F488674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1034 | 396 | 1015 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10000125|Ga0213875_1000012575 |
| Length | 345 |
| Sequence | MSQPDTPRRGKVAVIGAGFYGSTTAQRLAEYDIFEEVVLTDIIDGKPEGLALDMNQSRPIEGFETRVTGQTTGRSGDGYEAVAGSGIVVITAGLPRKPGMSRMDLIEVNAKIVRDVVENVVKHAPEAVLIVVSNPLDEMTALAAKVSGFPSSRVMGQAGMLDTARFSYFVAEKLGVPAGSVRTLTLGSHGDTMVPVPSACSVSGRPLGELLPAEEIDKLVTRTRNGGGEIVGLLKTGSAYYAPSAAAARMARAVAADSGDVMPVCAWVDGEYGISGVYLGVEAEIGSAGVRRVVQRDLSDTELAALREAAEAVRAKQASRSCASQGGAGPARRSPGPRPAGRRRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 2 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 3 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 4 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 5 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 6 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 7 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 8 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 9 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 10 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 11 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 12 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 13 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 14 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 15 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 16 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 17 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 18 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 119 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 181 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 182 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 196 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 211 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 244 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 253 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 254 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 257 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 260 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 261 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 262 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 263 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 264 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 265 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 266 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 267 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 268 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 275 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 276 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 340 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 343 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 344 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 345 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 346 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 347 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 348 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 351 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 391 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 394 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 395 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 396 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.1 |
| Metatranscriptomes | 1.06 |
| Isolates | 1.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 4.26 |
| Rhizosphere | 91.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10018873 | 3300003373 | Bacteria | 1792 |
| 2 | Ga0070658_10000726 | 3300005327 | Bacteria | 28475 |
| 3 | Ga0070658_10167961 | 3300005327 | Bacteria | 1843 |
| 4 | Ga0070676_10043582 | 3300005328 | Bacteria | 2608 |
| 5 | Ga0070683_100072950 | 3300005329 | Bacteria | 3205 |
| 6 | Ga0070683_100173090 | 3300005329 | Bacteria | 2049 |
| 7 | Ga0070683_100220782 | 3300005329 | Bacteria | 1801 |
| 8 | Ga0068869_100006152 | 3300005334 | Bacteria | 7599 |
| 9 | Ga0068869_100274442 | 3300005334 | Bacteria | 1354 |
| 10 | Ga0070666_10106644 | 3300005335 | Bacteria | 1935 |
| 11 | Ga0070680_100043236 | 3300005336 | Bacteria | 3659 |
| 12 | Ga0070680_100056299 | 3300005336 | Bacteria | 3214 |
| 13 | Ga0070680_100257496 | 3300005336 | Bacteria | 1476 |
| 14 | Ga0068868_100044731 | 3300005338 | Bacteria | 3462 |
| 15 | Ga0070660_100056267 | 3300005339 | Bacteria | 3042 |
| 16 | Ga0070660_100085659 | 3300005339 | Bacteria | 2479 |
| 17 | Ga0070687_100007727 | 3300005343 | Bacteria | 4507 |
| 18 | Ga0070692_10003994 | 3300005345 | Bacteria | 6091 |
| 19 | Ga0070675_100028479 | 3300005354 | Bacteria | 4495 |
| 20 | Ga0070671_100044503 | 3300005355 | Bacteria | 3689 |
| 21 | Ga0070673_100003932 | 3300005364 | Bacteria | 9334 |
| 22 | Ga0070673_100038754 | 3300005364 | Bacteria | 3641 |
| 23 | Ga0070659_100005916 | 3300005366 | Bacteria | 8815 |
| 24 | Ga0070659_100010121 | 3300005366 | Bacteria | 6941 |
| 25 | Ga0070659_100067507 | 3300005366 | Bacteria | 2836 |
| 26 | Ga0070659_100176405 | 3300005366 | Bacteria | 1752 |
| 27 | Ga0070659_100360254 | 3300005366 | Bacteria | 1222 |
| 28 | Ga0070667_100211942 | 3300005367 | Bacteria | 1722 |
| 29 | Ga0070709_10001361 | 3300005434 | Bacteria | 13346 |
| 30 | Ga0070709_10012963 | 3300005434 | Bacteria | 4675 |
| 31 | Ga0070709_10036675 | 3300005434 | Bacteria | 2989 |
| 32 | Ga0070709_10088459 | 3300005434 | Bacteria | 2037 |
| 33 | Ga0070709_10114686 | 3300005434 | Bacteria | 1816 |
| 34 | Ga0070714_100000545 | 3300005435 | Bacteria | 27112 |
| 35 | Ga0070714_100001325 | 3300005435 | Bacteria | 17871 |
| 36 | Ga0070714_100025088 | 3300005435 | Bacteria | 4917 |
| 37 | Ga0070714_100117982 | 3300005435 | Bacteria | 2357 |
| 38 | Ga0070713_100000483 | 3300005436 | Bacteria | 25351 |
| 39 | Ga0070713_100003097 | 3300005436 | Bacteria | 10939 |
| 40 | Ga0070713_100008642 | 3300005436 | Bacteria | 7238 |
| 41 | Ga0070713_100012555 | 3300005436 | Bacteria | 6218 |
| 42 | Ga0070713_100021482 | 3300005436 | Bacteria | 4968 |
| 43 | Ga0070713_100149652 | 3300005436 | Bacteria | 2075 |
| 44 | Ga0070713_100165594 | 3300005436 | Bacteria | 1976 |
| 45 | Ga0070710_10000539 | 3300005437 | Bacteria | 17930 |
| 46 | Ga0070710_10000864 | 3300005437 | Bacteria | 14525 |
| 47 | Ga0070710_10016620 | 3300005437 | Bacteria | 3748 |
| 48 | Ga0070710_10063603 | 3300005437 | Bacteria | 2108 |
| 49 | Ga0070710_10085268 | 3300005437 | Bacteria | 1852 |
| 50 | Ga0070701_10085083 | 3300005438 | Bacteria | 1721 |
| 51 | Ga0070711_100027416 | 3300005439 | Bacteria | 3739 |
| 52 | Ga0070711_100056913 | 3300005439 | Bacteria | 2705 |
| 53 | Ga0070711_100127218 | 3300005439 | Bacteria | 1893 |
| 54 | Ga0070708_100001278 | 3300005445 | Bacteria | 19366 |
| 55 | Ga0070708_100015039 | 3300005445 | Bacteria | 6383 |
| 56 | Ga0070708_100198649 | 3300005445 | Bacteria | 1877 |
| 57 | Ga0070708_100238464 | 3300005445 | Bacteria | 1707 |
| 58 | Ga0070663_100026128 | 3300005455 | Bacteria | 3950 |
| 59 | Ga0070663_100349091 | 3300005455 | Bacteria | 1197 |
| 60 | Ga0070681_10087816 | 3300005458 | Bacteria | 3062 |
| 61 | Ga0070681_10101000 | 3300005458 | Bacteria | 2830 |
| 62 | Ga0070681_10174259 | 3300005458 | Bacteria | 2073 |
| 63 | Ga0070681_10383872 | 3300005458 | Bacteria | 1315 |
| 64 | Ga0070681_10390902 | 3300005458 | Bacteria | 1302 |
| 65 | Ga0070681_10393953 | 3300005458 | Bacteria | 1296 |
| 66 | Ga0070681_10537162 | 3300005458 | Bacteria | 1083 |
| 67 | Ga0070685_10060058 | 3300005466 | Bacteria | 2222 |
| 68 | Ga0070706_100000990 | 3300005467 | Bacteria | 30930 |
| 69 | Ga0070706_100001894 | 3300005467 | Bacteria | 21601 |
| 70 | Ga0070706_100004349 | 3300005467 | Bacteria | 13686 |
| 71 | Ga0070706_100008020 | 3300005467 | Bacteria | 9852 |
| 72 | Ga0070706_100024464 | 3300005467 | Bacteria | 5560 |
| 73 | Ga0070706_100053956 | 3300005467 | Bacteria | 3711 |
| 74 | Ga0070706_100057020 | 3300005467 | Bacteria | 3604 |
| 75 | Ga0070706_100083098 | 3300005467 | Bacteria | 2966 |
| 76 | Ga0070706_100096173 | 3300005467 | Bacteria | 2749 |
| 77 | Ga0070707_100000256 | 3300005468 | Bacteria | 53538 |
| 78 | Ga0070707_100004570 | 3300005468 | Bacteria | 12957 |
| 79 | Ga0070707_100007016 | 3300005468 | Bacteria | 10448 |
| 80 | Ga0070707_100026268 | 3300005468 | Bacteria | 5528 |
| 81 | Ga0070707_100029674 | 3300005468 | Bacteria | 5205 |
| 82 | Ga0070707_100168762 | 3300005468 | Bacteria | 2133 |
| 83 | Ga0070707_100172512 | 3300005468 | Bacteria | 2107 |
| 84 | Ga0070707_100180529 | 3300005468 | Bacteria | 2057 |
| 85 | Ga0070707_100198649 | 3300005468 | Bacteria | 1954 |
| 86 | Ga0070707_100233617 | 3300005468 | Bacteria | 1789 |
| 87 | Ga0070707_100254561 | 3300005468 | Bacteria | 1709 |
| 88 | Ga0070707_100305997 | 3300005468 | Bacteria | 1545 |
| 89 | Ga0070698_100000292 | 3300005471 | Bacteria | 50989 |
| 90 | Ga0070698_100000333 | 3300005471 | Bacteria | 48484 |
| 91 | Ga0070698_100000898 | 3300005471 | Bacteria | 32677 |
| 92 | Ga0070698_100002525 | 3300005471 | Bacteria | 20157 |
| 93 | Ga0070698_100013017 | 3300005471 | Bacteria | 8806 |
| 94 | Ga0070698_100017040 | 3300005471 | Bacteria | 7660 |
| 95 | Ga0070698_100017971 | 3300005471 | Bacteria | 7447 |
| 96 | Ga0070698_100051847 | 3300005471 | Bacteria | 4177 |
| 97 | Ga0070698_100070857 | 3300005471 | Bacteria | 3497 |
| 98 | Ga0070698_100086838 | 3300005471 | Bacteria | 3114 |
| 99 | Ga0070698_100131717 | 3300005471 | Bacteria | 2455 |
| 100 | Ga0070698_100228475 | 3300005471 | Bacteria | 1794 |
| 101 | Ga0070699_100020685 | 3300005518 | Bacteria | 5677 |
| 102 | Ga0070699_100028148 | 3300005518 | Bacteria | 4846 |
| 103 | Ga0070699_100221012 | 3300005518 | Bacteria | 1688 |
| 104 | Ga0070679_100034617 | 3300005530 | Bacteria | 5006 |
| 105 | Ga0070679_100040543 | 3300005530 | Bacteria | 4632 |
| 106 | Ga0070679_100053534 | 3300005530 | Bacteria | 4017 |
| 107 | Ga0070679_100085114 | 3300005530 | Bacteria | 3149 |
| 108 | Ga0070679_100173911 | 3300005530 | Bacteria | 2126 |
| 109 | Ga0070679_100207892 | 3300005530 | Bacteria | 1922 |
| 110 | Ga0070697_100108411 | 3300005536 | Bacteria | 2312 |
| 111 | Ga0070697_100140261 | 3300005536 | Bacteria | 2032 |
| 112 | Ga0068853_100227422 | 3300005539 | Bacteria | 1705 |
| 113 | Ga0068853_100331322 | 3300005539 | Bacteria | 1413 |
| 114 | Ga0070686_100004813 | 3300005544 | Bacteria | 7452 |
| 115 | Ga0070696_100008315 | 3300005546 | Bacteria | 6942 |
| 116 | Ga0070693_100003713 | 3300005547 | Bacteria | 7140 |
| 117 | Ga0070693_100016084 | 3300005547 | Bacteria | 3865 |
| 118 | Ga0070665_100006607 | 3300005548 | Bacteria | 11785 |
| 119 | Ga0070665_100117827 | 3300005548 | Bacteria | 2658 |
| 120 | Ga0070665_100147095 | 3300005548 | Bacteria | 2359 |
| 121 | Ga0068855_100449672 | 3300005563 | Bacteria | 1406 |
| 122 | Ga0070664_100016206 | 3300005564 | Bacteria | 6108 |
| 123 | Ga0068854_100125742 | 3300005578 | Bacteria | 1952 |
| 124 | Ga0068856_100115958 | 3300005614 | Bacteria | 2679 |
| 125 | Ga0068856_100320759 | 3300005614 | Bacteria | 1566 |
| 126 | Ga0068856_100380650 | 3300005614 | Bacteria | 1430 |
| 127 | Ga0070702_100000031 | 3300005615 | Bacteria | 37489 |
| 128 | Ga0070702_100030640 | 3300005615 | Bacteria | 2934 |
| 129 | Ga0068852_100011289 | 3300005616 | Bacteria | 6719 |
| 130 | Ga0068852_100295725 | 3300005616 | Bacteria | 1566 |
| 131 | Ga0068859_100066935 | 3300005617 | Bacteria | 3627 |
| 132 | Ga0068859_100443735 | 3300005617 | Bacteria | 1394 |
| 133 | Ga0068864_100058887 | 3300005618 | Bacteria | 3321 |
| 134 | Ga0068861_100014024 | 3300005719 | Bacteria | 5620 |
| 135 | Ga0068861_100220936 | 3300005719 | Bacteria | 1601 |
| 136 | Ga0068861_100264042 | 3300005719 | Bacteria | 1475 |
| 137 | Ga0068851_10035674 | 3300005834 | Bacteria | 2487 |
| 138 | Ga0068870_10000614 | 3300005840 | Bacteria | 13559 |
| 139 | Ga0068863_100021114 | 3300005841 | Bacteria | 6220 |
| 140 | Ga0068863_100111276 | 3300005841 | Bacteria | 2608 |
| 141 | Ga0068863_100144648 | 3300005841 | Bacteria | 2273 |
| 142 | Ga0068858_100180277 | 3300005842 | Bacteria | 1994 |
| 143 | Ga0068858_100188374 | 3300005842 | Bacteria | 1949 |
| 144 | Ga0068860_100043085 | 3300005843 | Bacteria | 4307 |
| 145 | Ga0081455_10057618 | 3300005937 | Bacteria | 3292 |
| 146 | Ga0081455_10156068 | 3300005937 | Bacteria | 1754 |
| 147 | Ga0081538_10002786 | 3300005981 | Bacteria | 16746 |
| 148 | Ga0081538_10008955 | 3300005981 | Bacteria | 8411 |
| 149 | Ga0081538_10026674 | 3300005981 | Bacteria | 4031 |
| 150 | Ga0081538_10034098 | 3300005981 | Bacteria | 3373 |
| 151 | Ga0081538_10037427 | 3300005981 | Bacteria | 3148 |
| 152 | Ga0081540_1000250 | 3300005983 | Bacteria | 56639 |
| 153 | Ga0081540_1000330 | 3300005983 | Bacteria | 49099 |
| 154 | Ga0081540_1005418 | 3300005983 | Bacteria | 9524 |
| 155 | Ga0081540_1020749 | 3300005983 | Bacteria | 3938 |
| 156 | Ga0081540_1032375 | 3300005983 | Bacteria | 2856 |
| 157 | Ga0081539_10004919 | 3300005985 | Bacteria | 14234 |
| 158 | Ga0081539_10018877 | 3300005985 | Bacteria | 4752 |
| 159 | Ga0081539_10150970 | 3300005985 | Bacteria | 1118 |
| 160 | Ga0070717_10001205 | 3300006028 | Bacteria | 17518 |
| 161 | Ga0070717_10002725 | 3300006028 | Bacteria | 12478 |
| 162 | Ga0070717_10011881 | 3300006028 | Bacteria | 6626 |
| 163 | Ga0070717_10050812 | 3300006028 | Bacteria | 3409 |
| 164 | Ga0070717_10076722 | 3300006028 | Bacteria | 2797 |
| 165 | Ga0070717_10134834 | 3300006028 | Bacteria | 2125 |
| 166 | Ga0070717_10263592 | 3300006028 | Bacteria | 1525 |
| 167 | Ga0070717_10461944 | 3300006028 | Bacteria | 1145 |
| 168 | Ga0075432_10026310 | 3300006058 | Bacteria | 1998 |
| 169 | Ga0070715_10052548 | 3300006163 | Bacteria | 1758 |
| 170 | Ga0070715_10057037 | 3300006163 | Bacteria | 1701 |
| 171 | Ga0070716_100001415 | 3300006173 | Bacteria | 10653 |
| 172 | Ga0070716_100026533 | 3300006173 | Bacteria | 3103 |
| 173 | Ga0070716_100045435 | 3300006173 | Bacteria | 2466 |
| 174 | Ga0070712_100002052 | 3300006175 | Bacteria | 12329 |
| 175 | Ga0070712_100008902 | 3300006175 | Bacteria | 6323 |
| 176 | Ga0070712_100014062 | 3300006175 | Bacteria | 5131 |
| 177 | Ga0070712_100093705 | 3300006175 | Bacteria | 2205 |
| 178 | Ga0070712_100398840 | 3300006175 | Bacteria | 1136 |
| 179 | Ga0097621_100002544 | 3300006237 | Bacteria | 12495 |
| 180 | Ga0097621_100037665 | 3300006237 | Bacteria | 3877 |
| 181 | Ga0097621_100111339 | 3300006237 | Bacteria | 2314 |
| 182 | Ga0068871_100047631 | 3300006358 | Bacteria | 3458 |
| 183 | Ga0068871_100091961 | 3300006358 | Bacteria | 2529 |
| 184 | Ga0068871_100129495 | 3300006358 | Bacteria | 2139 |
| 185 | Ga0075428_100020125 | 3300006844 | Bacteria | 7389 |
| 186 | Ga0075428_100062887 | 3300006844 | Bacteria | 4063 |
| 187 | Ga0075428_100282093 | 3300006844 | Bacteria | 1787 |
| 188 | Ga0075430_100000294 | 3300006846 | Bacteria | 35128 |
| 189 | Ga0075430_100001663 | 3300006846 | Bacteria | 18174 |
| 190 | Ga0075430_100006545 | 3300006846 | Bacteria | 9825 |
| 191 | Ga0075430_100155213 | 3300006846 | Bacteria | 1906 |
| 192 | Ga0075431_100046671 | 3300006847 | Bacteria | 4467 |
| 193 | Ga0075431_100063910 | 3300006847 | Bacteria | 3799 |
| 194 | Ga0075431_100272902 | 3300006847 | Bacteria | 1713 |
| 195 | Ga0075433_10031211 | 3300006852 | Bacteria | 4553 |
| 196 | Ga0075433_10049564 | 3300006852 | Bacteria | 3653 |
| 197 | Ga0075433_10143574 | 3300006852 | Bacteria | 2122 |
| 198 | Ga0075434_100009917 | 3300006871 | Bacteria | 8910 |
| 199 | Ga0075434_100018423 | 3300006871 | Bacteria | 6746 |
| 200 | Ga0075434_100044958 | 3300006871 | Bacteria | 4380 |
| 201 | Ga0075434_100216438 | 3300006871 | Bacteria | 1936 |
| 202 | Ga0075429_100002678 | 3300006880 | Bacteria | 14987 |
| 203 | Ga0075429_100044119 | 3300006880 | Bacteria | 3878 |
| 204 | Ga0075429_100116528 | 3300006880 | Bacteria | 2335 |
| 205 | Ga0075436_100004879 | 3300006914 | Bacteria | 9217 |
| 206 | Ga0075436_100074055 | 3300006914 | Bacteria | 2357 |
| 207 | Ga0097620_100066940 | 3300006931 | Bacteria | 3627 |
| 208 | Ga0097620_100443771 | 3300006931 | Bacteria | 1394 |
| 209 | Ga0075435_100064936 | 3300007076 | Bacteria | 2966 |
| 210 | Ga0075435_100232998 | 3300007076 | Bacteria | 1565 |
| 211 | Ga0075435_100328524 | 3300007076 | Bacteria | 1309 |
| 212 | Ga0105240_10251979 | 3300009093 | Bacteria | 2041 |
| 213 | Ga0111539_10032226 | 3300009094 | Bacteria | 6366 |
| 214 | Ga0111539_10047409 | 3300009094 | Bacteria | 5135 |
| 215 | Ga0105245_10005437 | 3300009098 | Bacteria | 11189 |
| 216 | Ga0105245_10056487 | 3300009098 | Bacteria | 3529 |
| 217 | Ga0105247_10053503 | 3300009101 | Bacteria | 2490 |
| 218 | Ga0114129_10006711 | 3300009147 | Bacteria | 16343 |
| 219 | Ga0114129_10009018 | 3300009147 | Bacteria | 14220 |
| 220 | Ga0114129_10047822 | 3300009147 | Bacteria | 6010 |
| 221 | Ga0114129_10166468 | 3300009147 | Bacteria | 3008 |
| 222 | Ga0114129_10184699 | 3300009147 | Bacteria | 2835 |
| 223 | Ga0114129_10412805 | 3300009147 | Bacteria | 1777 |
| 224 | Ga0105243_10365331 | 3300009148 | Bacteria | 1330 |
| 225 | Ga0105241_10379178 | 3300009174 | Bacteria | 1235 |
| 226 | Ga0105248_10152913 | 3300009177 | Bacteria | 2603 |
| 227 | Ga0105248_10294461 | 3300009177 | Bacteria | 1827 |
| 228 | Ga0105237_10033633 | 3300009545 | Bacteria | 5195 |
| 229 | Ga0105238_10129275 | 3300009551 | Bacteria | 2504 |
| 230 | Ga0105238_10290145 | 3300009551 | Bacteria | 1618 |
| 231 | Ga0105249_10073392 | 3300009553 | Bacteria | 3166 |
| 232 | Ga0099796_10050215 | 3300010159 | Bacteria | 1445 |
| 233 | Ga0105239_10036023 | 3300010375 | Bacteria | 5432 |
| 234 | Ga0157313_1001542 | 3300012503 | Bacteria | 1259 |
| 235 | Ga0157371_10059306 | 3300013102 | Bacteria | 2713 |
| 236 | Ga0157371_10137477 | 3300013102 | Bacteria | 1740 |
| 237 | Ga0157370_10049599 | 3300013104 | Bacteria | 4017 |
| 238 | Ga0157370_10057438 | 3300013104 | Bacteria | 3700 |
| 239 | Ga0157370_10090646 | 3300013104 | Bacteria | 2870 |
| 240 | Ga0157369_10011739 | 3300013105 | Bacteria | 9946 |
| 241 | Ga0157369_10264471 | 3300013105 | Bacteria | 1793 |
| 242 | Ga0157374_10020729 | 3300013296 | Bacteria | 5836 |
| 243 | Ga0157374_10259101 | 3300013296 | Bacteria | 1713 |
| 244 | Ga0163162_10013494 | 3300013306 | Bacteria | 7975 |
| 245 | Ga0163162_10127754 | 3300013306 | Bacteria | 2649 |
| 246 | Ga0157375_10193002 | 3300013308 | Bacteria | 2192 |
| 247 | Ga0157375_10448831 | 3300013308 | Bacteria | 1455 |
| 248 | Ga0163163_10001600 | 3300014325 | Bacteria | 19033 |
| 249 | Ga0157379_10017361 | 3300014968 | Bacteria | 6340 |
| 250 | Ga0157379_10146024 | 3300014968 | Bacteria | 2133 |
| 251 | Ga0157379_10150130 | 3300014968 | Bacteria | 2102 |
| 252 | Ga0157376_10103696 | 3300014969 | Bacteria | 2491 |
| 253 | Ga0163161_10099487 | 3300017792 | Bacteria | 2163 |
| 254 | Ga0206349_1541197 | 3300020075 | Bacteria | 1324 |
| 255 | Ga0206351_10996409 | 3300020077 | Bacteria | 2111 |
| 256 | Ga0206354_10500860 | 3300020081 | Bacteria | 2269 |
| 257 | Ga0206354_10593962 | 3300020081 | Bacteria | 4033 |
| 258 | Ga0213873_10019370 | 3300021358 | Bacteria | 1578 |
| 259 | Ga0213875_10000125 | 3300021388 | Bacteria | 85515 |
| 260 | Ga0213875_10000250 | 3300021388 | Bacteria | 54123 |
| 261 | Ga0213875_10016542 | 3300021388 | Bacteria | 3574 |
| 262 | Ga0213875_10033159 | 3300021388 | Bacteria | 2438 |
| 263 | Ga0213871_10050030 | 3300021441 | Bacteria | 1143 |
| 264 | Ga0224712_10003353 | 3300022467 | Bacteria | 4150 |
| 265 | Ga0224712_10012929 | 3300022467 | Bacteria | 2644 |
| 266 | Ga0224712_10013796 | 3300022467 | Bacteria | 2584 |
| 267 | Ga0224712_10017923 | 3300022467 | Bacteria | 2357 |
| 268 | Ga0224712_10021524 | 3300022467 | Bacteria | 2208 |
| 269 | Ga0224712_10021811 | 3300022467 | Bacteria | 2198 |
| 270 | Ga0224712_10127430 | 3300022467 | Bacteria | 1108 |
| 271 | Ga0224572_1000791 | 3300024225 | Bacteria | 4180 |
| 272 | Ga0207656_10020636 | 3300025321 | Bacteria | 2621 |
| 273 | Ga0207653_10008398 | 3300025885 | Bacteria | 3216 |
| 274 | Ga0207692_10001094 | 3300025898 | Bacteria | 9936 |
| 275 | Ga0207692_10001437 | 3300025898 | Bacteria | 8917 |
| 276 | Ga0207692_10004739 | 3300025898 | Bacteria | 5402 |
| 277 | Ga0207692_10025602 | 3300025898 | Bacteria | 2758 |
| 278 | Ga0207692_10033061 | 3300025898 | Bacteria | 2491 |
| 279 | Ga0207692_10138175 | 3300025898 | Bacteria | 1383 |
| 280 | Ga0207692_10244113 | 3300025898 | Bacteria | 1074 |
| 281 | Ga0207710_10028052 | 3300025900 | Bacteria | 2442 |
| 282 | Ga0207688_10017900 | 3300025901 | Bacteria | 3856 |
| 283 | Ga0207688_10106533 | 3300025901 | Bacteria | 1624 |
| 284 | Ga0207680_10025579 | 3300025903 | Bacteria | 3258 |
| 285 | Ga0207685_10022394 | 3300025905 | Bacteria | 2135 |
| 286 | Ga0207685_10039962 | 3300025905 | Bacteria | 1745 |
| 287 | Ga0207699_10001830 | 3300025906 | Bacteria | 10004 |
| 288 | Ga0207699_10006266 | 3300025906 | Bacteria | 5746 |
| 289 | Ga0207699_10011057 | 3300025906 | Bacteria | 4547 |
| 290 | Ga0207699_10074359 | 3300025906 | Bacteria | 2087 |
| 291 | Ga0207699_10154582 | 3300025906 | Bacteria | 1521 |
| 292 | Ga0207643_10000204 | 3300025908 | Bacteria | 41257 |
| 293 | Ga0207705_10001642 | 3300025909 | Bacteria | 17743 |
| 294 | Ga0207684_10001419 | 3300025910 | Bacteria | 25953 |
| 295 | Ga0207684_10002612 | 3300025910 | Bacteria | 18016 |
| 296 | Ga0207684_10002799 | 3300025910 | Bacteria | 17340 |
| 297 | Ga0207684_10015342 | 3300025910 | Bacteria | 6595 |
| 298 | Ga0207684_10092354 | 3300025910 | Bacteria | 2579 |
| 299 | Ga0207684_10186921 | 3300025910 | Bacteria | 1786 |
| 300 | Ga0207654_10054753 | 3300025911 | Bacteria | 2306 |
| 301 | Ga0207707_10035796 | 3300025912 | Bacteria | 4341 |
| 302 | Ga0207707_10098332 | 3300025912 | Bacteria | 2558 |
| 303 | Ga0207707_10109135 | 3300025912 | Bacteria | 2419 |
| 304 | Ga0207695_10287073 | 3300025913 | Bacteria | 1538 |
| 305 | Ga0207695_10361244 | 3300025913 | Bacteria | 1339 |
| 306 | Ga0207671_10071968 | 3300025914 | Bacteria | 2579 |
| 307 | Ga0207671_10151559 | 3300025914 | Bacteria | 1791 |
| 308 | Ga0207693_10001078 | 3300025915 | Bacteria | 24478 |
| 309 | Ga0207693_10005180 | 3300025915 | Bacteria | 10914 |
| 310 | Ga0207693_10008773 | 3300025915 | Bacteria | 8262 |
| 311 | Ga0207693_10013430 | 3300025915 | Bacteria | 6604 |
| 312 | Ga0207693_10014990 | 3300025915 | Bacteria | 6223 |
| 313 | Ga0207693_10085727 | 3300025915 | Bacteria | 2467 |
| 314 | Ga0207693_10138270 | 3300025915 | Bacteria | 1915 |
| 315 | Ga0207663_10010431 | 3300025916 | Bacteria | 4947 |
| 316 | Ga0207663_10014695 | 3300025916 | Bacteria | 4296 |
| 317 | Ga0207663_10039635 | 3300025916 | Bacteria | 2856 |
| 318 | Ga0207663_10074280 | 3300025916 | Bacteria | 2203 |
| 319 | Ga0207663_10084495 | 3300025916 | Bacteria | 2088 |
| 320 | Ga0207660_10038844 | 3300025917 | Bacteria | 3325 |
| 321 | Ga0207660_10254343 | 3300025917 | Bacteria | 1387 |
| 322 | Ga0207662_10011478 | 3300025918 | Bacteria | 4917 |
| 323 | Ga0207662_10052164 | 3300025918 | Bacteria | 2434 |
| 324 | Ga0207657_10044561 | 3300025919 | Bacteria | 3899 |
| 325 | Ga0207657_10089951 | 3300025919 | Bacteria | 2562 |
| 326 | Ga0207657_10105478 | 3300025919 | Bacteria | 2333 |
| 327 | Ga0207657_10165197 | 3300025919 | Bacteria | 1796 |
| 328 | Ga0207649_10018450 | 3300025920 | Bacteria | 3969 |
| 329 | Ga0207652_10124104 | 3300025921 | Bacteria | 2299 |
| 330 | Ga0207652_10159071 | 3300025921 | Bacteria | 2024 |
| 331 | Ga0207652_10219371 | 3300025921 | Bacteria | 1713 |
| 332 | Ga0207652_10403798 | 3300025921 | Bacteria | 1233 |
| 333 | Ga0207646_10000950 | 3300025922 | Bacteria | 37311 |
| 334 | Ga0207646_10001124 | 3300025922 | Bacteria | 34128 |
| 335 | Ga0207646_10031779 | 3300025922 | Bacteria | 4778 |
| 336 | Ga0207646_10044143 | 3300025922 | Bacteria | 4001 |
| 337 | Ga0207646_10072069 | 3300025922 | Bacteria | 3086 |
| 338 | Ga0207646_10102009 | 3300025922 | Bacteria | 2572 |
| 339 | Ga0207646_10184097 | 3300025922 | Bacteria | 1886 |
| 340 | Ga0207646_10201908 | 3300025922 | Bacteria | 1796 |
| 341 | Ga0207650_10002710 | 3300025925 | Bacteria | 12237 |
| 342 | Ga0207659_10004400 | 3300025926 | Bacteria | 8514 |
| 343 | Ga0207687_10006217 | 3300025927 | Bacteria | 7905 |
| 344 | Ga0207687_10074652 | 3300025927 | Bacteria | 2431 |
| 345 | Ga0207687_10075188 | 3300025927 | Bacteria | 2424 |
| 346 | Ga0207700_10001672 | 3300025928 | Bacteria | 12587 |
| 347 | Ga0207700_10002173 | 3300025928 | Bacteria | 11233 |
| 348 | Ga0207700_10005055 | 3300025928 | Bacteria | 7845 |
| 349 | Ga0207700_10020413 | 3300025928 | Bacteria | 4499 |
| 350 | Ga0207700_10021329 | 3300025928 | Bacteria | 4421 |
| 351 | Ga0207700_10022331 | 3300025928 | Bacteria | 4340 |
| 352 | Ga0207700_10034120 | 3300025928 | Bacteria | 3649 |
| 353 | Ga0207700_10057202 | 3300025928 | Bacteria | 2939 |
| 354 | Ga0207700_10096005 | 3300025928 | Bacteria | 2352 |
| 355 | Ga0207700_10301731 | 3300025928 | Bacteria | 1383 |
| 356 | Ga0207664_10000427 | 3300025929 | Bacteria | 30029 |
| 357 | Ga0207664_10000940 | 3300025929 | Bacteria | 19579 |
| 358 | Ga0207664_10002584 | 3300025929 | Bacteria | 11979 |
| 359 | Ga0207664_10007361 | 3300025929 | Bacteria | 7629 |
| 360 | Ga0207664_10020499 | 3300025929 | Bacteria | 4901 |
| 361 | Ga0207664_10021524 | 3300025929 | Bacteria | 4797 |
| 362 | Ga0207664_10043770 | 3300025929 | Bacteria | 3504 |
| 363 | Ga0207664_10052186 | 3300025929 | Bacteria | 3233 |
| 364 | Ga0207664_10053493 | 3300025929 | Bacteria | 3196 |
| 365 | Ga0207664_10080047 | 3300025929 | Bacteria | 2654 |
| 366 | Ga0207664_10191859 | 3300025929 | Bacteria | 1759 |
| 367 | Ga0207664_10304935 | 3300025929 | Bacteria | 1402 |
| 368 | Ga0207644_10007562 | 3300025931 | Bacteria | 7084 |
| 369 | Ga0207644_10044521 | 3300025931 | Bacteria | 3153 |
| 370 | Ga0207690_10000219 | 3300025932 | Bacteria | 43461 |
| 371 | Ga0207690_10030154 | 3300025932 | Bacteria | 3456 |
| 372 | Ga0207690_10333355 | 3300025932 | Bacteria | 1196 |
| 373 | Ga0207686_10114479 | 3300025934 | Bacteria | 1825 |
| 374 | Ga0207670_10035613 | 3300025936 | Bacteria | 3229 |
| 375 | Ga0207665_10001719 | 3300025939 | Bacteria | 14712 |
| 376 | Ga0207665_10002491 | 3300025939 | Bacteria | 12398 |
| 377 | Ga0207665_10017416 | 3300025939 | Bacteria | 4721 |
| 378 | Ga0207665_10025411 | 3300025939 | Bacteria | 3908 |
| 379 | Ga0207665_10056283 | 3300025939 | Bacteria | 2654 |
| 380 | Ga0207665_10134613 | 3300025939 | Bacteria | 1757 |
| 381 | Ga0207665_10141555 | 3300025939 | Bacteria | 1716 |
| 382 | Ga0207691_10029944 | 3300025940 | Bacteria | 5090 |
| 383 | Ga0207711_10178971 | 3300025941 | Bacteria | 1927 |
| 384 | Ga0207689_10000223 | 3300025942 | Bacteria | 50338 |
| 385 | Ga0207689_10017179 | 3300025942 | Bacteria | 6124 |
| 386 | Ga0207661_10130930 | 3300025944 | Bacteria | 2148 |
| 387 | Ga0207661_10510587 | 3300025944 | Bacteria | 1099 |
| 388 | Ga0207679_10006307 | 3300025945 | Bacteria | 7488 |
| 389 | Ga0207712_10023350 | 3300025961 | Bacteria | 4080 |
| 390 | Ga0207712_10098587 | 3300025961 | Bacteria | 2168 |
| 391 | Ga0207668_10127648 | 3300025972 | Bacteria | 1937 |
| 392 | Ga0207640_10046715 | 3300025981 | Bacteria | 2788 |
| 393 | Ga0207640_10270453 | 3300025981 | Bacteria | 1329 |
| 394 | Ga0207677_10018630 | 3300026023 | Bacteria | 4170 |
| 395 | Ga0207703_10040754 | 3300026035 | Bacteria | 3718 |
| 396 | Ga0207639_10083405 | 3300026041 | Bacteria | 2537 |
| 397 | Ga0207639_10328799 | 3300026041 | Bacteria | 1359 |
| 398 | Ga0207678_10002516 | 3300026067 | Bacteria | 16688 |
| 399 | Ga0207678_10006007 | 3300026067 | Bacteria | 10803 |
| 400 | Ga0207708_10046904 | 3300026075 | Bacteria | 3290 |
| 401 | Ga0207702_10043655 | 3300026078 | Bacteria | 3765 |
| 402 | Ga0207702_10056949 | 3300026078 | Bacteria | 3320 |
| 403 | Ga0207702_10070243 | 3300026078 | Bacteria | 3012 |
| 404 | Ga0207702_10130343 | 3300026078 | Bacteria | 2262 |
| 405 | Ga0207702_10370778 | 3300026078 | Bacteria | 1374 |
| 406 | Ga0207702_10386642 | 3300026078 | Bacteria | 1346 |
| 407 | Ga0207641_10009542 | 3300026088 | Bacteria | 7995 |
| 408 | Ga0207676_10001541 | 3300026095 | Bacteria | 17016 |
| 409 | Ga0207676_10156658 | 3300026095 | Bacteria | 1968 |
| 410 | Ga0207674_10004964 | 3300026116 | Bacteria | 15897 |
| 411 | Ga0207674_10123468 | 3300026116 | Bacteria | 2555 |
| 412 | Ga0207675_100002250 | 3300026118 | Bacteria | 19196 |
| 413 | Ga0207675_100037515 | 3300026118 | Bacteria | 4520 |
| 414 | Ga0207675_100265546 | 3300026118 | Bacteria | 1664 |
| 415 | Ga0207683_10000804 | 3300026121 | Bacteria | 28698 |
| 416 | Ga0207683_10005606 | 3300026121 | Bacteria | 10764 |
| 417 | Ga0207683_10024244 | 3300026121 | Bacteria | 5222 |
| 418 | Ga0207698_10002366 | 3300026142 | Bacteria | 11182 |
| 419 | Ga0207698_10317204 | 3300026142 | Bacteria | 1458 |
| 420 | Ga0207428_10000537 | 3300027907 | Bacteria | 45252 |
| 421 | Ga0207428_10009923 | 3300027907 | Bacteria | 8528 |
| 422 | Ga0207428_10068605 | 3300027907 | Bacteria | 2789 |
| 423 | Ga0268266_10023015 | 3300028379 | Bacteria | 5303 |
| 424 | Ga0268266_10525110 | 3300028379 | Bacteria | 1132 |
| 425 | Ga0265336_10004601 | 3300028666 | Bacteria | 5184 |
| 426 | Ga0307517_10074469 | 3300028786 | Bacteria | 2994 |
| 427 | Ga0307515_10001066 | 3300028794 | Bacteria | 62806 |
| 428 | Ga0307515_10009042 | 3300028794 | Bacteria | 19333 |
| 429 | Ga0307515_10170578 | 3300028794 | Bacteria | 2171 |
| 430 | Ga0265338_10002247 | 3300028800 | Bacteria | 29390 |
| 431 | Ga0265338_10014640 | 3300028800 | Bacteria | 8701 |
| 432 | Ga0265338_10031380 | 3300028800 | Bacteria | 5211 |
| 433 | Ga0307512_10003683 | 3300030522 | Bacteria | 17448 |
| 434 | Ga0307512_10025517 | 3300030522 | Bacteria | 5234 |
| 435 | Ga0316181_1149483 | 3300030744 | Bacteria | 2422 |
| 436 | Ga0265330_10081434 | 3300031235 | Bacteria | 1395 |
| 437 | Ga0265320_10022258 | 3300031240 | Bacteria | 3393 |
| 438 | Ga0265325_10027015 | 3300031241 | Bacteria | 3105 |
| 439 | Ga0265340_10008623 | 3300031247 | Bacteria | 5496 |
| 440 | Ga0265340_10013418 | 3300031247 | Bacteria | 4302 |
| 441 | Ga0265340_10034361 | 3300031247 | Bacteria | 2522 |
| 442 | Ga0265316_10042524 | 3300031344 | Bacteria | 3631 |
| 443 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 444 | Ga0307513_10036904 | 3300031456 | Bacteria | 5443 |
| 445 | Ga0307509_10178452 | 3300031507 | Bacteria | 1993 |
| 446 | Ga0307408_100018031 | 3300031548 | Bacteria | 4735 |
| 447 | Ga0307408_100030377 | 3300031548 | Bacteria | 3752 |
| 448 | Ga0307408_100206281 | 3300031548 | Bacteria | 1594 |
| 449 | Ga0265313_10046513 | 3300031595 | Bacteria | 2106 |
| 450 | Ga0307508_10033247 | 3300031616 | Bacteria | 4654 |
| 451 | Ga0307508_10306467 | 3300031616 | Bacteria | 1181 |
| 452 | Ga0316579_10011444 | 3300031691 | Bacteria | 3770 |
| 453 | Ga0316579_10079237 | 3300031691 | Bacteria | 1563 |
| 454 | Ga0265314_10022618 | 3300031711 | Bacteria | 4814 |
| 455 | Ga0265314_10136154 | 3300031711 | Bacteria | 1525 |
| 456 | Ga0265342_10094939 | 3300031712 | Bacteria | 1705 |
| 457 | Ga0316576_10014040 | 3300031727 | Bacteria | 5341 |
| 458 | Ga0316578_10020196 | 3300031728 | Bacteria | 3677 |
| 459 | Ga0307516_10001792 | 3300031730 | Bacteria | 29478 |
| 460 | Ga0307405_10016418 | 3300031731 | Bacteria | 4037 |
| 461 | Ga0307405_10034777 | 3300031731 | Bacteria | 3002 |
| 462 | Ga0307405_10071517 | 3300031731 | Bacteria | 2232 |
| 463 | Ga0307413_10002297 | 3300031824 | Bacteria | 7739 |
| 464 | Ga0307413_10028958 | 3300031824 | Bacteria | 3092 |
| 465 | Ga0307413_10126857 | 3300031824 | Bacteria | 1739 |
| 466 | Ga0307413_10174920 | 3300031824 | Bacteria | 1524 |
| 467 | Ga0307410_10008218 | 3300031852 | Bacteria | 5775 |
| 468 | Ga0307410_10012065 | 3300031852 | Bacteria | 4974 |
| 469 | Ga0307410_10017362 | 3300031852 | Bacteria | 4320 |
| 470 | Ga0307410_10151531 | 3300031852 | Bacteria | 1727 |
| 471 | Ga0326468_10000905 | 3300031889 | Bacteria | 2896 |
| 472 | Ga0307406_10005635 | 3300031901 | Bacteria | 6845 |
| 473 | Ga0307406_10080903 | 3300031901 | Bacteria | 2158 |
| 474 | Ga0307406_10140744 | 3300031901 | Bacteria | 1707 |
| 475 | Ga0307407_10010091 | 3300031903 | Bacteria | 4436 |
| 476 | Ga0307412_10037573 | 3300031911 | Bacteria | 3113 |
| 477 | Ga0307412_10176155 | 3300031911 | Bacteria | 1604 |
| 478 | Ga0307409_100042353 | 3300031995 | Bacteria | 3409 |
| 479 | Ga0307409_100062244 | 3300031995 | Bacteria | 2920 |
| 480 | Ga0307409_100074136 | 3300031995 | Bacteria | 2718 |
| 481 | Ga0307409_100224732 | 3300031995 | Bacteria | 1697 |
| 482 | Ga0307416_100005911 | 3300032002 | Bacteria | 7596 |
| 483 | Ga0307416_100010416 | 3300032002 | Bacteria | 6138 |
| 484 | Ga0307416_100014187 | 3300032002 | Bacteria | 5446 |
| 485 | Ga0307416_100021209 | 3300032002 | Bacteria | 4658 |
| 486 | Ga0307416_100022814 | 3300032002 | Bacteria | 4527 |
| 487 | Ga0307416_100026645 | 3300032002 | Bacteria | 4263 |
| 488 | Ga0307416_100051710 | 3300032002 | Bacteria | 3284 |
| 489 | Ga0307416_100127411 | 3300032002 | Bacteria | 2283 |
| 490 | Ga0307416_100190815 | 3300032002 | Bacteria | 1932 |
| 491 | Ga0307414_10295094 | 3300032004 | Bacteria | 1368 |
| 492 | Ga0307411_10003583 | 3300032005 | Bacteria | 7239 |
| 493 | Ga0307411_10013764 | 3300032005 | Bacteria | 4478 |
| 494 | Ga0307411_10067943 | 3300032005 | Bacteria | 2401 |
| 495 | Ga0307415_100001464 | 3300032126 | Bacteria | 11306 |
| 496 | Ga0307415_100005414 | 3300032126 | Bacteria | 6777 |
| 497 | Ga0307415_100005543 | 3300032126 | Bacteria | 6715 |
| 498 | Ga0307415_100048312 | 3300032126 | Bacteria | 2871 |
| 499 | Ga0307415_100059169 | 3300032126 | Bacteria | 2641 |
| 500 | Ga0307415_100115846 | 3300032126 | Bacteria | 1998 |
| 501 | Ga0307415_100165772 | 3300032126 | Bacteria | 1717 |
| 502 | Ga0307415_100231174 | 3300032126 | Bacteria | 1489 |
| 503 | Ga0316583_10003287 | 3300032133 | Bacteria | 5682 |
| 504 | Ga0316585_10024611 | 3300032137 | Bacteria | 1863 |
| 505 | Ga0307510_10178321 | 3300033180 | Bacteria | 1692 |
| 506 | Ga0373930_0011979 | 3300034816 | Bacteria | 1574 |
| 507 | Ga0373948_0010418 | 3300034817 | Bacteria | 1623 |
| 508 | Ga0373926_0009034 | 3300035083 | Bacteria | 3323 |
| 509 | Ga0373926_0107581 | 3300035083 | Bacteria | 1046 |
| 510 | Ga0373928_0007014 | 3300035084 | Bacteria | 2172 |
| 511 | Ga0373934_0000070 | 3300035086 | Bacteria | 35142 |
| 512 | Ga0373934_0002196 | 3300035086 | Bacteria | 7172 |
| 513 | Ga0373934_0006637 | 3300035086 | Bacteria | 4297 |
| 514 | Ga0373940_0020952 | 3300035088 | Bacteria | 1666 |
| 515 | Ga0373940_0040831 | 3300035088 | Bacteria | 1274 |
| 516 | Ga0373944_0002438 | 3300035089 | Bacteria | 4722 |
| 517 | Ga0373949_0003325 | 3300035090 | Bacteria | 3861 |
| 518 | Ga0373949_0023621 | 3300035090 | Bacteria | 1425 |
| 519 | Ga0373923_0011010 | 3300035111 | Bacteria | 3307 |
| 520 | Ga0373923_0056349 | 3300035111 | Bacteria | 1659 |
| 521 | Ga0373923_0066202 | 3300035111 | Bacteria | 1544 |
| 522 | Ga0373932_0016751 | 3300035112 | Bacteria | 1874 |
| 523 | Ga0373936_0001293 | 3300035113 | Bacteria | 9062 |
| 524 | Ga0373936_0004164 | 3300035113 | Bacteria | 5452 |
| 525 | Ga0373936_0083543 | 3300035113 | Bacteria | 1331 |
| 526 | Ga0373939_0060424 | 3300035114 | Bacteria | 1204 |
| 527 | Ga0373945_0044491 | 3300035116 | Bacteria | 1614 |
| 528 | Ga0373953_0000185 | 3300035117 | Bacteria | 16552 |
| 529 | Ga0373953_0001732 | 3300035117 | Bacteria | 6429 |
| 530 | Ga0373953_0010341 | 3300035117 | Bacteria | 3243 |
| 531 | Ga0373953_0045019 | 3300035117 | Bacteria | 1766 |
| 532 | Ga0373953_0068325 | 3300035117 | Bacteria | 1462 |
| 533 | Ga0373954_0002192 | 3300035118 | Bacteria | 8115 |
| 534 | Ga0373954_0040812 | 3300035118 | Bacteria | 2162 |
| 535 | Ga0373954_0040873 | 3300035118 | Bacteria | 2161 |
| 536 | Ga0373954_0061833 | 3300035118 | Bacteria | 1768 |
| 537 | Ga0373956_0000007 | 3300035119 | Bacteria | 63448 |
| 538 | Ga0373956_0020043 | 3300035119 | Bacteria | 2840 |
| 539 | Ga0373956_0090125 | 3300035119 | Bacteria | 1414 |
| 540 | Ga0373956_0126010 | 3300035119 | Bacteria | 1197 |
| 541 | Ga0373957_0000024 | 3300035120 | Bacteria | 39141 |
| 542 | Ga0373957_0002117 | 3300035120 | Bacteria | 5582 |
| 543 | Ga0373957_0033521 | 3300035120 | Bacteria | 1897 |
| 544 | Ga0373960_0004470 | 3300035121 | Bacteria | 3206 |
| 545 | Ga0373943_0001340 | 3300035170 | Bacteria | 11093 |
| 546 | Ga0373943_0001795 | 3300035170 | Bacteria | 9697 |
| 547 | Ga0373946_0001065 | 3300035171 | Bacteria | 9448 |
| 548 | Ga0373946_0017131 | 3300035171 | Bacteria | 2768 |
| 549 | Ga0373955_0000368 | 3300035172 | Bacteria | 19027 |
| 550 | Ga0373955_0017001 | 3300035172 | Bacteria | 3589 |
| 551 | Ga0373955_0049962 | 3300035172 | Bacteria | 2272 |
| 552 | Ga0373955_0058166 | 3300035172 | Bacteria | 2126 |
| 553 | Ga0373955_0322137 | 3300035172 | Bacteria | 934 |
| 554 | Ga0373942_0022330 | 3300035207 | Bacteria | 1604 |
| 555 | Ga0316574_0001450 | 3300035398 | Bacteria | 11268 |
| 556 | Ga0316574_0003741 | 3300035398 | Bacteria | 7883 |
| 557 | Ga0316574_0150904 | 3300035398 | Bacteria | 1497 |
| 558 | Ga0373924_0000372 | 3300035410 | Bacteria | 13775 |
| 559 | Ga0373924_0011689 | 3300035410 | Bacteria | 3265 |
| 560 | Ga0373924_0018862 | 3300035410 | Bacteria | 2665 |
| 561 | Ga0373924_0029116 | 3300035410 | Bacteria | 2206 |
| 562 | Ga0373924_0076608 | 3300035410 | Bacteria | 1417 |
| 563 | Ga0373931_0027647 | 3300035691 | Bacteria | 2897 |
| 564 | Ga0373935_0003744 | 3300035692 | Bacteria | 8878 |
| 565 | Ga0373935_0005495 | 3300035692 | Bacteria | 7466 |
| 566 | Ga0373935_0053505 | 3300035692 | Bacteria | 2568 |
| 567 | Ga0373935_0073581 | 3300035692 | Bacteria | 2208 |
| 568 | Ga0373935_0075094 | 3300035692 | Bacteria | 2186 |
| 569 | Ga0373935_0332305 | 3300035692 | Bacteria | 1080 |
| 570 | Ga0373927_0003060 | 3300035695 | Bacteria | 12127 |
| 571 | Ga0373927_0070955 | 3300035695 | Bacteria | 2254 |
| 572 | Ga0373933_0000002 | 3300035724 | Bacteria | 151785 |
| 573 | Ga0373933_0001577 | 3300035724 | Bacteria | 13343 |
| 574 | Ga0373933_0015191 | 3300035724 | Bacteria | 4291 |
| 575 | Ga0373933_0019084 | 3300035724 | Bacteria | 3866 |
| 576 | Ga0373933_0022077 | 3300035724 | Bacteria | 3622 |
| 577 | Ga0373933_0037724 | 3300035724 | Bacteria | 2836 |
| 578 | Ga0373933_0071489 | 3300035724 | Bacteria | 2112 |
| 579 | Ga0373933_0142720 | 3300035724 | Bacteria | 1513 |
| 580 | Ga0373947_0000007 | 3300035725 | Bacteria | 192259 |
| 581 | Ga0373947_0003580 | 3300035725 | Bacteria | 9160 |
| 582 | Ga0373937_0000014 | 3300036401 | Bacteria | 151785 |
| 583 | Ga0373937_0000312 | 3300036401 | Bacteria | 45975 |
| 584 | Ga0373937_0003119 | 3300036401 | Bacteria | 13861 |
| 585 | Ga0373937_0007378 | 3300036401 | Bacteria | 9513 |
| 586 | Ga0373937_0046082 | 3300036401 | Bacteria | 3986 |
| 587 | Ga0373937_0074903 | 3300036401 | Bacteria | 3124 |
| 588 | Ga0373937_0106572 | 3300036401 | Bacteria | 2605 |
| 589 | Ga0373937_0117122 | 3300036401 | Bacteria | 2481 |
| 590 | Ga0373937_0232432 | 3300036401 | Bacteria | 1736 |
| 591 | Ga0373937_0236231 | 3300036401 | Bacteria | 1721 |
| 592 | Ga0373937_0238112 | 3300036401 | Bacteria | 1714 |
| 593 | Ga0373937_0373198 | 3300036401 | Bacteria | 1352 |
| 594 | Ga0316582_0057528 | 3300036647 | Bacteria | 2484 |
| 595 | Ga0316584_0018562 | 3300036712 | Bacteria | 5019 |
| 596 | Ga0373925_0023473 | 3300037068 | Bacteria | 4500 |
| 597 | Ga0373925_0062211 | 3300037068 | Bacteria | 2807 |
| 598 | Ga0373925_0127897 | 3300037068 | Bacteria | 1978 |
| 599 | Ga0373925_0221542 | 3300037068 | Bacteria | 1510 |
| 600 | Ga0395899_0297566 | 3300037312 | Bacteria | 1093 |
| 601 | Ga0395900_0025836 | 3300037418 | Bacteria | 6012 |
| 602 | Ga0395900_0256887 | 3300037418 | Bacteria | 1746 |
| 603 | Ga0395900_0357357 | 3300037418 | Bacteria | 1433 |
| 604 | Ga0395898_0090208 | 3300037466 | Bacteria | 2950 |
| 605 | Ga0395898_0154853 | 3300037466 | Bacteria | 2192 |
| 606 | Ga0395898_0161474 | 3300037466 | Bacteria | 2143 |
| 607 | Ga0395898_0361040 | 3300037466 | Bacteria | 1385 |
| 608 | Ga0395905_0028781 | 3300037471 | Bacteria | 5235 |
| 609 | Ga0395905_0149731 | 3300037471 | Bacteria | 2196 |
| 610 | Ga0436364_0093921 | 3300037853 | Bacteria | 15238 |
| 611 | Ga0436364_0118843 | 3300037853 | Bacteria | 1215 |
| 612 | Ga0436364_0287407 | 3300037853 | Bacteria | 132611 |
| 613 | Ga0436364_0639700 | 3300037853 | Bacteria | 1225 |
| 614 | Ga0436364_0732570 | 3300037853 | Bacteria | 62691 |
| 615 | Ga0436364_0786912 | 3300037853 | Bacteria | 2866 |
| 616 | Ga0436364_0886432 | 3300037853 | Bacteria | 2692 |
| 617 | Ga0436364_0935193 | 3300037853 | Bacteria | 1531 |
| 618 | Ga0436364_1083867 | 3300037853 | Bacteria | 4252 |
| 619 | Ga0436364_1537007 | 3300037853 | Bacteria | 5306 |
| 620 | Ga0395901_0032412 | 3300038443 | Bacteria | 5391 |
| 621 | Ga0395901_0044943 | 3300038443 | Bacteria | 4582 |
| 622 | Ga0395901_0072361 | 3300038443 | Bacteria | 3594 |
| 623 | Ga0395901_0231170 | 3300038443 | Bacteria | 1930 |
| 624 | Ga0395901_0338218 | 3300038443 | Bacteria | 1555 |
| 625 | Ga0395901_0441791 | 3300038443 | Bacteria | 1331 |
| 626 | Ga0400485_02208 | 3300038735 | Bacteria | 45471 |
| 627 | Ga0400486_25692 | 3300038742 | Bacteria | 36614 |
| 628 | Ga0436360_0021783 | 3300039438 | Bacteria | 1375 |
| 629 | Ga0436360_0455054 | 3300039438 | Bacteria | 2049 |
| 630 | Ga0436361_0756449 | 3300039447 | Bacteria | 1580 |
| 631 | Ga0436363_0045890 | 3300039450 | Bacteria | 1127 |
| 632 | Ga0436363_0398535 | 3300039450 | Bacteria | 848 |
| 633 | Ga0436363_0838504 | 3300039450 | Bacteria | 3983 |
| 634 | Ga0439436_0003729 | 3300041404 | Bacteria | 4651 |
| 635 | Ga0451853_3927494 | 3300041512 | Bacteria | 1778 |
| 636 | Ga0439433_0009335 | 3300041999 | Bacteria | 2135 |
| 637 | Ga0439442_011772 | 3300042002 | Bacteria | 1784 |
| 638 | Ga0439448_0000572 | 3300042005 | Bacteria | 8631 |
| 639 | Ga0439448_0051675 | 3300042005 | Bacteria | 1346 |
| 640 | Ga0439449_0005338 | 3300042007 | Bacteria | 4921 |
| 641 | Ga0439455_0026469 | 3300042012 | Bacteria | 1416 |
| 642 | Ga0439463_003040 | 3300042016 | Bacteria | 4258 |
| 643 | Ga0439458_0003964 | 3300042157 | Bacteria | 3420 |
| 644 | Ga0439464_0010056 | 3300042439 | Bacteria | 2495 |
| 645 | Ga0439464_0010767 | 3300042439 | Bacteria | 2417 |
| 646 | Ga0439460_0012086 | 3300042461 | Bacteria | 2234 |
| 647 | Ga0439460_0044508 | 3300042461 | Bacteria | 1314 |
| 648 | Ga0450916_000764 | 3300042530 | Bacteria | 2970 |
| 649 | Ga0466965_0142339 | 3300044683 | Bacteria | 1250 |
| 650 | Ga0466966_0196157 | 3300044684 | Bacteria | 1222 |
| 651 | Ga0466961_0017604 | 3300044693 | Bacteria | 4591 |
| 652 | Ga0466961_0068036 | 3300044693 | Bacteria | 2262 |
| 653 | Ga0466961_0233543 | 3300044693 | Bacteria | 1131 |
| 654 | Ga0466963_0015064 | 3300044694 | Bacteria | 4780 |
| 655 | Ga0466963_0038698 | 3300044694 | Bacteria | 3120 |
| 656 | Ga0466963_0109300 | 3300044694 | Bacteria | 1897 |
| 657 | Ga0466963_0267352 | 3300044694 | Bacteria | 1201 |
| 658 | Ga0466964_0054574 | 3300044706 | Bacteria | 1647 |
| 659 | Ga0466964_0063476 | 3300044706 | Bacteria | 1543 |
| 660 | Ga0466971_0124060 | 3300044719 | Bacteria | 1196 |
| 661 | Ga0466968_0000127 | 3300044735 | Bacteria | 22573 |
| 662 | Ga0466970_0001582 | 3300044765 | Bacteria | 10998 |
| 663 | Ga0466970_0032333 | 3300044765 | Bacteria | 2764 |
| 664 | Ga0466970_0120894 | 3300044765 | Bacteria | 1434 |
| 665 | Ga0466957_0002458 | 3300044842 | Bacteria | 9948 |
| 666 | Ga0466957_0199478 | 3300044842 | Bacteria | 1314 |
| 667 | Ga0466960_0014624 | 3300044901 | Bacteria | 3366 |
| 668 | Ga0466960_0098437 | 3300044901 | Bacteria | 1502 |
| 669 | Ga0466959_0163057 | 3300045049 | Bacteria | 1566 |
| 670 | Ga0466959_0184133 | 3300045049 | Bacteria | 1460 |
| 671 | Ga0466959_0285378 | 3300045049 | Bacteria | 1132 |
| 672 | Ga0466958_0002125 | 3300045836 | Bacteria | 9848 |
| 673 | Ga0466958_0025951 | 3300045836 | Bacteria | 3459 |
| 674 | Ga0466967_0006236 | 3300045976 | Bacteria | 8408 |
| 675 | Ga0466967_0097718 | 3300045976 | Bacteria | 2680 |
| 676 | Ga0466967_0123286 | 3300045976 | Bacteria | 2397 |
| 677 | Ga0466967_0141670 | 3300045976 | Bacteria | 2240 |
| 678 | Ga0466967_0144241 | 3300045976 | Bacteria | 2220 |
| 679 | Ga0466967_0168790 | 3300045976 | Bacteria | 2057 |
| 680 | Ga0466967_0223140 | 3300045976 | Bacteria | 1792 |
| 681 | Ga0495592_0000133 | 3300046454 | Bacteria | 66075 |
| 682 | Ga0495592_0021245 | 3300046454 | Bacteria | 4935 |
| 683 | Ga0495592_0027905 | 3300046454 | Bacteria | 4276 |
| 684 | Ga0495592_0045713 | 3300046454 | Bacteria | 3266 |
| 685 | Ga0495592_0145629 | 3300046454 | Bacteria | 1643 |
| 686 | Ga0495629_0003615 | 3300046459 | Bacteria | 11686 |
| 687 | Ga0495629_0120393 | 3300046459 | Bacteria | 1828 |
| 688 | Ga0495641_0013730 | 3300046461 | Bacteria | 4427 |
| 689 | Ga0495641_0026292 | 3300046461 | Bacteria | 2841 |
| 690 | Ga0495651_0000019 | 3300046462 | Bacteria | 120970 |
| 691 | Ga0495651_0001424 | 3300046462 | Bacteria | 18558 |
| 692 | Ga0495651_0013797 | 3300046462 | Bacteria | 6249 |
| 693 | Ga0495651_0030057 | 3300046462 | Bacteria | 4236 |
| 694 | Ga0495651_0126446 | 3300046462 | Bacteria | 1871 |
| 695 | Ga0495653_0003782 | 3300046463 | Bacteria | 12247 |
| 696 | Ga0495653_0006300 | 3300046463 | Bacteria | 9733 |
| 697 | Ga0495653_0010412 | 3300046463 | Bacteria | 7606 |
| 698 | Ga0495653_0015651 | 3300046463 | Bacteria | 6182 |
| 699 | Ga0495653_0017351 | 3300046463 | Bacteria | 5855 |
| 700 | Ga0495653_0098404 | 3300046463 | Bacteria | 2124 |
| 701 | Ga0495653_0151850 | 3300046463 | Bacteria | 1617 |
| 702 | Ga0495582_0000493 | 3300046473 | Bacteria | 21575 |
| 703 | Ga0495582_0015285 | 3300046473 | Bacteria | 4218 |
| 704 | Ga0495582_0080091 | 3300046473 | Bacteria | 1813 |
| 705 | Ga0495639_0005262 | 3300046475 | Bacteria | 5564 |
| 706 | Ga0495639_0007891 | 3300046475 | Bacteria | 4575 |
| 707 | Ga0495662_0020889 | 3300046476 | Bacteria | 3167 |
| 708 | Ga0495662_0103426 | 3300046476 | Bacteria | 1393 |
| 709 | Ga0495662_0160612 | 3300046476 | Bacteria | 1107 |
| 710 | Ga0495664_0006872 | 3300046477 | Bacteria | 6297 |
| 711 | Ga0495664_0009160 | 3300046477 | Bacteria | 5535 |
| 712 | Ga0495664_0010930 | 3300046477 | Bacteria | 5105 |
| 713 | Ga0495664_0017711 | 3300046477 | Bacteria | 4073 |
| 714 | Ga0495664_0020928 | 3300046477 | Bacteria | 3776 |
| 715 | Ga0495664_0062050 | 3300046477 | Bacteria | 2225 |
| 716 | Ga0495664_0108657 | 3300046477 | Bacteria | 1673 |
| 717 | Ga0495594_0097426 | 3300046499 | Bacteria | 1653 |
| 718 | Ga0495596_0022225 | 3300046500 | Bacteria | 2583 |
| 719 | Ga0495608_0000028 | 3300046511 | Bacteria | 151829 |
| 720 | Ga0495608_0009390 | 3300046511 | Bacteria | 6838 |
| 721 | Ga0495608_0014063 | 3300046511 | Bacteria | 5554 |
| 722 | Ga0495608_0020716 | 3300046511 | Bacteria | 4517 |
| 723 | Ga0495608_0044749 | 3300046511 | Bacteria | 2953 |
| 724 | Ga0495608_0108063 | 3300046511 | Bacteria | 1789 |
| 725 | Ga0495608_0236051 | 3300046511 | Bacteria | 1143 |
| 726 | Ga0495608_0275611 | 3300046511 | Bacteria | 1045 |
| 727 | Ga0495618_0052774 | 3300046514 | Bacteria | 2570 |
| 728 | Ga0495618_0108712 | 3300046514 | Bacteria | 1775 |
| 729 | Ga0495618_0130471 | 3300046514 | Bacteria | 1608 |
| 730 | Ga0495628_0000337 | 3300046516 | Bacteria | 42541 |
| 731 | Ga0495628_0010312 | 3300046516 | Bacteria | 7943 |
| 732 | Ga0495628_0088817 | 3300046516 | Bacteria | 2394 |
| 733 | Ga0495628_0254132 | 3300046516 | Bacteria | 1311 |
| 734 | Ga0495630_0051465 | 3300046517 | Bacteria | 3082 |
| 735 | Ga0495630_0078411 | 3300046517 | Bacteria | 2491 |
| 736 | Ga0495630_0101646 | 3300046517 | Bacteria | 2175 |
| 737 | Ga0495630_0156506 | 3300046517 | Bacteria | 1734 |
| 738 | Ga0495632_0072168 | 3300046519 | Bacteria | 1657 |
| 739 | Ga0495644_0072826 | 3300046523 | Bacteria | 1292 |
| 740 | Ga0495666_0058276 | 3300046526 | Bacteria | 1848 |
| 741 | Ga0495666_0078256 | 3300046526 | Bacteria | 1566 |
| 742 | Ga0495652_0000031 | 3300046529 | Bacteria | 151765 |
| 743 | Ga0495652_0019111 | 3300046529 | Bacteria | 6103 |
| 744 | Ga0495652_0033547 | 3300046529 | Bacteria | 4481 |
| 745 | Ga0495652_0071909 | 3300046529 | Bacteria | 2885 |
| 746 | Ga0495652_0095275 | 3300046529 | Bacteria | 2425 |
| 747 | Ga0495652_0103519 | 3300046529 | Bacteria | 2304 |
| 748 | Ga0495652_0152813 | 3300046529 | Bacteria | 1801 |
| 749 | Ga0495665_0012938 | 3300046531 | Bacteria | 4516 |
| 750 | Ga0495665_0052706 | 3300046531 | Bacteria | 2153 |
| 751 | Ga0495665_0111120 | 3300046531 | Bacteria | 1437 |
| 752 | Ga0495640_0046881 | 3300046533 | Bacteria | 2992 |
| 753 | Ga0495640_0056386 | 3300046533 | Bacteria | 2685 |
| 754 | Ga0495640_0086003 | 3300046533 | Bacteria | 2083 |
| 755 | Ga0495640_0223359 | 3300046533 | Bacteria | 1187 |
| 756 | Ga0495586_0022724 | 3300046535 | Bacteria | 3347 |
| 757 | Ga0495587_0000023 | 3300046536 | Bacteria | 151763 |
| 758 | Ga0495587_0010018 | 3300046536 | Bacteria | 6052 |
| 759 | Ga0495587_0017955 | 3300046536 | Bacteria | 4387 |
| 760 | Ga0495587_0020164 | 3300046536 | Bacteria | 4118 |
| 761 | Ga0495587_0104905 | 3300046536 | Bacteria | 1626 |
| 762 | Ga0495645_0001100 | 3300046543 | Bacteria | 18313 |
| 763 | Ga0495645_0008216 | 3300046543 | Bacteria | 7279 |
| 764 | Ga0495645_0021367 | 3300046543 | Bacteria | 4678 |
| 765 | Ga0495645_0028709 | 3300046543 | Bacteria | 4042 |
| 766 | Ga0495645_0031746 | 3300046543 | Bacteria | 3849 |
| 767 | Ga0495645_0055887 | 3300046543 | Bacteria | 2865 |
| 768 | Ga0495645_0057243 | 3300046543 | Bacteria | 2830 |
| 769 | Ga0495645_0132004 | 3300046543 | Bacteria | 1749 |
| 770 | Ga0495667_0000054 | 3300046559 | Bacteria | 105009 |
| 771 | Ga0495667_0001016 | 3300046559 | Bacteria | 18127 |
| 772 | Ga0495667_0003509 | 3300046559 | Bacteria | 10519 |
| 773 | Ga0495667_0005370 | 3300046559 | Bacteria | 8664 |
| 774 | Ga0495667_0008650 | 3300046559 | Bacteria | 6912 |
| 775 | Ga0495667_0008718 | 3300046559 | Bacteria | 6887 |
| 776 | Ga0495667_0030351 | 3300046559 | Bacteria | 3633 |
| 777 | Ga0495667_0065162 | 3300046559 | Bacteria | 2383 |
| 778 | Ga0495634_0044036 | 3300046642 | Bacteria | 3022 |
| 779 | Ga0495634_0057617 | 3300046642 | Bacteria | 2592 |
| 780 | Ga0495634_0107121 | 3300046642 | Bacteria | 1800 |
| 781 | Ga0495611_0067192 | 3300046648 | Bacteria | 1636 |
| 782 | Ga0495635_0001264 | 3300046663 | Bacteria | 16898 |
| 783 | Ga0495635_0003596 | 3300046663 | Bacteria | 10733 |
| 784 | Ga0495635_0030032 | 3300046663 | Bacteria | 3778 |
| 785 | Ga0495635_0030207 | 3300046663 | Bacteria | 3765 |
| 786 | Ga0495635_0033733 | 3300046663 | Bacteria | 3551 |
| 787 | Ga0495635_0038410 | 3300046663 | Bacteria | 3315 |
| 788 | Ga0495659_0049178 | 3300046664 | Bacteria | 1530 |
| 789 | Ga0495657_0000022 | 3300046675 | Bacteria | 151837 |
| 790 | Ga0495657_0002053 | 3300046675 | Bacteria | 17157 |
| 791 | Ga0495657_0025333 | 3300046675 | Bacteria | 4214 |
| 792 | Ga0495657_0056185 | 3300046675 | Bacteria | 2622 |
| 793 | Ga0495657_0091134 | 3300046675 | Bacteria | 1956 |
| 794 | Ga0495657_0113762 | 3300046675 | Bacteria | 1711 |
| 795 | Ga0495599_0000125 | 3300046678 | Bacteria | 50781 |
| 796 | Ga0495599_0086416 | 3300046678 | Bacteria | 1958 |
| 797 | Ga0495623_0000416 | 3300046679 | Bacteria | 28025 |
| 798 | Ga0495623_0023167 | 3300046679 | Bacteria | 4007 |
| 799 | Ga0495623_0033514 | 3300046679 | Bacteria | 3295 |
| 800 | Ga0495623_0037893 | 3300046679 | Bacteria | 3083 |
| 801 | Ga0495623_0058265 | 3300046679 | Bacteria | 2428 |
| 802 | Ga0495623_0100795 | 3300046679 | Bacteria | 1759 |
| 803 | Ga0495646_0017254 | 3300046680 | Bacteria | 4581 |
| 804 | Ga0495646_0019999 | 3300046680 | Bacteria | 4233 |
| 805 | Ga0495646_0076103 | 3300046680 | Bacteria | 1966 |
| 806 | Ga0495646_0136431 | 3300046680 | Bacteria | 1376 |
| 807 | Ga0495646_0150015 | 3300046680 | Bacteria | 1297 |
| 808 | Ga0495647_0021475 | 3300046681 | Bacteria | 2324 |
| 809 | Ga0495658_0076226 | 3300046683 | Bacteria | 1959 |
| 810 | Ga0495658_0167186 | 3300046683 | Bacteria | 1359 |
| 811 | Ga0495613_0031895 | 3300046689 | Bacteria | 3913 |
| 812 | Ga0495624_0009088 | 3300046690 | Bacteria | 6894 |
| 813 | Ga0495624_0013469 | 3300046690 | Bacteria | 5575 |
| 814 | Ga0495624_0114947 | 3300046690 | Bacteria | 1654 |
| 815 | Ga0495624_0128899 | 3300046690 | Bacteria | 1551 |
| 816 | Ga0495670_0028797 | 3300046691 | Bacteria | 2754 |
| 817 | Ga0495600_0008548 | 3300046809 | Bacteria | 6296 |
| 818 | Ga0495600_0011991 | 3300046809 | Bacteria | 5411 |
| 819 | Ga0495600_0052868 | 3300046809 | Bacteria | 2652 |
| 820 | Ga0495600_0055207 | 3300046809 | Bacteria | 2594 |
| 821 | Ga0495600_0134971 | 3300046809 | Bacteria | 1603 |
| 822 | Ga0495600_0200203 | 3300046809 | Bacteria | 1283 |
| 823 | Ga0495600_0219902 | 3300046809 | Bacteria | 1215 |
| 824 | Ga0495581_0010470 | 3300047315 | Bacteria | 5361 |
| 825 | Ga0495581_0015106 | 3300047315 | Bacteria | 4482 |
| 826 | Ga0495581_0086599 | 3300047315 | Bacteria | 1816 |
| 827 | Ga0495581_0147695 | 3300047315 | Bacteria | 1372 |
| 828 | Ga0495604_0000022 | 3300047317 | Bacteria | 151744 |
| 829 | Ga0495604_0030817 | 3300047317 | Bacteria | 4256 |
| 830 | Ga0495604_0034218 | 3300047317 | Bacteria | 4021 |
| 831 | Ga0495604_0136622 | 3300047317 | Bacteria | 1756 |
| 832 | Ga0495604_0171420 | 3300047317 | Bacteria | 1525 |
| 833 | Ga0495604_0184356 | 3300047317 | Bacteria | 1458 |
| 834 | Ga0495674_0002831 | 3300047319 | Bacteria | 16861 |
| 835 | Ga0495674_0008396 | 3300047319 | Bacteria | 9843 |
| 836 | Ga0495674_0025284 | 3300047319 | Bacteria | 5446 |
| 837 | Ga0495674_0027125 | 3300047319 | Bacteria | 5238 |
| 838 | Ga0495674_0032708 | 3300047319 | Bacteria | 4715 |
| 839 | Ga0495674_0186190 | 3300047319 | Bacteria | 1727 |
| 840 | Ga0495676_0261425 | 3300047321 | Bacteria | 1177 |
| 841 | Ga0495680_0000154 | 3300047322 | Bacteria | 69567 |
| 842 | Ga0495680_0005823 | 3300047322 | Bacteria | 11532 |
| 843 | Ga0495680_0011807 | 3300047322 | Bacteria | 7715 |
| 844 | Ga0495680_0064853 | 3300047322 | Bacteria | 2799 |
| 845 | Ga0495680_0203865 | 3300047322 | Bacteria | 1418 |
| 846 | Ga0495680_0224846 | 3300047322 | Bacteria | 1338 |
| 847 | Ga0495680_0338032 | 3300047322 | Bacteria | 1051 |
| 848 | Ga0495675_0000843 | 3300047444 | Bacteria | 18757 |
| 849 | Ga0495675_0013912 | 3300047444 | Bacteria | 5088 |
| 850 | Ga0495675_0020526 | 3300047444 | Bacteria | 4203 |
| 851 | Ga0495675_0031919 | 3300047444 | Bacteria | 3363 |
| 852 | Ga0495675_0045040 | 3300047444 | Bacteria | 2809 |
| 853 | Ga0495675_0081429 | 3300047444 | Bacteria | 2038 |
| 854 | Ga0495675_0139513 | 3300047444 | Bacteria | 1503 |
| 855 | Ga0495677_0062292 | 3300047445 | Bacteria | 1384 |
| 856 | Ga0495684_0002351 | 3300047471 | Bacteria | 15113 |
| 857 | Ga0495684_0020511 | 3300047471 | Bacteria | 5094 |
| 858 | Ga0495684_0020760 | 3300047471 | Bacteria | 5060 |
| 859 | Ga0495684_0029724 | 3300047471 | Bacteria | 4193 |
| 860 | Ga0495684_0045475 | 3300047471 | Bacteria | 3360 |
| 861 | Ga0495684_0051985 | 3300047471 | Bacteria | 3126 |
| 862 | Ga0495684_0072458 | 3300047471 | Bacteria | 2617 |
| 863 | Ga0495684_0144903 | 3300047471 | Bacteria | 1779 |
| 864 | Ga0495593_0005889 | 3300047673 | Bacteria | 7222 |
| 865 | Ga0495593_0025477 | 3300047673 | Bacteria | 3274 |
| 866 | Ga0495602_0000195 | 3300048088 | Bacteria | 57149 |
| 867 | Ga0495602_0000251 | 3300048088 | Bacteria | 50166 |
| 868 | Ga0495602_0071257 | 3300048088 | Bacteria | 2968 |
| 869 | Ga0495602_0129599 | 3300048088 | Bacteria | 2014 |
| 870 | Ga0495602_0274928 | 3300048088 | Bacteria | 1243 |
| 871 | Ga0495602_0328137 | 3300048088 | Bacteria | 1111 |
| 872 | Ga0495614_0086759 | 3300048089 | Bacteria | 1359 |
| 873 | Ga0496100_0054147 | 3300048903 | Bacteria | 2615 |
| 874 | Ga0496101_0002786 | 3300048904 | Bacteria | 10718 |
| 875 | Ga0496102_0006094 | 3300048905 | Bacteria | 10280 |
| 876 | Ga0496102_0044150 | 3300048905 | Bacteria | 4044 |
| 877 | Ga0496102_0061553 | 3300048905 | Bacteria | 3435 |
| 878 | Ga0496103_0109747 | 3300048906 | Bacteria | 1752 |
| 879 | Ga0496104_0000798 | 3300048907 | Bacteria | 27060 |
| 880 | Ga0496104_0012341 | 3300048907 | Bacteria | 7680 |
| 881 | Ga0496104_0068816 | 3300048907 | Bacteria | 3364 |
| 882 | Ga0496104_0122788 | 3300048907 | Bacteria | 2493 |
| 883 | Ga0496105_0012818 | 3300048908 | Bacteria | 6645 |
| 884 | Ga0496105_0016937 | 3300048908 | Bacteria | 5831 |
| 885 | Ga0496105_0018502 | 3300048908 | Bacteria | 5603 |
| 886 | Ga0496105_0024086 | 3300048908 | Bacteria | 4944 |
| 887 | Ga0496106_0034290 | 3300048909 | Bacteria | 3790 |
| 888 | Ga0496106_0105687 | 3300048909 | Bacteria | 2187 |
| 889 | Ga0496106_0287040 | 3300048909 | Bacteria | 1319 |
| 890 | Ga0496107_0106800 | 3300048910 | Bacteria | 2056 |
| 891 | Ga0496107_0146431 | 3300048910 | Bacteria | 1746 |
| 892 | Ga0496107_0357290 | 3300048910 | Bacteria | 1087 |
| 893 | Ga0496108_0073187 | 3300048911 | Bacteria | 2893 |
| 894 | Ga0496108_0146718 | 3300048911 | Bacteria | 2034 |
| 895 | Ga0496108_0300630 | 3300048911 | Bacteria | 1398 |
| 896 | Ga0496109_0009817 | 3300048912 | Bacteria | 8171 |
| 897 | Ga0496109_0208517 | 3300048912 | Bacteria | 1837 |
| 898 | Ga0496110_0091221 | 3300048913 | Bacteria | 2725 |
| 899 | Ga0496110_0177546 | 3300048913 | Bacteria | 1933 |
| 900 | Ga0496110_0316810 | 3300048913 | Bacteria | 1421 |
| 901 | Ga0496110_0346966 | 3300048913 | Bacteria | 1352 |
| 902 | Ga0496111_0032415 | 3300048914 | Bacteria | 3725 |
| 903 | Ga0496111_0051138 | 3300048914 | Bacteria | 2983 |
| 904 | Ga0496112_0053238 | 3300048915 | Bacteria | 3974 |
| 905 | Ga0496112_0104811 | 3300048915 | Bacteria | 2798 |
| 906 | Ga0496112_0108323 | 3300048915 | Bacteria | 2748 |
| 907 | Ga0496113_0016988 | 3300048916 | Bacteria | 5039 |
| 908 | Ga0496113_0024157 | 3300048916 | Bacteria | 4316 |
| 909 | Ga0496113_0051817 | 3300048916 | Bacteria | 3063 |
| 910 | Ga0496113_0070327 | 3300048916 | Bacteria | 2660 |
| 911 | Ga0496114_0100327 | 3300048917 | Bacteria | 2470 |
| 912 | Ga0496114_0139974 | 3300048917 | Bacteria | 2094 |
| 913 | Ga0496115_0015886 | 3300048918 | Bacteria | 5720 |
| 914 | Ga0496115_0035994 | 3300048918 | Bacteria | 3918 |
| 915 | Ga0496115_0069974 | 3300048918 | Bacteria | 2843 |
| 916 | Ga0496115_0162714 | 3300048918 | Bacteria | 1845 |
| 917 | Ga0496119_0003055 | 3300048922 | Bacteria | 17709 |
| 918 | Ga0496121_0210719 | 3300048924 | Bacteria | 1377 |
| 919 | Ga0496126_0078461 | 3300048929 | Bacteria | 2926 |
| 920 | Ga0496126_0180939 | 3300048929 | Bacteria | 1791 |
| 921 | Ga0501031_0174904 | 3300049568 | Bacteria | 1402 |
| 922 | Ga0501032_0100248 | 3300049569 | Bacteria | 1919 |
| 923 | Ga0501033_0149713 | 3300049570 | Bacteria | 1684 |
| 924 | Ga0501036_0003648 | 3300049572 | Bacteria | 12312 |
| 925 | Ga0501037_0120427 | 3300049573 | Bacteria | 1887 |
| 926 | Ga0501038_0001572 | 3300049574 | Bacteria | 21145 |
| 927 | Ga0501038_0109061 | 3300049574 | Bacteria | 2294 |
| 928 | Ga0501039_0000354 | 3300049575 | Bacteria | 32857 |
| 929 | Ga0501040_0000917 | 3300049576 | Bacteria | 18488 |
| 930 | Ga0501041_0022606 | 3300049577 | Bacteria | 3765 |
| 931 | Ga0501042_0017637 | 3300049578 | Bacteria | 4927 |
| 932 | Ga0501042_0066361 | 3300049578 | Bacteria | 2579 |
| 933 | Ga0501046_0071323 | 3300049580 | Bacteria | 2699 |
| 934 | Ga0501047_0000141 | 3300049581 | Bacteria | 88104 |
| 935 | Ga0501048_0011341 | 3300049582 | Bacteria | 6646 |
| 936 | Ga0501068_0011701 | 3300049584 | Bacteria | 4960 |
| 937 | Ga0501072_0001751 | 3300049588 | Bacteria | 16134 |
| 938 | Ga0501072_0081895 | 3300049588 | Bacteria | 2559 |
| 939 | Ga0501074_0001654 | 3300049590 | Bacteria | 15132 |
| 940 | Ga0501074_0092134 | 3300049590 | Bacteria | 2170 |
| 941 | Ga0501075_0000450 | 3300049591 | Bacteria | 24475 |
| 942 | Ga0501076_0032057 | 3300049592 | Bacteria | 4101 |
| 943 | Ga0501077_0010629 | 3300049593 | Bacteria | 5732 |
| 944 | Ga0501079_0001334 | 3300049741 | Bacteria | 17363 |
| 945 | Ga0501080_0217989 | 3300049742 | Bacteria | 1747 |
| 946 | Ga0501081_0005425 | 3300049743 | Bacteria | 8231 |
| 947 | Ga0501035_0295741 | 3300049822 | Bacteria | 1365 |
| 948 | Ga0501045_0003401 | 3300049824 | Bacteria | 10897 |
| 949 | Ga0501045_0021181 | 3300049824 | Bacteria | 4648 |
| 950 | nmdc:mga05p37_1958_c1 | 3300050507 | Bacteria | 24006 |
| 951 | nmdc:mga05p37_21880_c1 | 3300050507 | Bacteria | 7748 |
| 952 | nmdc:mga05p37_220523_c1 | 3300050507 | Bacteria | 2289 |
| 953 | nmdc:mga05p37_558250_c1 | 3300050507 | Bacteria | 1302 |
| 954 | nmdc:mga05p37_61924_c1 | 3300050507 | Bacteria | 4606 |
| 955 | nmdc:mga09592_112556_c1 | 3300050508 | Bacteria | 2335 |
| 956 | nmdc:mga09592_368255_c1 | 3300050508 | Bacteria | 1243 |
| 957 | nmdc:mga09592_4052_c1 | 3300050508 | Bacteria | 11826 |
| 958 | nmdc:mga0qj67_10319_c1 | 3300050509 | Bacteria | 6976 |
| 959 | nmdc:mga0qj67_314_c1 | 3300050509 | Bacteria | 33600 |
| 960 | nmdc:mga0qj67_43141_c1 | 3300050509 | Bacteria | 3552 |
| 961 | nmdc:mga06r32_21997_c1 | 3300050510 | Bacteria | 5890 |
| 962 | nmdc:mga06r32_28294_c1 | 3300050510 | Bacteria | 5243 |
| 963 | nmdc:mga06r32_629_c3 | 3300050510 | Bacteria | 4841 |
| 964 | nmdc:mga08y16_11933_c1 | 3300050511 | Bacteria | 9125 |
| 965 | nmdc:mga08y16_132702_c1 | 3300050511 | Bacteria | 2589 |
| 966 | nmdc:mga08y16_136272_c1 | 3300050511 | Bacteria | 2552 |
| 967 | nmdc:mga08y16_30087_c1 | 3300050511 | Bacteria | 5716 |
| 968 | nmdc:mga0n895_10127_c1 | 3300050512 | Bacteria | 8299 |
| 969 | nmdc:mga0n895_18120_c1 | 3300050512 | Bacteria | 6510 |
| 970 | nmdc:mga0n895_262196_c1 | 3300050512 | Bacteria | 1754 |
| 971 | nmdc:mga0n895_416606_c1 | 3300050512 | Bacteria | 1358 |
| 972 | nmdc:mga0n895_75353_c1 | 3300050512 | Bacteria | 3354 |
| 973 | nmdc:mga0rr50_223505_c1 | 3300050513 | Bacteria | 1555 |
| 974 | nmdc:mga0rr50_234658_c1 | 3300050513 | Bacteria | 1519 |
| 975 | nmdc:mga0rr50_59627_c1 | 3300050513 | Bacteria | 2867 |
| 976 | nmdc:mga08x19_191754_c1 | 3300050514 | Bacteria | 1398 |
| 977 | nmdc:mga08x19_31370_c1 | 3300050514 | Bacteria | 3342 |
| 978 | nmdc:mga08x19_33680_c1 | 3300050514 | Bacteria | 3234 |
| 979 | nmdc:mga0a205_101699_c1 | 3300050515 | Bacteria | 2773 |
| 980 | nmdc:mga0a205_15293_c1 | 3300050515 | Bacteria | 7170 |
| 981 | nmdc:mga0a205_34049_c1 | 3300050515 | Bacteria | 4887 |
| 982 | nmdc:mga0a205_42659_c1 | 3300050515 | Bacteria | 4371 |
| 983 | nmdc:mga0a205_99733_c1 | 3300050515 | Bacteria | 2803 |
| 984 | Ga0495601_0046037 | 3300053077 | Bacteria | 2745 |
| 985 | Ga0495601_0070273 | 3300053077 | Bacteria | 2235 |
| 986 | Ga0495601_0077583 | 3300053077 | Bacteria | 2128 |
| 987 | Ga0495601_0077975 | 3300053077 | Bacteria | 2122 |
| 988 | Ga0495601_0098392 | 3300053077 | Bacteria | 1888 |
| 989 | Ga0495601_0228448 | 3300053077 | Bacteria | 1215 |
| 990 | Ga0495601_0249047 | 3300053077 | Bacteria | 1160 |
| 991 | Ga0495612_0003726 | 3300053078 | Bacteria | 6333 |
| 992 | Ga0495612_0004582 | 3300053078 | Bacteria | 5731 |
| 993 | Ga0495612_0008163 | 3300053078 | Bacteria | 4256 |
| 994 | Ga0495612_0019187 | 3300053078 | Bacteria | 2739 |
| 995 | Ga0495612_0039241 | 3300053078 | Bacteria | 1925 |
| 996 | Ga0495612_0087585 | 3300053078 | Bacteria | 1314 |
| 997 | Ga0495595_0001056 | 3300053084 | Bacteria | 10645 |
| 998 | Ga0495595_0013842 | 3300053084 | Bacteria | 3413 |
| 999 | Ga0495595_0017836 | 3300053084 | Bacteria | 3058 |
| 1000 | Ga0495595_0034282 | 3300053084 | Bacteria | 2295 |
| 1001 | Ga0495595_0052060 | 3300053084 | Bacteria | 1899 |
| 1002 | Ga0495595_0083694 | 3300053084 | Bacteria | 1523 |
| 1003 | Ga0495619_0041514 | 3300053085 | Bacteria | 3009 |
| 1004 | Ga0495619_0056829 | 3300053085 | Bacteria | 2595 |
| 1005 | Ga0495619_0115459 | 3300053085 | Bacteria | 1837 |
| 1006 | Ga0500644_0001435 | 3300053088 | Bacteria | 6304 |
| 1007 | Ga0501084_0013673 | 3300054114 | Bacteria | 6718 |
| 1008 | Ga0501084_0014695 | 3300054114 | Bacteria | 6492 |
| 1009 | Ga0501084_0352786 | 3300054114 | Bacteria | 1243 |
| 1010 | Ga0590075_005988 | 3300059424 | Bacteria | 2877 |
| 1011 | Ga0590077_001146 | 3300059426 | Bacteria | 6467 |
| 1012 | Ga0501082_0007058 | 3300060353 | Bacteria | 9697 |
| 1013 | Ga0501082_0033886 | 3300060353 | Bacteria | 4405 |
| 1014 | Ga0466962_0095767 | 3300061719 | Bacteria | 1423 |
| 1015 | Ga0530510_0000669 | 3300061734 | Bacteria | 22218 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0332305 | Ga0373935_0332305_263_1063 | 235 |
| 2 | 3300046809 | Ga0495600_0200203 | Ga0495600_0200203_488_1273 | 235 |
| 3 | 3300050511 | nmdc:mga08y16_132702_c1 | nmdc:mga08y16_132702_c1_1782_2543 | 237 |
| 4 | 3300037853 | Ga0436364_0886432 | Ga0436364_0886432_1856_2668 | 247 |
| 5 | 3300039450 | Ga0436363_0398535 | Ga0436363_0398535_12_836 | 247 |
| 6 | 3300005981 | Ga0081538_10008955 | Ga0081538_100089552 | 255 |
| 7 | 3300035172 | Ga0373955_0322137 | Ga0373955_0322137_82_921 | 256 |
| 8 | 3300005937 | Ga0081455_10156068 | Ga0081455_101560681 | 262 |
| 9 | 3300025921 | Ga0207652_10159071 | Ga0207652_101590712 | 264 |
| 10 | 3300006175 | Ga0070712_100398840 | Ga0070712_1003988401 | 265 |
| 11 | 3300032126 | Ga0307415_100048312 | Ga0307415_1000483125 | 265 |
| 12 | 3300035398 | Ga0316574_0150904 | Ga0316574_0150904_402_1358 | 265 |
| 13 | 3300047445 | Ga0495677_0062292 | Ga0495677_0062292_294_1229 | 265 |
| 14 | 3300005467 | Ga0070706_100053956 | Ga0070706_1000539562 | 266 |
| 15 | 3300028666 | Ga0265336_10004601 | Ga0265336_100046015 | 266 |
| 16 | 3300028800 | Ga0265338_10002247 | Ga0265338_1000224720 | 266 |
| 17 | 3300032126 | Ga0307415_100231174 | Ga0307415_1002311742 | 266 |
| 18 | 3300039447 | Ga0436361_0756449 | Ga0436361_0756449_578_1510 | 266 |
| 19 | 3300005334 | Ga0068869_100274442 | Ga0068869_1002744422 | 267 |
| 20 | 3300005719 | Ga0068861_100264042 | Ga0068861_1002640422 | 267 |
| 21 | 3300005985 | Ga0081539_10018877 | Ga0081539_100188772 | 267 |
| 22 | 3300006163 | Ga0070715_10052548 | Ga0070715_100525482 | 267 |
| 23 | 3300025898 | Ga0207692_10001437 | Ga0207692_100014374 | 267 |
| 24 | 3300025905 | Ga0207685_10022394 | Ga0207685_100223942 | 267 |
| 25 | 3300025906 | Ga0207699_10006266 | Ga0207699_100062665 | 267 |
| 26 | 3300025929 | Ga0207664_10043770 | Ga0207664_100437703 | 267 |
| 27 | 3300025939 | Ga0207665_10017416 | Ga0207665_100174164 | 267 |
| 28 | 3300026118 | Ga0207675_100265546 | Ga0207675_1002655462 | 267 |
| 29 | 3300031247 | Ga0265340_10034361 | Ga0265340_100343612 | 267 |
| 30 | 3300005471 | Ga0070698_100000898 | Ga0070698_10000089811 | 269 |
| 31 | 3300028794 | Ga0307515_10170578 | Ga0307515_101705782 | 269 |
| 32 | 3300030522 | Ga0307512_10025517 | Ga0307512_100255172 | 269 |
| 33 | 3300013105 | Ga0157369_10264471 | Ga0157369_102644712 | 270 |
| 34 | 3300022467 | Ga0224712_10021524 | Ga0224712_100215242 | 270 |
| 35 | 3300005445 | Ga0070708_100015039 | Ga0070708_1000150395 | 271 |
| 36 | 3300005468 | Ga0070707_100172512 | Ga0070707_1001725122 | 271 |
| 37 | 3300005471 | Ga0070698_100070857 | Ga0070698_1000708572 | 271 |
| 38 | 3300005985 | Ga0081539_10004919 | Ga0081539_1000491916 | 271 |
| 39 | 3300026121 | Ga0207683_10024244 | Ga0207683_100242444 | 271 |
| 40 | 3300028786 | Ga0307517_10074469 | Ga0307517_100744693 | 271 |
| 41 | 3300028794 | Ga0307515_10009042 | Ga0307515_1000904211 | 271 |
| 42 | 3300030522 | Ga0307512_10003683 | Ga0307512_100036833 | 271 |
| 43 | 3300031456 | Ga0307513_10036904 | Ga0307513_100369041 | 271 |
| 44 | 3300031616 | Ga0307508_10033247 | Ga0307508_100332473 | 271 |
| 45 | 3300031731 | Ga0307405_10071517 | Ga0307405_100715172 | 271 |
| 46 | 3300031824 | Ga0307413_10126857 | Ga0307413_101268572 | 271 |
| 47 | 3300031852 | Ga0307410_10008218 | Ga0307410_100082182 | 271 |
| 48 | 3300031901 | Ga0307406_10005635 | Ga0307406_100056356 | 271 |
| 49 | 3300031995 | Ga0307409_100074136 | Ga0307409_1000741362 | 271 |
| 50 | 3300032002 | Ga0307416_100026645 | Ga0307416_1000266453 | 271 |
| 51 | 3300032126 | Ga0307415_100059169 | Ga0307415_1000591692 | 271 |
| 52 | 3300033180 | Ga0307510_10178321 | Ga0307510_101783212 | 271 |
| 53 | 3300046519 | Ga0495632_0072168 | Ga0495632_0072168_527_1477 | 271 |
| 54 | 3300053088 | Ga0500644_0001435 | Ga0500644_0001435_1676_2626 | 271 |
| 55 | 3300005614 | Ga0068856_100115958 | Ga0068856_1001159582 | 272 |
| 56 | 3300009093 | Ga0105240_10251979 | Ga0105240_102519793 | 272 |
| 57 | 3300009551 | Ga0105238_10129275 | Ga0105238_101292752 | 272 |
| 58 | 3300010375 | Ga0105239_10036023 | Ga0105239_100360232 | 272 |
| 59 | 3300031889 | Ga0326468_10000905 | Ga0326468_100009053 | 272 |
| 60 | 3300044842 | Ga0466957_0199478 | Ga0466957_0199478_35_985 | 272 |
| 61 | 3300045049 | Ga0466959_0184133 | Ga0466959_0184133_137_1090 | 272 |
| 62 | 3300005719 | Ga0068861_100014024 | Ga0068861_1000140243 | 273 |
| 63 | 3300009553 | Ga0105249_10073392 | Ga0105249_100733923 | 273 |
| 64 | 3300025961 | Ga0207712_10023350 | Ga0207712_100233503 | 273 |
| 65 | 3300026118 | Ga0207675_100002250 | Ga0207675_1000022507 | 273 |
| 66 | 3300037853 | Ga0436364_0118843 | Ga0436364_0118843_162_1118 | 273 |
| 67 | 3300044842 | Ga0466957_0002458 | Ga0466957_0002458_301_1257 | 273 |
| 68 | 3300046523 | Ga0495644_0072826 | Ga0495644_0072826_277_1212 | 273 |
| 69 | 3300046664 | Ga0495659_0049178 | Ga0495659_0049178_476_1411 | 273 |
| 70 | 3300046691 | Ga0495670_0028797 | Ga0495670_0028797_1270_2205 | 273 |
| 71 | 3300050507 | nmdc:mga05p37_220523_c1 | nmdc:mga05p37_220523_c1_625_1560 | 273 |
| 72 | 3300005336 | Ga0070680_100257496 | Ga0070680_1002574962 | 274 |
| 73 | 3300005339 | Ga0070660_100085659 | Ga0070660_1000856592 | 274 |
| 74 | 3300005366 | Ga0070659_100005916 | Ga0070659_1000059166 | 274 |
| 75 | 3300005366 | Ga0070659_100360254 | Ga0070659_1003602541 | 274 |
| 76 | 3300005434 | Ga0070709_10001361 | Ga0070709_1000136113 | 274 |
| 77 | 3300005435 | Ga0070714_100000545 | Ga0070714_10000054510 | 274 |
| 78 | 3300005436 | Ga0070713_100000483 | Ga0070713_10000048316 | 274 |
| 79 | 3300005437 | Ga0070710_10000539 | Ga0070710_1000053910 | 274 |
| 80 | 3300005458 | Ga0070681_10087816 | Ga0070681_100878162 | 274 |
| 81 | 3300005467 | Ga0070706_100001894 | Ga0070706_1000018947 | 274 |
| 82 | 3300005471 | Ga0070698_100013017 | Ga0070698_1000130172 | 274 |
| 83 | 3300005530 | Ga0070679_100207892 | Ga0070679_1002078922 | 274 |
| 84 | 3300006028 | Ga0070717_10001205 | Ga0070717_100012053 | 274 |
| 85 | 3300006028 | Ga0070717_10002725 | Ga0070717_100027257 | 274 |
| 86 | 3300006173 | Ga0070716_100001415 | Ga0070716_1000014157 | 274 |
| 87 | 3300022467 | Ga0224712_10012929 | Ga0224712_100129291 | 274 |
| 88 | 3300025898 | Ga0207692_10001094 | Ga0207692_100010948 | 274 |
| 89 | 3300025906 | Ga0207699_10001830 | Ga0207699_100018308 | 274 |
| 90 | 3300025910 | Ga0207684_10001419 | Ga0207684_1000141915 | 274 |
| 91 | 3300025915 | Ga0207693_10001078 | Ga0207693_100010786 | 274 |
| 92 | 3300025917 | Ga0207660_10254343 | Ga0207660_102543431 | 274 |
| 93 | 3300025919 | Ga0207657_10044561 | Ga0207657_100445614 | 274 |
| 94 | 3300025919 | Ga0207657_10105478 | Ga0207657_101054782 | 274 |
| 95 | 3300025921 | Ga0207652_10219371 | Ga0207652_102193712 | 274 |
| 96 | 3300025928 | Ga0207700_10005055 | Ga0207700_100050556 | 274 |
| 97 | 3300025929 | Ga0207664_10000427 | Ga0207664_1000042710 | 274 |
| 98 | 3300025932 | Ga0207690_10000219 | Ga0207690_1000021912 | 274 |
| 99 | 3300025932 | Ga0207690_10333355 | Ga0207690_103333551 | 274 |
| 100 | 3300025939 | Ga0207665_10002491 | Ga0207665_100024919 | 274 |
| 101 | 3300026023 | Ga0207677_10018630 | Ga0207677_100186302 | 274 |
| 102 | 3300031235 | Ga0265330_10081434 | Ga0265330_100814341 | 274 |
| 103 | 3300031344 | Ga0265316_10042524 | Ga0265316_100425244 | 274 |
| 104 | 3300031995 | Ga0307409_100042353 | Ga0307409_1000423534 | 274 |
| 105 | 3300032005 | Ga0307411_10067943 | Ga0307411_100679432 | 274 |
| 106 | 3300035086 | Ga0373934_0000070 | Ga0373934_0000070_12824_13780 | 274 |
| 107 | 3300035117 | Ga0373953_0000185 | Ga0373953_0000185_4020_4976 | 274 |
| 108 | 3300035118 | Ga0373954_0002192 | Ga0373954_0002192_6872_7828 | 274 |
| 109 | 3300035119 | Ga0373956_0000007 | Ga0373956_0000007_55789_56745 | 274 |
| 110 | 3300035120 | Ga0373957_0000024 | Ga0373957_0000024_36522_37478 | 274 |
| 111 | 3300035172 | Ga0373955_0000368 | Ga0373955_0000368_638_1594 | 274 |
| 112 | 3300035410 | Ga0373924_0000372 | Ga0373924_0000372_1306_2262 | 274 |
| 113 | 3300035724 | Ga0373933_0000002 | Ga0373933_0000002_62379_63335 | 274 |
| 114 | 3300036401 | Ga0373937_0000014 | Ga0373937_0000014_88451_89407 | 274 |
| 115 | 3300037068 | Ga0373925_0127897 | Ga0373925_0127897_1073_1966 | 274 |
| 116 | 3300046454 | Ga0495592_0000133 | Ga0495592_0000133_62379_63335 | 274 |
| 117 | 3300046462 | Ga0495651_0000019 | Ga0495651_0000019_88451_89407 | 274 |
| 118 | 3300046463 | Ga0495653_0003782 | Ga0495653_0003782_2163_3119 | 274 |
| 119 | 3300046511 | Ga0495608_0000028 | Ga0495608_0000028_62371_63327 | 274 |
| 120 | 3300046516 | Ga0495628_0000337 | Ga0495628_0000337_4803_5759 | 274 |
| 121 | 3300046529 | Ga0495652_0000031 | Ga0495652_0000031_62359_63315 | 274 |
| 122 | 3300046536 | Ga0495587_0000023 | Ga0495587_0000023_88429_89385 | 274 |
| 123 | 3300046559 | Ga0495667_0000054 | Ga0495667_0000054_62371_63327 | 274 |
| 124 | 3300046675 | Ga0495657_0000022 | Ga0495657_0000022_62379_63335 | 274 |
| 125 | 3300046678 | Ga0495599_0000125 | Ga0495599_0000125_9020_9976 | 274 |
| 126 | 3300046679 | Ga0495623_0000416 | Ga0495623_0000416_25852_26808 | 274 |
| 127 | 3300046680 | Ga0495646_0019999 | Ga0495646_0019999_1264_2220 | 274 |
| 128 | 3300046809 | Ga0495600_0008548 | Ga0495600_0008548_4866_5822 | 274 |
| 129 | 3300047317 | Ga0495604_0000022 | Ga0495604_0000022_62356_63312 | 274 |
| 130 | 3300047322 | Ga0495680_0000154 | Ga0495680_0000154_63829_64785 | 274 |
| 131 | 3300047444 | Ga0495675_0000843 | Ga0495675_0000843_13213_14169 | 274 |
| 132 | 3300048088 | Ga0495602_0000251 | Ga0495602_0000251_27720_28676 | 274 |
| 133 | 3300053077 | Ga0495601_0077583 | Ga0495601_0077583_603_1559 | 274 |
| 134 | 3300053084 | Ga0495595_0034282 | Ga0495595_0034282_309_1265 | 274 |
| 135 | 3300005366 | Ga0070659_100010121 | Ga0070659_1000101217 | 275 |
| 136 | 3300005445 | Ga0070708_100001278 | Ga0070708_10000127810 | 275 |
| 137 | 3300005467 | Ga0070706_100004349 | Ga0070706_10000434912 | 275 |
| 138 | 3300005467 | Ga0070706_100024464 | Ga0070706_1000244642 | 275 |
| 139 | 3300005468 | Ga0070707_100007016 | Ga0070707_1000070162 | 275 |
| 140 | 3300005468 | Ga0070707_100029674 | Ga0070707_1000296745 | 275 |
| 141 | 3300005471 | Ga0070698_100051847 | Ga0070698_1000518472 | 275 |
| 142 | 3300005536 | Ga0070697_100108411 | Ga0070697_1001084112 | 275 |
| 143 | 3300006028 | Ga0070717_10134834 | Ga0070717_101348342 | 275 |
| 144 | 3300006914 | Ga0075436_100074055 | Ga0075436_1000740552 | 275 |
| 145 | 3300013102 | Ga0157371_10059306 | Ga0157371_100593062 | 275 |
| 146 | 3300025910 | Ga0207684_10002612 | Ga0207684_100026128 | 275 |
| 147 | 3300025910 | Ga0207684_10186921 | Ga0207684_101869212 | 275 |
| 148 | 3300025922 | Ga0207646_10000950 | Ga0207646_100009508 | 275 |
| 149 | 3300025922 | Ga0207646_10072069 | Ga0207646_100720692 | 275 |
| 150 | 3300028794 | Ga0307515_10001066 | Ga0307515_1000106610 | 275 |
| 151 | 3300028800 | Ga0265338_10014640 | Ga0265338_100146408 | 275 |
| 152 | 3300031240 | Ga0265320_10022258 | Ga0265320_100222585 | 275 |
| 153 | 3300031241 | Ga0265325_10027015 | Ga0265325_100270151 | 275 |
| 154 | 3300031595 | Ga0265313_10046513 | Ga0265313_100465132 | 275 |
| 155 | 3300031711 | Ga0265314_10022618 | Ga0265314_100226183 | 275 |
| 156 | 3300035117 | Ga0373953_0068325 | Ga0373953_0068325_105_1061 | 275 |
| 157 | 3300035119 | Ga0373956_0090125 | Ga0373956_0090125_59_1015 | 275 |
| 158 | 3300036401 | Ga0373937_0117122 | Ga0373937_0117122_942_1898 | 275 |
| 159 | 3300038443 | Ga0395901_0072361 | Ga0395901_0072361_1652_2608 | 275 |
| 160 | 3300044684 | Ga0466966_0196157 | Ga0466966_0196157_254_1207 | 275 |
| 161 | 3300044694 | Ga0466963_0109300 | Ga0466963_0109300_757_1710 | 275 |
| 162 | 3300044765 | Ga0466970_0120894 | Ga0466970_0120894_312_1265 | 275 |
| 163 | 3300045049 | Ga0466959_0163057 | Ga0466959_0163057_494_1447 | 275 |
| 164 | 3300046462 | Ga0495651_0001424 | Ga0495651_0001424_12388_13344 | 275 |
| 165 | 3300046463 | Ga0495653_0015651 | Ga0495653_0015651_4220_5176 | 275 |
| 166 | 3300046477 | Ga0495664_0108657 | Ga0495664_0108657_13_969 | 275 |
| 167 | 3300046511 | Ga0495608_0009390 | Ga0495608_0009390_4121_5077 | 275 |
| 168 | 3300046529 | Ga0495652_0033547 | Ga0495652_0033547_1321_2277 | 275 |
| 169 | 3300046533 | Ga0495640_0223359 | Ga0495640_0223359_67_1023 | 275 |
| 170 | 3300046536 | Ga0495587_0017955 | Ga0495587_0017955_2678_3634 | 275 |
| 171 | 3300046559 | Ga0495667_0001016 | Ga0495667_0001016_11280_12236 | 275 |
| 172 | 3300046663 | Ga0495635_0030032 | Ga0495635_0030032_58_1014 | 275 |
| 173 | 3300046675 | Ga0495657_0002053 | Ga0495657_0002053_15091_16047 | 275 |
| 174 | 3300047317 | Ga0495604_0030817 | Ga0495604_0030817_3188_4144 | 275 |
| 175 | 3300047319 | Ga0495674_0027125 | Ga0495674_0027125_1846_2802 | 275 |
| 176 | 3300047322 | Ga0495680_0005823 | Ga0495680_0005823_1799_2755 | 275 |
| 177 | 3300047444 | Ga0495675_0013912 | Ga0495675_0013912_94_1050 | 275 |
| 178 | 3300053077 | Ga0495601_0249047 | Ga0495601_0249047_47_1003 | 275 |
| 179 | 3300061719 | Ga0466962_0095767 | Ga0466962_0095767_301_1254 | 275 |
| 180 | 3300005329 | Ga0070683_100173090 | Ga0070683_1001730901 | 276 |
| 181 | 3300005455 | Ga0070663_100349091 | Ga0070663_1003490912 | 276 |
| 182 | 3300005530 | Ga0070679_100053534 | Ga0070679_1000535345 | 276 |
| 183 | 3300005617 | Ga0068859_100066935 | Ga0068859_1000669352 | 276 |
| 184 | 3300005983 | Ga0081540_1000250 | Ga0081540_10002502 | 276 |
| 185 | 3300005983 | Ga0081540_1032375 | Ga0081540_10323755 | 276 |
| 186 | 3300006847 | Ga0075431_100063910 | Ga0075431_1000639103 | 276 |
| 187 | 3300006931 | Ga0097620_100066940 | Ga0097620_1000669402 | 276 |
| 188 | 3300025981 | Ga0207640_10270453 | Ga0207640_102704532 | 276 |
| 189 | 3300026142 | Ga0207698_10317204 | Ga0207698_103172041 | 276 |
| 190 | 3300031507 | Ga0307509_10178452 | Ga0307509_101784523 | 276 |
| 191 | 3300032002 | Ga0307416_100190815 | Ga0307416_1001908152 | 276 |
| 192 | 3300035083 | Ga0373926_0009034 | Ga0373926_0009034_19_975 | 276 |
| 193 | 3300035113 | Ga0373936_0004164 | Ga0373936_0004164_1016_1972 | 276 |
| 194 | 3300035117 | Ga0373953_0045019 | Ga0373953_0045019_797_1753 | 276 |
| 195 | 3300035170 | Ga0373943_0001795 | Ga0373943_0001795_3517_4473 | 276 |
| 196 | 3300035410 | Ga0373924_0018862 | Ga0373924_0018862_1692_2648 | 276 |
| 197 | 3300035695 | Ga0373927_0070955 | Ga0373927_0070955_663_1619 | 276 |
| 198 | 3300035724 | Ga0373933_0071489 | Ga0373933_0071489_428_1423 | 276 |
| 199 | 3300036401 | Ga0373937_0238112 | Ga0373937_0238112_347_1303 | 276 |
| 200 | 3300037068 | Ga0373925_0062211 | Ga0373925_0062211_135_1091 | 276 |
| 201 | 3300037466 | Ga0395898_0090208 | Ga0395898_0090208_1347_2303 | 276 |
| 202 | 3300037471 | Ga0395905_0149731 | Ga0395905_0149731_747_1703 | 276 |
| 203 | 3300037853 | Ga0436364_0935193 | Ga0436364_0935193_109_1068 | 276 |
| 204 | 3300041512 | Ga0451853_3927494 | Ga0451853_3927494_190_1146 | 276 |
| 205 | 3300046461 | Ga0495641_0013730 | Ga0495641_0013730_3431_4387 | 276 |
| 206 | 3300046473 | Ga0495582_0000493 | Ga0495582_0000493_46_1002 | 276 |
| 207 | 3300046475 | Ga0495639_0005262 | Ga0495639_0005262_67_1023 | 276 |
| 208 | 3300046477 | Ga0495664_0009160 | Ga0495664_0009160_4542_5498 | 276 |
| 209 | 3300046529 | Ga0495652_0071909 | Ga0495652_0071909_1870_2826 | 276 |
| 210 | 3300046531 | Ga0495665_0012938 | Ga0495665_0012938_3540_4496 | 276 |
| 211 | 3300046536 | Ga0495587_0104905 | Ga0495587_0104905_618_1574 | 276 |
| 212 | 3300046543 | Ga0495645_0008216 | Ga0495645_0008216_6252_7208 | 276 |
| 213 | 3300046559 | Ga0495667_0065162 | Ga0495667_0065162_276_1271 | 276 |
| 214 | 3300046675 | Ga0495657_0091134 | Ga0495657_0091134_933_1889 | 276 |
| 215 | 3300046680 | Ga0495646_0076103 | Ga0495646_0076103_78_1034 | 276 |
| 216 | 3300046683 | Ga0495658_0076226 | Ga0495658_0076226_965_1921 | 276 |
| 217 | 3300046809 | Ga0495600_0055207 | Ga0495600_0055207_67_1023 | 276 |
| 218 | 3300047315 | Ga0495581_0010470 | Ga0495581_0010470_69_1025 | 276 |
| 219 | 3300047471 | Ga0495684_0020511 | Ga0495684_0020511_4090_5046 | 276 |
| 220 | 3300047673 | Ga0495593_0005889 | Ga0495593_0005889_6244_7200 | 276 |
| 221 | 3300048088 | Ga0495602_0071257 | Ga0495602_0071257_578_1534 | 276 |
| 222 | 3300048907 | Ga0496104_0068816 | Ga0496104_0068816_2283_3236 | 276 |
| 223 | 3300048915 | Ga0496112_0104811 | Ga0496112_0104811_1367_2320 | 276 |
| 224 | 3300050510 | nmdc:mga06r32_629_c3 | nmdc:mga06r32_629_c3_581_1540 | 276 |
| 225 | 3300053077 | Ga0495601_0228448 | Ga0495601_0228448_58_1014 | 276 |
| 226 | 3300053078 | Ga0495612_0008163 | Ga0495612_0008163_35_991 | 276 |
| 227 | 3300053084 | Ga0495595_0083694 | Ga0495595_0083694_94_1050 | 276 |
| 228 | 3300053085 | Ga0495619_0041514 | Ga0495619_0041514_1997_2953 | 276 |
| 229 | 3300005458 | Ga0070681_10174259 | Ga0070681_101742592 | 277 |
| 230 | 3300005530 | Ga0070679_100034617 | Ga0070679_1000346175 | 277 |
| 231 | 3300006237 | Ga0097621_100111339 | Ga0097621_1001113392 | 277 |
| 232 | 3300006852 | Ga0075433_10143574 | Ga0075433_101435742 | 277 |
| 233 | 3300006871 | Ga0075434_100018423 | Ga0075434_1000184235 | 277 |
| 234 | 3300009545 | Ga0105237_10033633 | Ga0105237_100336332 | 277 |
| 235 | 3300013308 | Ga0157375_10448831 | Ga0157375_104488312 | 277 |
| 236 | 3300025906 | Ga0207699_10011057 | Ga0207699_100110573 | 277 |
| 237 | 3300025912 | Ga0207707_10098332 | Ga0207707_100983322 | 277 |
| 238 | 3300025914 | Ga0207671_10071968 | Ga0207671_100719682 | 277 |
| 239 | 3300025921 | Ga0207652_10124104 | Ga0207652_101241042 | 277 |
| 240 | 3300025929 | Ga0207664_10191859 | Ga0207664_101918592 | 277 |
| 241 | 3300031548 | Ga0307408_100018031 | Ga0307408_1000180313 | 277 |
| 242 | 3300031711 | Ga0265314_10136154 | Ga0265314_101361542 | 277 |
| 243 | 3300031712 | Ga0265342_10094939 | Ga0265342_100949392 | 277 |
| 244 | 3300031901 | Ga0307406_10080903 | Ga0307406_100809033 | 277 |
| 245 | 3300031901 | Ga0307406_10140744 | Ga0307406_101407443 | 277 |
| 246 | 3300032002 | Ga0307416_100021209 | Ga0307416_1000212092 | 277 |
| 247 | 3300035083 | Ga0373926_0107581 | Ga0373926_0107581_78_1034 | 277 |
| 248 | 3300035114 | Ga0373939_0060424 | Ga0373939_0060424_36_992 | 277 |
| 249 | 3300044693 | Ga0466961_0017604 | Ga0466961_0017604_549_1505 | 277 |
| 250 | 3300046473 | Ga0495582_0015285 | Ga0495582_0015285_416_1372 | 277 |
| 251 | 3300046499 | Ga0495594_0097426 | Ga0495594_0097426_620_1576 | 277 |
| 252 | 3300046531 | Ga0495665_0052706 | Ga0495665_0052706_1007_1963 | 277 |
| 253 | 3300046648 | Ga0495611_0067192 | Ga0495611_0067192_274_1209 | 277 |
| 254 | 3300046681 | Ga0495647_0021475 | Ga0495647_0021475_1199_2155 | 277 |
| 255 | 3300048906 | Ga0496103_0109747 | Ga0496103_0109747_754_1710 | 277 |
| 256 | 3300048907 | Ga0496104_0122788 | Ga0496104_0122788_1041_1997 | 277 |
| 257 | 3300048910 | Ga0496107_0106800 | Ga0496107_0106800_1040_1996 | 277 |
| 258 | 3300048915 | Ga0496112_0108323 | Ga0496112_0108323_461_1417 | 277 |
| 259 | 3300049742 | Ga0501080_0217989 | Ga0501080_0217989_572_1555 | 277 |
| 260 | 3300050512 | nmdc:mga0n895_18120_c1 | nmdc:mga0n895_18120_c1_1455_2411 | 277 |
| 261 | 3300050514 | nmdc:mga08x19_31370_c1 | nmdc:mga08x19_31370_c1_668_1624 | 277 |
| 262 | 3300050515 | nmdc:mga0a205_42659_c1 | nmdc:mga0a205_42659_c1_2583_3539 | 277 |
| 263 | 3300012503 | Ga0157313_1001542 | Ga0157313_10015422 | 278 |
| 264 | 3300035118 | Ga0373954_0040873 | Ga0373954_0040873_959_1915 | 278 |
| 265 | 3300036647 | Ga0316582_0057528 | Ga0316582_0057528_788_1672 | 278 |
| 266 | 3300038735 | Ga0400485_02208 | Ga0400485_02208_9718_10683 | 278 |
| 267 | 3300038742 | Ga0400486_25692 | Ga0400486_25692_832_1797 | 278 |
| 268 | 3300044693 | Ga0466961_0068036 | Ga0466961_0068036_245_1204 | 278 |
| 269 | 3300044706 | Ga0466964_0054574 | Ga0466964_0054574_496_1455 | 278 |
| 270 | 3300045836 | Ga0466958_0002125 | Ga0466958_0002125_6969_7928 | 278 |
| 271 | 3300046459 | Ga0495629_0120393 | Ga0495629_0120393_221_1177 | 278 |
| 272 | 3300031548 | Ga0307408_100206281 | Ga0307408_1002062812 | 279 |
| 273 | 3300031731 | Ga0307405_10016418 | Ga0307405_100164183 | 279 |
| 274 | 3300031824 | Ga0307413_10028958 | Ga0307413_100289582 | 279 |
| 275 | 3300031903 | Ga0307407_10010091 | Ga0307407_100100912 | 279 |
| 276 | 3300031995 | Ga0307409_100062244 | Ga0307409_1000622443 | 279 |
| 277 | 3300032002 | Ga0307416_100005911 | Ga0307416_1000059115 | 279 |
| 278 | 3300032004 | Ga0307414_10295094 | Ga0307414_102950942 | 279 |
| 279 | 3300032005 | Ga0307411_10013764 | Ga0307411_100137643 | 279 |
| 280 | 3300032126 | Ga0307415_100005543 | Ga0307415_1000055435 | 279 |
| 281 | 3300035692 | Ga0373935_0005495 | Ga0373935_0005495_5289_6245 | 279 |
| 282 | 3300035725 | Ga0373947_0000007 | Ga0373947_0000007_144380_145336 | 279 |
| 283 | 3300044694 | Ga0466963_0015064 | Ga0466963_0015064_3131_4096 | 279 |
| 284 | 3300046533 | Ga0495640_0046881 | Ga0495640_0046881_491_1447 | 279 |
| 285 | 3300005334 | Ga0068869_100006152 | Ga0068869_1000061522 | 280 |
| 286 | 3300005338 | Ga0068868_100044731 | Ga0068868_1000447312 | 280 |
| 287 | 3300005339 | Ga0070660_100056267 | Ga0070660_1000562674 | 280 |
| 288 | 3300005345 | Ga0070692_10003994 | Ga0070692_100039944 | 280 |
| 289 | 3300005366 | Ga0070659_100176405 | Ga0070659_1001764052 | 280 |
| 290 | 3300005455 | Ga0070663_100026128 | Ga0070663_1000261284 | 280 |
| 291 | 3300005458 | Ga0070681_10383872 | Ga0070681_103838721 | 280 |
| 292 | 3300005468 | Ga0070707_100026268 | Ga0070707_1000262682 | 280 |
| 293 | 3300005471 | Ga0070698_100228475 | Ga0070698_1002284752 | 280 |
| 294 | 3300005547 | Ga0070693_100003713 | Ga0070693_1000037136 | 280 |
| 295 | 3300005548 | Ga0070665_100006607 | Ga0070665_1000066078 | 280 |
| 296 | 3300005617 | Ga0068859_100443735 | Ga0068859_1004437352 | 280 |
| 297 | 3300005834 | Ga0068851_10035674 | Ga0068851_100356742 | 280 |
| 298 | 3300005840 | Ga0068870_10000614 | Ga0068870_100006148 | 280 |
| 299 | 3300005843 | Ga0068860_100043085 | Ga0068860_1000430853 | 280 |
| 300 | 3300006237 | Ga0097621_100037665 | Ga0097621_1000376654 | 280 |
| 301 | 3300006358 | Ga0068871_100047631 | Ga0068871_1000476314 | 280 |
| 302 | 3300006844 | Ga0075428_100062887 | Ga0075428_1000628874 | 280 |
| 303 | 3300006847 | Ga0075431_100272902 | Ga0075431_1002729022 | 280 |
| 304 | 3300006852 | Ga0075433_10049564 | Ga0075433_100495642 | 280 |
| 305 | 3300006931 | Ga0097620_100443771 | Ga0097620_1004437712 | 280 |
| 306 | 3300009101 | Ga0105247_10053503 | Ga0105247_100535033 | 280 |
| 307 | 3300009551 | Ga0105238_10290145 | Ga0105238_102901452 | 280 |
| 308 | 3300013102 | Ga0157371_10137477 | Ga0157371_101374772 | 280 |
| 309 | 3300013104 | Ga0157370_10057438 | Ga0157370_100574384 | 280 |
| 310 | 3300013296 | Ga0157374_10259101 | Ga0157374_102591012 | 280 |
| 311 | 3300014968 | Ga0157379_10146024 | Ga0157379_101460242 | 280 |
| 312 | 3300020081 | Ga0206354_10593962 | Ga0206354_105939622 | 280 |
| 313 | 3300025321 | Ga0207656_10020636 | Ga0207656_100206362 | 280 |
| 314 | 3300025900 | Ga0207710_10028052 | Ga0207710_100280521 | 280 |
| 315 | 3300025901 | Ga0207688_10017900 | Ga0207688_100179002 | 280 |
| 316 | 3300025908 | Ga0207643_10000204 | Ga0207643_100002047 | 280 |
| 317 | 3300025913 | Ga0207695_10287073 | Ga0207695_102870732 | 280 |
| 318 | 3300025917 | Ga0207660_10038844 | Ga0207660_100388444 | 280 |
| 319 | 3300025919 | Ga0207657_10165197 | Ga0207657_101651971 | 280 |
| 320 | 3300025920 | Ga0207649_10018450 | Ga0207649_100184504 | 280 |
| 321 | 3300025922 | Ga0207646_10102009 | Ga0207646_101020092 | 280 |
| 322 | 3300025925 | Ga0207650_10002710 | Ga0207650_100027104 | 280 |
| 323 | 3300025926 | Ga0207659_10004400 | Ga0207659_100044006 | 280 |
| 324 | 3300025927 | Ga0207687_10075188 | Ga0207687_100751882 | 280 |
| 325 | 3300025931 | Ga0207644_10007562 | Ga0207644_100075625 | 280 |
| 326 | 3300025932 | Ga0207690_10030154 | Ga0207690_100301542 | 280 |
| 327 | 3300025942 | Ga0207689_10000223 | Ga0207689_1000022314 | 280 |
| 328 | 3300025945 | Ga0207679_10006307 | Ga0207679_100063073 | 280 |
| 329 | 3300026067 | Ga0207678_10002516 | Ga0207678_100025168 | 280 |
| 330 | 3300026088 | Ga0207641_10009542 | Ga0207641_100095425 | 280 |
| 331 | 3300026095 | Ga0207676_10001541 | Ga0207676_1000154114 | 280 |
| 332 | 3300026121 | Ga0207683_10000804 | Ga0207683_1000080418 | 280 |
| 333 | 3300027907 | Ga0207428_10009923 | Ga0207428_100099234 | 280 |
| 334 | 3300028379 | Ga0268266_10023015 | Ga0268266_100230154 | 280 |
| 335 | 3300031824 | Ga0307413_10174920 | Ga0307413_101749201 | 280 |
| 336 | 3300032002 | Ga0307416_100051710 | Ga0307416_1000517102 | 280 |
| 337 | 3300048905 | Ga0496102_0006094 | Ga0496102_0006094_8922_9860 | 280 |
| 338 | 3300048907 | Ga0496104_0012341 | Ga0496104_0012341_1342_2280 | 280 |
| 339 | 3300048908 | Ga0496105_0016937 | Ga0496105_0016937_2618_3556 | 280 |
| 340 | 3300048909 | Ga0496106_0034290 | Ga0496106_0034290_2389_3327 | 280 |
| 341 | 3300048911 | Ga0496108_0073187 | Ga0496108_0073187_300_1238 | 280 |
| 342 | 3300050511 | nmdc:mga08y16_11933_c1 | nmdc:mga08y16_11933_c1_6474_7412 | 280 |
| 343 | 3300050515 | nmdc:mga0a205_34049_c1 | nmdc:mga0a205_34049_c1_1452_2390 | 280 |
| 344 | 3300005328 | Ga0070676_10043582 | Ga0070676_100435822 | 281 |
| 345 | 3300005336 | Ga0070680_100056299 | Ga0070680_1000562994 | 281 |
| 346 | 3300005364 | Ga0070673_100003932 | Ga0070673_1000039326 | 281 |
| 347 | 3300005367 | Ga0070667_100211942 | Ga0070667_1002119421 | 281 |
| 348 | 3300005471 | Ga0070698_100017971 | Ga0070698_1000179712 | 281 |
| 349 | 3300005615 | Ga0070702_100000031 | Ga0070702_10000003129 | 281 |
| 350 | 3300006871 | Ga0075434_100044958 | Ga0075434_1000449584 | 281 |
| 351 | 3300009094 | Ga0111539_10032226 | Ga0111539_100322262 | 281 |
| 352 | 3300014969 | Ga0157376_10103696 | Ga0157376_101036962 | 281 |
| 353 | 3300020075 | Ga0206349_1541197 | Ga0206349_15411972 | 281 |
| 354 | 3300020081 | Ga0206354_10500860 | Ga0206354_105008602 | 281 |
| 355 | 3300022467 | Ga0224712_10003353 | Ga0224712_100033533 | 281 |
| 356 | 3300048913 | Ga0496110_0316810 | Ga0496110_0316810_467_1396 | 281 |
| 357 | 3300048916 | Ga0496113_0016988 | Ga0496113_0016988_2762_3700 | 281 |
| 358 | 3300048929 | Ga0496126_0078461 | Ga0496126_0078461_305_1261 | 281 |
| 359 | 3300050512 | nmdc:mga0n895_262196_c1 | nmdc:mga0n895_262196_c1_569_1507 | 281 |
| 360 | 3300005327 | Ga0070658_10167961 | Ga0070658_101679612 | 282 |
| 361 | 3300005435 | Ga0070714_100001325 | Ga0070714_10000132513 | 282 |
| 362 | 3300005436 | Ga0070713_100021482 | Ga0070713_1000214823 | 282 |
| 363 | 3300007076 | Ga0075435_100064936 | Ga0075435_1000649362 | 282 |
| 364 | 3300025901 | Ga0207688_10106533 | Ga0207688_101065332 | 282 |
| 365 | 3300025919 | Ga0207657_10089951 | Ga0207657_100899511 | 282 |
| 366 | 3300025928 | Ga0207700_10057202 | Ga0207700_100572023 | 282 |
| 367 | 3300025929 | Ga0207664_10000940 | Ga0207664_100009405 | 282 |
| 368 | 3300025961 | Ga0207712_10098587 | Ga0207712_100985872 | 282 |
| 369 | 3300026118 | Ga0207675_100037515 | Ga0207675_1000375154 | 282 |
| 370 | 3300046476 | Ga0495662_0160612 | Ga0495662_0160612_40_996 | 282 |
| 371 | 3300046511 | Ga0495608_0108063 | Ga0495608_0108063_161_1156 | 282 |
| 372 | 3300046675 | Ga0495657_0056185 | Ga0495657_0056185_120_1076 | 282 |
| 373 | 3300046690 | Ga0495624_0114947 | Ga0495624_0114947_21_977 | 282 |
| 374 | 3300047317 | Ga0495604_0136622 | Ga0495604_0136622_733_1728 | 282 |
| 375 | 3300047471 | Ga0495684_0029724 | Ga0495684_0029724_399_1355 | 282 |
| 376 | 3300005471 | Ga0070698_100131717 | Ga0070698_1001317172 | 283 |
| 377 | 3300005536 | Ga0070697_100140261 | Ga0070697_1001402613 | 283 |
| 378 | 3300046459 | Ga0495629_0003615 | Ga0495629_0003615_1596_2552 | 283 |
| 379 | 3300046476 | Ga0495662_0103426 | Ga0495662_0103426_350_1306 | 283 |
| 380 | 3300046477 | Ga0495664_0010930 | Ga0495664_0010930_295_1251 | 283 |
| 381 | 3300046500 | Ga0495596_0022225 | Ga0495596_0022225_464_1399 | 283 |
| 382 | 3300046511 | Ga0495608_0236051 | Ga0495608_0236051_40_996 | 283 |
| 383 | 3300046526 | Ga0495666_0058276 | Ga0495666_0058276_355_1311 | 283 |
| 384 | 3300046679 | Ga0495623_0058265 | Ga0495623_0058265_1441_2397 | 283 |
| 385 | 3300046690 | Ga0495624_0013469 | Ga0495624_0013469_4359_5315 | 283 |
| 386 | 3300047319 | Ga0495674_0025284 | Ga0495674_0025284_1347_2303 | 283 |
| 387 | 3300047444 | Ga0495675_0020526 | Ga0495675_0020526_999_1955 | 283 |
| 388 | 3300047673 | Ga0495593_0025477 | Ga0495593_0025477_2041_2997 | 283 |
| 389 | 3300048088 | Ga0495602_0328137 | Ga0495602_0328137_147_1100 | 283 |
| 390 | 3300048089 | Ga0495614_0086759 | Ga0495614_0086759_176_1132 | 283 |
| 391 | 3300049581 | Ga0501047_0000141 | Ga0501047_0000141_85590_86546 | 283 |
| 392 | 3300053085 | Ga0495619_0056829 | Ga0495619_0056829_20_976 | 283 |
| 393 | 3300005563 | Ga0068855_100449672 | Ga0068855_1004496721 | 284 |
| 394 | 3300009174 | Ga0105241_10379178 | Ga0105241_103791782 | 284 |
| 395 | 3300050510 | nmdc:mga06r32_28294_c1 | nmdc:mga06r32_28294_c1_3700_4650 | 284 |
| 396 | 3300005530 | Ga0070679_100085114 | Ga0070679_1000851142 | 285 |
| 397 | 3300006846 | Ga0075430_100006545 | Ga0075430_1000065451 | 285 |
| 398 | 3300006880 | Ga0075429_100002678 | Ga0075429_1000026782 | 285 |
| 399 | 3300009147 | Ga0114129_10009018 | Ga0114129_100090182 | 285 |
| 400 | 3300010159 | Ga0099796_10050215 | Ga0099796_100502152 | 285 |
| 401 | 3300013306 | Ga0163162_10127754 | Ga0163162_101277543 | 285 |
| 402 | 3300022467 | Ga0224712_10021811 | Ga0224712_100218111 | 285 |
| 403 | 3300050509 | nmdc:mga0qj67_43141_c1 | nmdc:mga0qj67_43141_c1_936_1886 | 285 |
| 404 | 3300020077 | Ga0206351_10996409 | Ga0206351_109964092 | 286 |
| 405 | 3300025918 | Ga0207662_10011478 | Ga0207662_100114782 | 286 |
| 406 | 3300031548 | Ga0307408_100030377 | Ga0307408_1000303772 | 286 |
| 407 | 3300031824 | Ga0307413_10002297 | Ga0307413_100022974 | 286 |
| 408 | 3300031852 | Ga0307410_10012065 | Ga0307410_100120653 | 286 |
| 409 | 3300031852 | Ga0307410_10017362 | Ga0307410_100173624 | 286 |
| 410 | 3300031911 | Ga0307412_10037573 | Ga0307412_100375734 | 286 |
| 411 | 3300032002 | Ga0307416_100022814 | Ga0307416_1000228142 | 286 |
| 412 | 3300032005 | Ga0307411_10003583 | Ga0307411_100035838 | 286 |
| 413 | 3300032126 | Ga0307415_100165772 | Ga0307415_1001657722 | 286 |
| 414 | 3300037418 | Ga0395900_0256887 | Ga0395900_0256887_534_1469 | 286 |
| 415 | 3300037466 | Ga0395898_0161474 | Ga0395898_0161474_967_1902 | 286 |
| 416 | 3300037853 | Ga0436364_1537007 | Ga0436364_1537007_2345_3301 | 286 |
| 417 | 3300042157 | Ga0439458_0003964 | Ga0439458_0003964_998_1936 | 286 |
| 418 | 3300005437 | Ga0070710_10000864 | Ga0070710_1000086411 | 287 |
| 419 | 3300005981 | Ga0081538_10026674 | Ga0081538_100266744 | 287 |
| 420 | 3300005983 | Ga0081540_1000330 | Ga0081540_100033017 | 287 |
| 421 | 3300031616 | Ga0307508_10306467 | Ga0307508_103064671 | 287 |
| 422 | 3300031731 | Ga0307405_10034777 | Ga0307405_100347774 | 287 |
| 423 | 3300031995 | Ga0307409_100224732 | Ga0307409_1002247322 | 287 |
| 424 | 3300032002 | Ga0307416_100014187 | Ga0307416_1000141874 | 287 |
| 425 | 3300032126 | Ga0307415_100001464 | Ga0307415_1000014646 | 287 |
| 426 | 3300035398 | Ga0316574_0003741 | Ga0316574_0003741_6135_7094 | 287 |
| 427 | 3300042005 | Ga0439448_0000572 | Ga0439448_0000572_6961_7896 | 287 |
| 428 | 3300042012 | Ga0439455_0026469 | Ga0439455_0026469_273_1208 | 287 |
| 429 | 3300042016 | Ga0439463_003040 | Ga0439463_003040_3023_3958 | 287 |
| 430 | 3300042439 | Ga0439464_0010056 | Ga0439464_0010056_1106_2041 | 287 |
| 431 | 3300042439 | Ga0439464_0010767 | Ga0439464_0010767_286_1221 | 287 |
| 432 | 3300042461 | Ga0439460_0012086 | Ga0439460_0012086_1107_2042 | 287 |
| 433 | 3300042461 | Ga0439460_0044508 | Ga0439460_0044508_186_1121 | 287 |
| 434 | 3300042530 | Ga0450916_000764 | Ga0450916_000764_585_1520 | 287 |
| 435 | 3300049568 | Ga0501031_0174904 | Ga0501031_0174904_48_983 | 287 |
| 436 | 3300049569 | Ga0501032_0100248 | Ga0501032_0100248_52_987 | 287 |
| 437 | 3300049570 | Ga0501033_0149713 | Ga0501033_0149713_411_1346 | 287 |
| 438 | 3300049572 | Ga0501036_0003648 | Ga0501036_0003648_1619_2554 | 287 |
| 439 | 3300049573 | Ga0501037_0120427 | Ga0501037_0120427_149_1084 | 287 |
| 440 | 3300049574 | Ga0501038_0109061 | Ga0501038_0109061_979_1914 | 287 |
| 441 | 3300049575 | Ga0501039_0000354 | Ga0501039_0000354_14859_15794 | 287 |
| 442 | 3300049576 | Ga0501040_0000917 | Ga0501040_0000917_2715_3650 | 287 |
| 443 | 3300049577 | Ga0501041_0022606 | Ga0501041_0022606_1608_2543 | 287 |
| 444 | 3300049578 | Ga0501042_0017637 | Ga0501042_0017637_1927_2862 | 287 |
| 445 | 3300049580 | Ga0501046_0071323 | Ga0501046_0071323_1679_2614 | 287 |
| 446 | 3300049582 | Ga0501048_0011341 | Ga0501048_0011341_4038_4973 | 287 |
| 447 | 3300049584 | Ga0501068_0011701 | Ga0501068_0011701_1176_2111 | 287 |
| 448 | 3300049588 | Ga0501072_0001751 | Ga0501072_0001751_14851_15786 | 287 |
| 449 | 3300049590 | Ga0501074_0092134 | Ga0501074_0092134_694_1629 | 287 |
| 450 | 3300049591 | Ga0501075_0000450 | Ga0501075_0000450_6729_7664 | 287 |
| 451 | 3300049593 | Ga0501077_0010629 | Ga0501077_0010629_739_1674 | 287 |
| 452 | 3300049741 | Ga0501079_0001334 | Ga0501079_0001334_14322_15257 | 287 |
| 453 | 3300049822 | Ga0501035_0295741 | Ga0501035_0295741_77_1012 | 287 |
| 454 | 3300049824 | Ga0501045_0021181 | Ga0501045_0021181_915_1850 | 287 |
| 455 | 3300054114 | Ga0501084_0014695 | Ga0501084_0014695_1256_2191 | 287 |
| 456 | 3300059424 | Ga0590075_005988 | Ga0590075_005988_35_970 | 287 |
| 457 | 3300059426 | Ga0590077_001146 | Ga0590077_001146_3521_4456 | 287 |
| 458 | 3300060353 | Ga0501082_0007058 | Ga0501082_0007058_1891_2826 | 287 |
| 459 | 3300061734 | Ga0530510_0000669 | Ga0530510_0000669_928_1863 | 287 |
| 460 | 3300037471 | Ga0395905_0028781 | Ga0395905_0028781_4155_5090 | 288 |
| 461 | 3300038443 | Ga0395901_0231170 | Ga0395901_0231170_60_995 | 288 |
| 462 | 3300005548 | Ga0070665_100147095 | Ga0070665_1001470953 | 289 |
| 463 | iso_pu_bacteria | 2684623035 | 2686539196 | 289 |
| 464 | iso_pu_bacteria | 2895880812 | 2895890449 | 289 |
| 465 | iso_pu_bacteria | 2515154088 | 2515496569 | 290 |
| 466 | iso_pu_bacteria | 2515154129 | 2515718426 | 290 |
| 467 | iso_pu_bacteria | 2515154137 | 2515756807 | 290 |
| 468 | iso_pu_bacteria | 2515154202 | 2516083418 | 290 |
| 469 | iso_pu_bacteria | 2515154203 | 2516089330 | 290 |
| 470 | iso_pu_bacteria | 2675903059 | 2676480256 | 290 |
| 471 | iso_pu_bacteria | 2832004796 | 2832007879 | 290 |
| 472 | iso_pu_bacteria | 2855683550 | 2855685961 | 290 |
| 473 | iso_pu_bacteria | 2861520306 | 2861524772 | 290 |
| 474 | iso_pu_bacteria | 2866065130 | 2866068786 | 290 |
| 475 | iso_pu_bacteria | 8003856774 | 8003858437 | 290 |
| 476 | iso_pu_bacteria | 8056054917 | 8056056906 | 290 |
| 477 | 3300031852 | Ga0307410_10151531 | Ga0307410_101515313 | 291 |
| 478 | 3300031911 | Ga0307412_10176155 | Ga0307412_101761551 | 291 |
| 479 | 3300032126 | Ga0307415_100115846 | Ga0307415_1001158463 | 291 |
| 480 | iso_pu_bacteria | 2515154155 | 2515855258 | 291 |
| 481 | iso_pu_bacteria | 2675903058 | 2676473578 | 291 |
| 482 | iso_pu_bacteria | 2731639228 | 2731909024 | 291 |
| 483 | iso_pu_bacteria | 2799112218 | 2799184882 | 291 |
| 484 | iso_pu_bacteria | 2827628540 | 2827632091 | 291 |
| 485 | 3300005434 | Ga0070709_10036675 | Ga0070709_100366753 | 292 |
| 486 | 3300005436 | Ga0070713_100003097 | Ga0070713_1000030978 | 292 |
| 487 | 3300005436 | Ga0070713_100012555 | Ga0070713_1000125554 | 292 |
| 488 | 3300005439 | Ga0070711_100127218 | Ga0070711_1001272182 | 292 |
| 489 | 3300005539 | Ga0068853_100331322 | Ga0068853_1003313222 | 292 |
| 490 | 3300006173 | Ga0070716_100045435 | Ga0070716_1000454352 | 292 |
| 491 | 3300006175 | Ga0070712_100014062 | Ga0070712_1000140624 | 292 |
| 492 | 3300009147 | Ga0114129_10047822 | Ga0114129_100478224 | 292 |
| 493 | 3300009148 | Ga0105243_10365331 | Ga0105243_103653311 | 292 |
| 494 | 3300009177 | Ga0105248_10294461 | Ga0105248_102944612 | 292 |
| 495 | 3300021358 | Ga0213873_10019370 | Ga0213873_100193702 | 292 |
| 496 | 3300021388 | Ga0213875_10016542 | Ga0213875_100165423 | 292 |
| 497 | 3300021441 | Ga0213871_10050030 | Ga0213871_100500301 | 292 |
| 498 | 3300022467 | Ga0224712_10127430 | Ga0224712_101274301 | 292 |
| 499 | 3300025912 | Ga0207707_10109135 | Ga0207707_101091352 | 292 |
| 500 | 3300025915 | Ga0207693_10008773 | Ga0207693_100087737 | 292 |
| 501 | 3300025915 | Ga0207693_10085727 | Ga0207693_100857272 | 292 |
| 502 | 3300025916 | Ga0207663_10074280 | Ga0207663_100742802 | 292 |
| 503 | 3300025928 | Ga0207700_10021329 | Ga0207700_100213293 | 292 |
| 504 | 3300025928 | Ga0207700_10034120 | Ga0207700_100341204 | 292 |
| 505 | 3300025929 | Ga0207664_10007361 | Ga0207664_100073617 | 292 |
| 506 | 3300025929 | Ga0207664_10020499 | Ga0207664_100204995 | 292 |
| 507 | 3300025929 | Ga0207664_10304935 | Ga0207664_103049352 | 292 |
| 508 | 3300025939 | Ga0207665_10134613 | Ga0207665_101346132 | 292 |
| 509 | 3300025939 | Ga0207665_10141555 | Ga0207665_101415552 | 292 |
| 510 | 3300025940 | Ga0207691_10029944 | Ga0207691_100299441 | 292 |
| 511 | 3300025944 | Ga0207661_10130930 | Ga0207661_101309302 | 292 |
| 512 | 3300025944 | Ga0207661_10510587 | Ga0207661_105105871 | 292 |
| 513 | 3300026041 | Ga0207639_10328799 | Ga0207639_103287991 | 292 |
| 514 | 3300026078 | Ga0207702_10370778 | Ga0207702_103707782 | 292 |
| 515 | 3300026116 | Ga0207674_10123468 | Ga0207674_101234681 | 292 |
| 516 | 3300028800 | Ga0265338_10031380 | Ga0265338_100313805 | 292 |
| 517 | 3300035111 | Ga0373923_0056349 | Ga0373923_0056349_18_995 | 292 |
| 518 | 3300035111 | Ga0373923_0066202 | Ga0373923_0066202_90_1043 | 292 |
| 519 | 3300035118 | Ga0373954_0061833 | Ga0373954_0061833_146_1117 | 292 |
| 520 | 3300035410 | Ga0373924_0011689 | Ga0373924_0011689_150_1103 | 292 |
| 521 | 3300035692 | Ga0373935_0073581 | Ga0373935_0073581_342_1295 | 292 |
| 522 | 3300035724 | Ga0373933_0037724 | Ga0373933_0037724_864_1817 | 292 |
| 523 | 3300035724 | Ga0373933_0142720 | Ga0373933_0142720_105_1058 | 292 |
| 524 | 3300036401 | Ga0373937_0000312 | Ga0373937_0000312_17081_18034 | 292 |
| 525 | 3300036401 | Ga0373937_0007378 | Ga0373937_0007378_6594_7547 | 292 |
| 526 | 3300036401 | Ga0373937_0046082 | Ga0373937_0046082_735_1688 | 292 |
| 527 | 3300036401 | Ga0373937_0106572 | Ga0373937_0106572_1555_2508 | 292 |
| 528 | 3300037068 | Ga0373925_0221542 | Ga0373925_0221542_109_1062 | 292 |
| 529 | 3300037853 | Ga0436364_0093921 | Ga0436364_0093921_7981_8934 | 292 |
| 530 | 3300037853 | Ga0436364_0786912 | Ga0436364_0786912_1101_2054 | 292 |
| 531 | 3300037853 | Ga0436364_1083867 | Ga0436364_1083867_2902_3855 | 292 |
| 532 | 3300039438 | Ga0436360_0021783 | Ga0436360_0021783_253_1206 | 292 |
| 533 | 3300039438 | Ga0436360_0455054 | Ga0436360_0455054_1003_2013 | 292 |
| 534 | 3300042005 | Ga0439448_0051675 | Ga0439448_0051675_184_1122 | 292 |
| 535 | 3300044693 | Ga0466961_0233543 | Ga0466961_0233543_159_1112 | 292 |
| 536 | 3300044694 | Ga0466963_0038698 | Ga0466963_0038698_172_1125 | 292 |
| 537 | 3300044719 | Ga0466971_0124060 | Ga0466971_0124060_171_1124 | 292 |
| 538 | 3300044765 | Ga0466970_0032333 | Ga0466970_0032333_800_1753 | 292 |
| 539 | 3300046454 | Ga0495592_0045713 | Ga0495592_0045713_1800_2753 | 292 |
| 540 | 3300046477 | Ga0495664_0006872 | Ga0495664_0006872_4495_5448 | 292 |
| 541 | 3300046511 | Ga0495608_0020716 | Ga0495608_0020716_693_1646 | 292 |
| 542 | 3300046511 | Ga0495608_0044749 | Ga0495608_0044749_1431_2384 | 292 |
| 543 | 3300046511 | Ga0495608_0275611 | Ga0495608_0275611_64_1017 | 292 |
| 544 | 3300046514 | Ga0495618_0130471 | Ga0495618_0130471_354_1307 | 292 |
| 545 | 3300046516 | Ga0495628_0254132 | Ga0495628_0254132_294_1247 | 292 |
| 546 | 3300046529 | Ga0495652_0152813 | Ga0495652_0152813_183_1136 | 292 |
| 547 | 3300046533 | Ga0495640_0056386 | Ga0495640_0056386_1317_2270 | 292 |
| 548 | 3300046536 | Ga0495587_0010018 | Ga0495587_0010018_368_1321 | 292 |
| 549 | 3300046543 | Ga0495645_0001100 | Ga0495645_0001100_7617_8570 | 292 |
| 550 | 3300046559 | Ga0495667_0005370 | Ga0495667_0005370_1391_2344 | 292 |
| 551 | 3300046559 | Ga0495667_0030351 | Ga0495667_0030351_593_1546 | 292 |
| 552 | 3300046663 | Ga0495635_0033733 | Ga0495635_0033733_2121_3074 | 292 |
| 553 | 3300046679 | Ga0495623_0100795 | Ga0495623_0100795_347_1300 | 292 |
| 554 | 3300046680 | Ga0495646_0136431 | Ga0495646_0136431_83_1036 | 292 |
| 555 | 3300046680 | Ga0495646_0150015 | Ga0495646_0150015_332_1285 | 292 |
| 556 | 3300046809 | Ga0495600_0219902 | Ga0495600_0219902_196_1149 | 292 |
| 557 | 3300047319 | Ga0495674_0186190 | Ga0495674_0186190_22_975 | 292 |
| 558 | 3300047322 | Ga0495680_0203865 | Ga0495680_0203865_64_1017 | 292 |
| 559 | 3300047322 | Ga0495680_0224846 | Ga0495680_0224846_291_1244 | 292 |
| 560 | 3300047322 | Ga0495680_0338032 | Ga0495680_0338032_13_966 | 292 |
| 561 | 3300047444 | Ga0495675_0031919 | Ga0495675_0031919_2043_2996 | 292 |
| 562 | 3300047444 | Ga0495675_0081429 | Ga0495675_0081429_496_1449 | 292 |
| 563 | 3300047471 | Ga0495684_0045475 | Ga0495684_0045475_1985_2938 | 292 |
| 564 | 3300048088 | Ga0495602_0000195 | Ga0495602_0000195_39396_40349 | 292 |
| 565 | 3300048922 | Ga0496119_0003055 | Ga0496119_0003055_15979_16932 | 292 |
| 566 | 3300048924 | Ga0496121_0210719 | Ga0496121_0210719_366_1319 | 292 |
| 567 | 3300053077 | Ga0495601_0046037 | Ga0495601_0046037_1778_2731 | 292 |
| 568 | 3300053077 | Ga0495601_0098392 | Ga0495601_0098392_180_1133 | 292 |
| 569 | 3300053078 | Ga0495612_0003726 | Ga0495612_0003726_1838_2791 | 292 |
| 570 | 3300053084 | Ga0495595_0001056 | Ga0495595_0001056_8946_9899 | 292 |
| 571 | 3300053084 | Ga0495595_0017836 | Ga0495595_0017836_838_1791 | 292 |
| 572 | 3300053085 | Ga0495619_0115459 | Ga0495619_0115459_530_1483 | 292 |
| 573 | 3300054114 | Ga0501084_0352786 | Ga0501084_0352786_270_1223 | 292 |
| 574 | 3300005327 | Ga0070658_10000726 | Ga0070658_1000072631 | 293 |
| 575 | 3300005329 | Ga0070683_100072950 | Ga0070683_1000729503 | 293 |
| 576 | 3300005329 | Ga0070683_100220782 | Ga0070683_1002207822 | 293 |
| 577 | 3300005335 | Ga0070666_10106644 | Ga0070666_101066442 | 293 |
| 578 | 3300005336 | Ga0070680_100043236 | Ga0070680_1000432363 | 293 |
| 579 | 3300005343 | Ga0070687_100007727 | Ga0070687_1000077274 | 293 |
| 580 | 3300005354 | Ga0070675_100028479 | Ga0070675_1000284792 | 293 |
| 581 | 3300005355 | Ga0070671_100044503 | Ga0070671_1000445033 | 293 |
| 582 | 3300005364 | Ga0070673_100038754 | Ga0070673_1000387542 | 293 |
| 583 | 3300005366 | Ga0070659_100067507 | Ga0070659_1000675072 | 293 |
| 584 | 3300005434 | Ga0070709_10012963 | Ga0070709_100129634 | 293 |
| 585 | 3300005434 | Ga0070709_10088459 | Ga0070709_100884592 | 293 |
| 586 | 3300005434 | Ga0070709_10114686 | Ga0070709_101146862 | 293 |
| 587 | 3300005435 | Ga0070714_100025088 | Ga0070714_1000250882 | 293 |
| 588 | 3300005435 | Ga0070714_100117982 | Ga0070714_1001179822 | 293 |
| 589 | 3300005436 | Ga0070713_100008642 | Ga0070713_1000086424 | 293 |
| 590 | 3300005436 | Ga0070713_100149652 | Ga0070713_1001496522 | 293 |
| 591 | 3300005436 | Ga0070713_100165594 | Ga0070713_1001655941 | 293 |
| 592 | 3300005437 | Ga0070710_10016620 | Ga0070710_100166203 | 293 |
| 593 | 3300005437 | Ga0070710_10063603 | Ga0070710_100636032 | 293 |
| 594 | 3300005437 | Ga0070710_10085268 | Ga0070710_100852681 | 293 |
| 595 | 3300005438 | Ga0070701_10085083 | Ga0070701_100850832 | 293 |
| 596 | 3300005439 | Ga0070711_100027416 | Ga0070711_1000274163 | 293 |
| 597 | 3300005439 | Ga0070711_100056913 | Ga0070711_1000569131 | 293 |
| 598 | 3300005445 | Ga0070708_100198649 | Ga0070708_1001986492 | 293 |
| 599 | 3300005445 | Ga0070708_100238464 | Ga0070708_1002384641 | 293 |
| 600 | 3300005458 | Ga0070681_10101000 | Ga0070681_101010003 | 293 |
| 601 | 3300005458 | Ga0070681_10390902 | Ga0070681_103909022 | 293 |
| 602 | 3300005458 | Ga0070681_10393953 | Ga0070681_103939531 | 293 |
| 603 | 3300005458 | Ga0070681_10537162 | Ga0070681_105371621 | 293 |
| 604 | 3300005466 | Ga0070685_10060058 | Ga0070685_100600582 | 293 |
| 605 | 3300005467 | Ga0070706_100000990 | Ga0070706_10000099014 | 293 |
| 606 | 3300005467 | Ga0070706_100008020 | Ga0070706_1000080207 | 293 |
| 607 | 3300005467 | Ga0070706_100057020 | Ga0070706_1000570202 | 293 |
| 608 | 3300005467 | Ga0070706_100083098 | Ga0070706_1000830981 | 293 |
| 609 | 3300005467 | Ga0070706_100096173 | Ga0070706_1000961733 | 293 |
| 610 | 3300005468 | Ga0070707_100000256 | Ga0070707_10000025632 | 293 |
| 611 | 3300005468 | Ga0070707_100004570 | Ga0070707_10000457010 | 293 |
| 612 | 3300005468 | Ga0070707_100168762 | Ga0070707_1001687622 | 293 |
| 613 | 3300005468 | Ga0070707_100180529 | Ga0070707_1001805292 | 293 |
| 614 | 3300005468 | Ga0070707_100198649 | Ga0070707_1001986491 | 293 |
| 615 | 3300005468 | Ga0070707_100233617 | Ga0070707_1002336171 | 293 |
| 616 | 3300005468 | Ga0070707_100254561 | Ga0070707_1002545612 | 293 |
| 617 | 3300005468 | Ga0070707_100305997 | Ga0070707_1003059971 | 293 |
| 618 | 3300005471 | Ga0070698_100000292 | Ga0070698_10000029220 | 293 |
| 619 | 3300005471 | Ga0070698_100000333 | Ga0070698_10000033327 | 293 |
| 620 | 3300005471 | Ga0070698_100002525 | Ga0070698_10000252513 | 293 |
| 621 | 3300005471 | Ga0070698_100017040 | Ga0070698_1000170402 | 293 |
| 622 | 3300005471 | Ga0070698_100086838 | Ga0070698_1000868383 | 293 |
| 623 | 3300005518 | Ga0070699_100020685 | Ga0070699_1000206851 | 293 |
| 624 | 3300005518 | Ga0070699_100028148 | Ga0070699_1000281482 | 293 |
| 625 | 3300005518 | Ga0070699_100221012 | Ga0070699_1002210121 | 293 |
| 626 | 3300005530 | Ga0070679_100040543 | Ga0070679_1000405434 | 293 |
| 627 | 3300005530 | Ga0070679_100173911 | Ga0070679_1001739111 | 293 |
| 628 | 3300005539 | Ga0068853_100227422 | Ga0068853_1002274221 | 293 |
| 629 | 3300005544 | Ga0070686_100004813 | Ga0070686_1000048133 | 293 |
| 630 | 3300005546 | Ga0070696_100008315 | Ga0070696_1000083153 | 293 |
| 631 | 3300005547 | Ga0070693_100016084 | Ga0070693_1000160842 | 293 |
| 632 | 3300005548 | Ga0070665_100117827 | Ga0070665_1001178272 | 293 |
| 633 | 3300005564 | Ga0070664_100016206 | Ga0070664_1000162062 | 293 |
| 634 | 3300005578 | Ga0068854_100125742 | Ga0068854_1001257422 | 293 |
| 635 | 3300005614 | Ga0068856_100320759 | Ga0068856_1003207591 | 293 |
| 636 | 3300005614 | Ga0068856_100380650 | Ga0068856_1003806502 | 293 |
| 637 | 3300005615 | Ga0070702_100030640 | Ga0070702_1000306402 | 293 |
| 638 | 3300005616 | Ga0068852_100011289 | Ga0068852_1000112897 | 293 |
| 639 | 3300005616 | Ga0068852_100295725 | Ga0068852_1002957252 | 293 |
| 640 | 3300005618 | Ga0068864_100058887 | Ga0068864_1000588872 | 293 |
| 641 | 3300005719 | Ga0068861_100220936 | Ga0068861_1002209362 | 293 |
| 642 | 3300005841 | Ga0068863_100021114 | Ga0068863_1000211145 | 293 |
| 643 | 3300005841 | Ga0068863_100111276 | Ga0068863_1001112763 | 293 |
| 644 | 3300005841 | Ga0068863_100144648 | Ga0068863_1001446482 | 293 |
| 645 | 3300005842 | Ga0068858_100180277 | Ga0068858_1001802771 | 293 |
| 646 | 3300005842 | Ga0068858_100188374 | Ga0068858_1001883742 | 293 |
| 647 | 3300005983 | Ga0081540_1005418 | Ga0081540_10054186 | 293 |
| 648 | 3300005983 | Ga0081540_1020749 | Ga0081540_10207492 | 293 |
| 649 | 3300006028 | Ga0070717_10011881 | Ga0070717_100118817 | 293 |
| 650 | 3300006028 | Ga0070717_10050812 | Ga0070717_100508122 | 293 |
| 651 | 3300006028 | Ga0070717_10076722 | Ga0070717_100767221 | 293 |
| 652 | 3300006028 | Ga0070717_10263592 | Ga0070717_102635922 | 293 |
| 653 | 3300006028 | Ga0070717_10461944 | Ga0070717_104619441 | 293 |
| 654 | 3300006163 | Ga0070715_10057037 | Ga0070715_100570372 | 293 |
| 655 | 3300006173 | Ga0070716_100026533 | Ga0070716_1000265331 | 293 |
| 656 | 3300006175 | Ga0070712_100002052 | Ga0070712_10000205210 | 293 |
| 657 | 3300006175 | Ga0070712_100008902 | Ga0070712_1000089024 | 293 |
| 658 | 3300006175 | Ga0070712_100093705 | Ga0070712_1000937052 | 293 |
| 659 | 3300006237 | Ga0097621_100002544 | Ga0097621_1000025447 | 293 |
| 660 | 3300006358 | Ga0068871_100091961 | Ga0068871_1000919612 | 293 |
| 661 | 3300006358 | Ga0068871_100129495 | Ga0068871_1001294952 | 293 |
| 662 | 3300006844 | Ga0075428_100020125 | Ga0075428_1000201254 | 293 |
| 663 | 3300006846 | Ga0075430_100000294 | Ga0075430_1000002943 | 293 |
| 664 | 3300006846 | Ga0075430_100155213 | Ga0075430_1001552133 | 293 |
| 665 | 3300006871 | Ga0075434_100009917 | Ga0075434_1000099176 | 293 |
| 666 | 3300006871 | Ga0075434_100216438 | Ga0075434_1002164381 | 293 |
| 667 | 3300006880 | Ga0075429_100044119 | Ga0075429_1000441193 | 293 |
| 668 | 3300006914 | Ga0075436_100004879 | Ga0075436_1000048797 | 293 |
| 669 | 3300007076 | Ga0075435_100328524 | Ga0075435_1003285242 | 293 |
| 670 | 3300009094 | Ga0111539_10047409 | Ga0111539_100474093 | 293 |
| 671 | 3300009098 | Ga0105245_10005437 | Ga0105245_100054374 | 293 |
| 672 | 3300009098 | Ga0105245_10056487 | Ga0105245_100564872 | 293 |
| 673 | 3300009147 | Ga0114129_10006711 | Ga0114129_100067113 | 293 |
| 674 | 3300009147 | Ga0114129_10184699 | Ga0114129_101846993 | 293 |
| 675 | 3300009177 | Ga0105248_10152913 | Ga0105248_101529132 | 293 |
| 676 | 3300013104 | Ga0157370_10049599 | Ga0157370_100495992 | 293 |
| 677 | 3300013104 | Ga0157370_10090646 | Ga0157370_100906462 | 293 |
| 678 | 3300013105 | Ga0157369_10011739 | Ga0157369_100117393 | 293 |
| 679 | 3300013296 | Ga0157374_10020729 | Ga0157374_100207294 | 293 |
| 680 | 3300013306 | Ga0163162_10013494 | Ga0163162_100134944 | 293 |
| 681 | 3300013308 | Ga0157375_10193002 | Ga0157375_101930022 | 293 |
| 682 | 3300014325 | Ga0163163_10001600 | Ga0163163_100016004 | 293 |
| 683 | 3300014968 | Ga0157379_10017361 | Ga0157379_100173614 | 293 |
| 684 | 3300014968 | Ga0157379_10150130 | Ga0157379_101501303 | 293 |
| 685 | 3300017792 | Ga0163161_10099487 | Ga0163161_100994873 | 293 |
| 686 | 3300021388 | Ga0213875_10000250 | Ga0213875_100002502 | 293 |
| 687 | 3300021388 | Ga0213875_10033159 | Ga0213875_100331593 | 293 |
| 688 | 3300022467 | Ga0224712_10013796 | Ga0224712_100137962 | 293 |
| 689 | 3300022467 | Ga0224712_10017923 | Ga0224712_100179232 | 293 |
| 690 | 3300024225 | Ga0224572_1000791 | Ga0224572_10007912 | 293 |
| 691 | 3300025885 | Ga0207653_10008398 | Ga0207653_100083983 | 293 |
| 692 | 3300025898 | Ga0207692_10004739 | Ga0207692_100047395 | 293 |
| 693 | 3300025898 | Ga0207692_10025602 | Ga0207692_100256022 | 293 |
| 694 | 3300025898 | Ga0207692_10033061 | Ga0207692_100330613 | 293 |
| 695 | 3300025898 | Ga0207692_10138175 | Ga0207692_101381752 | 293 |
| 696 | 3300025898 | Ga0207692_10244113 | Ga0207692_102441131 | 293 |
| 697 | 3300025903 | Ga0207680_10025579 | Ga0207680_100255792 | 293 |
| 698 | 3300025905 | Ga0207685_10039962 | Ga0207685_100399621 | 293 |
| 699 | 3300025906 | Ga0207699_10074359 | Ga0207699_100743591 | 293 |
| 700 | 3300025906 | Ga0207699_10154582 | Ga0207699_101545821 | 293 |
| 701 | 3300025909 | Ga0207705_10001642 | Ga0207705_100016422 | 293 |
| 702 | 3300025910 | Ga0207684_10002799 | Ga0207684_1000279911 | 293 |
| 703 | 3300025910 | Ga0207684_10015342 | Ga0207684_100153425 | 293 |
| 704 | 3300025910 | Ga0207684_10092354 | Ga0207684_100923544 | 293 |
| 705 | 3300025911 | Ga0207654_10054753 | Ga0207654_100547531 | 293 |
| 706 | 3300025912 | Ga0207707_10035796 | Ga0207707_100357962 | 293 |
| 707 | 3300025913 | Ga0207695_10361244 | Ga0207695_103612442 | 293 |
| 708 | 3300025914 | Ga0207671_10151559 | Ga0207671_101515592 | 293 |
| 709 | 3300025915 | Ga0207693_10005180 | Ga0207693_100051807 | 293 |
| 710 | 3300025915 | Ga0207693_10013430 | Ga0207693_100134304 | 293 |
| 711 | 3300025915 | Ga0207693_10014990 | Ga0207693_100149905 | 293 |
| 712 | 3300025915 | Ga0207693_10138270 | Ga0207693_101382702 | 293 |
| 713 | 3300025916 | Ga0207663_10010431 | Ga0207663_100104312 | 293 |
| 714 | 3300025916 | Ga0207663_10014695 | Ga0207663_100146952 | 293 |
| 715 | 3300025916 | Ga0207663_10039635 | Ga0207663_100396352 | 293 |
| 716 | 3300025916 | Ga0207663_10084495 | Ga0207663_100844951 | 293 |
| 717 | 3300025918 | Ga0207662_10052164 | Ga0207662_100521642 | 293 |
| 718 | 3300025921 | Ga0207652_10403798 | Ga0207652_104037982 | 293 |
| 719 | 3300025922 | Ga0207646_10001124 | Ga0207646_1000112417 | 293 |
| 720 | 3300025922 | Ga0207646_10031779 | Ga0207646_100317794 | 293 |
| 721 | 3300025922 | Ga0207646_10044143 | Ga0207646_100441433 | 293 |
| 722 | 3300025922 | Ga0207646_10184097 | Ga0207646_101840972 | 293 |
| 723 | 3300025922 | Ga0207646_10201908 | Ga0207646_102019082 | 293 |
| 724 | 3300025927 | Ga0207687_10006217 | Ga0207687_100062174 | 293 |
| 725 | 3300025927 | Ga0207687_10074652 | Ga0207687_100746521 | 293 |
| 726 | 3300025928 | Ga0207700_10001672 | Ga0207700_100016728 | 293 |
| 727 | 3300025928 | Ga0207700_10002173 | Ga0207700_100021735 | 293 |
| 728 | 3300025928 | Ga0207700_10020413 | Ga0207700_100204135 | 293 |
| 729 | 3300025928 | Ga0207700_10022331 | Ga0207700_100223315 | 293 |
| 730 | 3300025928 | Ga0207700_10096005 | Ga0207700_100960052 | 293 |
| 731 | 3300025928 | Ga0207700_10301731 | Ga0207700_103017311 | 293 |
| 732 | 3300025929 | Ga0207664_10002584 | Ga0207664_100025842 | 293 |
| 733 | 3300025929 | Ga0207664_10021524 | Ga0207664_100215245 | 293 |
| 734 | 3300025929 | Ga0207664_10052186 | Ga0207664_100521862 | 293 |
| 735 | 3300025929 | Ga0207664_10053493 | Ga0207664_100534932 | 293 |
| 736 | 3300025929 | Ga0207664_10080047 | Ga0207664_100800473 | 293 |
| 737 | 3300025931 | Ga0207644_10044521 | Ga0207644_100445214 | 293 |
| 738 | 3300025934 | Ga0207686_10114479 | Ga0207686_101144792 | 293 |
| 739 | 3300025936 | Ga0207670_10035613 | Ga0207670_100356134 | 293 |
| 740 | 3300025939 | Ga0207665_10001719 | Ga0207665_100017199 | 293 |
| 741 | 3300025939 | Ga0207665_10025411 | Ga0207665_100254113 | 293 |
| 742 | 3300025939 | Ga0207665_10056283 | Ga0207665_100562831 | 293 |
| 743 | 3300025941 | Ga0207711_10178971 | Ga0207711_101789712 | 293 |
| 744 | 3300025942 | Ga0207689_10017179 | Ga0207689_100171793 | 293 |
| 745 | 3300025972 | Ga0207668_10127648 | Ga0207668_101276481 | 293 |
| 746 | 3300025981 | Ga0207640_10046715 | Ga0207640_100467153 | 293 |
| 747 | 3300026035 | Ga0207703_10040754 | Ga0207703_100407542 | 293 |
| 748 | 3300026041 | Ga0207639_10083405 | Ga0207639_100834052 | 293 |
| 749 | 3300026067 | Ga0207678_10006007 | Ga0207678_100060075 | 293 |
| 750 | 3300026075 | Ga0207708_10046904 | Ga0207708_100469043 | 293 |
| 751 | 3300026078 | Ga0207702_10043655 | Ga0207702_100436554 | 293 |
| 752 | 3300026078 | Ga0207702_10056949 | Ga0207702_100569492 | 293 |
| 753 | 3300026078 | Ga0207702_10070243 | Ga0207702_100702433 | 293 |
| 754 | 3300026078 | Ga0207702_10130343 | Ga0207702_101303432 | 293 |
| 755 | 3300026078 | Ga0207702_10386642 | Ga0207702_103866422 | 293 |
| 756 | 3300026095 | Ga0207676_10156658 | Ga0207676_101566582 | 293 |
| 757 | 3300026116 | Ga0207674_10004964 | Ga0207674_1000496411 | 293 |
| 758 | 3300026121 | Ga0207683_10005606 | Ga0207683_1000560611 | 293 |
| 759 | 3300026142 | Ga0207698_10002366 | Ga0207698_100023665 | 293 |
| 760 | 3300027907 | Ga0207428_10068605 | Ga0207428_100686054 | 293 |
| 761 | 3300028379 | Ga0268266_10525110 | Ga0268266_105251101 | 293 |
| 762 | 3300030744 | Ga0316181_1149483 | Ga0316181_11494831 | 293 |
| 763 | 3300031247 | Ga0265340_10013418 | Ga0265340_100134184 | 293 |
| 764 | 3300031456 | Ga0307513_10000001 | Ga0307513_10000001395 | 293 |
| 765 | 3300031691 | Ga0316579_10011444 | Ga0316579_100114443 | 293 |
| 766 | 3300031727 | Ga0316576_10014040 | Ga0316576_100140402 | 293 |
| 767 | 3300031728 | Ga0316578_10020196 | Ga0316578_100201964 | 293 |
| 768 | 3300031730 | Ga0307516_10001792 | Ga0307516_1000179222 | 293 |
| 769 | 3300032133 | Ga0316583_10003287 | Ga0316583_100032874 | 293 |
| 770 | 3300032137 | Ga0316585_10024611 | Ga0316585_100246112 | 293 |
| 771 | 3300034816 | Ga0373930_0011979 | Ga0373930_0011979_138_1124 | 293 |
| 772 | 3300034817 | Ga0373948_0010418 | Ga0373948_0010418_416_1402 | 293 |
| 773 | 3300035084 | Ga0373928_0007014 | Ga0373928_0007014_1058_2014 | 293 |
| 774 | 3300035086 | Ga0373934_0002196 | Ga0373934_0002196_2505_3461 | 293 |
| 775 | 3300035086 | Ga0373934_0006637 | Ga0373934_0006637_46_1002 | 293 |
| 776 | 3300035088 | Ga0373940_0020952 | Ga0373940_0020952_38_994 | 293 |
| 777 | 3300035088 | Ga0373940_0040831 | Ga0373940_0040831_247_1203 | 293 |
| 778 | 3300035089 | Ga0373944_0002438 | Ga0373944_0002438_3634_4590 | 293 |
| 779 | 3300035090 | Ga0373949_0003325 | Ga0373949_0003325_606_1562 | 293 |
| 780 | 3300035090 | Ga0373949_0023621 | Ga0373949_0023621_228_1202 | 293 |
| 781 | 3300035111 | Ga0373923_0011010 | Ga0373923_0011010_1777_2733 | 293 |
| 782 | 3300035112 | Ga0373932_0016751 | Ga0373932_0016751_874_1830 | 293 |
| 783 | 3300035113 | Ga0373936_0001293 | Ga0373936_0001293_6972_7928 | 293 |
| 784 | 3300035113 | Ga0373936_0083543 | Ga0373936_0083543_288_1244 | 293 |
| 785 | 3300035116 | Ga0373945_0044491 | Ga0373945_0044491_482_1438 | 293 |
| 786 | 3300035117 | Ga0373953_0001732 | Ga0373953_0001732_3076_4032 | 293 |
| 787 | 3300035117 | Ga0373953_0010341 | Ga0373953_0010341_940_1896 | 293 |
| 788 | 3300035118 | Ga0373954_0040812 | Ga0373954_0040812_1135_2091 | 293 |
| 789 | 3300035119 | Ga0373956_0020043 | Ga0373956_0020043_361_1317 | 293 |
| 790 | 3300035119 | Ga0373956_0126010 | Ga0373956_0126010_40_996 | 293 |
| 791 | 3300035120 | Ga0373957_0002117 | Ga0373957_0002117_4138_5094 | 293 |
| 792 | 3300035120 | Ga0373957_0033521 | Ga0373957_0033521_63_1019 | 293 |
| 793 | 3300035121 | Ga0373960_0004470 | Ga0373960_0004470_766_1722 | 293 |
| 794 | 3300035170 | Ga0373943_0001340 | Ga0373943_0001340_4859_5815 | 293 |
| 795 | 3300035171 | Ga0373946_0001065 | Ga0373946_0001065_1685_2641 | 293 |
| 796 | 3300035171 | Ga0373946_0017131 | Ga0373946_0017131_171_1127 | 293 |
| 797 | 3300035172 | Ga0373955_0017001 | Ga0373955_0017001_45_1001 | 293 |
| 798 | 3300035172 | Ga0373955_0049962 | Ga0373955_0049962_453_1409 | 293 |
| 799 | 3300035172 | Ga0373955_0058166 | Ga0373955_0058166_942_1898 | 293 |
| 800 | 3300035207 | Ga0373942_0022330 | Ga0373942_0022330_165_1121 | 293 |
| 801 | 3300035398 | Ga0316574_0001450 | Ga0316574_0001450_3723_4691 | 293 |
| 802 | 3300035410 | Ga0373924_0029116 | Ga0373924_0029116_197_1153 | 293 |
| 803 | 3300035410 | Ga0373924_0076608 | Ga0373924_0076608_339_1295 | 293 |
| 804 | 3300035691 | Ga0373931_0027647 | Ga0373931_0027647_998_1984 | 293 |
| 805 | 3300035692 | Ga0373935_0003744 | Ga0373935_0003744_1135_2091 | 293 |
| 806 | 3300035692 | Ga0373935_0053505 | Ga0373935_0053505_235_1191 | 293 |
| 807 | 3300035692 | Ga0373935_0075094 | Ga0373935_0075094_1184_2140 | 293 |
| 808 | 3300035695 | Ga0373927_0003060 | Ga0373927_0003060_6567_7523 | 293 |
| 809 | 3300035724 | Ga0373933_0001577 | Ga0373933_0001577_9089_10045 | 293 |
| 810 | 3300035724 | Ga0373933_0015191 | Ga0373933_0015191_3141_4097 | 293 |
| 811 | 3300035724 | Ga0373933_0019084 | Ga0373933_0019084_2732_3688 | 293 |
| 812 | 3300035724 | Ga0373933_0022077 | Ga0373933_0022077_1230_2186 | 293 |
| 813 | 3300035725 | Ga0373947_0003580 | Ga0373947_0003580_1363_2319 | 293 |
| 814 | 3300036401 | Ga0373937_0003119 | Ga0373937_0003119_3845_4801 | 293 |
| 815 | 3300036401 | Ga0373937_0074903 | Ga0373937_0074903_110_1066 | 293 |
| 816 | 3300036401 | Ga0373937_0232432 | Ga0373937_0232432_168_1124 | 293 |
| 817 | 3300036401 | Ga0373937_0236231 | Ga0373937_0236231_617_1573 | 293 |
| 818 | 3300036401 | Ga0373937_0373198 | Ga0373937_0373198_191_1147 | 293 |
| 819 | 3300036712 | Ga0316584_0018562 | Ga0316584_0018562_1628_2596 | 293 |
| 820 | 3300037068 | Ga0373925_0023473 | Ga0373925_0023473_1739_2695 | 293 |
| 821 | 3300037853 | Ga0436364_0287407 | Ga0436364_0287407_50273_51229 | 293 |
| 822 | 3300037853 | Ga0436364_0639700 | Ga0436364_0639700_201_1157 | 293 |
| 823 | 3300039450 | Ga0436363_0045890 | Ga0436363_0045890_110_1105 | 293 |
| 824 | 3300039450 | Ga0436363_0838504 | Ga0436363_0838504_1969_2925 | 293 |
| 825 | 3300041404 | Ga0439436_0003729 | Ga0439436_0003729_662_1612 | 293 |
| 826 | 3300041999 | Ga0439433_0009335 | Ga0439433_0009335_567_1517 | 293 |
| 827 | 3300042002 | Ga0439442_011772 | Ga0439442_011772_148_1098 | 293 |
| 828 | 3300042007 | Ga0439449_0005338 | Ga0439449_0005338_2156_3106 | 293 |
| 829 | 3300044683 | Ga0466965_0142339 | Ga0466965_0142339_173_1129 | 293 |
| 830 | 3300044694 | Ga0466963_0267352 | Ga0466963_0267352_25_981 | 293 |
| 831 | 3300044706 | Ga0466964_0063476 | Ga0466964_0063476_328_1293 | 293 |
| 832 | 3300044735 | Ga0466968_0000127 | Ga0466968_0000127_16019_16975 | 293 |
| 833 | 3300044765 | Ga0466970_0001582 | Ga0466970_0001582_8737_9693 | 293 |
| 834 | 3300044901 | Ga0466960_0014624 | Ga0466960_0014624_327_1289 | 293 |
| 835 | 3300044901 | Ga0466960_0098437 | Ga0466960_0098437_85_1041 | 293 |
| 836 | 3300045049 | Ga0466959_0285378 | Ga0466959_0285378_69_1025 | 293 |
| 837 | 3300045836 | Ga0466958_0025951 | Ga0466958_0025951_509_1465 | 293 |
| 838 | 3300045976 | Ga0466967_0006236 | Ga0466967_0006236_3225_4190 | 293 |
| 839 | 3300045976 | Ga0466967_0097718 | Ga0466967_0097718_537_1493 | 293 |
| 840 | 3300045976 | Ga0466967_0123286 | Ga0466967_0123286_611_1567 | 293 |
| 841 | 3300045976 | Ga0466967_0141670 | Ga0466967_0141670_1128_2093 | 293 |
| 842 | 3300045976 | Ga0466967_0144241 | Ga0466967_0144241_1178_2143 | 293 |
| 843 | 3300045976 | Ga0466967_0168790 | Ga0466967_0168790_716_1672 | 293 |
| 844 | 3300045976 | Ga0466967_0223140 | Ga0466967_0223140_640_1596 | 293 |
| 845 | 3300046454 | Ga0495592_0021245 | Ga0495592_0021245_3062_4018 | 293 |
| 846 | 3300046454 | Ga0495592_0027905 | Ga0495592_0027905_42_998 | 293 |
| 847 | 3300046454 | Ga0495592_0145629 | Ga0495592_0145629_600_1556 | 293 |
| 848 | 3300046461 | Ga0495641_0026292 | Ga0495641_0026292_1805_2761 | 293 |
| 849 | 3300046462 | Ga0495651_0013797 | Ga0495651_0013797_4804_5760 | 293 |
| 850 | 3300046462 | Ga0495651_0030057 | Ga0495651_0030057_1113_2069 | 293 |
| 851 | 3300046462 | Ga0495651_0126446 | Ga0495651_0126446_352_1308 | 293 |
| 852 | 3300046463 | Ga0495653_0006300 | Ga0495653_0006300_7643_8599 | 293 |
| 853 | 3300046463 | Ga0495653_0010412 | Ga0495653_0010412_5484_6440 | 293 |
| 854 | 3300046463 | Ga0495653_0017351 | Ga0495653_0017351_2549_3505 | 293 |
| 855 | 3300046463 | Ga0495653_0098404 | Ga0495653_0098404_745_1701 | 293 |
| 856 | 3300046463 | Ga0495653_0151850 | Ga0495653_0151850_163_1119 | 293 |
| 857 | 3300046473 | Ga0495582_0080091 | Ga0495582_0080091_80_1036 | 293 |
| 858 | 3300046475 | Ga0495639_0007891 | Ga0495639_0007891_654_1610 | 293 |
| 859 | 3300046476 | Ga0495662_0020889 | Ga0495662_0020889_429_1385 | 293 |
| 860 | 3300046477 | Ga0495664_0017711 | Ga0495664_0017711_1592_2548 | 293 |
| 861 | 3300046477 | Ga0495664_0020928 | Ga0495664_0020928_1926_2882 | 293 |
| 862 | 3300046477 | Ga0495664_0062050 | Ga0495664_0062050_655_1650 | 293 |
| 863 | 3300046511 | Ga0495608_0014063 | Ga0495608_0014063_537_1493 | 293 |
| 864 | 3300046514 | Ga0495618_0052774 | Ga0495618_0052774_782_1738 | 293 |
| 865 | 3300046514 | Ga0495618_0108712 | Ga0495618_0108712_657_1613 | 293 |
| 866 | 3300046516 | Ga0495628_0010312 | Ga0495628_0010312_6923_7879 | 293 |
| 867 | 3300046516 | Ga0495628_0088817 | Ga0495628_0088817_114_1070 | 293 |
| 868 | 3300046517 | Ga0495630_0051465 | Ga0495630_0051465_1058_2014 | 293 |
| 869 | 3300046517 | Ga0495630_0078411 | Ga0495630_0078411_869_1825 | 293 |
| 870 | 3300046517 | Ga0495630_0101646 | Ga0495630_0101646_1124_2080 | 293 |
| 871 | 3300046517 | Ga0495630_0156506 | Ga0495630_0156506_735_1691 | 293 |
| 872 | 3300046526 | Ga0495666_0078256 | Ga0495666_0078256_253_1209 | 293 |
| 873 | 3300046529 | Ga0495652_0019111 | Ga0495652_0019111_1026_1982 | 293 |
| 874 | 3300046529 | Ga0495652_0095275 | Ga0495652_0095275_204_1160 | 293 |
| 875 | 3300046529 | Ga0495652_0103519 | Ga0495652_0103519_143_1099 | 293 |
| 876 | 3300046531 | Ga0495665_0111120 | Ga0495665_0111120_459_1415 | 293 |
| 877 | 3300046533 | Ga0495640_0086003 | Ga0495640_0086003_352_1308 | 293 |
| 878 | 3300046535 | Ga0495586_0022724 | Ga0495586_0022724_1523_2479 | 293 |
| 879 | 3300046536 | Ga0495587_0020164 | Ga0495587_0020164_2222_3178 | 293 |
| 880 | 3300046543 | Ga0495645_0021367 | Ga0495645_0021367_72_1028 | 293 |
| 881 | 3300046543 | Ga0495645_0028709 | Ga0495645_0028709_2883_3839 | 293 |
| 882 | 3300046543 | Ga0495645_0031746 | Ga0495645_0031746_1322_2278 | 293 |
| 883 | 3300046543 | Ga0495645_0055887 | Ga0495645_0055887_975_1931 | 293 |
| 884 | 3300046543 | Ga0495645_0057243 | Ga0495645_0057243_527_1483 | 293 |
| 885 | 3300046543 | Ga0495645_0132004 | Ga0495645_0132004_530_1486 | 293 |
| 886 | 3300046559 | Ga0495667_0003509 | Ga0495667_0003509_8205_9161 | 293 |
| 887 | 3300046559 | Ga0495667_0008650 | Ga0495667_0008650_313_1269 | 293 |
| 888 | 3300046559 | Ga0495667_0008718 | Ga0495667_0008718_4793_5749 | 293 |
| 889 | 3300046642 | Ga0495634_0044036 | Ga0495634_0044036_2026_2982 | 293 |
| 890 | 3300046642 | Ga0495634_0057617 | Ga0495634_0057617_1620_2576 | 293 |
| 891 | 3300046642 | Ga0495634_0107121 | Ga0495634_0107121_466_1422 | 293 |
| 892 | 3300046663 | Ga0495635_0001264 | Ga0495635_0001264_7078_8034 | 293 |
| 893 | 3300046663 | Ga0495635_0003596 | Ga0495635_0003596_2763_3719 | 293 |
| 894 | 3300046663 | Ga0495635_0030207 | Ga0495635_0030207_700_1656 | 293 |
| 895 | 3300046663 | Ga0495635_0038410 | Ga0495635_0038410_1324_2280 | 293 |
| 896 | 3300046675 | Ga0495657_0025333 | Ga0495657_0025333_2747_3703 | 293 |
| 897 | 3300046675 | Ga0495657_0113762 | Ga0495657_0113762_352_1308 | 293 |
| 898 | 3300046678 | Ga0495599_0086416 | Ga0495599_0086416_349_1344 | 293 |
| 899 | 3300046679 | Ga0495623_0023167 | Ga0495623_0023167_2101_3057 | 293 |
| 900 | 3300046679 | Ga0495623_0033514 | Ga0495623_0033514_1357_2313 | 293 |
| 901 | 3300046679 | Ga0495623_0037893 | Ga0495623_0037893_1587_2543 | 293 |
| 902 | 3300046680 | Ga0495646_0017254 | Ga0495646_0017254_243_1199 | 293 |
| 903 | 3300046683 | Ga0495658_0167186 | Ga0495658_0167186_380_1336 | 293 |
| 904 | 3300046689 | Ga0495613_0031895 | Ga0495613_0031895_2697_3653 | 293 |
| 905 | 3300046690 | Ga0495624_0009088 | Ga0495624_0009088_5483_6439 | 293 |
| 906 | 3300046690 | Ga0495624_0128899 | Ga0495624_0128899_144_1100 | 293 |
| 907 | 3300046809 | Ga0495600_0011991 | Ga0495600_0011991_1723_2679 | 293 |
| 908 | 3300046809 | Ga0495600_0052868 | Ga0495600_0052868_34_990 | 293 |
| 909 | 3300046809 | Ga0495600_0134971 | Ga0495600_0134971_253_1209 | 293 |
| 910 | 3300047315 | Ga0495581_0015106 | Ga0495581_0015106_1507_2463 | 293 |
| 911 | 3300047315 | Ga0495581_0086599 | Ga0495581_0086599_777_1733 | 293 |
| 912 | 3300047315 | Ga0495581_0147695 | Ga0495581_0147695_371_1327 | 293 |
| 913 | 3300047317 | Ga0495604_0034218 | Ga0495604_0034218_2416_3372 | 293 |
| 914 | 3300047317 | Ga0495604_0171420 | Ga0495604_0171420_336_1292 | 293 |
| 915 | 3300047317 | Ga0495604_0184356 | Ga0495604_0184356_448_1404 | 293 |
| 916 | 3300047319 | Ga0495674_0002831 | Ga0495674_0002831_8509_9465 | 293 |
| 917 | 3300047319 | Ga0495674_0008396 | Ga0495674_0008396_4759_5715 | 293 |
| 918 | 3300047319 | Ga0495674_0032708 | Ga0495674_0032708_2570_3526 | 293 |
| 919 | 3300047321 | Ga0495676_0261425 | Ga0495676_0261425_14_970 | 293 |
| 920 | 3300047322 | Ga0495680_0011807 | Ga0495680_0011807_6386_7342 | 293 |
| 921 | 3300047322 | Ga0495680_0064853 | Ga0495680_0064853_613_1569 | 293 |
| 922 | 3300047444 | Ga0495675_0045040 | Ga0495675_0045040_941_1897 | 293 |
| 923 | 3300047444 | Ga0495675_0139513 | Ga0495675_0139513_195_1151 | 293 |
| 924 | 3300047471 | Ga0495684_0002351 | Ga0495684_0002351_5654_6610 | 293 |
| 925 | 3300047471 | Ga0495684_0020760 | Ga0495684_0020760_3690_4646 | 293 |
| 926 | 3300047471 | Ga0495684_0051985 | Ga0495684_0051985_1071_2027 | 293 |
| 927 | 3300047471 | Ga0495684_0072458 | Ga0495684_0072458_20_976 | 293 |
| 928 | 3300047471 | Ga0495684_0144903 | Ga0495684_0144903_264_1220 | 293 |
| 929 | 3300048088 | Ga0495602_0129599 | Ga0495602_0129599_854_1810 | 293 |
| 930 | 3300048088 | Ga0495602_0274928 | Ga0495602_0274928_16_972 | 293 |
| 931 | 3300048903 | Ga0496100_0054147 | Ga0496100_0054147_953_1939 | 293 |
| 932 | 3300048904 | Ga0496101_0002786 | Ga0496101_0002786_4816_5772 | 293 |
| 933 | 3300048905 | Ga0496102_0044150 | Ga0496102_0044150_910_1866 | 293 |
| 934 | 3300048905 | Ga0496102_0061553 | Ga0496102_0061553_45_1001 | 293 |
| 935 | 3300048907 | Ga0496104_0000798 | Ga0496104_0000798_17759_18715 | 293 |
| 936 | 3300048908 | Ga0496105_0012818 | Ga0496105_0012818_1690_2676 | 293 |
| 937 | 3300048908 | Ga0496105_0018502 | Ga0496105_0018502_972_1928 | 293 |
| 938 | 3300048908 | Ga0496105_0024086 | Ga0496105_0024086_3672_4628 | 293 |
| 939 | 3300048909 | Ga0496106_0105687 | Ga0496106_0105687_315_1301 | 293 |
| 940 | 3300048909 | Ga0496106_0287040 | Ga0496106_0287040_309_1265 | 293 |
| 941 | 3300048910 | Ga0496107_0146431 | Ga0496107_0146431_737_1723 | 293 |
| 942 | 3300048910 | Ga0496107_0357290 | Ga0496107_0357290_69_1025 | 293 |
| 943 | 3300048911 | Ga0496108_0146718 | Ga0496108_0146718_303_1259 | 293 |
| 944 | 3300048911 | Ga0496108_0300630 | Ga0496108_0300630_380_1336 | 293 |
| 945 | 3300048912 | Ga0496109_0009817 | Ga0496109_0009817_4842_5798 | 293 |
| 946 | 3300048912 | Ga0496109_0208517 | Ga0496109_0208517_204_1190 | 293 |
| 947 | 3300048913 | Ga0496110_0091221 | Ga0496110_0091221_1183_2139 | 293 |
| 948 | 3300048913 | Ga0496110_0177546 | Ga0496110_0177546_898_1884 | 293 |
| 949 | 3300048913 | Ga0496110_0346966 | Ga0496110_0346966_165_1121 | 293 |
| 950 | 3300048914 | Ga0496111_0032415 | Ga0496111_0032415_1100_2086 | 293 |
| 951 | 3300048914 | Ga0496111_0051138 | Ga0496111_0051138_567_1523 | 293 |
| 952 | 3300048915 | Ga0496112_0053238 | Ga0496112_0053238_1643_2599 | 293 |
| 953 | 3300048916 | Ga0496113_0024157 | Ga0496113_0024157_257_1213 | 293 |
| 954 | 3300048916 | Ga0496113_0051817 | Ga0496113_0051817_1727_2683 | 293 |
| 955 | 3300048916 | Ga0496113_0070327 | Ga0496113_0070327_989_1945 | 293 |
| 956 | 3300048917 | Ga0496114_0100327 | Ga0496114_0100327_262_1218 | 293 |
| 957 | 3300048917 | Ga0496114_0139974 | Ga0496114_0139974_593_1579 | 293 |
| 958 | 3300048918 | Ga0496115_0015886 | Ga0496115_0015886_4547_5533 | 293 |
| 959 | 3300048918 | Ga0496115_0035994 | Ga0496115_0035994_2838_3794 | 293 |
| 960 | 3300048918 | Ga0496115_0069974 | Ga0496115_0069974_1430_2386 | 293 |
| 961 | 3300048918 | Ga0496115_0162714 | Ga0496115_0162714_727_1683 | 293 |
| 962 | 3300048929 | Ga0496126_0180939 | Ga0496126_0180939_829_1779 | 293 |
| 963 | 3300049574 | Ga0501038_0001572 | Ga0501038_0001572_11021_11950 | 293 |
| 964 | 3300049578 | Ga0501042_0066361 | Ga0501042_0066361_1525_2481 | 293 |
| 965 | 3300049588 | Ga0501072_0081895 | Ga0501072_0081895_1117_2046 | 293 |
| 966 | 3300049590 | Ga0501074_0001654 | Ga0501074_0001654_4223_5152 | 293 |
| 967 | 3300049592 | Ga0501076_0032057 | Ga0501076_0032057_1388_2317 | 293 |
| 968 | 3300049743 | Ga0501081_0005425 | Ga0501081_0005425_1267_2196 | 293 |
| 969 | 3300049824 | Ga0501045_0003401 | Ga0501045_0003401_8207_9136 | 293 |
| 970 | 3300050507 | nmdc:mga05p37_1958_c1 | nmdc:mga05p37_1958_c1_6555_7511 | 293 |
| 971 | 3300050508 | nmdc:mga09592_112556_c1 | nmdc:mga09592_112556_c1_372_1328 | 293 |
| 972 | 3300050508 | nmdc:mga09592_368255_c1 | nmdc:mga09592_368255_c1_270_1226 | 293 |
| 973 | 3300050509 | nmdc:mga0qj67_314_c1 | nmdc:mga0qj67_314_c1_968_1918 | 293 |
| 974 | 3300050511 | nmdc:mga08y16_30087_c1 | nmdc:mga08y16_30087_c1_2353_3309 | 293 |
| 975 | 3300050512 | nmdc:mga0n895_10127_c1 | nmdc:mga0n895_10127_c1_6842_7798 | 293 |
| 976 | 3300050512 | nmdc:mga0n895_416606_c1 | nmdc:mga0n895_416606_c1_385_1341 | 293 |
| 977 | 3300050513 | nmdc:mga0rr50_234658_c1 | nmdc:mga0rr50_234658_c1_349_1335 | 293 |
| 978 | 3300050513 | nmdc:mga0rr50_59627_c1 | nmdc:mga0rr50_59627_c1_832_1788 | 293 |
| 979 | 3300050514 | nmdc:mga08x19_191754_c1 | nmdc:mga08x19_191754_c1_384_1340 | 293 |
| 980 | 3300050514 | nmdc:mga08x19_33680_c1 | nmdc:mga08x19_33680_c1_351_1307 | 293 |
| 981 | 3300050515 | nmdc:mga0a205_15293_c1 | nmdc:mga0a205_15293_c1_2914_3870 | 293 |
| 982 | 3300050515 | nmdc:mga0a205_99733_c1 | nmdc:mga0a205_99733_c1_10_966 | 293 |
| 983 | 3300053077 | Ga0495601_0070273 | Ga0495601_0070273_1127_2083 | 293 |
| 984 | 3300053077 | Ga0495601_0077975 | Ga0495601_0077975_222_1178 | 293 |
| 985 | 3300053078 | Ga0495612_0004582 | Ga0495612_0004582_4752_5708 | 293 |
| 986 | 3300053078 | Ga0495612_0019187 | Ga0495612_0019187_236_1231 | 293 |
| 987 | 3300053078 | Ga0495612_0039241 | Ga0495612_0039241_933_1889 | 293 |
| 988 | 3300053078 | Ga0495612_0087585 | Ga0495612_0087585_58_1014 | 293 |
| 989 | 3300053084 | Ga0495595_0013842 | Ga0495595_0013842_2181_3137 | 293 |
| 990 | 3300053084 | Ga0495595_0052060 | Ga0495595_0052060_469_1425 | 293 |
| 991 | 3300054114 | Ga0501084_0013673 | Ga0501084_0013673_4922_5851 | 293 |
| 992 | 3300060353 | Ga0501082_0033886 | Ga0501082_0033886_2972_3901 | 293 |
| 993 | 3300009147 | Ga0114129_10166468 | Ga0114129_101664682 | 294 |
| 994 | 3300031691 | Ga0316579_10079237 | Ga0316579_100792371 | 294 |
| 995 | 3300032002 | Ga0307416_100127411 | Ga0307416_1001274112 | 294 |
| 996 | 3300037418 | Ga0395900_0357357 | Ga0395900_0357357_409_1341 | 294 |
| 997 | 3300037466 | Ga0395898_0361040 | Ga0395898_0361040_296_1228 | 294 |
| 998 | 3300038443 | Ga0395901_0338218 | Ga0395901_0338218_95_1027 | 294 |
| 999 | 3300050507 | nmdc:mga05p37_558250_c1 | nmdc:mga05p37_558250_c1_230_1162 | 294 |
| 1000 | 3300003373 | JGI25407J50210_10018873 | JGI25407J50210_100188732 | 295 |
| 1001 | 3300005937 | Ga0081455_10057618 | Ga0081455_100576183 | 295 |
| 1002 | 3300005981 | Ga0081538_10002786 | Ga0081538_1000278618 | 295 |
| 1003 | 3300005981 | Ga0081538_10034098 | Ga0081538_100340983 | 295 |
| 1004 | 3300005981 | Ga0081538_10037427 | Ga0081538_100374275 | 295 |
| 1005 | 3300005985 | Ga0081539_10150970 | Ga0081539_101509702 | 295 |
| 1006 | 3300006058 | Ga0075432_10026310 | Ga0075432_100263103 | 295 |
| 1007 | 3300006844 | Ga0075428_100282093 | Ga0075428_1002820932 | 295 |
| 1008 | 3300006846 | Ga0075430_100001663 | Ga0075430_10000166312 | 295 |
| 1009 | 3300006847 | Ga0075431_100046671 | Ga0075431_1000466713 | 295 |
| 1010 | 3300006852 | Ga0075433_10031211 | Ga0075433_100312114 | 295 |
| 1011 | 3300006880 | Ga0075429_100116528 | Ga0075429_1001165282 | 295 |
| 1012 | 3300007076 | Ga0075435_100232998 | Ga0075435_1002329983 | 295 |
| 1013 | 3300009147 | Ga0114129_10412805 | Ga0114129_104128052 | 295 |
| 1014 | 3300021388 | Ga0213875_10000125 | Ga0213875_1000012575 | 295 |
| 1015 | 3300027907 | Ga0207428_10000537 | Ga0207428_1000053730 | 295 |
| 1016 | 3300031247 | Ga0265340_10008623 | Ga0265340_100086234 | 295 |
| 1017 | 3300032002 | Ga0307416_100010416 | Ga0307416_1000104163 | 295 |
| 1018 | 3300032126 | Ga0307415_100005414 | Ga0307415_1000054146 | 295 |
| 1019 | 3300037312 | Ga0395899_0297566 | Ga0395899_0297566_49_990 | 295 |
| 1020 | 3300037418 | Ga0395900_0025836 | Ga0395900_0025836_701_1642 | 295 |
| 1021 | 3300037466 | Ga0395898_0154853 | Ga0395898_0154853_128_1069 | 295 |
| 1022 | 3300037853 | Ga0436364_0732570 | Ga0436364_0732570_14521_15696 | 295 |
| 1023 | 3300038443 | Ga0395901_0032412 | Ga0395901_0032412_4437_5378 | 295 |
| 1024 | 3300038443 | Ga0395901_0044943 | Ga0395901_0044943_1578_2519 | 295 |
| 1025 | 3300038443 | Ga0395901_0441791 | Ga0395901_0441791_334_1275 | 295 |
| 1026 | 3300050507 | nmdc:mga05p37_21880_c1 | nmdc:mga05p37_21880_c1_5474_6409 | 295 |
| 1027 | 3300050507 | nmdc:mga05p37_61924_c1 | nmdc:mga05p37_61924_c1_2486_3421 | 295 |
| 1028 | 3300050508 | nmdc:mga09592_4052_c1 | nmdc:mga09592_4052_c1_1309_2244 | 295 |
| 1029 | 3300050509 | nmdc:mga0qj67_10319_c1 | nmdc:mga0qj67_10319_c1_836_1771 | 295 |
| 1030 | 3300050510 | nmdc:mga06r32_21997_c1 | nmdc:mga06r32_21997_c1_145_1080 | 295 |
| 1031 | 3300050511 | nmdc:mga08y16_136272_c1 | nmdc:mga08y16_136272_c1_770_1705 | 295 |
| 1032 | 3300050512 | nmdc:mga0n895_75353_c1 | nmdc:mga0n895_75353_c1_649_1584 | 295 |
| 1033 | 3300050513 | nmdc:mga0rr50_223505_c1 | nmdc:mga0rr50_223505_c1_332_1267 | 295 |
| 1034 | 3300050515 | nmdc:mga0a205_101699_c1 | nmdc:mga0a205_101699_c1_554_1489 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1guz-assembly1.cif.gz_C | structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases | 0.9586 | 3 | 288 |
| 1gv1-assembly1.cif.gz_C | structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases | 0.953 | 3 | 288 |
| 1uxi-assembly1.cif.gz_A | large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface | 0.9433 | 1 | 292 |
| 2hjr-assembly1.cif.gz_B | crystal structure of cryptosporidium parvum malate dehydrogenase | 0.9416 | 2 | 292 |
| 4ros-assembly1.cif.gz_A | crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose | 0.939 | 2 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4plhC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9778 | 2 | 142 | 3.40.50.720 |
| 1gv0A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9527 | 3 | 142 | 3.40.50.720 |
| 2d4aB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9451 | 4 | 142 | 3.40.50.720 |
| 4plhC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9425 | 2 | 142 | 3.40.50.720 |
| 6ihdA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9413 | 2 | 134 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838GIN4-F1-model_v4 | Malate dehydrogenase | 0.9907 | 1 | 61 |
GO:0016616
GO:0019752 |
| AF-A0A357JJB3-F1-model_v4 | Malate dehydrogenase | 0.9885 | 3 | 63 |
GO:0016616
GO:0019752 |
| AF-X0T3M2-F1-model_v4 | Lactate/malate dehydrogenase N-terminal domain-containing protein | 0.9829 | 2 | 204 |
GO:0004459
GO:0006089 GO:0006090 |
| AF-A0A7V3PRZ4-F1-model_v4 | Malate dehydrogenase (EC 1.1.1.37) | 0.9762 | 3 | 193 |
GO:0004459
GO:0006089 GO:0006090 GO:0030060 |
| AF-A0A7Y2UZ01-F1-model_v4 | Malate dehydrogenase | 0.9759 | 3 | 115 |
GO:0004459
GO:0006089 GO:0006090 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar