 114 3.90.1030.10
af_Q4DPQ0_51_164_3.90.1030.10 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9525 11 114 3.90.1030.10
ID Description Score Start End GO Terms
AF-A0A354B6G4-F1-model_v4 50S ribosomal protein L17 1.001 13 88 GO:0003735
GO:0006412
GO:0022625
AF-A0A1F9ENG3-F1-model_v4 50S ribosomal protein L17 1 20 113 GO:0003735
GO:0006412
GO:0022625
AF-A0A545AYL0-F1-model_v4 Large ribosomal subunit protein bL17 0.9942 13 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A2E0WCX0-F1-model_v4 Large ribosomal subunit protein bL17 0.9904 13 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A1V5DEQ6-F1-model_v4 50S ribosomal protein L17 0.9883 24 116 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
83.36 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map