F488674

General Info

Members Datasets Scaffolds Average Seq Length
1034 396 1015 308

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000125|Ga0213875_1000012575
Length 345
Sequence MSQPDTPRRGKVAVIGAGFYGSTTAQRLAEYDIFEEVVLTDIIDGKPEGLALDMNQSRPIEGFETRVTGQTTGRSGDGYEAVAGSGIVVITAGLPRKPGMSRMDLIEVNAKIVRDVVENVVKHAPEAVLIVVSNPLDEMTALAAKVSGFPSSRVMGQAGMLDTARFSYFVAEKLGVPAGSVRTLTLGSHGDTMVPVPSACSVSGRPLGELLPAEEIDKLVTRTRNGGGEIVGLLKTGSAYYAPSAAAARMARAVAADSGDVMPVCAWVDGEYGISGVYLGVEAEIGSAGVRRVVQRDLSDTELAALREAAEAVRAKQASRSCASQGGAGPARRSPGPRPAGRRRA

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
8 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
9 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
10 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
11 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
12 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
13 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
14 2855683550 Micromonospora sp. RP3T Isolate Unclassified
15 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
16 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
17 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
18 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
196 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
211 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
214 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
220 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
253 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
254 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
260 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
261 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
262 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
263 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
264 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
265 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
266 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
267 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
268 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
269 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
275 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
276 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
330 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
331 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
367 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
368 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
369 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
370 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
393 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
394 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
395 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
396 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 1.06
Isolates 1.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 4.26
Rhizosphere 91.49
Stem 0
Stem Tuber 0
Unclassified 4.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10018873 3300003373 Bacteria 1792
2 Ga0070658_10000726 3300005327 Bacteria 28475
3 Ga0070658_10167961 3300005327 Bacteria 1843
4 Ga0070676_10043582 3300005328 Bacteria 2608
5 Ga0070683_100072950 3300005329 Bacteria 3205
6 Ga0070683_100173090 3300005329 Bacteria 2049
7 Ga0070683_100220782 3300005329 Bacteria 1801
8 Ga0068869_100006152 3300005334 Bacteria 7599
9 Ga0068869_100274442 3300005334 Bacteria 1354
10 Ga0070666_10106644 3300005335 Bacteria 1935
11 Ga0070680_100043236 3300005336 Bacteria 3659
12 Ga0070680_100056299 3300005336 Bacteria 3214
13 Ga0070680_100257496 3300005336 Bacteria 1476
14 Ga0068868_100044731 3300005338 Bacteria 3462
15 Ga0070660_100056267 3300005339 Bacteria 3042
16 Ga0070660_100085659 3300005339 Bacteria 2479
17 Ga0070687_100007727 3300005343 Bacteria 4507
18 Ga0070692_10003994 3300005345 Bacteria 6091
19 Ga0070675_100028479 3300005354 Bacteria 4495
20 Ga0070671_100044503 3300005355 Bacteria 3689
21 Ga0070673_100003932 3300005364 Bacteria 9334
22 Ga0070673_100038754 3300005364 Bacteria 3641
23 Ga0070659_100005916 3300005366 Bacteria 8815
24 Ga0070659_100010121 3300005366 Bacteria 6941
25 Ga0070659_100067507 3300005366 Bacteria 2836
26 Ga0070659_100176405 3300005366 Bacteria 1752
27 Ga0070659_100360254 3300005366 Bacteria 1222
28 Ga0070667_100211942 3300005367 Bacteria 1722
29 Ga0070709_10001361 3300005434 Bacteria 13346
30 Ga0070709_10012963 3300005434 Bacteria 4675
31 Ga0070709_10036675 3300005434 Bacteria 2989
32 Ga0070709_10088459 3300005434 Bacteria 2037
33 Ga0070709_10114686 3300005434 Bacteria 1816
34 Ga0070714_100000545 3300005435 Bacteria 27112
35 Ga0070714_100001325 3300005435 Bacteria 17871
36 Ga0070714_100025088 3300005435 Bacteria 4917
37 Ga0070714_100117982 3300005435 Bacteria 2357
38 Ga0070713_100000483 3300005436 Bacteria 25351
39 Ga0070713_100003097 3300005436 Bacteria 10939
40 Ga0070713_100008642 3300005436 Bacteria 7238
41 Ga0070713_100012555 3300005436 Bacteria 6218
42 Ga0070713_100021482 3300005436 Bacteria 4968
43 Ga0070713_100149652 3300005436 Bacteria 2075
44 Ga0070713_100165594 3300005436 Bacteria 1976
45 Ga0070710_10000539 3300005437 Bacteria 17930
46 Ga0070710_10000864 3300005437 Bacteria 14525
47 Ga0070710_10016620 3300005437 Bacteria 3748
48 Ga0070710_10063603 3300005437 Bacteria 2108
49 Ga0070710_10085268 3300005437 Bacteria 1852
50 Ga0070701_10085083 3300005438 Bacteria 1721
51 Ga0070711_100027416 3300005439 Bacteria 3739
52 Ga0070711_100056913 3300005439 Bacteria 2705
53 Ga0070711_100127218 3300005439 Bacteria 1893
54 Ga0070708_100001278 3300005445 Bacteria 19366
55 Ga0070708_100015039 3300005445 Bacteria 6383
56 Ga0070708_100198649 3300005445 Bacteria 1877
57 Ga0070708_100238464 3300005445 Bacteria 1707
58 Ga0070663_100026128 3300005455 Bacteria 3950
59 Ga0070663_100349091 3300005455 Bacteria 1197
60 Ga0070681_10087816 3300005458 Bacteria 3062
61 Ga0070681_10101000 3300005458 Bacteria 2830
62 Ga0070681_10174259 3300005458 Bacteria 2073
63 Ga0070681_10383872 3300005458 Bacteria 1315
64 Ga0070681_10390902 3300005458 Bacteria 1302
65 Ga0070681_10393953 3300005458 Bacteria 1296
66 Ga0070681_10537162 3300005458 Bacteria 1083
67 Ga0070685_10060058 3300005466 Bacteria 2222
68 Ga0070706_100000990 3300005467 Bacteria 30930
69 Ga0070706_100001894 3300005467 Bacteria 21601
70 Ga0070706_100004349 3300005467 Bacteria 13686
71 Ga0070706_100008020 3300005467 Bacteria 9852
72 Ga0070706_100024464 3300005467 Bacteria 5560
73 Ga0070706_100053956 3300005467 Bacteria 3711
74 Ga0070706_100057020 3300005467 Bacteria 3604
75 Ga0070706_100083098 3300005467 Bacteria 2966
76 Ga0070706_100096173 3300005467 Bacteria 2749
77 Ga0070707_100000256 3300005468 Bacteria 53538
78 Ga0070707_100004570 3300005468 Bacteria 12957
79 Ga0070707_100007016 3300005468 Bacteria 10448
80 Ga0070707_100026268 3300005468 Bacteria 5528
81 Ga0070707_100029674 3300005468 Bacteria 5205
82 Ga0070707_100168762 3300005468 Bacteria 2133
83 Ga0070707_100172512 3300005468 Bacteria 2107
84 Ga0070707_100180529 3300005468 Bacteria 2057
85 Ga0070707_100198649 3300005468 Bacteria 1954
86 Ga0070707_100233617 3300005468 Bacteria 1789
87 Ga0070707_100254561 3300005468 Bacteria 1709
88 Ga0070707_100305997 3300005468 Bacteria 1545
89 Ga0070698_100000292 3300005471 Bacteria 50989
90 Ga0070698_100000333 3300005471 Bacteria 48484
91 Ga0070698_100000898 3300005471 Bacteria 32677
92 Ga0070698_100002525 3300005471 Bacteria 20157
93 Ga0070698_100013017 3300005471 Bacteria 8806
94 Ga0070698_100017040 3300005471 Bacteria 7660
95 Ga0070698_100017971 3300005471 Bacteria 7447
96 Ga0070698_100051847 3300005471 Bacteria 4177
97 Ga0070698_100070857 3300005471 Bacteria 3497
98 Ga0070698_100086838 3300005471 Bacteria 3114
99 Ga0070698_100131717 3300005471 Bacteria 2455
100 Ga0070698_100228475 3300005471 Bacteria 1794
101 Ga0070699_100020685 3300005518 Bacteria 5677
102 Ga0070699_100028148 3300005518 Bacteria 4846
103 Ga0070699_100221012 3300005518 Bacteria 1688
104 Ga0070679_100034617 3300005530 Bacteria 5006
105 Ga0070679_100040543 3300005530 Bacteria 4632
106 Ga0070679_100053534 3300005530 Bacteria 4017
107 Ga0070679_100085114 3300005530 Bacteria 3149
108 Ga0070679_100173911 3300005530 Bacteria 2126
109 Ga0070679_100207892 3300005530 Bacteria 1922
110 Ga0070697_100108411 3300005536 Bacteria 2312
111 Ga0070697_100140261 3300005536 Bacteria 2032
112 Ga0068853_100227422 3300005539 Bacteria 1705
113 Ga0068853_100331322 3300005539 Bacteria 1413
114 Ga0070686_100004813 3300005544 Bacteria 7452
115 Ga0070696_100008315 3300005546 Bacteria 6942
116 Ga0070693_100003713 3300005547 Bacteria 7140
117 Ga0070693_100016084 3300005547 Bacteria 3865
118 Ga0070665_100006607 3300005548 Bacteria 11785
119 Ga0070665_100117827 3300005548 Bacteria 2658
120 Ga0070665_100147095 3300005548 Bacteria 2359
121 Ga0068855_100449672 3300005563 Bacteria 1406
122 Ga0070664_100016206 3300005564 Bacteria 6108
123 Ga0068854_100125742 3300005578 Bacteria 1952
124 Ga0068856_100115958 3300005614 Bacteria 2679
125 Ga0068856_100320759 3300005614 Bacteria 1566
126 Ga0068856_100380650 3300005614 Bacteria 1430
127 Ga0070702_100000031 3300005615 Bacteria 37489
128 Ga0070702_100030640 3300005615 Bacteria 2934
129 Ga0068852_100011289 3300005616 Bacteria 6719
130 Ga0068852_100295725 3300005616 Bacteria 1566
131 Ga0068859_100066935 3300005617 Bacteria 3627
132 Ga0068859_100443735 3300005617 Bacteria 1394
133 Ga0068864_100058887 3300005618 Bacteria 3321
134 Ga0068861_100014024 3300005719 Bacteria 5620
135 Ga0068861_100220936 3300005719 Bacteria 1601
136 Ga0068861_100264042 3300005719 Bacteria 1475
137 Ga0068851_10035674 3300005834 Bacteria 2487
138 Ga0068870_10000614 3300005840 Bacteria 13559
139 Ga0068863_100021114 3300005841 Bacteria 6220
140 Ga0068863_100111276 3300005841 Bacteria 2608
141 Ga0068863_100144648 3300005841 Bacteria 2273
142 Ga0068858_100180277 3300005842 Bacteria 1994
143 Ga0068858_100188374 3300005842 Bacteria 1949
144 Ga0068860_100043085 3300005843 Bacteria 4307
145 Ga0081455_10057618 3300005937 Bacteria 3292
146 Ga0081455_10156068 3300005937 Bacteria 1754
147 Ga0081538_10002786 3300005981 Bacteria 16746
148 Ga0081538_10008955 3300005981 Bacteria 8411
149 Ga0081538_10026674 3300005981 Bacteria 4031
150 Ga0081538_10034098 3300005981 Bacteria 3373
151 Ga0081538_10037427 3300005981 Bacteria 3148
152 Ga0081540_1000250 3300005983 Bacteria 56639
153 Ga0081540_1000330 3300005983 Bacteria 49099
154 Ga0081540_1005418 3300005983 Bacteria 9524
155 Ga0081540_1020749 3300005983 Bacteria 3938
156 Ga0081540_1032375 3300005983 Bacteria 2856
157 Ga0081539_10004919 3300005985 Bacteria 14234
158 Ga0081539_10018877 3300005985 Bacteria 4752
159 Ga0081539_10150970 3300005985 Bacteria 1118
160 Ga0070717_10001205 3300006028 Bacteria 17518
161 Ga0070717_10002725 3300006028 Bacteria 12478
162 Ga0070717_10011881 3300006028 Bacteria 6626
163 Ga0070717_10050812 3300006028 Bacteria 3409
164 Ga0070717_10076722 3300006028 Bacteria 2797
165 Ga0070717_10134834 3300006028 Bacteria 2125
166 Ga0070717_10263592 3300006028 Bacteria 1525
167 Ga0070717_10461944 3300006028 Bacteria 1145
168 Ga0075432_10026310 3300006058 Bacteria 1998
169 Ga0070715_10052548 3300006163 Bacteria 1758
170 Ga0070715_10057037 3300006163 Bacteria 1701
171 Ga0070716_100001415 3300006173 Bacteria 10653
172 Ga0070716_100026533 3300006173 Bacteria 3103
173 Ga0070716_100045435 3300006173 Bacteria 2466
174 Ga0070712_100002052 3300006175 Bacteria 12329
175 Ga0070712_100008902 3300006175 Bacteria 6323
176 Ga0070712_100014062 3300006175 Bacteria 5131
177 Ga0070712_100093705 3300006175 Bacteria 2205
178 Ga0070712_100398840 3300006175 Bacteria 1136
179 Ga0097621_100002544 3300006237 Bacteria 12495
180 Ga0097621_100037665 3300006237 Bacteria 3877
181 Ga0097621_100111339 3300006237 Bacteria 2314
182 Ga0068871_100047631 3300006358 Bacteria 3458
183 Ga0068871_100091961 3300006358 Bacteria 2529
184 Ga0068871_100129495 3300006358 Bacteria 2139
185 Ga0075428_100020125 3300006844 Bacteria 7389
186 Ga0075428_100062887 3300006844 Bacteria 4063
187 Ga0075428_100282093 3300006844 Bacteria 1787
188 Ga0075430_100000294 3300006846 Bacteria 35128
189 Ga0075430_100001663 3300006846 Bacteria 18174
190 Ga0075430_100006545 3300006846 Bacteria 9825
191 Ga0075430_100155213 3300006846 Bacteria 1906
192 Ga0075431_100046671 3300006847 Bacteria 4467
193 Ga0075431_100063910 3300006847 Bacteria 3799
194 Ga0075431_100272902 3300006847 Bacteria 1713
195 Ga0075433_10031211 3300006852 Bacteria 4553
196 Ga0075433_10049564 3300006852 Bacteria 3653
197 Ga0075433_10143574 3300006852 Bacteria 2122
198 Ga0075434_100009917 3300006871 Bacteria 8910
199 Ga0075434_100018423 3300006871 Bacteria 6746
200 Ga0075434_100044958 3300006871 Bacteria 4380
201 Ga0075434_100216438 3300006871 Bacteria 1936
202 Ga0075429_100002678 3300006880 Bacteria 14987
203 Ga0075429_100044119 3300006880 Bacteria 3878
204 Ga0075429_100116528 3300006880 Bacteria 2335
205 Ga0075436_100004879 3300006914 Bacteria 9217
206 Ga0075436_100074055 3300006914 Bacteria 2357
207 Ga0097620_100066940 3300006931 Bacteria 3627
208 Ga0097620_100443771 3300006931 Bacteria 1394
209 Ga0075435_100064936 3300007076 Bacteria 2966
210 Ga0075435_100232998 3300007076 Bacteria 1565
211 Ga0075435_100328524 3300007076 Bacteria 1309
212 Ga0105240_10251979 3300009093 Bacteria 2041
213 Ga0111539_10032226 3300009094 Bacteria 6366
214 Ga0111539_10047409 3300009094 Bacteria 5135
215 Ga0105245_10005437 3300009098 Bacteria 11189
216 Ga0105245_10056487 3300009098 Bacteria 3529
217 Ga0105247_10053503 3300009101 Bacteria 2490
218 Ga0114129_10006711 3300009147 Bacteria 16343
219 Ga0114129_10009018 3300009147 Bacteria 14220
220 Ga0114129_10047822 3300009147 Bacteria 6010
221 Ga0114129_10166468 3300009147 Bacteria 3008
222 Ga0114129_10184699 3300009147 Bacteria 2835
223 Ga0114129_10412805 3300009147 Bacteria 1777
224 Ga0105243_10365331 3300009148 Bacteria 1330
225 Ga0105241_10379178 3300009174 Bacteria 1235
226 Ga0105248_10152913 3300009177 Bacteria 2603
227 Ga0105248_10294461 3300009177 Bacteria 1827
228 Ga0105237_10033633 3300009545 Bacteria 5195
229 Ga0105238_10129275 3300009551 Bacteria 2504
230 Ga0105238_10290145 3300009551 Bacteria 1618
231 Ga0105249_10073392 3300009553 Bacteria 3166
232 Ga0099796_10050215 3300010159 Bacteria 1445
233 Ga0105239_10036023 3300010375 Bacteria 5432
234 Ga0157313_1001542 3300012503 Bacteria 1259
235 Ga0157371_10059306 3300013102 Bacteria 2713
236 Ga0157371_10137477 3300013102 Bacteria 1740
237 Ga0157370_10049599 3300013104 Bacteria 4017
238 Ga0157370_10057438 3300013104 Bacteria 3700
239 Ga0157370_10090646 3300013104 Bacteria 2870
240 Ga0157369_10011739 3300013105 Bacteria 9946
241 Ga0157369_10264471 3300013105 Bacteria 1793
242 Ga0157374_10020729 3300013296 Bacteria 5836
243 Ga0157374_10259101 3300013296 Bacteria 1713
244 Ga0163162_10013494 3300013306 Bacteria 7975
245 Ga0163162_10127754 3300013306 Bacteria 2649
246 Ga0157375_10193002 3300013308 Bacteria 2192
247 Ga0157375_10448831 3300013308 Bacteria 1455
248 Ga0163163_10001600 3300014325 Bacteria 19033
249 Ga0157379_10017361 3300014968 Bacteria 6340
250 Ga0157379_10146024 3300014968 Bacteria 2133
251 Ga0157379_10150130 3300014968 Bacteria 2102
252 Ga0157376_10103696 3300014969 Bacteria 2491
253 Ga0163161_10099487 3300017792 Bacteria 2163
254 Ga0206349_1541197 3300020075 Bacteria 1324
255 Ga0206351_10996409 3300020077 Bacteria 2111
256 Ga0206354_10500860 3300020081 Bacteria 2269
257 Ga0206354_10593962 3300020081 Bacteria 4033
258 Ga0213873_10019370 3300021358 Bacteria 1578
259 Ga0213875_10000125 3300021388 Bacteria 85515
260 Ga0213875_10000250 3300021388 Bacteria 54123
261 Ga0213875_10016542 3300021388 Bacteria 3574
262 Ga0213875_10033159 3300021388 Bacteria 2438
263 Ga0213871_10050030 3300021441 Bacteria 1143
264 Ga0224712_10003353 3300022467 Bacteria 4150
265 Ga0224712_10012929 3300022467 Bacteria 2644
266 Ga0224712_10013796 3300022467 Bacteria 2584
267 Ga0224712_10017923 3300022467 Bacteria 2357
268 Ga0224712_10021524 3300022467 Bacteria 2208
269 Ga0224712_10021811 3300022467 Bacteria 2198
270 Ga0224712_10127430 3300022467 Bacteria 1108
271 Ga0224572_1000791 3300024225 Bacteria 4180
272 Ga0207656_10020636 3300025321 Bacteria 2621
273 Ga0207653_10008398 3300025885 Bacteria 3216
274 Ga0207692_10001094 3300025898 Bacteria 9936
275 Ga0207692_10001437 3300025898 Bacteria 8917
276 Ga0207692_10004739 3300025898 Bacteria 5402
277 Ga0207692_10025602 3300025898 Bacteria 2758
278 Ga0207692_10033061 3300025898 Bacteria 2491
279 Ga0207692_10138175 3300025898 Bacteria 1383
280 Ga0207692_10244113 3300025898 Bacteria 1074
281 Ga0207710_10028052 3300025900 Bacteria 2442
282 Ga0207688_10017900 3300025901 Bacteria 3856
283 Ga0207688_10106533 3300025901 Bacteria 1624
284 Ga0207680_10025579 3300025903 Bacteria 3258
285 Ga0207685_10022394 3300025905 Bacteria 2135
286 Ga0207685_10039962 3300025905 Bacteria 1745
287 Ga0207699_10001830 3300025906 Bacteria 10004
288 Ga0207699_10006266 3300025906 Bacteria 5746
289 Ga0207699_10011057 3300025906 Bacteria 4547
290 Ga0207699_10074359 3300025906 Bacteria 2087
291 Ga0207699_10154582 3300025906 Bacteria 1521
292 Ga0207643_10000204 3300025908 Bacteria 41257
293 Ga0207705_10001642 3300025909 Bacteria 17743
294 Ga0207684_10001419 3300025910 Bacteria 25953
295 Ga0207684_10002612 3300025910 Bacteria 18016
296 Ga0207684_10002799 3300025910 Bacteria 17340
297 Ga0207684_10015342 3300025910 Bacteria 6595
298 Ga0207684_10092354 3300025910 Bacteria 2579
299 Ga0207684_10186921 3300025910 Bacteria 1786
300 Ga0207654_10054753 3300025911 Bacteria 2306
301 Ga0207707_10035796 3300025912 Bacteria 4341
302 Ga0207707_10098332 3300025912 Bacteria 2558
303 Ga0207707_10109135 3300025912 Bacteria 2419
304 Ga0207695_10287073 3300025913 Bacteria 1538
305 Ga0207695_10361244 3300025913 Bacteria 1339
306 Ga0207671_10071968 3300025914 Bacteria 2579
307 Ga0207671_10151559 3300025914 Bacteria 1791
308 Ga0207693_10001078 3300025915 Bacteria 24478
309 Ga0207693_10005180 3300025915 Bacteria 10914
310 Ga0207693_10008773 3300025915 Bacteria 8262
311 Ga0207693_10013430 3300025915 Bacteria 6604
312 Ga0207693_10014990 3300025915 Bacteria 6223
313 Ga0207693_10085727 3300025915 Bacteria 2467
314 Ga0207693_10138270 3300025915 Bacteria 1915
315 Ga0207663_10010431 3300025916 Bacteria 4947
316 Ga0207663_10014695 3300025916 Bacteria 4296
317 Ga0207663_10039635 3300025916 Bacteria 2856
318 Ga0207663_10074280 3300025916 Bacteria 2203
319 Ga0207663_10084495 3300025916 Bacteria 2088
320 Ga0207660_10038844 3300025917 Bacteria 3325
321 Ga0207660_10254343 3300025917 Bacteria 1387
322 Ga0207662_10011478 3300025918 Bacteria 4917
323 Ga0207662_10052164 3300025918 Bacteria 2434
324 Ga0207657_10044561 3300025919 Bacteria 3899
325 Ga0207657_10089951 3300025919 Bacteria 2562
326 Ga0207657_10105478 3300025919 Bacteria 2333
327 Ga0207657_10165197 3300025919 Bacteria 1796
328 Ga0207649_10018450 3300025920 Bacteria 3969
329 Ga0207652_10124104 3300025921 Bacteria 2299
330 Ga0207652_10159071 3300025921 Bacteria 2024
331 Ga0207652_10219371 3300025921 Bacteria 1713
332 Ga0207652_10403798 3300025921 Bacteria 1233
333 Ga0207646_10000950 3300025922 Bacteria 37311
334 Ga0207646_10001124 3300025922 Bacteria 34128
335 Ga0207646_10031779 3300025922 Bacteria 4778
336 Ga0207646_10044143 3300025922 Bacteria 4001
337 Ga0207646_10072069 3300025922 Bacteria 3086
338 Ga0207646_10102009 3300025922 Bacteria 2572
339 Ga0207646_10184097 3300025922 Bacteria 1886
340 Ga0207646_10201908 3300025922 Bacteria 1796
341 Ga0207650_10002710 3300025925 Bacteria 12237
342 Ga0207659_10004400 3300025926 Bacteria 8514
343 Ga0207687_10006217 3300025927 Bacteria 7905
344 Ga0207687_10074652 3300025927 Bacteria 2431
345 Ga0207687_10075188 3300025927 Bacteria 2424
346 Ga0207700_10001672 3300025928 Bacteria 12587
347 Ga0207700_10002173 3300025928 Bacteria 11233
348 Ga0207700_10005055 3300025928 Bacteria 7845
349 Ga0207700_10020413 3300025928 Bacteria 4499
350 Ga0207700_10021329 3300025928 Bacteria 4421
351 Ga0207700_10022331 3300025928 Bacteria 4340
352 Ga0207700_10034120 3300025928 Bacteria 3649
353 Ga0207700_10057202 3300025928 Bacteria 2939
354 Ga0207700_10096005 3300025928 Bacteria 2352
355 Ga0207700_10301731 3300025928 Bacteria 1383
356 Ga0207664_10000427 3300025929 Bacteria 30029
357 Ga0207664_10000940 3300025929 Bacteria 19579
358 Ga0207664_10002584 3300025929 Bacteria 11979
359 Ga0207664_10007361 3300025929 Bacteria 7629
360 Ga0207664_10020499 3300025929 Bacteria 4901
361 Ga0207664_10021524 3300025929 Bacteria 4797
362 Ga0207664_10043770 3300025929 Bacteria 3504
363 Ga0207664_10052186 3300025929 Bacteria 3233
364 Ga0207664_10053493 3300025929 Bacteria 3196
365 Ga0207664_10080047 3300025929 Bacteria 2654
366 Ga0207664_10191859 3300025929 Bacteria 1759
367 Ga0207664_10304935 3300025929 Bacteria 1402
368 Ga0207644_10007562 3300025931 Bacteria 7084
369 Ga0207644_10044521 3300025931 Bacteria 3153
370 Ga0207690_10000219 3300025932 Bacteria 43461
371 Ga0207690_10030154 3300025932 Bacteria 3456
372 Ga0207690_10333355 3300025932 Bacteria 1196
373 Ga0207686_10114479 3300025934 Bacteria 1825
374 Ga0207670_10035613 3300025936 Bacteria 3229
375 Ga0207665_10001719 3300025939 Bacteria 14712
376 Ga0207665_10002491 3300025939 Bacteria 12398
377 Ga0207665_10017416 3300025939 Bacteria 4721
378 Ga0207665_10025411 3300025939 Bacteria 3908
379 Ga0207665_10056283 3300025939 Bacteria 2654
380 Ga0207665_10134613 3300025939 Bacteria 1757
381 Ga0207665_10141555 3300025939 Bacteria 1716
382 Ga0207691_10029944 3300025940 Bacteria 5090
383 Ga0207711_10178971 3300025941 Bacteria 1927
384 Ga0207689_10000223 3300025942 Bacteria 50338
385 Ga0207689_10017179 3300025942 Bacteria 6124
386 Ga0207661_10130930 3300025944 Bacteria 2148
387 Ga0207661_10510587 3300025944 Bacteria 1099
388 Ga0207679_10006307 3300025945 Bacteria 7488
389 Ga0207712_10023350 3300025961 Bacteria 4080
390 Ga0207712_10098587 3300025961 Bacteria 2168
391 Ga0207668_10127648 3300025972 Bacteria 1937
392 Ga0207640_10046715 3300025981 Bacteria 2788
393 Ga0207640_10270453 3300025981 Bacteria 1329
394 Ga0207677_10018630 3300026023 Bacteria 4170
395 Ga0207703_10040754 3300026035 Bacteria 3718
396 Ga0207639_10083405 3300026041 Bacteria 2537
397 Ga0207639_10328799 3300026041 Bacteria 1359
398 Ga0207678_10002516 3300026067 Bacteria 16688
399 Ga0207678_10006007 3300026067 Bacteria 10803
400 Ga0207708_10046904 3300026075 Bacteria 3290
401 Ga0207702_10043655 3300026078 Bacteria 3765
402 Ga0207702_10056949 3300026078 Bacteria 3320
403 Ga0207702_10070243 3300026078 Bacteria 3012
404 Ga0207702_10130343 3300026078 Bacteria 2262
405 Ga0207702_10370778 3300026078 Bacteria 1374
406 Ga0207702_10386642 3300026078 Bacteria 1346
407 Ga0207641_10009542 3300026088 Bacteria 7995
408 Ga0207676_10001541 3300026095 Bacteria 17016
409 Ga0207676_10156658 3300026095 Bacteria 1968
410 Ga0207674_10004964 3300026116 Bacteria 15897
411 Ga0207674_10123468 3300026116 Bacteria 2555
412 Ga0207675_100002250 3300026118 Bacteria 19196
413 Ga0207675_100037515 3300026118 Bacteria 4520
414 Ga0207675_100265546 3300026118 Bacteria 1664
415 Ga0207683_10000804 3300026121 Bacteria 28698
416 Ga0207683_10005606 3300026121 Bacteria 10764
417 Ga0207683_10024244 3300026121 Bacteria 5222
418 Ga0207698_10002366 3300026142 Bacteria 11182
419 Ga0207698_10317204 3300026142 Bacteria 1458
420 Ga0207428_10000537 3300027907 Bacteria 45252
421 Ga0207428_10009923 3300027907 Bacteria 8528
422 Ga0207428_10068605 3300027907 Bacteria 2789
423 Ga0268266_10023015 3300028379 Bacteria 5303
424 Ga0268266_10525110 3300028379 Bacteria 1132
425 Ga0265336_10004601 3300028666 Bacteria 5184
426 Ga0307517_10074469 3300028786 Bacteria 2994
427 Ga0307515_10001066 3300028794 Bacteria 62806
428 Ga0307515_10009042 3300028794 Bacteria 19333
429 Ga0307515_10170578 3300028794 Bacteria 2171
430 Ga0265338_10002247 3300028800 Bacteria 29390
431 Ga0265338_10014640 3300028800 Bacteria 8701
432 Ga0265338_10031380 3300028800 Bacteria 5211
433 Ga0307512_10003683 3300030522 Bacteria 17448
434 Ga0307512_10025517 3300030522 Bacteria 5234
435 Ga0316181_1149483 3300030744 Bacteria 2422
436 Ga0265330_10081434 3300031235 Bacteria 1395
437 Ga0265320_10022258 3300031240 Bacteria 3393
438 Ga0265325_10027015 3300031241 Bacteria 3105
439 Ga0265340_10008623 3300031247 Bacteria 5496
440 Ga0265340_10013418 3300031247 Bacteria 4302
441 Ga0265340_10034361 3300031247 Bacteria 2522
442 Ga0265316_10042524 3300031344 Bacteria 3631
443 Ga0307513_10000001 3300031456 Bacteria 1660464
444 Ga0307513_10036904 3300031456 Bacteria 5443
445 Ga0307509_10178452 3300031507 Bacteria 1993
446 Ga0307408_100018031 3300031548 Bacteria 4735
447 Ga0307408_100030377 3300031548 Bacteria 3752
448 Ga0307408_100206281 3300031548 Bacteria 1594
449 Ga0265313_10046513 3300031595 Bacteria 2106
450 Ga0307508_10033247 3300031616 Bacteria 4654
451 Ga0307508_10306467 3300031616 Bacteria 1181
452 Ga0316579_10011444 3300031691 Bacteria 3770
453 Ga0316579_10079237 3300031691 Bacteria 1563
454 Ga0265314_10022618 3300031711 Bacteria 4814
455 Ga0265314_10136154 3300031711 Bacteria 1525
456 Ga0265342_10094939 3300031712 Bacteria 1705
457 Ga0316576_10014040 3300031727 Bacteria 5341
458 Ga0316578_10020196 3300031728 Bacteria 3677
459 Ga0307516_10001792 3300031730 Bacteria 29478
460 Ga0307405_10016418 3300031731 Bacteria 4037
461 Ga0307405_10034777 3300031731 Bacteria 3002
462 Ga0307405_10071517 3300031731 Bacteria 2232
463 Ga0307413_10002297 3300031824 Bacteria 7739
464 Ga0307413_10028958 3300031824 Bacteria 3092
465 Ga0307413_10126857 3300031824 Bacteria 1739
466 Ga0307413_10174920 3300031824 Bacteria 1524
467 Ga0307410_10008218 3300031852 Bacteria 5775
468 Ga0307410_10012065 3300031852 Bacteria 4974
469 Ga0307410_10017362 3300031852 Bacteria 4320
470 Ga0307410_10151531 3300031852 Bacteria 1727
471 Ga0326468_10000905 3300031889 Bacteria 2896
472 Ga0307406_10005635 3300031901 Bacteria 6845
473 Ga0307406_10080903 3300031901 Bacteria 2158
474 Ga0307406_10140744 3300031901 Bacteria 1707
475 Ga0307407_10010091 3300031903 Bacteria 4436
476 Ga0307412_10037573 3300031911 Bacteria 3113
477 Ga0307412_10176155 3300031911 Bacteria 1604
478 Ga0307409_100042353 3300031995 Bacteria 3409
479 Ga0307409_100062244 3300031995 Bacteria 2920
480 Ga0307409_100074136 3300031995 Bacteria 2718
481 Ga0307409_100224732 3300031995 Bacteria 1697
482 Ga0307416_100005911 3300032002 Bacteria 7596
483 Ga0307416_100010416 3300032002 Bacteria 6138
484 Ga0307416_100014187 3300032002 Bacteria 5446
485 Ga0307416_100021209 3300032002 Bacteria 4658
486 Ga0307416_100022814 3300032002 Bacteria 4527
487 Ga0307416_100026645 3300032002 Bacteria 4263
488 Ga0307416_100051710 3300032002 Bacteria 3284
489 Ga0307416_100127411 3300032002 Bacteria 2283
490 Ga0307416_100190815 3300032002 Bacteria 1932
491 Ga0307414_10295094 3300032004 Bacteria 1368
492 Ga0307411_10003583 3300032005 Bacteria 7239
493 Ga0307411_10013764 3300032005 Bacteria 4478
494 Ga0307411_10067943 3300032005 Bacteria 2401
495 Ga0307415_100001464 3300032126 Bacteria 11306
496 Ga0307415_100005414 3300032126 Bacteria 6777
497 Ga0307415_100005543 3300032126 Bacteria 6715
498 Ga0307415_100048312 3300032126 Bacteria 2871
499 Ga0307415_100059169 3300032126 Bacteria 2641
500 Ga0307415_100115846 3300032126 Bacteria 1998
501 Ga0307415_100165772 3300032126 Bacteria 1717
502 Ga0307415_100231174 3300032126 Bacteria 1489
503 Ga0316583_10003287 3300032133 Bacteria 5682
504 Ga0316585_10024611 3300032137 Bacteria 1863
505 Ga0307510_10178321 3300033180 Bacteria 1692
506 Ga0373930_0011979 3300034816 Bacteria 1574
507 Ga0373948_0010418 3300034817 Bacteria 1623
508 Ga0373926_0009034 3300035083 Bacteria 3323
509 Ga0373926_0107581 3300035083 Bacteria 1046
510 Ga0373928_0007014 3300035084 Bacteria 2172
511 Ga0373934_0000070 3300035086 Bacteria 35142
512 Ga0373934_0002196 3300035086 Bacteria 7172
513 Ga0373934_0006637 3300035086 Bacteria 4297
514 Ga0373940_0020952 3300035088 Bacteria 1666
515 Ga0373940_0040831 3300035088 Bacteria 1274
516 Ga0373944_0002438 3300035089 Bacteria 4722
517 Ga0373949_0003325 3300035090 Bacteria 3861
518 Ga0373949_0023621 3300035090 Bacteria 1425
519 Ga0373923_0011010 3300035111 Bacteria 3307
520 Ga0373923_0056349 3300035111 Bacteria 1659
521 Ga0373923_0066202 3300035111 Bacteria 1544
522 Ga0373932_0016751 3300035112 Bacteria 1874
523 Ga0373936_0001293 3300035113 Bacteria 9062
524 Ga0373936_0004164 3300035113 Bacteria 5452
525 Ga0373936_0083543 3300035113 Bacteria 1331
526 Ga0373939_0060424 3300035114 Bacteria 1204
527 Ga0373945_0044491 3300035116 Bacteria 1614
528 Ga0373953_0000185 3300035117 Bacteria 16552
529 Ga0373953_0001732 3300035117 Bacteria 6429
530 Ga0373953_0010341 3300035117 Bacteria 3243
531 Ga0373953_0045019 3300035117 Bacteria 1766
532 Ga0373953_0068325 3300035117 Bacteria 1462
533 Ga0373954_0002192 3300035118 Bacteria 8115
534 Ga0373954_0040812 3300035118 Bacteria 2162
535 Ga0373954_0040873 3300035118 Bacteria 2161
536 Ga0373954_0061833 3300035118 Bacteria 1768
537 Ga0373956_0000007 3300035119 Bacteria 63448
538 Ga0373956_0020043 3300035119 Bacteria 2840
539 Ga0373956_0090125 3300035119 Bacteria 1414
540 Ga0373956_0126010 3300035119 Bacteria 1197
541 Ga0373957_0000024 3300035120 Bacteria 39141
542 Ga0373957_0002117 3300035120 Bacteria 5582
543 Ga0373957_0033521 3300035120 Bacteria 1897
544 Ga0373960_0004470 3300035121 Bacteria 3206
545 Ga0373943_0001340 3300035170 Bacteria 11093
546 Ga0373943_0001795 3300035170 Bacteria 9697
547 Ga0373946_0001065 3300035171 Bacteria 9448
548 Ga0373946_0017131 3300035171 Bacteria 2768
549 Ga0373955_0000368 3300035172 Bacteria 19027
550 Ga0373955_0017001 3300035172 Bacteria 3589
551 Ga0373955_0049962 3300035172 Bacteria 2272
552 Ga0373955_0058166 3300035172 Bacteria 2126
553 Ga0373955_0322137 3300035172 Bacteria 934
554 Ga0373942_0022330 3300035207 Bacteria 1604
555 Ga0316574_0001450 3300035398 Bacteria 11268
556 Ga0316574_0003741 3300035398 Bacteria 7883
557 Ga0316574_0150904 3300035398 Bacteria 1497
558 Ga0373924_0000372 3300035410 Bacteria 13775
559 Ga0373924_0011689 3300035410 Bacteria 3265
560 Ga0373924_0018862 3300035410 Bacteria 2665
561 Ga0373924_0029116 3300035410 Bacteria 2206
562 Ga0373924_0076608 3300035410 Bacteria 1417
563 Ga0373931_0027647 3300035691 Bacteria 2897
564 Ga0373935_0003744 3300035692 Bacteria 8878
565 Ga0373935_0005495 3300035692 Bacteria 7466
566 Ga0373935_0053505 3300035692 Bacteria 2568
567 Ga0373935_0073581 3300035692 Bacteria 2208
568 Ga0373935_0075094 3300035692 Bacteria 2186
569 Ga0373935_0332305 3300035692 Bacteria 1080
570 Ga0373927_0003060 3300035695 Bacteria 12127
571 Ga0373927_0070955 3300035695 Bacteria 2254
572 Ga0373933_0000002 3300035724 Bacteria 151785
573 Ga0373933_0001577 3300035724 Bacteria 13343
574 Ga0373933_0015191 3300035724 Bacteria 4291
575 Ga0373933_0019084 3300035724 Bacteria 3866
576 Ga0373933_0022077 3300035724 Bacteria 3622
577 Ga0373933_0037724 3300035724 Bacteria 2836
578 Ga0373933_0071489 3300035724 Bacteria 2112
579 Ga0373933_0142720 3300035724 Bacteria 1513
580 Ga0373947_0000007 3300035725 Bacteria 192259
581 Ga0373947_0003580 3300035725 Bacteria 9160
582 Ga0373937_0000014 3300036401 Bacteria 151785
583 Ga0373937_0000312 3300036401 Bacteria 45975
584 Ga0373937_0003119 3300036401 Bacteria 13861
585 Ga0373937_0007378 3300036401 Bacteria 9513
586 Ga0373937_0046082 3300036401 Bacteria 3986
587 Ga0373937_0074903 3300036401 Bacteria 3124
588 Ga0373937_0106572 3300036401 Bacteria 2605
589 Ga0373937_0117122 3300036401 Bacteria 2481
590 Ga0373937_0232432 3300036401 Bacteria 1736
591 Ga0373937_0236231 3300036401 Bacteria 1721
592 Ga0373937_0238112 3300036401 Bacteria 1714
593 Ga0373937_0373198 3300036401 Bacteria 1352
594 Ga0316582_0057528 3300036647 Bacteria 2484
595 Ga0316584_0018562 3300036712 Bacteria 5019
596 Ga0373925_0023473 3300037068 Bacteria 4500
597 Ga0373925_0062211 3300037068 Bacteria 2807
598 Ga0373925_0127897 3300037068 Bacteria 1978
599 Ga0373925_0221542 3300037068 Bacteria 1510
600 Ga0395899_0297566 3300037312 Bacteria 1093
601 Ga0395900_0025836 3300037418 Bacteria 6012
602 Ga0395900_0256887 3300037418 Bacteria 1746
603 Ga0395900_0357357 3300037418 Bacteria 1433
604 Ga0395898_0090208 3300037466 Bacteria 2950
605 Ga0395898_0154853 3300037466 Bacteria 2192
606 Ga0395898_0161474 3300037466 Bacteria 2143
607 Ga0395898_0361040 3300037466 Bacteria 1385
608 Ga0395905_0028781 3300037471 Bacteria 5235
609 Ga0395905_0149731 3300037471 Bacteria 2196
610 Ga0436364_0093921 3300037853 Bacteria 15238
611 Ga0436364_0118843 3300037853 Bacteria 1215
612 Ga0436364_0287407 3300037853 Bacteria 132611
613 Ga0436364_0639700 3300037853 Bacteria 1225
614 Ga0436364_0732570 3300037853 Bacteria 62691
615 Ga0436364_0786912 3300037853 Bacteria 2866
616 Ga0436364_0886432 3300037853 Bacteria 2692
617 Ga0436364_0935193 3300037853 Bacteria 1531
618 Ga0436364_1083867 3300037853 Bacteria 4252
619 Ga0436364_1537007 3300037853 Bacteria 5306
620 Ga0395901_0032412 3300038443 Bacteria 5391
621 Ga0395901_0044943 3300038443 Bacteria 4582
622 Ga0395901_0072361 3300038443 Bacteria 3594
623 Ga0395901_0231170 3300038443 Bacteria 1930
624 Ga0395901_0338218 3300038443 Bacteria 1555
625 Ga0395901_0441791 3300038443 Bacteria 1331
626 Ga0400485_02208 3300038735 Bacteria 45471
627 Ga0400486_25692 3300038742 Bacteria 36614
628 Ga0436360_0021783 3300039438 Bacteria 1375
629 Ga0436360_0455054 3300039438 Bacteria 2049
630 Ga0436361_0756449 3300039447 Bacteria 1580
631 Ga0436363_0045890 3300039450 Bacteria 1127
632 Ga0436363_0398535 3300039450 Bacteria 848
633 Ga0436363_0838504 3300039450 Bacteria 3983
634 Ga0439436_0003729 3300041404 Bacteria 4651
635 Ga0451853_3927494 3300041512 Bacteria 1778
636 Ga0439433_0009335 3300041999 Bacteria 2135
637 Ga0439442_011772 3300042002 Bacteria 1784
638 Ga0439448_0000572 3300042005 Bacteria 8631
639 Ga0439448_0051675 3300042005 Bacteria 1346
640 Ga0439449_0005338 3300042007 Bacteria 4921
641 Ga0439455_0026469 3300042012 Bacteria 1416
642 Ga0439463_003040 3300042016 Bacteria 4258
643 Ga0439458_0003964 3300042157 Bacteria 3420
644 Ga0439464_0010056 3300042439 Bacteria 2495
645 Ga0439464_0010767 3300042439 Bacteria 2417
646 Ga0439460_0012086 3300042461 Bacteria 2234
647 Ga0439460_0044508 3300042461 Bacteria 1314
648 Ga0450916_000764 3300042530 Bacteria 2970
649 Ga0466965_0142339 3300044683 Bacteria 1250
650 Ga0466966_0196157 3300044684 Bacteria 1222
651 Ga0466961_0017604 3300044693 Bacteria 4591
652 Ga0466961_0068036 3300044693 Bacteria 2262
653 Ga0466961_0233543 3300044693 Bacteria 1131
654 Ga0466963_0015064 3300044694 Bacteria 4780
655 Ga0466963_0038698 3300044694 Bacteria 3120
656 Ga0466963_0109300 3300044694 Bacteria 1897
657 Ga0466963_0267352 3300044694 Bacteria 1201
658 Ga0466964_0054574 3300044706 Bacteria 1647
659 Ga0466964_0063476 3300044706 Bacteria 1543
660 Ga0466971_0124060 3300044719 Bacteria 1196
661 Ga0466968_0000127 3300044735 Bacteria 22573
662 Ga0466970_0001582 3300044765 Bacteria 10998
663 Ga0466970_0032333 3300044765 Bacteria 2764
664 Ga0466970_0120894 3300044765 Bacteria 1434
665 Ga0466957_0002458 3300044842 Bacteria 9948
666 Ga0466957_0199478 3300044842 Bacteria 1314
667 Ga0466960_0014624 3300044901 Bacteria 3366
668 Ga0466960_0098437 3300044901 Bacteria 1502
669 Ga0466959_0163057 3300045049 Bacteria 1566
670 Ga0466959_0184133 3300045049 Bacteria 1460
671 Ga0466959_0285378 3300045049 Bacteria 1132
672 Ga0466958_0002125 3300045836 Bacteria 9848
673 Ga0466958_0025951 3300045836 Bacteria 3459
674 Ga0466967_0006236 3300045976 Bacteria 8408
675 Ga0466967_0097718 3300045976 Bacteria 2680
676 Ga0466967_0123286 3300045976 Bacteria 2397
677 Ga0466967_0141670 3300045976 Bacteria 2240
678 Ga0466967_0144241 3300045976 Bacteria 2220
679 Ga0466967_0168790 3300045976 Bacteria 2057
680 Ga0466967_0223140 3300045976 Bacteria 1792
681 Ga0495592_0000133 3300046454 Bacteria 66075
682 Ga0495592_0021245 3300046454 Bacteria 4935
683 Ga0495592_0027905 3300046454 Bacteria 4276
684 Ga0495592_0045713 3300046454 Bacteria 3266
685 Ga0495592_0145629 3300046454 Bacteria 1643
686 Ga0495629_0003615 3300046459 Bacteria 11686
687 Ga0495629_0120393 3300046459 Bacteria 1828
688 Ga0495641_0013730 3300046461 Bacteria 4427
689 Ga0495641_0026292 3300046461 Bacteria 2841
690 Ga0495651_0000019 3300046462 Bacteria 120970
691 Ga0495651_0001424 3300046462 Bacteria 18558
692 Ga0495651_0013797 3300046462 Bacteria 6249
693 Ga0495651_0030057 3300046462 Bacteria 4236
694 Ga0495651_0126446 3300046462 Bacteria 1871
695 Ga0495653_0003782 3300046463 Bacteria 12247
696 Ga0495653_0006300 3300046463 Bacteria 9733
697 Ga0495653_0010412 3300046463 Bacteria 7606
698 Ga0495653_0015651 3300046463 Bacteria 6182
699 Ga0495653_0017351 3300046463 Bacteria 5855
700 Ga0495653_0098404 3300046463 Bacteria 2124
701 Ga0495653_0151850 3300046463 Bacteria 1617
702 Ga0495582_0000493 3300046473 Bacteria 21575
703 Ga0495582_0015285 3300046473 Bacteria 4218
704 Ga0495582_0080091 3300046473 Bacteria 1813
705 Ga0495639_0005262 3300046475 Bacteria 5564
706 Ga0495639_0007891 3300046475 Bacteria 4575
707 Ga0495662_0020889 3300046476 Bacteria 3167
708 Ga0495662_0103426 3300046476 Bacteria 1393
709 Ga0495662_0160612 3300046476 Bacteria 1107
710 Ga0495664_0006872 3300046477 Bacteria 6297
711 Ga0495664_0009160 3300046477 Bacteria 5535
712 Ga0495664_0010930 3300046477 Bacteria 5105
713 Ga0495664_0017711 3300046477 Bacteria 4073
714 Ga0495664_0020928 3300046477 Bacteria 3776
715 Ga0495664_0062050 3300046477 Bacteria 2225
716 Ga0495664_0108657 3300046477 Bacteria 1673
717 Ga0495594_0097426 3300046499 Bacteria 1653
718 Ga0495596_0022225 3300046500 Bacteria 2583
719 Ga0495608_0000028 3300046511 Bacteria 151829
720 Ga0495608_0009390 3300046511 Bacteria 6838
721 Ga0495608_0014063 3300046511 Bacteria 5554
722 Ga0495608_0020716 3300046511 Bacteria 4517
723 Ga0495608_0044749 3300046511 Bacteria 2953
724 Ga0495608_0108063 3300046511 Bacteria 1789
725 Ga0495608_0236051 3300046511 Bacteria 1143
726 Ga0495608_0275611 3300046511 Bacteria 1045
727 Ga0495618_0052774 3300046514 Bacteria 2570
728 Ga0495618_0108712 3300046514 Bacteria 1775
729 Ga0495618_0130471 3300046514 Bacteria 1608
730 Ga0495628_0000337 3300046516 Bacteria 42541
731 Ga0495628_0010312 3300046516 Bacteria 7943
732 Ga0495628_0088817 3300046516 Bacteria 2394
733 Ga0495628_0254132 3300046516 Bacteria 1311
734 Ga0495630_0051465 3300046517 Bacteria 3082
735 Ga0495630_0078411 3300046517 Bacteria 2491
736 Ga0495630_0101646 3300046517 Bacteria 2175
737 Ga0495630_0156506 3300046517 Bacteria 1734
738 Ga0495632_0072168 3300046519 Bacteria 1657
739 Ga0495644_0072826 3300046523 Bacteria 1292
740 Ga0495666_0058276 3300046526 Bacteria 1848
741 Ga0495666_0078256 3300046526 Bacteria 1566
742 Ga0495652_0000031 3300046529 Bacteria 151765
743 Ga0495652_0019111 3300046529 Bacteria 6103
744 Ga0495652_0033547 3300046529 Bacteria 4481
745 Ga0495652_0071909 3300046529 Bacteria 2885
746 Ga0495652_0095275 3300046529 Bacteria 2425
747 Ga0495652_0103519 3300046529 Bacteria 2304
748 Ga0495652_0152813 3300046529 Bacteria 1801
749 Ga0495665_0012938 3300046531 Bacteria 4516
750 Ga0495665_0052706 3300046531 Bacteria 2153
751 Ga0495665_0111120 3300046531 Bacteria 1437
752 Ga0495640_0046881 3300046533 Bacteria 2992
753 Ga0495640_0056386 3300046533 Bacteria 2685
754 Ga0495640_0086003 3300046533 Bacteria 2083
755 Ga0495640_0223359 3300046533 Bacteria 1187
756 Ga0495586_0022724 3300046535 Bacteria 3347
757 Ga0495587_0000023 3300046536 Bacteria 151763
758 Ga0495587_0010018 3300046536 Bacteria 6052
759 Ga0495587_0017955 3300046536 Bacteria 4387
760 Ga0495587_0020164 3300046536 Bacteria 4118
761 Ga0495587_0104905 3300046536 Bacteria 1626
762 Ga0495645_0001100 3300046543 Bacteria 18313
763 Ga0495645_0008216 3300046543 Bacteria 7279
764 Ga0495645_0021367 3300046543 Bacteria 4678
765 Ga0495645_0028709 3300046543 Bacteria 4042
766 Ga0495645_0031746 3300046543 Bacteria 3849
767 Ga0495645_0055887 3300046543 Bacteria 2865
768 Ga0495645_0057243 3300046543 Bacteria 2830
769 Ga0495645_0132004 3300046543 Bacteria 1749
770 Ga0495667_0000054 3300046559 Bacteria 105009
771 Ga0495667_0001016 3300046559 Bacteria 18127
772 Ga0495667_0003509 3300046559 Bacteria 10519
773 Ga0495667_0005370 3300046559 Bacteria 8664
774 Ga0495667_0008650 3300046559 Bacteria 6912
775 Ga0495667_0008718 3300046559 Bacteria 6887
776 Ga0495667_0030351 3300046559 Bacteria 3633
777 Ga0495667_0065162 3300046559 Bacteria 2383
778 Ga0495634_0044036 3300046642 Bacteria 3022
779 Ga0495634_0057617 3300046642 Bacteria 2592
780 Ga0495634_0107121 3300046642 Bacteria 1800
781 Ga0495611_0067192 3300046648 Bacteria 1636
782 Ga0495635_0001264 3300046663 Bacteria 16898
783 Ga0495635_0003596 3300046663 Bacteria 10733
784 Ga0495635_0030032 3300046663 Bacteria 3778
785 Ga0495635_0030207 3300046663 Bacteria 3765
786 Ga0495635_0033733 3300046663 Bacteria 3551
787 Ga0495635_0038410 3300046663 Bacteria 3315
788 Ga0495659_0049178 3300046664 Bacteria 1530
789 Ga0495657_0000022 3300046675 Bacteria 151837
790 Ga0495657_0002053 3300046675 Bacteria 17157
791 Ga0495657_0025333 3300046675 Bacteria 4214
792 Ga0495657_0056185 3300046675 Bacteria 2622
793 Ga0495657_0091134 3300046675 Bacteria 1956
794 Ga0495657_0113762 3300046675 Bacteria 1711
795 Ga0495599_0000125 3300046678 Bacteria 50781
796 Ga0495599_0086416 3300046678 Bacteria 1958
797 Ga0495623_0000416 3300046679 Bacteria 28025
798 Ga0495623_0023167 3300046679 Bacteria 4007
799 Ga0495623_0033514 3300046679 Bacteria 3295
800 Ga0495623_0037893 3300046679 Bacteria 3083
801 Ga0495623_0058265 3300046679 Bacteria 2428
802 Ga0495623_0100795 3300046679 Bacteria 1759
803 Ga0495646_0017254 3300046680 Bacteria 4581
804 Ga0495646_0019999 3300046680 Bacteria 4233
805 Ga0495646_0076103 3300046680 Bacteria 1966
806 Ga0495646_0136431 3300046680 Bacteria 1376
807 Ga0495646_0150015 3300046680 Bacteria 1297
808 Ga0495647_0021475 3300046681 Bacteria 2324
809 Ga0495658_0076226 3300046683 Bacteria 1959
810 Ga0495658_0167186 3300046683 Bacteria 1359
811 Ga0495613_0031895 3300046689 Bacteria 3913
812 Ga0495624_0009088 3300046690 Bacteria 6894
813 Ga0495624_0013469 3300046690 Bacteria 5575
814 Ga0495624_0114947 3300046690 Bacteria 1654
815 Ga0495624_0128899 3300046690 Bacteria 1551
816 Ga0495670_0028797 3300046691 Bacteria 2754
817 Ga0495600_0008548 3300046809 Bacteria 6296
818 Ga0495600_0011991 3300046809 Bacteria 5411
819 Ga0495600_0052868 3300046809 Bacteria 2652
820 Ga0495600_0055207 3300046809 Bacteria 2594
821 Ga0495600_0134971 3300046809 Bacteria 1603
822 Ga0495600_0200203 3300046809 Bacteria 1283
823 Ga0495600_0219902 3300046809 Bacteria 1215
824 Ga0495581_0010470 3300047315 Bacteria 5361
825 Ga0495581_0015106 3300047315 Bacteria 4482
826 Ga0495581_0086599 3300047315 Bacteria 1816
827 Ga0495581_0147695 3300047315 Bacteria 1372
828 Ga0495604_0000022 3300047317 Bacteria 151744
829 Ga0495604_0030817 3300047317 Bacteria 4256
830 Ga0495604_0034218 3300047317 Bacteria 4021
831 Ga0495604_0136622 3300047317 Bacteria 1756
832 Ga0495604_0171420 3300047317 Bacteria 1525
833 Ga0495604_0184356 3300047317 Bacteria 1458
834 Ga0495674_0002831 3300047319 Bacteria 16861
835 Ga0495674_0008396 3300047319 Bacteria 9843
836 Ga0495674_0025284 3300047319 Bacteria 5446
837 Ga0495674_0027125 3300047319 Bacteria 5238
838 Ga0495674_0032708 3300047319 Bacteria 4715
839 Ga0495674_0186190 3300047319 Bacteria 1727
840 Ga0495676_0261425 3300047321 Bacteria 1177
841 Ga0495680_0000154 3300047322 Bacteria 69567
842 Ga0495680_0005823 3300047322 Bacteria 11532
843 Ga0495680_0011807 3300047322 Bacteria 7715
844 Ga0495680_0064853 3300047322 Bacteria 2799
845 Ga0495680_0203865 3300047322 Bacteria 1418
846 Ga0495680_0224846 3300047322 Bacteria 1338
847 Ga0495680_0338032 3300047322 Bacteria 1051
848 Ga0495675_0000843 3300047444 Bacteria 18757
849 Ga0495675_0013912 3300047444 Bacteria 5088
850 Ga0495675_0020526 3300047444 Bacteria 4203
851 Ga0495675_0031919 3300047444 Bacteria 3363
852 Ga0495675_0045040 3300047444 Bacteria 2809
853 Ga0495675_0081429 3300047444 Bacteria 2038
854 Ga0495675_0139513 3300047444 Bacteria 1503
855 Ga0495677_0062292 3300047445 Bacteria 1384
856 Ga0495684_0002351 3300047471 Bacteria 15113
857 Ga0495684_0020511 3300047471 Bacteria 5094
858 Ga0495684_0020760 3300047471 Bacteria 5060
859 Ga0495684_0029724 3300047471 Bacteria 4193
860 Ga0495684_0045475 3300047471 Bacteria 3360
861 Ga0495684_0051985 3300047471 Bacteria 3126
862 Ga0495684_0072458 3300047471 Bacteria 2617
863 Ga0495684_0144903 3300047471 Bacteria 1779
864 Ga0495593_0005889 3300047673 Bacteria 7222
865 Ga0495593_0025477 3300047673 Bacteria 3274
866 Ga0495602_0000195 3300048088 Bacteria 57149
867 Ga0495602_0000251 3300048088 Bacteria 50166
868 Ga0495602_0071257 3300048088 Bacteria 2968
869 Ga0495602_0129599 3300048088 Bacteria 2014
870 Ga0495602_0274928 3300048088 Bacteria 1243
871 Ga0495602_0328137 3300048088 Bacteria 1111
872 Ga0495614_0086759 3300048089 Bacteria 1359
873 Ga0496100_0054147 3300048903 Bacteria 2615
874 Ga0496101_0002786 3300048904 Bacteria 10718
875 Ga0496102_0006094 3300048905 Bacteria 10280
876 Ga0496102_0044150 3300048905 Bacteria 4044
877 Ga0496102_0061553 3300048905 Bacteria 3435
878 Ga0496103_0109747 3300048906 Bacteria 1752
879 Ga0496104_0000798 3300048907 Bacteria 27060
880 Ga0496104_0012341 3300048907 Bacteria 7680
881 Ga0496104_0068816 3300048907 Bacteria 3364
882 Ga0496104_0122788 3300048907 Bacteria 2493
883 Ga0496105_0012818 3300048908 Bacteria 6645
884 Ga0496105_0016937 3300048908 Bacteria 5831
885 Ga0496105_0018502 3300048908 Bacteria 5603
886 Ga0496105_0024086 3300048908 Bacteria 4944
887 Ga0496106_0034290 3300048909 Bacteria 3790
888 Ga0496106_0105687 3300048909 Bacteria 2187
889 Ga0496106_0287040 3300048909 Bacteria 1319
890 Ga0496107_0106800 3300048910 Bacteria 2056
891 Ga0496107_0146431 3300048910 Bacteria 1746
892 Ga0496107_0357290 3300048910 Bacteria 1087
893 Ga0496108_0073187 3300048911 Bacteria 2893
894 Ga0496108_0146718 3300048911 Bacteria 2034
895 Ga0496108_0300630 3300048911 Bacteria 1398
896 Ga0496109_0009817 3300048912 Bacteria 8171
897 Ga0496109_0208517 3300048912 Bacteria 1837
898 Ga0496110_0091221 3300048913 Bacteria 2725
899 Ga0496110_0177546 3300048913 Bacteria 1933
900 Ga0496110_0316810 3300048913 Bacteria 1421
901 Ga0496110_0346966 3300048913 Bacteria 1352
902 Ga0496111_0032415 3300048914 Bacteria 3725
903 Ga0496111_0051138 3300048914 Bacteria 2983
904 Ga0496112_0053238 3300048915 Bacteria 3974
905 Ga0496112_0104811 3300048915 Bacteria 2798
906 Ga0496112_0108323 3300048915 Bacteria 2748
907 Ga0496113_0016988 3300048916 Bacteria 5039
908 Ga0496113_0024157 3300048916 Bacteria 4316
909 Ga0496113_0051817 3300048916 Bacteria 3063
910 Ga0496113_0070327 3300048916 Bacteria 2660
911 Ga0496114_0100327 3300048917 Bacteria 2470
912 Ga0496114_0139974 3300048917 Bacteria 2094
913 Ga0496115_0015886 3300048918 Bacteria 5720
914 Ga0496115_0035994 3300048918 Bacteria 3918
915 Ga0496115_0069974 3300048918 Bacteria 2843
916 Ga0496115_0162714 3300048918 Bacteria 1845
917 Ga0496119_0003055 3300048922 Bacteria 17709
918 Ga0496121_0210719 3300048924 Bacteria 1377
919 Ga0496126_0078461 3300048929 Bacteria 2926
920 Ga0496126_0180939 3300048929 Bacteria 1791
921 Ga0501031_0174904 3300049568 Bacteria 1402
922 Ga0501032_0100248 3300049569 Bacteria 1919
923 Ga0501033_0149713 3300049570 Bacteria 1684
924 Ga0501036_0003648 3300049572 Bacteria 12312
925 Ga0501037_0120427 3300049573 Bacteria 1887
926 Ga0501038_0001572 3300049574 Bacteria 21145
927 Ga0501038_0109061 3300049574 Bacteria 2294
928 Ga0501039_0000354 3300049575 Bacteria 32857
929 Ga0501040_0000917 3300049576 Bacteria 18488
930 Ga0501041_0022606 3300049577 Bacteria 3765
931 Ga0501042_0017637 3300049578 Bacteria 4927
932 Ga0501042_0066361 3300049578 Bacteria 2579
933 Ga0501046_0071323 3300049580 Bacteria 2699
934 Ga0501047_0000141 3300049581 Bacteria 88104
935 Ga0501048_0011341 3300049582 Bacteria 6646
936 Ga0501068_0011701 3300049584 Bacteria 4960
937 Ga0501072_0001751 3300049588 Bacteria 16134
938 Ga0501072_0081895 3300049588 Bacteria 2559
939 Ga0501074_0001654 3300049590 Bacteria 15132
940 Ga0501074_0092134 3300049590 Bacteria 2170
941 Ga0501075_0000450 3300049591 Bacteria 24475
942 Ga0501076_0032057 3300049592 Bacteria 4101
943 Ga0501077_0010629 3300049593 Bacteria 5732
944 Ga0501079_0001334 3300049741 Bacteria 17363
945 Ga0501080_0217989 3300049742 Bacteria 1747
946 Ga0501081_0005425 3300049743 Bacteria 8231
947 Ga0501035_0295741 3300049822 Bacteria 1365
948 Ga0501045_0003401 3300049824 Bacteria 10897
949 Ga0501045_0021181 3300049824 Bacteria 4648
950 nmdc:mga05p37_1958_c1 3300050507 Bacteria 24006
951 nmdc:mga05p37_21880_c1 3300050507 Bacteria 7748
952 nmdc:mga05p37_220523_c1 3300050507 Bacteria 2289
953 nmdc:mga05p37_558250_c1 3300050507 Bacteria 1302
954 nmdc:mga05p37_61924_c1 3300050507 Bacteria 4606
955 nmdc:mga09592_112556_c1 3300050508 Bacteria 2335
956 nmdc:mga09592_368255_c1 3300050508 Bacteria 1243
957 nmdc:mga09592_4052_c1 3300050508 Bacteria 11826
958 nmdc:mga0qj67_10319_c1 3300050509 Bacteria 6976
959 nmdc:mga0qj67_314_c1 3300050509 Bacteria 33600
960 nmdc:mga0qj67_43141_c1 3300050509 Bacteria 3552
961 nmdc:mga06r32_21997_c1 3300050510 Bacteria 5890
962 nmdc:mga06r32_28294_c1 3300050510 Bacteria 5243
963 nmdc:mga06r32_629_c3 3300050510 Bacteria 4841
964 nmdc:mga08y16_11933_c1 3300050511 Bacteria 9125
965 nmdc:mga08y16_132702_c1 3300050511 Bacteria 2589
966 nmdc:mga08y16_136272_c1 3300050511 Bacteria 2552
967 nmdc:mga08y16_30087_c1 3300050511 Bacteria 5716
968 nmdc:mga0n895_10127_c1 3300050512 Bacteria 8299
969 nmdc:mga0n895_18120_c1 3300050512 Bacteria 6510
970 nmdc:mga0n895_262196_c1 3300050512 Bacteria 1754
971 nmdc:mga0n895_416606_c1 3300050512 Bacteria 1358
972 nmdc:mga0n895_75353_c1 3300050512 Bacteria 3354
973 nmdc:mga0rr50_223505_c1 3300050513 Bacteria 1555
974 nmdc:mga0rr50_234658_c1 3300050513 Bacteria 1519
975 nmdc:mga0rr50_59627_c1 3300050513 Bacteria 2867
976 nmdc:mga08x19_191754_c1 3300050514 Bacteria 1398
977 nmdc:mga08x19_31370_c1 3300050514 Bacteria 3342
978 nmdc:mga08x19_33680_c1 3300050514 Bacteria 3234
979 nmdc:mga0a205_101699_c1 3300050515 Bacteria 2773
980 nmdc:mga0a205_15293_c1 3300050515 Bacteria 7170
981 nmdc:mga0a205_34049_c1 3300050515 Bacteria 4887
982 nmdc:mga0a205_42659_c1 3300050515 Bacteria 4371
983 nmdc:mga0a205_99733_c1 3300050515 Bacteria 2803
984 Ga0495601_0046037 3300053077 Bacteria 2745
985 Ga0495601_0070273 3300053077 Bacteria 2235
986 Ga0495601_0077583 3300053077 Bacteria 2128
987 Ga0495601_0077975 3300053077 Bacteria 2122
988 Ga0495601_0098392 3300053077 Bacteria 1888
989 Ga0495601_0228448 3300053077 Bacteria 1215
990 Ga0495601_0249047 3300053077 Bacteria 1160
991 Ga0495612_0003726 3300053078 Bacteria 6333
992 Ga0495612_0004582 3300053078 Bacteria 5731
993 Ga0495612_0008163 3300053078 Bacteria 4256
994 Ga0495612_0019187 3300053078 Bacteria 2739
995 Ga0495612_0039241 3300053078 Bacteria 1925
996 Ga0495612_0087585 3300053078 Bacteria 1314
997 Ga0495595_0001056 3300053084 Bacteria 10645
998 Ga0495595_0013842 3300053084 Bacteria 3413
999 Ga0495595_0017836 3300053084 Bacteria 3058
1000 Ga0495595_0034282 3300053084 Bacteria 2295
1001 Ga0495595_0052060 3300053084 Bacteria 1899
1002 Ga0495595_0083694 3300053084 Bacteria 1523
1003 Ga0495619_0041514 3300053085 Bacteria 3009
1004 Ga0495619_0056829 3300053085 Bacteria 2595
1005 Ga0495619_0115459 3300053085 Bacteria 1837
1006 Ga0500644_0001435 3300053088 Bacteria 6304
1007 Ga0501084_0013673 3300054114 Bacteria 6718
1008 Ga0501084_0014695 3300054114 Bacteria 6492
1009 Ga0501084_0352786 3300054114 Bacteria 1243
1010 Ga0590075_005988 3300059424 Bacteria 2877
1011 Ga0590077_001146 3300059426 Bacteria 6467
1012 Ga0501082_0007058 3300060353 Bacteria 9697
1013 Ga0501082_0033886 3300060353 Bacteria 4405
1014 Ga0466962_0095767 3300061719 Bacteria 1423
1015 Ga0530510_0000669 3300061734 Bacteria 22218

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0332305 Ga0373935_0332305_263_1063 235
2 3300046809 Ga0495600_0200203 Ga0495600_0200203_488_1273 235
3 3300050511 nmdc:mga08y16_132702_c1 nmdc:mga08y16_132702_c1_1782_2543 237
4 3300037853 Ga0436364_0886432 Ga0436364_0886432_1856_2668 247
5 3300039450 Ga0436363_0398535 Ga0436363_0398535_12_836 247
6 3300005981 Ga0081538_10008955 Ga0081538_100089552 255
7 3300035172 Ga0373955_0322137 Ga0373955_0322137_82_921 256
8 3300005937 Ga0081455_10156068 Ga0081455_101560681 262
9 3300025921 Ga0207652_10159071 Ga0207652_101590712 264
10 3300006175 Ga0070712_100398840 Ga0070712_1003988401 265
11 3300032126 Ga0307415_100048312 Ga0307415_1000483125 265
12 3300035398 Ga0316574_0150904 Ga0316574_0150904_402_1358 265
13 3300047445 Ga0495677_0062292 Ga0495677_0062292_294_1229 265
14 3300005467 Ga0070706_100053956 Ga0070706_1000539562 266
15 3300028666 Ga0265336_10004601 Ga0265336_100046015 266
16 3300028800 Ga0265338_10002247 Ga0265338_1000224720 266
17 3300032126 Ga0307415_100231174 Ga0307415_1002311742 266
18 3300039447 Ga0436361_0756449 Ga0436361_0756449_578_1510 266
19 3300005334 Ga0068869_100274442 Ga0068869_1002744422 267
20 3300005719 Ga0068861_100264042 Ga0068861_1002640422 267
21 3300005985 Ga0081539_10018877 Ga0081539_100188772 267
22 3300006163 Ga0070715_10052548 Ga0070715_100525482 267
23 3300025898 Ga0207692_10001437 Ga0207692_100014374 267
24 3300025905 Ga0207685_10022394 Ga0207685_100223942 267
25 3300025906 Ga0207699_10006266 Ga0207699_100062665 267
26 3300025929 Ga0207664_10043770 Ga0207664_100437703 267
27 3300025939 Ga0207665_10017416 Ga0207665_100174164 267
28 3300026118 Ga0207675_100265546 Ga0207675_1002655462 267
29 3300031247 Ga0265340_10034361 Ga0265340_100343612 267
30 3300005471 Ga0070698_100000898 Ga0070698_10000089811 269
31 3300028794 Ga0307515_10170578 Ga0307515_101705782 269
32 3300030522 Ga0307512_10025517 Ga0307512_100255172 269
33 3300013105 Ga0157369_10264471 Ga0157369_102644712 270
34 3300022467 Ga0224712_10021524 Ga0224712_100215242 270
35 3300005445 Ga0070708_100015039 Ga0070708_1000150395 271
36 3300005468 Ga0070707_100172512 Ga0070707_1001725122 271
37 3300005471 Ga0070698_100070857 Ga0070698_1000708572 271
38 3300005985 Ga0081539_10004919 Ga0081539_1000491916 271
39 3300026121 Ga0207683_10024244 Ga0207683_100242444 271
40 3300028786 Ga0307517_10074469 Ga0307517_100744693 271
41 3300028794 Ga0307515_10009042 Ga0307515_1000904211 271
42 3300030522 Ga0307512_10003683 Ga0307512_100036833 271
43 3300031456 Ga0307513_10036904 Ga0307513_100369041 271
44 3300031616 Ga0307508_10033247 Ga0307508_100332473 271
45 3300031731 Ga0307405_10071517 Ga0307405_100715172 271
46 3300031824 Ga0307413_10126857 Ga0307413_101268572 271
47 3300031852 Ga0307410_10008218 Ga0307410_100082182 271
48 3300031901 Ga0307406_10005635 Ga0307406_100056356 271
49 3300031995 Ga0307409_100074136 Ga0307409_1000741362 271
50 3300032002 Ga0307416_100026645 Ga0307416_1000266453 271
51 3300032126 Ga0307415_100059169 Ga0307415_1000591692 271
52 3300033180 Ga0307510_10178321 Ga0307510_101783212 271
53 3300046519 Ga0495632_0072168 Ga0495632_0072168_527_1477 271
54 3300053088 Ga0500644_0001435 Ga0500644_0001435_1676_2626 271
55 3300005614 Ga0068856_100115958 Ga0068856_1001159582 272
56 3300009093 Ga0105240_10251979 Ga0105240_102519793 272
57 3300009551 Ga0105238_10129275 Ga0105238_101292752 272
58 3300010375 Ga0105239_10036023 Ga0105239_100360232 272
59 3300031889 Ga0326468_10000905 Ga0326468_100009053 272
60 3300044842 Ga0466957_0199478 Ga0466957_0199478_35_985 272
61 3300045049 Ga0466959_0184133 Ga0466959_0184133_137_1090 272
62 3300005719 Ga0068861_100014024 Ga0068861_1000140243 273
63 3300009553 Ga0105249_10073392 Ga0105249_100733923 273
64 3300025961 Ga0207712_10023350 Ga0207712_100233503 273
65 3300026118 Ga0207675_100002250 Ga0207675_1000022507 273
66 3300037853 Ga0436364_0118843 Ga0436364_0118843_162_1118 273
67 3300044842 Ga0466957_0002458 Ga0466957_0002458_301_1257 273
68 3300046523 Ga0495644_0072826 Ga0495644_0072826_277_1212 273
69 3300046664 Ga0495659_0049178 Ga0495659_0049178_476_1411 273
70 3300046691 Ga0495670_0028797 Ga0495670_0028797_1270_2205 273
71 3300050507 nmdc:mga05p37_220523_c1 nmdc:mga05p37_220523_c1_625_1560 273
72 3300005336 Ga0070680_100257496 Ga0070680_1002574962 274
73 3300005339 Ga0070660_100085659 Ga0070660_1000856592 274
74 3300005366 Ga0070659_100005916 Ga0070659_1000059166 274
75 3300005366 Ga0070659_100360254 Ga0070659_1003602541 274
76 3300005434 Ga0070709_10001361 Ga0070709_1000136113 274
77 3300005435 Ga0070714_100000545 Ga0070714_10000054510 274
78 3300005436 Ga0070713_100000483 Ga0070713_10000048316 274
79 3300005437 Ga0070710_10000539 Ga0070710_1000053910 274
80 3300005458 Ga0070681_10087816 Ga0070681_100878162 274
81 3300005467 Ga0070706_100001894 Ga0070706_1000018947 274
82 3300005471 Ga0070698_100013017 Ga0070698_1000130172 274
83 3300005530 Ga0070679_100207892 Ga0070679_1002078922 274
84 3300006028 Ga0070717_10001205 Ga0070717_100012053 274
85 3300006028 Ga0070717_10002725 Ga0070717_100027257 274
86 3300006173 Ga0070716_100001415 Ga0070716_1000014157 274
87 3300022467 Ga0224712_10012929 Ga0224712_100129291 274
88 3300025898 Ga0207692_10001094 Ga0207692_100010948 274
89 3300025906 Ga0207699_10001830 Ga0207699_100018308 274
90 3300025910 Ga0207684_10001419 Ga0207684_1000141915 274
91 3300025915 Ga0207693_10001078 Ga0207693_100010786 274
92 3300025917 Ga0207660_10254343 Ga0207660_102543431 274
93 3300025919 Ga0207657_10044561 Ga0207657_100445614 274
94 3300025919 Ga0207657_10105478 Ga0207657_101054782 274
95 3300025921 Ga0207652_10219371 Ga0207652_102193712 274
96 3300025928 Ga0207700_10005055 Ga0207700_100050556 274
97 3300025929 Ga0207664_10000427 Ga0207664_1000042710 274
98 3300025932 Ga0207690_10000219 Ga0207690_1000021912 274
99 3300025932 Ga0207690_10333355 Ga0207690_103333551 274
100 3300025939 Ga0207665_10002491 Ga0207665_100024919 274
101 3300026023 Ga0207677_10018630 Ga0207677_100186302 274
102 3300031235 Ga0265330_10081434 Ga0265330_100814341 274
103 3300031344 Ga0265316_10042524 Ga0265316_100425244 274
104 3300031995 Ga0307409_100042353 Ga0307409_1000423534 274
105 3300032005 Ga0307411_10067943 Ga0307411_100679432 274
106 3300035086 Ga0373934_0000070 Ga0373934_0000070_12824_13780 274
107 3300035117 Ga0373953_0000185 Ga0373953_0000185_4020_4976 274
108 3300035118 Ga0373954_0002192 Ga0373954_0002192_6872_7828 274
109 3300035119 Ga0373956_0000007 Ga0373956_0000007_55789_56745 274
110 3300035120 Ga0373957_0000024 Ga0373957_0000024_36522_37478 274
111 3300035172 Ga0373955_0000368 Ga0373955_0000368_638_1594 274
112 3300035410 Ga0373924_0000372 Ga0373924_0000372_1306_2262 274
113 3300035724 Ga0373933_0000002 Ga0373933_0000002_62379_63335 274
114 3300036401 Ga0373937_0000014 Ga0373937_0000014_88451_89407 274
115 3300037068 Ga0373925_0127897 Ga0373925_0127897_1073_1966 274
116 3300046454 Ga0495592_0000133 Ga0495592_0000133_62379_63335 274
117 3300046462 Ga0495651_0000019 Ga0495651_0000019_88451_89407 274
118 3300046463 Ga0495653_0003782 Ga0495653_0003782_2163_3119 274
119 3300046511 Ga0495608_0000028 Ga0495608_0000028_62371_63327 274
120 3300046516 Ga0495628_0000337 Ga0495628_0000337_4803_5759 274
121 3300046529 Ga0495652_0000031 Ga0495652_0000031_62359_63315 274
122 3300046536 Ga0495587_0000023 Ga0495587_0000023_88429_89385 274
123 3300046559 Ga0495667_0000054 Ga0495667_0000054_62371_63327 274
124 3300046675 Ga0495657_0000022 Ga0495657_0000022_62379_63335 274
125 3300046678 Ga0495599_0000125 Ga0495599_0000125_9020_9976 274
126 3300046679 Ga0495623_0000416 Ga0495623_0000416_25852_26808 274
127 3300046680 Ga0495646_0019999 Ga0495646_0019999_1264_2220 274
128 3300046809 Ga0495600_0008548 Ga0495600_0008548_4866_5822 274
129 3300047317 Ga0495604_0000022 Ga0495604_0000022_62356_63312 274
130 3300047322 Ga0495680_0000154 Ga0495680_0000154_63829_64785 274
131 3300047444 Ga0495675_0000843 Ga0495675_0000843_13213_14169 274
132 3300048088 Ga0495602_0000251 Ga0495602_0000251_27720_28676 274
133 3300053077 Ga0495601_0077583 Ga0495601_0077583_603_1559 274
134 3300053084 Ga0495595_0034282 Ga0495595_0034282_309_1265 274
135 3300005366 Ga0070659_100010121 Ga0070659_1000101217 275
136 3300005445 Ga0070708_100001278 Ga0070708_10000127810 275
137 3300005467 Ga0070706_100004349 Ga0070706_10000434912 275
138 3300005467 Ga0070706_100024464 Ga0070706_1000244642 275
139 3300005468 Ga0070707_100007016 Ga0070707_1000070162 275
140 3300005468 Ga0070707_100029674 Ga0070707_1000296745 275
141 3300005471 Ga0070698_100051847 Ga0070698_1000518472 275
142 3300005536 Ga0070697_100108411 Ga0070697_1001084112 275
143 3300006028 Ga0070717_10134834 Ga0070717_101348342 275
144 3300006914 Ga0075436_100074055 Ga0075436_1000740552 275
145 3300013102 Ga0157371_10059306 Ga0157371_100593062 275
146 3300025910 Ga0207684_10002612 Ga0207684_100026128 275
147 3300025910 Ga0207684_10186921 Ga0207684_101869212 275
148 3300025922 Ga0207646_10000950 Ga0207646_100009508 275
149 3300025922 Ga0207646_10072069 Ga0207646_100720692 275
150 3300028794 Ga0307515_10001066 Ga0307515_1000106610 275
151 3300028800 Ga0265338_10014640 Ga0265338_100146408 275
152 3300031240 Ga0265320_10022258 Ga0265320_100222585 275
153 3300031241 Ga0265325_10027015 Ga0265325_100270151 275
154 3300031595 Ga0265313_10046513 Ga0265313_100465132 275
155 3300031711 Ga0265314_10022618 Ga0265314_100226183 275
156 3300035117 Ga0373953_0068325 Ga0373953_0068325_105_1061 275
157 3300035119 Ga0373956_0090125 Ga0373956_0090125_59_1015 275
158 3300036401 Ga0373937_0117122 Ga0373937_0117122_942_1898 275
159 3300038443 Ga0395901_0072361 Ga0395901_0072361_1652_2608 275
160 3300044684 Ga0466966_0196157 Ga0466966_0196157_254_1207 275
161 3300044694 Ga0466963_0109300 Ga0466963_0109300_757_1710 275
162 3300044765 Ga0466970_0120894 Ga0466970_0120894_312_1265 275
163 3300045049 Ga0466959_0163057 Ga0466959_0163057_494_1447 275
164 3300046462 Ga0495651_0001424 Ga0495651_0001424_12388_13344 275
165 3300046463 Ga0495653_0015651 Ga0495653_0015651_4220_5176 275
166 3300046477 Ga0495664_0108657 Ga0495664_0108657_13_969 275
167 3300046511 Ga0495608_0009390 Ga0495608_0009390_4121_5077 275
168 3300046529 Ga0495652_0033547 Ga0495652_0033547_1321_2277 275
169 3300046533 Ga0495640_0223359 Ga0495640_0223359_67_1023 275
170 3300046536 Ga0495587_0017955 Ga0495587_0017955_2678_3634 275
171 3300046559 Ga0495667_0001016 Ga0495667_0001016_11280_12236 275
172 3300046663 Ga0495635_0030032 Ga0495635_0030032_58_1014 275
173 3300046675 Ga0495657_0002053 Ga0495657_0002053_15091_16047 275
174 3300047317 Ga0495604_0030817 Ga0495604_0030817_3188_4144 275
175 3300047319 Ga0495674_0027125 Ga0495674_0027125_1846_2802 275
176 3300047322 Ga0495680_0005823 Ga0495680_0005823_1799_2755 275
177 3300047444 Ga0495675_0013912 Ga0495675_0013912_94_1050 275
178 3300053077 Ga0495601_0249047 Ga0495601_0249047_47_1003 275
179 3300061719 Ga0466962_0095767 Ga0466962_0095767_301_1254 275
180 3300005329 Ga0070683_100173090 Ga0070683_1001730901 276
181 3300005455 Ga0070663_100349091 Ga0070663_1003490912 276
182 3300005530 Ga0070679_100053534 Ga0070679_1000535345 276
183 3300005617 Ga0068859_100066935 Ga0068859_1000669352 276
184 3300005983 Ga0081540_1000250 Ga0081540_10002502 276
185 3300005983 Ga0081540_1032375 Ga0081540_10323755 276
186 3300006847 Ga0075431_100063910 Ga0075431_1000639103 276
187 3300006931 Ga0097620_100066940 Ga0097620_1000669402 276
188 3300025981 Ga0207640_10270453 Ga0207640_102704532 276
189 3300026142 Ga0207698_10317204 Ga0207698_103172041 276
190 3300031507 Ga0307509_10178452 Ga0307509_101784523 276
191 3300032002 Ga0307416_100190815 Ga0307416_1001908152 276
192 3300035083 Ga0373926_0009034 Ga0373926_0009034_19_975 276
193 3300035113 Ga0373936_0004164 Ga0373936_0004164_1016_1972 276
194 3300035117 Ga0373953_0045019 Ga0373953_0045019_797_1753 276
195 3300035170 Ga0373943_0001795 Ga0373943_0001795_3517_4473 276
196 3300035410 Ga0373924_0018862 Ga0373924_0018862_1692_2648 276
197 3300035695 Ga0373927_0070955 Ga0373927_0070955_663_1619 276
198 3300035724 Ga0373933_0071489 Ga0373933_0071489_428_1423 276
199 3300036401 Ga0373937_0238112 Ga0373937_0238112_347_1303 276
200 3300037068 Ga0373925_0062211 Ga0373925_0062211_135_1091 276
201 3300037466 Ga0395898_0090208 Ga0395898_0090208_1347_2303 276
202 3300037471 Ga0395905_0149731 Ga0395905_0149731_747_1703 276
203 3300037853 Ga0436364_0935193 Ga0436364_0935193_109_1068 276
204 3300041512 Ga0451853_3927494 Ga0451853_3927494_190_1146 276
205 3300046461 Ga0495641_0013730 Ga0495641_0013730_3431_4387 276
206 3300046473 Ga0495582_0000493 Ga0495582_0000493_46_1002 276
207 3300046475 Ga0495639_0005262 Ga0495639_0005262_67_1023 276
208 3300046477 Ga0495664_0009160 Ga0495664_0009160_4542_5498 276
209 3300046529 Ga0495652_0071909 Ga0495652_0071909_1870_2826 276
210 3300046531 Ga0495665_0012938 Ga0495665_0012938_3540_4496 276
211 3300046536 Ga0495587_0104905 Ga0495587_0104905_618_1574 276
212 3300046543 Ga0495645_0008216 Ga0495645_0008216_6252_7208 276
213 3300046559 Ga0495667_0065162 Ga0495667_0065162_276_1271 276
214 3300046675 Ga0495657_0091134 Ga0495657_0091134_933_1889 276
215 3300046680 Ga0495646_0076103 Ga0495646_0076103_78_1034 276
216 3300046683 Ga0495658_0076226 Ga0495658_0076226_965_1921 276
217 3300046809 Ga0495600_0055207 Ga0495600_0055207_67_1023 276
218 3300047315 Ga0495581_0010470 Ga0495581_0010470_69_1025 276
219 3300047471 Ga0495684_0020511 Ga0495684_0020511_4090_5046 276
220 3300047673 Ga0495593_0005889 Ga0495593_0005889_6244_7200 276
221 3300048088 Ga0495602_0071257 Ga0495602_0071257_578_1534 276
222 3300048907 Ga0496104_0068816 Ga0496104_0068816_2283_3236 276
223 3300048915 Ga0496112_0104811 Ga0496112_0104811_1367_2320 276
224 3300050510 nmdc:mga06r32_629_c3 nmdc:mga06r32_629_c3_581_1540 276
225 3300053077 Ga0495601_0228448 Ga0495601_0228448_58_1014 276
226 3300053078 Ga0495612_0008163 Ga0495612_0008163_35_991 276
227 3300053084 Ga0495595_0083694 Ga0495595_0083694_94_1050 276
228 3300053085 Ga0495619_0041514 Ga0495619_0041514_1997_2953 276
229 3300005458 Ga0070681_10174259 Ga0070681_101742592 277
230 3300005530 Ga0070679_100034617 Ga0070679_1000346175 277
231 3300006237 Ga0097621_100111339 Ga0097621_1001113392 277
232 3300006852 Ga0075433_10143574 Ga0075433_101435742 277
233 3300006871 Ga0075434_100018423 Ga0075434_1000184235 277
234 3300009545 Ga0105237_10033633 Ga0105237_100336332 277
235 3300013308 Ga0157375_10448831 Ga0157375_104488312 277
236 3300025906 Ga0207699_10011057 Ga0207699_100110573 277
237 3300025912 Ga0207707_10098332 Ga0207707_100983322 277
238 3300025914 Ga0207671_10071968 Ga0207671_100719682 277
239 3300025921 Ga0207652_10124104 Ga0207652_101241042 277
240 3300025929 Ga0207664_10191859 Ga0207664_101918592 277
241 3300031548 Ga0307408_100018031 Ga0307408_1000180313 277
242 3300031711 Ga0265314_10136154 Ga0265314_101361542 277
243 3300031712 Ga0265342_10094939 Ga0265342_100949392 277
244 3300031901 Ga0307406_10080903 Ga0307406_100809033 277
245 3300031901 Ga0307406_10140744 Ga0307406_101407443 277
246 3300032002 Ga0307416_100021209 Ga0307416_1000212092 277
247 3300035083 Ga0373926_0107581 Ga0373926_0107581_78_1034 277
248 3300035114 Ga0373939_0060424 Ga0373939_0060424_36_992 277
249 3300044693 Ga0466961_0017604 Ga0466961_0017604_549_1505 277
250 3300046473 Ga0495582_0015285 Ga0495582_0015285_416_1372 277
251 3300046499 Ga0495594_0097426 Ga0495594_0097426_620_1576 277
252 3300046531 Ga0495665_0052706 Ga0495665_0052706_1007_1963 277
253 3300046648 Ga0495611_0067192 Ga0495611_0067192_274_1209 277
254 3300046681 Ga0495647_0021475 Ga0495647_0021475_1199_2155 277
255 3300048906 Ga0496103_0109747 Ga0496103_0109747_754_1710 277
256 3300048907 Ga0496104_0122788 Ga0496104_0122788_1041_1997 277
257 3300048910 Ga0496107_0106800 Ga0496107_0106800_1040_1996 277
258 3300048915 Ga0496112_0108323 Ga0496112_0108323_461_1417 277
259 3300049742 Ga0501080_0217989 Ga0501080_0217989_572_1555 277
260 3300050512 nmdc:mga0n895_18120_c1 nmdc:mga0n895_18120_c1_1455_2411 277
261 3300050514 nmdc:mga08x19_31370_c1 nmdc:mga08x19_31370_c1_668_1624 277
262 3300050515 nmdc:mga0a205_42659_c1 nmdc:mga0a205_42659_c1_2583_3539 277
263 3300012503 Ga0157313_1001542 Ga0157313_10015422 278
264 3300035118 Ga0373954_0040873 Ga0373954_0040873_959_1915 278
265 3300036647 Ga0316582_0057528 Ga0316582_0057528_788_1672 278
266 3300038735 Ga0400485_02208 Ga0400485_02208_9718_10683 278
267 3300038742 Ga0400486_25692 Ga0400486_25692_832_1797 278
268 3300044693 Ga0466961_0068036 Ga0466961_0068036_245_1204 278
269 3300044706 Ga0466964_0054574 Ga0466964_0054574_496_1455 278
270 3300045836 Ga0466958_0002125 Ga0466958_0002125_6969_7928 278
271 3300046459 Ga0495629_0120393 Ga0495629_0120393_221_1177 278
272 3300031548 Ga0307408_100206281 Ga0307408_1002062812 279
273 3300031731 Ga0307405_10016418 Ga0307405_100164183 279
274 3300031824 Ga0307413_10028958 Ga0307413_100289582 279
275 3300031903 Ga0307407_10010091 Ga0307407_100100912 279
276 3300031995 Ga0307409_100062244 Ga0307409_1000622443 279
277 3300032002 Ga0307416_100005911 Ga0307416_1000059115 279
278 3300032004 Ga0307414_10295094 Ga0307414_102950942 279
279 3300032005 Ga0307411_10013764 Ga0307411_100137643 279
280 3300032126 Ga0307415_100005543 Ga0307415_1000055435 279
281 3300035692 Ga0373935_0005495 Ga0373935_0005495_5289_6245 279
282 3300035725 Ga0373947_0000007 Ga0373947_0000007_144380_145336 279
283 3300044694 Ga0466963_0015064 Ga0466963_0015064_3131_4096 279
284 3300046533 Ga0495640_0046881 Ga0495640_0046881_491_1447 279
285 3300005334 Ga0068869_100006152 Ga0068869_1000061522 280
286 3300005338 Ga0068868_100044731 Ga0068868_1000447312 280
287 3300005339 Ga0070660_100056267 Ga0070660_1000562674 280
288 3300005345 Ga0070692_10003994 Ga0070692_100039944 280
289 3300005366 Ga0070659_100176405 Ga0070659_1001764052 280
290 3300005455 Ga0070663_100026128 Ga0070663_1000261284 280
291 3300005458 Ga0070681_10383872 Ga0070681_103838721 280
292 3300005468 Ga0070707_100026268 Ga0070707_1000262682 280
293 3300005471 Ga0070698_100228475 Ga0070698_1002284752 280
294 3300005547 Ga0070693_100003713 Ga0070693_1000037136 280
295 3300005548 Ga0070665_100006607 Ga0070665_1000066078 280
296 3300005617 Ga0068859_100443735 Ga0068859_1004437352 280
297 3300005834 Ga0068851_10035674 Ga0068851_100356742 280
298 3300005840 Ga0068870_10000614 Ga0068870_100006148 280
299 3300005843 Ga0068860_100043085 Ga0068860_1000430853 280
300 3300006237 Ga0097621_100037665 Ga0097621_1000376654 280
301 3300006358 Ga0068871_100047631 Ga0068871_1000476314 280
302 3300006844 Ga0075428_100062887 Ga0075428_1000628874 280
303 3300006847 Ga0075431_100272902 Ga0075431_1002729022 280
304 3300006852 Ga0075433_10049564 Ga0075433_100495642 280
305 3300006931 Ga0097620_100443771 Ga0097620_1004437712 280
306 3300009101 Ga0105247_10053503 Ga0105247_100535033 280
307 3300009551 Ga0105238_10290145 Ga0105238_102901452 280
308 3300013102 Ga0157371_10137477 Ga0157371_101374772 280
309 3300013104 Ga0157370_10057438 Ga0157370_100574384 280
310 3300013296 Ga0157374_10259101 Ga0157374_102591012 280
311 3300014968 Ga0157379_10146024 Ga0157379_101460242 280
312 3300020081 Ga0206354_10593962 Ga0206354_105939622 280
313 3300025321 Ga0207656_10020636 Ga0207656_100206362 280
314 3300025900 Ga0207710_10028052 Ga0207710_100280521 280
315 3300025901 Ga0207688_10017900 Ga0207688_100179002 280
316 3300025908 Ga0207643_10000204 Ga0207643_100002047 280
317 3300025913 Ga0207695_10287073 Ga0207695_102870732 280
318 3300025917 Ga0207660_10038844 Ga0207660_100388444 280
319 3300025919 Ga0207657_10165197 Ga0207657_101651971 280
320 3300025920 Ga0207649_10018450 Ga0207649_100184504 280
321 3300025922 Ga0207646_10102009 Ga0207646_101020092 280
322 3300025925 Ga0207650_10002710 Ga0207650_100027104 280
323 3300025926 Ga0207659_10004400 Ga0207659_100044006 280
324 3300025927 Ga0207687_10075188 Ga0207687_100751882 280
325 3300025931 Ga0207644_10007562 Ga0207644_100075625 280
326 3300025932 Ga0207690_10030154 Ga0207690_100301542 280
327 3300025942 Ga0207689_10000223 Ga0207689_1000022314 280
328 3300025945 Ga0207679_10006307 Ga0207679_100063073 280
329 3300026067 Ga0207678_10002516 Ga0207678_100025168 280
330 3300026088 Ga0207641_10009542 Ga0207641_100095425 280
331 3300026095 Ga0207676_10001541 Ga0207676_1000154114 280
332 3300026121 Ga0207683_10000804 Ga0207683_1000080418 280
333 3300027907 Ga0207428_10009923 Ga0207428_100099234 280
334 3300028379 Ga0268266_10023015 Ga0268266_100230154 280
335 3300031824 Ga0307413_10174920 Ga0307413_101749201 280
336 3300032002 Ga0307416_100051710 Ga0307416_1000517102 280
337 3300048905 Ga0496102_0006094 Ga0496102_0006094_8922_9860 280
338 3300048907 Ga0496104_0012341 Ga0496104_0012341_1342_2280 280
339 3300048908 Ga0496105_0016937 Ga0496105_0016937_2618_3556 280
340 3300048909 Ga0496106_0034290 Ga0496106_0034290_2389_3327 280
341 3300048911 Ga0496108_0073187 Ga0496108_0073187_300_1238 280
342 3300050511 nmdc:mga08y16_11933_c1 nmdc:mga08y16_11933_c1_6474_7412 280
343 3300050515 nmdc:mga0a205_34049_c1 nmdc:mga0a205_34049_c1_1452_2390 280
344 3300005328 Ga0070676_10043582 Ga0070676_100435822 281
345 3300005336 Ga0070680_100056299 Ga0070680_1000562994 281
346 3300005364 Ga0070673_100003932 Ga0070673_1000039326 281
347 3300005367 Ga0070667_100211942 Ga0070667_1002119421 281
348 3300005471 Ga0070698_100017971 Ga0070698_1000179712 281
349 3300005615 Ga0070702_100000031 Ga0070702_10000003129 281
350 3300006871 Ga0075434_100044958 Ga0075434_1000449584 281
351 3300009094 Ga0111539_10032226 Ga0111539_100322262 281
352 3300014969 Ga0157376_10103696 Ga0157376_101036962 281
353 3300020075 Ga0206349_1541197 Ga0206349_15411972 281
354 3300020081 Ga0206354_10500860 Ga0206354_105008602 281
355 3300022467 Ga0224712_10003353 Ga0224712_100033533 281
356 3300048913 Ga0496110_0316810 Ga0496110_0316810_467_1396 281
357 3300048916 Ga0496113_0016988 Ga0496113_0016988_2762_3700 281
358 3300048929 Ga0496126_0078461 Ga0496126_0078461_305_1261 281
359 3300050512 nmdc:mga0n895_262196_c1 nmdc:mga0n895_262196_c1_569_1507 281
360 3300005327 Ga0070658_10167961 Ga0070658_101679612 282
361 3300005435 Ga0070714_100001325 Ga0070714_10000132513 282
362 3300005436 Ga0070713_100021482 Ga0070713_1000214823 282
363 3300007076 Ga0075435_100064936 Ga0075435_1000649362 282
364 3300025901 Ga0207688_10106533 Ga0207688_101065332 282
365 3300025919 Ga0207657_10089951 Ga0207657_100899511 282
366 3300025928 Ga0207700_10057202 Ga0207700_100572023 282
367 3300025929 Ga0207664_10000940 Ga0207664_100009405 282
368 3300025961 Ga0207712_10098587 Ga0207712_100985872 282
369 3300026118 Ga0207675_100037515 Ga0207675_1000375154 282
370 3300046476 Ga0495662_0160612 Ga0495662_0160612_40_996 282
371 3300046511 Ga0495608_0108063 Ga0495608_0108063_161_1156 282
372 3300046675 Ga0495657_0056185 Ga0495657_0056185_120_1076 282
373 3300046690 Ga0495624_0114947 Ga0495624_0114947_21_977 282
374 3300047317 Ga0495604_0136622 Ga0495604_0136622_733_1728 282
375 3300047471 Ga0495684_0029724 Ga0495684_0029724_399_1355 282
376 3300005471 Ga0070698_100131717 Ga0070698_1001317172 283
377 3300005536 Ga0070697_100140261 Ga0070697_1001402613 283
378 3300046459 Ga0495629_0003615 Ga0495629_0003615_1596_2552 283
379 3300046476 Ga0495662_0103426 Ga0495662_0103426_350_1306 283
380 3300046477 Ga0495664_0010930 Ga0495664_0010930_295_1251 283
381 3300046500 Ga0495596_0022225 Ga0495596_0022225_464_1399 283
382 3300046511 Ga0495608_0236051 Ga0495608_0236051_40_996 283
383 3300046526 Ga0495666_0058276 Ga0495666_0058276_355_1311 283
384 3300046679 Ga0495623_0058265 Ga0495623_0058265_1441_2397 283
385 3300046690 Ga0495624_0013469 Ga0495624_0013469_4359_5315 283
386 3300047319 Ga0495674_0025284 Ga0495674_0025284_1347_2303 283
387 3300047444 Ga0495675_0020526 Ga0495675_0020526_999_1955 283
388 3300047673 Ga0495593_0025477 Ga0495593_0025477_2041_2997 283
389 3300048088 Ga0495602_0328137 Ga0495602_0328137_147_1100 283
390 3300048089 Ga0495614_0086759 Ga0495614_0086759_176_1132 283
391 3300049581 Ga0501047_0000141 Ga0501047_0000141_85590_86546 283
392 3300053085 Ga0495619_0056829 Ga0495619_0056829_20_976 283
393 3300005563 Ga0068855_100449672 Ga0068855_1004496721 284
394 3300009174 Ga0105241_10379178 Ga0105241_103791782 284
395 3300050510 nmdc:mga06r32_28294_c1 nmdc:mga06r32_28294_c1_3700_4650 284
396 3300005530 Ga0070679_100085114 Ga0070679_1000851142 285
397 3300006846 Ga0075430_100006545 Ga0075430_1000065451 285
398 3300006880 Ga0075429_100002678 Ga0075429_1000026782 285
399 3300009147 Ga0114129_10009018 Ga0114129_100090182 285
400 3300010159 Ga0099796_10050215 Ga0099796_100502152 285
401 3300013306 Ga0163162_10127754 Ga0163162_101277543 285
402 3300022467 Ga0224712_10021811 Ga0224712_100218111 285
403 3300050509 nmdc:mga0qj67_43141_c1 nmdc:mga0qj67_43141_c1_936_1886 285
404 3300020077 Ga0206351_10996409 Ga0206351_109964092 286
405 3300025918 Ga0207662_10011478 Ga0207662_100114782 286
406 3300031548 Ga0307408_100030377 Ga0307408_1000303772 286
407 3300031824 Ga0307413_10002297 Ga0307413_100022974 286
408 3300031852 Ga0307410_10012065 Ga0307410_100120653 286
409 3300031852 Ga0307410_10017362 Ga0307410_100173624 286
410 3300031911 Ga0307412_10037573 Ga0307412_100375734 286
411 3300032002 Ga0307416_100022814 Ga0307416_1000228142 286
412 3300032005 Ga0307411_10003583 Ga0307411_100035838 286
413 3300032126 Ga0307415_100165772 Ga0307415_1001657722 286
414 3300037418 Ga0395900_0256887 Ga0395900_0256887_534_1469 286
415 3300037466 Ga0395898_0161474 Ga0395898_0161474_967_1902 286
416 3300037853 Ga0436364_1537007 Ga0436364_1537007_2345_3301 286
417 3300042157 Ga0439458_0003964 Ga0439458_0003964_998_1936 286
418 3300005437 Ga0070710_10000864 Ga0070710_1000086411 287
419 3300005981 Ga0081538_10026674 Ga0081538_100266744 287
420 3300005983 Ga0081540_1000330 Ga0081540_100033017 287
421 3300031616 Ga0307508_10306467 Ga0307508_103064671 287
422 3300031731 Ga0307405_10034777 Ga0307405_100347774 287
423 3300031995 Ga0307409_100224732 Ga0307409_1002247322 287
424 3300032002 Ga0307416_100014187 Ga0307416_1000141874 287
425 3300032126 Ga0307415_100001464 Ga0307415_1000014646 287
426 3300035398 Ga0316574_0003741 Ga0316574_0003741_6135_7094 287
427 3300042005 Ga0439448_0000572 Ga0439448_0000572_6961_7896 287
428 3300042012 Ga0439455_0026469 Ga0439455_0026469_273_1208 287
429 3300042016 Ga0439463_003040 Ga0439463_003040_3023_3958 287
430 3300042439 Ga0439464_0010056 Ga0439464_0010056_1106_2041 287
431 3300042439 Ga0439464_0010767 Ga0439464_0010767_286_1221 287
432 3300042461 Ga0439460_0012086 Ga0439460_0012086_1107_2042 287
433 3300042461 Ga0439460_0044508 Ga0439460_0044508_186_1121 287
434 3300042530 Ga0450916_000764 Ga0450916_000764_585_1520 287
435 3300049568 Ga0501031_0174904 Ga0501031_0174904_48_983 287
436 3300049569 Ga0501032_0100248 Ga0501032_0100248_52_987 287
437 3300049570 Ga0501033_0149713 Ga0501033_0149713_411_1346 287
438 3300049572 Ga0501036_0003648 Ga0501036_0003648_1619_2554 287
439 3300049573 Ga0501037_0120427 Ga0501037_0120427_149_1084 287
440 3300049574 Ga0501038_0109061 Ga0501038_0109061_979_1914 287
441 3300049575 Ga0501039_0000354 Ga0501039_0000354_14859_15794 287
442 3300049576 Ga0501040_0000917 Ga0501040_0000917_2715_3650 287
443 3300049577 Ga0501041_0022606 Ga0501041_0022606_1608_2543 287
444 3300049578 Ga0501042_0017637 Ga0501042_0017637_1927_2862 287
445 3300049580 Ga0501046_0071323 Ga0501046_0071323_1679_2614 287
446 3300049582 Ga0501048_0011341 Ga0501048_0011341_4038_4973 287
447 3300049584 Ga0501068_0011701 Ga0501068_0011701_1176_2111 287
448 3300049588 Ga0501072_0001751 Ga0501072_0001751_14851_15786 287
449 3300049590 Ga0501074_0092134 Ga0501074_0092134_694_1629 287
450 3300049591 Ga0501075_0000450 Ga0501075_0000450_6729_7664 287
451 3300049593 Ga0501077_0010629 Ga0501077_0010629_739_1674 287
452 3300049741 Ga0501079_0001334 Ga0501079_0001334_14322_15257 287
453 3300049822 Ga0501035_0295741 Ga0501035_0295741_77_1012 287
454 3300049824 Ga0501045_0021181 Ga0501045_0021181_915_1850 287
455 3300054114 Ga0501084_0014695 Ga0501084_0014695_1256_2191 287
456 3300059424 Ga0590075_005988 Ga0590075_005988_35_970 287
457 3300059426 Ga0590077_001146 Ga0590077_001146_3521_4456 287
458 3300060353 Ga0501082_0007058 Ga0501082_0007058_1891_2826 287
459 3300061734 Ga0530510_0000669 Ga0530510_0000669_928_1863 287
460 3300037471 Ga0395905_0028781 Ga0395905_0028781_4155_5090 288
461 3300038443 Ga0395901_0231170 Ga0395901_0231170_60_995 288
462 3300005548 Ga0070665_100147095 Ga0070665_1001470953 289
463 iso_pu_bacteria 2684623035 2686539196 289
464 iso_pu_bacteria 2895880812 2895890449 289
465 iso_pu_bacteria 2515154088 2515496569 290
466 iso_pu_bacteria 2515154129 2515718426 290
467 iso_pu_bacteria 2515154137 2515756807 290
468 iso_pu_bacteria 2515154202 2516083418 290
469 iso_pu_bacteria 2515154203 2516089330 290
470 iso_pu_bacteria 2675903059 2676480256 290
471 iso_pu_bacteria 2832004796 2832007879 290
472 iso_pu_bacteria 2855683550 2855685961 290
473 iso_pu_bacteria 2861520306 2861524772 290
474 iso_pu_bacteria 2866065130 2866068786 290
475 iso_pu_bacteria 8003856774 8003858437 290
476 iso_pu_bacteria 8056054917 8056056906 290
477 3300031852 Ga0307410_10151531 Ga0307410_101515313 291
478 3300031911 Ga0307412_10176155 Ga0307412_101761551 291
479 3300032126 Ga0307415_100115846 Ga0307415_1001158463 291
480 iso_pu_bacteria 2515154155 2515855258 291
481 iso_pu_bacteria 2675903058 2676473578 291
482 iso_pu_bacteria 2731639228 2731909024 291
483 iso_pu_bacteria 2799112218 2799184882 291
484 iso_pu_bacteria 2827628540 2827632091 291
485 3300005434 Ga0070709_10036675 Ga0070709_100366753 292
486 3300005436 Ga0070713_100003097 Ga0070713_1000030978 292
487 3300005436 Ga0070713_100012555 Ga0070713_1000125554 292
488 3300005439 Ga0070711_100127218 Ga0070711_1001272182 292
489 3300005539 Ga0068853_100331322 Ga0068853_1003313222 292
490 3300006173 Ga0070716_100045435 Ga0070716_1000454352 292
491 3300006175 Ga0070712_100014062 Ga0070712_1000140624 292
492 3300009147 Ga0114129_10047822 Ga0114129_100478224 292
493 3300009148 Ga0105243_10365331 Ga0105243_103653311 292
494 3300009177 Ga0105248_10294461 Ga0105248_102944612 292
495 3300021358 Ga0213873_10019370 Ga0213873_100193702 292
496 3300021388 Ga0213875_10016542 Ga0213875_100165423 292
497 3300021441 Ga0213871_10050030 Ga0213871_100500301 292
498 3300022467 Ga0224712_10127430 Ga0224712_101274301 292
499 3300025912 Ga0207707_10109135 Ga0207707_101091352 292
500 3300025915 Ga0207693_10008773 Ga0207693_100087737 292
501 3300025915 Ga0207693_10085727 Ga0207693_100857272 292
502 3300025916 Ga0207663_10074280 Ga0207663_100742802 292
503 3300025928 Ga0207700_10021329 Ga0207700_100213293 292
504 3300025928 Ga0207700_10034120 Ga0207700_100341204 292
505 3300025929 Ga0207664_10007361 Ga0207664_100073617 292
506 3300025929 Ga0207664_10020499 Ga0207664_100204995 292
507 3300025929 Ga0207664_10304935 Ga0207664_103049352 292
508 3300025939 Ga0207665_10134613 Ga0207665_101346132 292
509 3300025939 Ga0207665_10141555 Ga0207665_101415552 292
510 3300025940 Ga0207691_10029944 Ga0207691_100299441 292
511 3300025944 Ga0207661_10130930 Ga0207661_101309302 292
512 3300025944 Ga0207661_10510587 Ga0207661_105105871 292
513 3300026041 Ga0207639_10328799 Ga0207639_103287991 292
514 3300026078 Ga0207702_10370778 Ga0207702_103707782 292
515 3300026116 Ga0207674_10123468 Ga0207674_101234681 292
516 3300028800 Ga0265338_10031380 Ga0265338_100313805 292
517 3300035111 Ga0373923_0056349 Ga0373923_0056349_18_995 292
518 3300035111 Ga0373923_0066202 Ga0373923_0066202_90_1043 292
519 3300035118 Ga0373954_0061833 Ga0373954_0061833_146_1117 292
520 3300035410 Ga0373924_0011689 Ga0373924_0011689_150_1103 292
521 3300035692 Ga0373935_0073581 Ga0373935_0073581_342_1295 292
522 3300035724 Ga0373933_0037724 Ga0373933_0037724_864_1817 292
523 3300035724 Ga0373933_0142720 Ga0373933_0142720_105_1058 292
524 3300036401 Ga0373937_0000312 Ga0373937_0000312_17081_18034 292
525 3300036401 Ga0373937_0007378 Ga0373937_0007378_6594_7547 292
526 3300036401 Ga0373937_0046082 Ga0373937_0046082_735_1688 292
527 3300036401 Ga0373937_0106572 Ga0373937_0106572_1555_2508 292
528 3300037068 Ga0373925_0221542 Ga0373925_0221542_109_1062 292
529 3300037853 Ga0436364_0093921 Ga0436364_0093921_7981_8934 292
530 3300037853 Ga0436364_0786912 Ga0436364_0786912_1101_2054 292
531 3300037853 Ga0436364_1083867 Ga0436364_1083867_2902_3855 292
532 3300039438 Ga0436360_0021783 Ga0436360_0021783_253_1206 292
533 3300039438 Ga0436360_0455054 Ga0436360_0455054_1003_2013 292
534 3300042005 Ga0439448_0051675 Ga0439448_0051675_184_1122 292
535 3300044693 Ga0466961_0233543 Ga0466961_0233543_159_1112 292
536 3300044694 Ga0466963_0038698 Ga0466963_0038698_172_1125 292
537 3300044719 Ga0466971_0124060 Ga0466971_0124060_171_1124 292
538 3300044765 Ga0466970_0032333 Ga0466970_0032333_800_1753 292
539 3300046454 Ga0495592_0045713 Ga0495592_0045713_1800_2753 292
540 3300046477 Ga0495664_0006872 Ga0495664_0006872_4495_5448 292
541 3300046511 Ga0495608_0020716 Ga0495608_0020716_693_1646 292
542 3300046511 Ga0495608_0044749 Ga0495608_0044749_1431_2384 292
543 3300046511 Ga0495608_0275611 Ga0495608_0275611_64_1017 292
544 3300046514 Ga0495618_0130471 Ga0495618_0130471_354_1307 292
545 3300046516 Ga0495628_0254132 Ga0495628_0254132_294_1247 292
546 3300046529 Ga0495652_0152813 Ga0495652_0152813_183_1136 292
547 3300046533 Ga0495640_0056386 Ga0495640_0056386_1317_2270 292
548 3300046536 Ga0495587_0010018 Ga0495587_0010018_368_1321 292
549 3300046543 Ga0495645_0001100 Ga0495645_0001100_7617_8570 292
550 3300046559 Ga0495667_0005370 Ga0495667_0005370_1391_2344 292
551 3300046559 Ga0495667_0030351 Ga0495667_0030351_593_1546 292
552 3300046663 Ga0495635_0033733 Ga0495635_0033733_2121_3074 292
553 3300046679 Ga0495623_0100795 Ga0495623_0100795_347_1300 292
554 3300046680 Ga0495646_0136431 Ga0495646_0136431_83_1036 292
555 3300046680 Ga0495646_0150015 Ga0495646_0150015_332_1285 292
556 3300046809 Ga0495600_0219902 Ga0495600_0219902_196_1149 292
557 3300047319 Ga0495674_0186190 Ga0495674_0186190_22_975 292
558 3300047322 Ga0495680_0203865 Ga0495680_0203865_64_1017 292
559 3300047322 Ga0495680_0224846 Ga0495680_0224846_291_1244 292
560 3300047322 Ga0495680_0338032 Ga0495680_0338032_13_966 292
561 3300047444 Ga0495675_0031919 Ga0495675_0031919_2043_2996 292
562 3300047444 Ga0495675_0081429 Ga0495675_0081429_496_1449 292
563 3300047471 Ga0495684_0045475 Ga0495684_0045475_1985_2938 292
564 3300048088 Ga0495602_0000195 Ga0495602_0000195_39396_40349 292
565 3300048922 Ga0496119_0003055 Ga0496119_0003055_15979_16932 292
566 3300048924 Ga0496121_0210719 Ga0496121_0210719_366_1319 292
567 3300053077 Ga0495601_0046037 Ga0495601_0046037_1778_2731 292
568 3300053077 Ga0495601_0098392 Ga0495601_0098392_180_1133 292
569 3300053078 Ga0495612_0003726 Ga0495612_0003726_1838_2791 292
570 3300053084 Ga0495595_0001056 Ga0495595_0001056_8946_9899 292
571 3300053084 Ga0495595_0017836 Ga0495595_0017836_838_1791 292
572 3300053085 Ga0495619_0115459 Ga0495619_0115459_530_1483 292
573 3300054114 Ga0501084_0352786 Ga0501084_0352786_270_1223 292
574 3300005327 Ga0070658_10000726 Ga0070658_1000072631 293
575 3300005329 Ga0070683_100072950 Ga0070683_1000729503 293
576 3300005329 Ga0070683_100220782 Ga0070683_1002207822 293
577 3300005335 Ga0070666_10106644 Ga0070666_101066442 293
578 3300005336 Ga0070680_100043236 Ga0070680_1000432363 293
579 3300005343 Ga0070687_100007727 Ga0070687_1000077274 293
580 3300005354 Ga0070675_100028479 Ga0070675_1000284792 293
581 3300005355 Ga0070671_100044503 Ga0070671_1000445033 293
582 3300005364 Ga0070673_100038754 Ga0070673_1000387542 293
583 3300005366 Ga0070659_100067507 Ga0070659_1000675072 293
584 3300005434 Ga0070709_10012963 Ga0070709_100129634 293
585 3300005434 Ga0070709_10088459 Ga0070709_100884592 293
586 3300005434 Ga0070709_10114686 Ga0070709_101146862 293
587 3300005435 Ga0070714_100025088 Ga0070714_1000250882 293
588 3300005435 Ga0070714_100117982 Ga0070714_1001179822 293
589 3300005436 Ga0070713_100008642 Ga0070713_1000086424 293
590 3300005436 Ga0070713_100149652 Ga0070713_1001496522 293
591 3300005436 Ga0070713_100165594 Ga0070713_1001655941 293
592 3300005437 Ga0070710_10016620 Ga0070710_100166203 293
593 3300005437 Ga0070710_10063603 Ga0070710_100636032 293
594 3300005437 Ga0070710_10085268 Ga0070710_100852681 293
595 3300005438 Ga0070701_10085083 Ga0070701_100850832 293
596 3300005439 Ga0070711_100027416 Ga0070711_1000274163 293
597 3300005439 Ga0070711_100056913 Ga0070711_1000569131 293
598 3300005445 Ga0070708_100198649 Ga0070708_1001986492 293
599 3300005445 Ga0070708_100238464 Ga0070708_1002384641 293
600 3300005458 Ga0070681_10101000 Ga0070681_101010003 293
601 3300005458 Ga0070681_10390902 Ga0070681_103909022 293
602 3300005458 Ga0070681_10393953 Ga0070681_103939531 293
603 3300005458 Ga0070681_10537162 Ga0070681_105371621 293
604 3300005466 Ga0070685_10060058 Ga0070685_100600582 293
605 3300005467 Ga0070706_100000990 Ga0070706_10000099014 293
606 3300005467 Ga0070706_100008020 Ga0070706_1000080207 293
607 3300005467 Ga0070706_100057020 Ga0070706_1000570202 293
608 3300005467 Ga0070706_100083098 Ga0070706_1000830981 293
609 3300005467 Ga0070706_100096173 Ga0070706_1000961733 293
610 3300005468 Ga0070707_100000256 Ga0070707_10000025632 293
611 3300005468 Ga0070707_100004570 Ga0070707_10000457010 293
612 3300005468 Ga0070707_100168762 Ga0070707_1001687622 293
613 3300005468 Ga0070707_100180529 Ga0070707_1001805292 293
614 3300005468 Ga0070707_100198649 Ga0070707_1001986491 293
615 3300005468 Ga0070707_100233617 Ga0070707_1002336171 293
616 3300005468 Ga0070707_100254561 Ga0070707_1002545612 293
617 3300005468 Ga0070707_100305997 Ga0070707_1003059971 293
618 3300005471 Ga0070698_100000292 Ga0070698_10000029220 293
619 3300005471 Ga0070698_100000333 Ga0070698_10000033327 293
620 3300005471 Ga0070698_100002525 Ga0070698_10000252513 293
621 3300005471 Ga0070698_100017040 Ga0070698_1000170402 293
622 3300005471 Ga0070698_100086838 Ga0070698_1000868383 293
623 3300005518 Ga0070699_100020685 Ga0070699_1000206851 293
624 3300005518 Ga0070699_100028148 Ga0070699_1000281482 293
625 3300005518 Ga0070699_100221012 Ga0070699_1002210121 293
626 3300005530 Ga0070679_100040543 Ga0070679_1000405434 293
627 3300005530 Ga0070679_100173911 Ga0070679_1001739111 293
628 3300005539 Ga0068853_100227422 Ga0068853_1002274221 293
629 3300005544 Ga0070686_100004813 Ga0070686_1000048133 293
630 3300005546 Ga0070696_100008315 Ga0070696_1000083153 293
631 3300005547 Ga0070693_100016084 Ga0070693_1000160842 293
632 3300005548 Ga0070665_100117827 Ga0070665_1001178272 293
633 3300005564 Ga0070664_100016206 Ga0070664_1000162062 293
634 3300005578 Ga0068854_100125742 Ga0068854_1001257422 293
635 3300005614 Ga0068856_100320759 Ga0068856_1003207591 293
636 3300005614 Ga0068856_100380650 Ga0068856_1003806502 293
637 3300005615 Ga0070702_100030640 Ga0070702_1000306402 293
638 3300005616 Ga0068852_100011289 Ga0068852_1000112897 293
639 3300005616 Ga0068852_100295725 Ga0068852_1002957252 293
640 3300005618 Ga0068864_100058887 Ga0068864_1000588872 293
641 3300005719 Ga0068861_100220936 Ga0068861_1002209362 293
642 3300005841 Ga0068863_100021114 Ga0068863_1000211145 293
643 3300005841 Ga0068863_100111276 Ga0068863_1001112763 293
644 3300005841 Ga0068863_100144648 Ga0068863_1001446482 293
645 3300005842 Ga0068858_100180277 Ga0068858_1001802771 293
646 3300005842 Ga0068858_100188374 Ga0068858_1001883742 293
647 3300005983 Ga0081540_1005418 Ga0081540_10054186 293
648 3300005983 Ga0081540_1020749 Ga0081540_10207492 293
649 3300006028 Ga0070717_10011881 Ga0070717_100118817 293
650 3300006028 Ga0070717_10050812 Ga0070717_100508122 293
651 3300006028 Ga0070717_10076722 Ga0070717_100767221 293
652 3300006028 Ga0070717_10263592 Ga0070717_102635922 293
653 3300006028 Ga0070717_10461944 Ga0070717_104619441 293
654 3300006163 Ga0070715_10057037 Ga0070715_100570372 293
655 3300006173 Ga0070716_100026533 Ga0070716_1000265331 293
656 3300006175 Ga0070712_100002052 Ga0070712_10000205210 293
657 3300006175 Ga0070712_100008902 Ga0070712_1000089024 293
658 3300006175 Ga0070712_100093705 Ga0070712_1000937052 293
659 3300006237 Ga0097621_100002544 Ga0097621_1000025447 293
660 3300006358 Ga0068871_100091961 Ga0068871_1000919612 293
661 3300006358 Ga0068871_100129495 Ga0068871_1001294952 293
662 3300006844 Ga0075428_100020125 Ga0075428_1000201254 293
663 3300006846 Ga0075430_100000294 Ga0075430_1000002943 293
664 3300006846 Ga0075430_100155213 Ga0075430_1001552133 293
665 3300006871 Ga0075434_100009917 Ga0075434_1000099176 293
666 3300006871 Ga0075434_100216438 Ga0075434_1002164381 293
667 3300006880 Ga0075429_100044119 Ga0075429_1000441193 293
668 3300006914 Ga0075436_100004879 Ga0075436_1000048797 293
669 3300007076 Ga0075435_100328524 Ga0075435_1003285242 293
670 3300009094 Ga0111539_10047409 Ga0111539_100474093 293
671 3300009098 Ga0105245_10005437 Ga0105245_100054374 293
672 3300009098 Ga0105245_10056487 Ga0105245_100564872 293
673 3300009147 Ga0114129_10006711 Ga0114129_100067113 293
674 3300009147 Ga0114129_10184699 Ga0114129_101846993 293
675 3300009177 Ga0105248_10152913 Ga0105248_101529132 293
676 3300013104 Ga0157370_10049599 Ga0157370_100495992 293
677 3300013104 Ga0157370_10090646 Ga0157370_100906462 293
678 3300013105 Ga0157369_10011739 Ga0157369_100117393 293
679 3300013296 Ga0157374_10020729 Ga0157374_100207294 293
680 3300013306 Ga0163162_10013494 Ga0163162_100134944 293
681 3300013308 Ga0157375_10193002 Ga0157375_101930022 293
682 3300014325 Ga0163163_10001600 Ga0163163_100016004 293
683 3300014968 Ga0157379_10017361 Ga0157379_100173614 293
684 3300014968 Ga0157379_10150130 Ga0157379_101501303 293
685 3300017792 Ga0163161_10099487 Ga0163161_100994873 293
686 3300021388 Ga0213875_10000250 Ga0213875_100002502 293
687 3300021388 Ga0213875_10033159 Ga0213875_100331593 293
688 3300022467 Ga0224712_10013796 Ga0224712_100137962 293
689 3300022467 Ga0224712_10017923 Ga0224712_100179232 293
690 3300024225 Ga0224572_1000791 Ga0224572_10007912 293
691 3300025885 Ga0207653_10008398 Ga0207653_100083983 293
692 3300025898 Ga0207692_10004739 Ga0207692_100047395 293
693 3300025898 Ga0207692_10025602 Ga0207692_100256022 293
694 3300025898 Ga0207692_10033061 Ga0207692_100330613 293
695 3300025898 Ga0207692_10138175 Ga0207692_101381752 293
696 3300025898 Ga0207692_10244113 Ga0207692_102441131 293
697 3300025903 Ga0207680_10025579 Ga0207680_100255792 293
698 3300025905 Ga0207685_10039962 Ga0207685_100399621 293
699 3300025906 Ga0207699_10074359 Ga0207699_100743591 293
700 3300025906 Ga0207699_10154582 Ga0207699_101545821 293
701 3300025909 Ga0207705_10001642 Ga0207705_100016422 293
702 3300025910 Ga0207684_10002799 Ga0207684_1000279911 293
703 3300025910 Ga0207684_10015342 Ga0207684_100153425 293
704 3300025910 Ga0207684_10092354 Ga0207684_100923544 293
705 3300025911 Ga0207654_10054753 Ga0207654_100547531 293
706 3300025912 Ga0207707_10035796 Ga0207707_100357962 293
707 3300025913 Ga0207695_10361244 Ga0207695_103612442 293
708 3300025914 Ga0207671_10151559 Ga0207671_101515592 293
709 3300025915 Ga0207693_10005180 Ga0207693_100051807 293
710 3300025915 Ga0207693_10013430 Ga0207693_100134304 293
711 3300025915 Ga0207693_10014990 Ga0207693_100149905 293
712 3300025915 Ga0207693_10138270 Ga0207693_101382702 293
713 3300025916 Ga0207663_10010431 Ga0207663_100104312 293
714 3300025916 Ga0207663_10014695 Ga0207663_100146952 293
715 3300025916 Ga0207663_10039635 Ga0207663_100396352 293
716 3300025916 Ga0207663_10084495 Ga0207663_100844951 293
717 3300025918 Ga0207662_10052164 Ga0207662_100521642 293
718 3300025921 Ga0207652_10403798 Ga0207652_104037982 293
719 3300025922 Ga0207646_10001124 Ga0207646_1000112417 293
720 3300025922 Ga0207646_10031779 Ga0207646_100317794 293
721 3300025922 Ga0207646_10044143 Ga0207646_100441433 293
722 3300025922 Ga0207646_10184097 Ga0207646_101840972 293
723 3300025922 Ga0207646_10201908 Ga0207646_102019082 293
724 3300025927 Ga0207687_10006217 Ga0207687_100062174 293
725 3300025927 Ga0207687_10074652 Ga0207687_100746521 293
726 3300025928 Ga0207700_10001672 Ga0207700_100016728 293
727 3300025928 Ga0207700_10002173 Ga0207700_100021735 293
728 3300025928 Ga0207700_10020413 Ga0207700_100204135 293
729 3300025928 Ga0207700_10022331 Ga0207700_100223315 293
730 3300025928 Ga0207700_10096005 Ga0207700_100960052 293
731 3300025928 Ga0207700_10301731 Ga0207700_103017311 293
732 3300025929 Ga0207664_10002584 Ga0207664_100025842 293
733 3300025929 Ga0207664_10021524 Ga0207664_100215245 293
734 3300025929 Ga0207664_10052186 Ga0207664_100521862 293
735 3300025929 Ga0207664_10053493 Ga0207664_100534932 293
736 3300025929 Ga0207664_10080047 Ga0207664_100800473 293
737 3300025931 Ga0207644_10044521 Ga0207644_100445214 293
738 3300025934 Ga0207686_10114479 Ga0207686_101144792 293
739 3300025936 Ga0207670_10035613 Ga0207670_100356134 293
740 3300025939 Ga0207665_10001719 Ga0207665_100017199 293
741 3300025939 Ga0207665_10025411 Ga0207665_100254113 293
742 3300025939 Ga0207665_10056283 Ga0207665_100562831 293
743 3300025941 Ga0207711_10178971 Ga0207711_101789712 293
744 3300025942 Ga0207689_10017179 Ga0207689_100171793 293
745 3300025972 Ga0207668_10127648 Ga0207668_101276481 293
746 3300025981 Ga0207640_10046715 Ga0207640_100467153 293
747 3300026035 Ga0207703_10040754 Ga0207703_100407542 293
748 3300026041 Ga0207639_10083405 Ga0207639_100834052 293
749 3300026067 Ga0207678_10006007 Ga0207678_100060075 293
750 3300026075 Ga0207708_10046904 Ga0207708_100469043 293
751 3300026078 Ga0207702_10043655 Ga0207702_100436554 293
752 3300026078 Ga0207702_10056949 Ga0207702_100569492 293
753 3300026078 Ga0207702_10070243 Ga0207702_100702433 293
754 3300026078 Ga0207702_10130343 Ga0207702_101303432 293
755 3300026078 Ga0207702_10386642 Ga0207702_103866422 293
756 3300026095 Ga0207676_10156658 Ga0207676_101566582 293
757 3300026116 Ga0207674_10004964 Ga0207674_1000496411 293
758 3300026121 Ga0207683_10005606 Ga0207683_1000560611 293
759 3300026142 Ga0207698_10002366 Ga0207698_100023665 293
760 3300027907 Ga0207428_10068605 Ga0207428_100686054 293
761 3300028379 Ga0268266_10525110 Ga0268266_105251101 293
762 3300030744 Ga0316181_1149483 Ga0316181_11494831 293
763 3300031247 Ga0265340_10013418 Ga0265340_100134184 293
764 3300031456 Ga0307513_10000001 Ga0307513_10000001395 293
765 3300031691 Ga0316579_10011444 Ga0316579_100114443 293
766 3300031727 Ga0316576_10014040 Ga0316576_100140402 293
767 3300031728 Ga0316578_10020196 Ga0316578_100201964 293
768 3300031730 Ga0307516_10001792 Ga0307516_1000179222 293
769 3300032133 Ga0316583_10003287 Ga0316583_100032874 293
770 3300032137 Ga0316585_10024611 Ga0316585_100246112 293
771 3300034816 Ga0373930_0011979 Ga0373930_0011979_138_1124 293
772 3300034817 Ga0373948_0010418 Ga0373948_0010418_416_1402 293
773 3300035084 Ga0373928_0007014 Ga0373928_0007014_1058_2014 293
774 3300035086 Ga0373934_0002196 Ga0373934_0002196_2505_3461 293
775 3300035086 Ga0373934_0006637 Ga0373934_0006637_46_1002 293
776 3300035088 Ga0373940_0020952 Ga0373940_0020952_38_994 293
777 3300035088 Ga0373940_0040831 Ga0373940_0040831_247_1203 293
778 3300035089 Ga0373944_0002438 Ga0373944_0002438_3634_4590 293
779 3300035090 Ga0373949_0003325 Ga0373949_0003325_606_1562 293
780 3300035090 Ga0373949_0023621 Ga0373949_0023621_228_1202 293
781 3300035111 Ga0373923_0011010 Ga0373923_0011010_1777_2733 293
782 3300035112 Ga0373932_0016751 Ga0373932_0016751_874_1830 293
783 3300035113 Ga0373936_0001293 Ga0373936_0001293_6972_7928 293
784 3300035113 Ga0373936_0083543 Ga0373936_0083543_288_1244 293
785 3300035116 Ga0373945_0044491 Ga0373945_0044491_482_1438 293
786 3300035117 Ga0373953_0001732 Ga0373953_0001732_3076_4032 293
787 3300035117 Ga0373953_0010341 Ga0373953_0010341_940_1896 293
788 3300035118 Ga0373954_0040812 Ga0373954_0040812_1135_2091 293
789 3300035119 Ga0373956_0020043 Ga0373956_0020043_361_1317 293
790 3300035119 Ga0373956_0126010 Ga0373956_0126010_40_996 293
791 3300035120 Ga0373957_0002117 Ga0373957_0002117_4138_5094 293
792 3300035120 Ga0373957_0033521 Ga0373957_0033521_63_1019 293
793 3300035121 Ga0373960_0004470 Ga0373960_0004470_766_1722 293
794 3300035170 Ga0373943_0001340 Ga0373943_0001340_4859_5815 293
795 3300035171 Ga0373946_0001065 Ga0373946_0001065_1685_2641 293
796 3300035171 Ga0373946_0017131 Ga0373946_0017131_171_1127 293
797 3300035172 Ga0373955_0017001 Ga0373955_0017001_45_1001 293
798 3300035172 Ga0373955_0049962 Ga0373955_0049962_453_1409 293
799 3300035172 Ga0373955_0058166 Ga0373955_0058166_942_1898 293
800 3300035207 Ga0373942_0022330 Ga0373942_0022330_165_1121 293
801 3300035398 Ga0316574_0001450 Ga0316574_0001450_3723_4691 293
802 3300035410 Ga0373924_0029116 Ga0373924_0029116_197_1153 293
803 3300035410 Ga0373924_0076608 Ga0373924_0076608_339_1295 293
804 3300035691 Ga0373931_0027647 Ga0373931_0027647_998_1984 293
805 3300035692 Ga0373935_0003744 Ga0373935_0003744_1135_2091 293
806 3300035692 Ga0373935_0053505 Ga0373935_0053505_235_1191 293
807 3300035692 Ga0373935_0075094 Ga0373935_0075094_1184_2140 293
808 3300035695 Ga0373927_0003060 Ga0373927_0003060_6567_7523 293
809 3300035724 Ga0373933_0001577 Ga0373933_0001577_9089_10045 293
810 3300035724 Ga0373933_0015191 Ga0373933_0015191_3141_4097 293
811 3300035724 Ga0373933_0019084 Ga0373933_0019084_2732_3688 293
812 3300035724 Ga0373933_0022077 Ga0373933_0022077_1230_2186 293
813 3300035725 Ga0373947_0003580 Ga0373947_0003580_1363_2319 293
814 3300036401 Ga0373937_0003119 Ga0373937_0003119_3845_4801 293
815 3300036401 Ga0373937_0074903 Ga0373937_0074903_110_1066 293
816 3300036401 Ga0373937_0232432 Ga0373937_0232432_168_1124 293
817 3300036401 Ga0373937_0236231 Ga0373937_0236231_617_1573 293
818 3300036401 Ga0373937_0373198 Ga0373937_0373198_191_1147 293
819 3300036712 Ga0316584_0018562 Ga0316584_0018562_1628_2596 293
820 3300037068 Ga0373925_0023473 Ga0373925_0023473_1739_2695 293
821 3300037853 Ga0436364_0287407 Ga0436364_0287407_50273_51229 293
822 3300037853 Ga0436364_0639700 Ga0436364_0639700_201_1157 293
823 3300039450 Ga0436363_0045890 Ga0436363_0045890_110_1105 293
824 3300039450 Ga0436363_0838504 Ga0436363_0838504_1969_2925 293
825 3300041404 Ga0439436_0003729 Ga0439436_0003729_662_1612 293
826 3300041999 Ga0439433_0009335 Ga0439433_0009335_567_1517 293
827 3300042002 Ga0439442_011772 Ga0439442_011772_148_1098 293
828 3300042007 Ga0439449_0005338 Ga0439449_0005338_2156_3106 293
829 3300044683 Ga0466965_0142339 Ga0466965_0142339_173_1129 293
830 3300044694 Ga0466963_0267352 Ga0466963_0267352_25_981 293
831 3300044706 Ga0466964_0063476 Ga0466964_0063476_328_1293 293
832 3300044735 Ga0466968_0000127 Ga0466968_0000127_16019_16975 293
833 3300044765 Ga0466970_0001582 Ga0466970_0001582_8737_9693 293
834 3300044901 Ga0466960_0014624 Ga0466960_0014624_327_1289 293
835 3300044901 Ga0466960_0098437 Ga0466960_0098437_85_1041 293
836 3300045049 Ga0466959_0285378 Ga0466959_0285378_69_1025 293
837 3300045836 Ga0466958_0025951 Ga0466958_0025951_509_1465 293
838 3300045976 Ga0466967_0006236 Ga0466967_0006236_3225_4190 293
839 3300045976 Ga0466967_0097718 Ga0466967_0097718_537_1493 293
840 3300045976 Ga0466967_0123286 Ga0466967_0123286_611_1567 293
841 3300045976 Ga0466967_0141670 Ga0466967_0141670_1128_2093 293
842 3300045976 Ga0466967_0144241 Ga0466967_0144241_1178_2143 293
843 3300045976 Ga0466967_0168790 Ga0466967_0168790_716_1672 293
844 3300045976 Ga0466967_0223140 Ga0466967_0223140_640_1596 293
845 3300046454 Ga0495592_0021245 Ga0495592_0021245_3062_4018 293
846 3300046454 Ga0495592_0027905 Ga0495592_0027905_42_998 293
847 3300046454 Ga0495592_0145629 Ga0495592_0145629_600_1556 293
848 3300046461 Ga0495641_0026292 Ga0495641_0026292_1805_2761 293
849 3300046462 Ga0495651_0013797 Ga0495651_0013797_4804_5760 293
850 3300046462 Ga0495651_0030057 Ga0495651_0030057_1113_2069 293
851 3300046462 Ga0495651_0126446 Ga0495651_0126446_352_1308 293
852 3300046463 Ga0495653_0006300 Ga0495653_0006300_7643_8599 293
853 3300046463 Ga0495653_0010412 Ga0495653_0010412_5484_6440 293
854 3300046463 Ga0495653_0017351 Ga0495653_0017351_2549_3505 293
855 3300046463 Ga0495653_0098404 Ga0495653_0098404_745_1701 293
856 3300046463 Ga0495653_0151850 Ga0495653_0151850_163_1119 293
857 3300046473 Ga0495582_0080091 Ga0495582_0080091_80_1036 293
858 3300046475 Ga0495639_0007891 Ga0495639_0007891_654_1610 293
859 3300046476 Ga0495662_0020889 Ga0495662_0020889_429_1385 293
860 3300046477 Ga0495664_0017711 Ga0495664_0017711_1592_2548 293
861 3300046477 Ga0495664_0020928 Ga0495664_0020928_1926_2882 293
862 3300046477 Ga0495664_0062050 Ga0495664_0062050_655_1650 293
863 3300046511 Ga0495608_0014063 Ga0495608_0014063_537_1493 293
864 3300046514 Ga0495618_0052774 Ga0495618_0052774_782_1738 293
865 3300046514 Ga0495618_0108712 Ga0495618_0108712_657_1613 293
866 3300046516 Ga0495628_0010312 Ga0495628_0010312_6923_7879 293
867 3300046516 Ga0495628_0088817 Ga0495628_0088817_114_1070 293
868 3300046517 Ga0495630_0051465 Ga0495630_0051465_1058_2014 293
869 3300046517 Ga0495630_0078411 Ga0495630_0078411_869_1825 293
870 3300046517 Ga0495630_0101646 Ga0495630_0101646_1124_2080 293
871 3300046517 Ga0495630_0156506 Ga0495630_0156506_735_1691 293
872 3300046526 Ga0495666_0078256 Ga0495666_0078256_253_1209 293
873 3300046529 Ga0495652_0019111 Ga0495652_0019111_1026_1982 293
874 3300046529 Ga0495652_0095275 Ga0495652_0095275_204_1160 293
875 3300046529 Ga0495652_0103519 Ga0495652_0103519_143_1099 293
876 3300046531 Ga0495665_0111120 Ga0495665_0111120_459_1415 293
877 3300046533 Ga0495640_0086003 Ga0495640_0086003_352_1308 293
878 3300046535 Ga0495586_0022724 Ga0495586_0022724_1523_2479 293
879 3300046536 Ga0495587_0020164 Ga0495587_0020164_2222_3178 293
880 3300046543 Ga0495645_0021367 Ga0495645_0021367_72_1028 293
881 3300046543 Ga0495645_0028709 Ga0495645_0028709_2883_3839 293
882 3300046543 Ga0495645_0031746 Ga0495645_0031746_1322_2278 293
883 3300046543 Ga0495645_0055887 Ga0495645_0055887_975_1931 293
884 3300046543 Ga0495645_0057243 Ga0495645_0057243_527_1483 293
885 3300046543 Ga0495645_0132004 Ga0495645_0132004_530_1486 293
886 3300046559 Ga0495667_0003509 Ga0495667_0003509_8205_9161 293
887 3300046559 Ga0495667_0008650 Ga0495667_0008650_313_1269 293
888 3300046559 Ga0495667_0008718 Ga0495667_0008718_4793_5749 293
889 3300046642 Ga0495634_0044036 Ga0495634_0044036_2026_2982 293
890 3300046642 Ga0495634_0057617 Ga0495634_0057617_1620_2576 293
891 3300046642 Ga0495634_0107121 Ga0495634_0107121_466_1422 293
892 3300046663 Ga0495635_0001264 Ga0495635_0001264_7078_8034 293
893 3300046663 Ga0495635_0003596 Ga0495635_0003596_2763_3719 293
894 3300046663 Ga0495635_0030207 Ga0495635_0030207_700_1656 293
895 3300046663 Ga0495635_0038410 Ga0495635_0038410_1324_2280 293
896 3300046675 Ga0495657_0025333 Ga0495657_0025333_2747_3703 293
897 3300046675 Ga0495657_0113762 Ga0495657_0113762_352_1308 293
898 3300046678 Ga0495599_0086416 Ga0495599_0086416_349_1344 293
899 3300046679 Ga0495623_0023167 Ga0495623_0023167_2101_3057 293
900 3300046679 Ga0495623_0033514 Ga0495623_0033514_1357_2313 293
901 3300046679 Ga0495623_0037893 Ga0495623_0037893_1587_2543 293
902 3300046680 Ga0495646_0017254 Ga0495646_0017254_243_1199 293
903 3300046683 Ga0495658_0167186 Ga0495658_0167186_380_1336 293
904 3300046689 Ga0495613_0031895 Ga0495613_0031895_2697_3653 293
905 3300046690 Ga0495624_0009088 Ga0495624_0009088_5483_6439 293
906 3300046690 Ga0495624_0128899 Ga0495624_0128899_144_1100 293
907 3300046809 Ga0495600_0011991 Ga0495600_0011991_1723_2679 293
908 3300046809 Ga0495600_0052868 Ga0495600_0052868_34_990 293
909 3300046809 Ga0495600_0134971 Ga0495600_0134971_253_1209 293
910 3300047315 Ga0495581_0015106 Ga0495581_0015106_1507_2463 293
911 3300047315 Ga0495581_0086599 Ga0495581_0086599_777_1733 293
912 3300047315 Ga0495581_0147695 Ga0495581_0147695_371_1327 293
913 3300047317 Ga0495604_0034218 Ga0495604_0034218_2416_3372 293
914 3300047317 Ga0495604_0171420 Ga0495604_0171420_336_1292 293
915 3300047317 Ga0495604_0184356 Ga0495604_0184356_448_1404 293
916 3300047319 Ga0495674_0002831 Ga0495674_0002831_8509_9465 293
917 3300047319 Ga0495674_0008396 Ga0495674_0008396_4759_5715 293
918 3300047319 Ga0495674_0032708 Ga0495674_0032708_2570_3526 293
919 3300047321 Ga0495676_0261425 Ga0495676_0261425_14_970 293
920 3300047322 Ga0495680_0011807 Ga0495680_0011807_6386_7342 293
921 3300047322 Ga0495680_0064853 Ga0495680_0064853_613_1569 293
922 3300047444 Ga0495675_0045040 Ga0495675_0045040_941_1897 293
923 3300047444 Ga0495675_0139513 Ga0495675_0139513_195_1151 293
924 3300047471 Ga0495684_0002351 Ga0495684_0002351_5654_6610 293
925 3300047471 Ga0495684_0020760 Ga0495684_0020760_3690_4646 293
926 3300047471 Ga0495684_0051985 Ga0495684_0051985_1071_2027 293
927 3300047471 Ga0495684_0072458 Ga0495684_0072458_20_976 293
928 3300047471 Ga0495684_0144903 Ga0495684_0144903_264_1220 293
929 3300048088 Ga0495602_0129599 Ga0495602_0129599_854_1810 293
930 3300048088 Ga0495602_0274928 Ga0495602_0274928_16_972 293
931 3300048903 Ga0496100_0054147 Ga0496100_0054147_953_1939 293
932 3300048904 Ga0496101_0002786 Ga0496101_0002786_4816_5772 293
933 3300048905 Ga0496102_0044150 Ga0496102_0044150_910_1866 293
934 3300048905 Ga0496102_0061553 Ga0496102_0061553_45_1001 293
935 3300048907 Ga0496104_0000798 Ga0496104_0000798_17759_18715 293
936 3300048908 Ga0496105_0012818 Ga0496105_0012818_1690_2676 293
937 3300048908 Ga0496105_0018502 Ga0496105_0018502_972_1928 293
938 3300048908 Ga0496105_0024086 Ga0496105_0024086_3672_4628 293
939 3300048909 Ga0496106_0105687 Ga0496106_0105687_315_1301 293
940 3300048909 Ga0496106_0287040 Ga0496106_0287040_309_1265 293
941 3300048910 Ga0496107_0146431 Ga0496107_0146431_737_1723 293
942 3300048910 Ga0496107_0357290 Ga0496107_0357290_69_1025 293
943 3300048911 Ga0496108_0146718 Ga0496108_0146718_303_1259 293
944 3300048911 Ga0496108_0300630 Ga0496108_0300630_380_1336 293
945 3300048912 Ga0496109_0009817 Ga0496109_0009817_4842_5798 293
946 3300048912 Ga0496109_0208517 Ga0496109_0208517_204_1190 293
947 3300048913 Ga0496110_0091221 Ga0496110_0091221_1183_2139 293
948 3300048913 Ga0496110_0177546 Ga0496110_0177546_898_1884 293
949 3300048913 Ga0496110_0346966 Ga0496110_0346966_165_1121 293
950 3300048914 Ga0496111_0032415 Ga0496111_0032415_1100_2086 293
951 3300048914 Ga0496111_0051138 Ga0496111_0051138_567_1523 293
952 3300048915 Ga0496112_0053238 Ga0496112_0053238_1643_2599 293
953 3300048916 Ga0496113_0024157 Ga0496113_0024157_257_1213 293
954 3300048916 Ga0496113_0051817 Ga0496113_0051817_1727_2683 293
955 3300048916 Ga0496113_0070327 Ga0496113_0070327_989_1945 293
956 3300048917 Ga0496114_0100327 Ga0496114_0100327_262_1218 293
957 3300048917 Ga0496114_0139974 Ga0496114_0139974_593_1579 293
958 3300048918 Ga0496115_0015886 Ga0496115_0015886_4547_5533 293
959 3300048918 Ga0496115_0035994 Ga0496115_0035994_2838_3794 293
960 3300048918 Ga0496115_0069974 Ga0496115_0069974_1430_2386 293
961 3300048918 Ga0496115_0162714 Ga0496115_0162714_727_1683 293
962 3300048929 Ga0496126_0180939 Ga0496126_0180939_829_1779 293
963 3300049574 Ga0501038_0001572 Ga0501038_0001572_11021_11950 293
964 3300049578 Ga0501042_0066361 Ga0501042_0066361_1525_2481 293
965 3300049588 Ga0501072_0081895 Ga0501072_0081895_1117_2046 293
966 3300049590 Ga0501074_0001654 Ga0501074_0001654_4223_5152 293
967 3300049592 Ga0501076_0032057 Ga0501076_0032057_1388_2317 293
968 3300049743 Ga0501081_0005425 Ga0501081_0005425_1267_2196 293
969 3300049824 Ga0501045_0003401 Ga0501045_0003401_8207_9136 293
970 3300050507 nmdc:mga05p37_1958_c1 nmdc:mga05p37_1958_c1_6555_7511 293
971 3300050508 nmdc:mga09592_112556_c1 nmdc:mga09592_112556_c1_372_1328 293
972 3300050508 nmdc:mga09592_368255_c1 nmdc:mga09592_368255_c1_270_1226 293
973 3300050509 nmdc:mga0qj67_314_c1 nmdc:mga0qj67_314_c1_968_1918 293
974 3300050511 nmdc:mga08y16_30087_c1 nmdc:mga08y16_30087_c1_2353_3309 293
975 3300050512 nmdc:mga0n895_10127_c1 nmdc:mga0n895_10127_c1_6842_7798 293
976 3300050512 nmdc:mga0n895_416606_c1 nmdc:mga0n895_416606_c1_385_1341 293
977 3300050513 nmdc:mga0rr50_234658_c1 nmdc:mga0rr50_234658_c1_349_1335 293
978 3300050513 nmdc:mga0rr50_59627_c1 nmdc:mga0rr50_59627_c1_832_1788 293
979 3300050514 nmdc:mga08x19_191754_c1 nmdc:mga08x19_191754_c1_384_1340 293
980 3300050514 nmdc:mga08x19_33680_c1 nmdc:mga08x19_33680_c1_351_1307 293
981 3300050515 nmdc:mga0a205_15293_c1 nmdc:mga0a205_15293_c1_2914_3870 293
982 3300050515 nmdc:mga0a205_99733_c1 nmdc:mga0a205_99733_c1_10_966 293
983 3300053077 Ga0495601_0070273 Ga0495601_0070273_1127_2083 293
984 3300053077 Ga0495601_0077975 Ga0495601_0077975_222_1178 293
985 3300053078 Ga0495612_0004582 Ga0495612_0004582_4752_5708 293
986 3300053078 Ga0495612_0019187 Ga0495612_0019187_236_1231 293
987 3300053078 Ga0495612_0039241 Ga0495612_0039241_933_1889 293
988 3300053078 Ga0495612_0087585 Ga0495612_0087585_58_1014 293
989 3300053084 Ga0495595_0013842 Ga0495595_0013842_2181_3137 293
990 3300053084 Ga0495595_0052060 Ga0495595_0052060_469_1425 293
991 3300054114 Ga0501084_0013673 Ga0501084_0013673_4922_5851 293
992 3300060353 Ga0501082_0033886 Ga0501082_0033886_2972_3901 293
993 3300009147 Ga0114129_10166468 Ga0114129_101664682 294
994 3300031691 Ga0316579_10079237 Ga0316579_100792371 294
995 3300032002 Ga0307416_100127411 Ga0307416_1001274112 294
996 3300037418 Ga0395900_0357357 Ga0395900_0357357_409_1341 294
997 3300037466 Ga0395898_0361040 Ga0395898_0361040_296_1228 294
998 3300038443 Ga0395901_0338218 Ga0395901_0338218_95_1027 294
999 3300050507 nmdc:mga05p37_558250_c1 nmdc:mga05p37_558250_c1_230_1162 294
1000 3300003373 JGI25407J50210_10018873 JGI25407J50210_100188732 295
1001 3300005937 Ga0081455_10057618 Ga0081455_100576183 295
1002 3300005981 Ga0081538_10002786 Ga0081538_1000278618 295
1003 3300005981 Ga0081538_10034098 Ga0081538_100340983 295
1004 3300005981 Ga0081538_10037427 Ga0081538_100374275 295
1005 3300005985 Ga0081539_10150970 Ga0081539_101509702 295
1006 3300006058 Ga0075432_10026310 Ga0075432_100263103 295
1007 3300006844 Ga0075428_100282093 Ga0075428_1002820932 295
1008 3300006846 Ga0075430_100001663 Ga0075430_10000166312 295
1009 3300006847 Ga0075431_100046671 Ga0075431_1000466713 295
1010 3300006852 Ga0075433_10031211 Ga0075433_100312114 295
1011 3300006880 Ga0075429_100116528 Ga0075429_1001165282 295
1012 3300007076 Ga0075435_100232998 Ga0075435_1002329983 295
1013 3300009147 Ga0114129_10412805 Ga0114129_104128052 295
1014 3300021388 Ga0213875_10000125 Ga0213875_1000012575 295
1015 3300027907 Ga0207428_10000537 Ga0207428_1000053730 295
1016 3300031247 Ga0265340_10008623 Ga0265340_100086234 295
1017 3300032002 Ga0307416_100010416 Ga0307416_1000104163 295
1018 3300032126 Ga0307415_100005414 Ga0307415_1000054146 295
1019 3300037312 Ga0395899_0297566 Ga0395899_0297566_49_990 295
1020 3300037418 Ga0395900_0025836 Ga0395900_0025836_701_1642 295
1021 3300037466 Ga0395898_0154853 Ga0395898_0154853_128_1069 295
1022 3300037853 Ga0436364_0732570 Ga0436364_0732570_14521_15696 295
1023 3300038443 Ga0395901_0032412 Ga0395901_0032412_4437_5378 295
1024 3300038443 Ga0395901_0044943 Ga0395901_0044943_1578_2519 295
1025 3300038443 Ga0395901_0441791 Ga0395901_0441791_334_1275 295
1026 3300050507 nmdc:mga05p37_21880_c1 nmdc:mga05p37_21880_c1_5474_6409 295
1027 3300050507 nmdc:mga05p37_61924_c1 nmdc:mga05p37_61924_c1_2486_3421 295
1028 3300050508 nmdc:mga09592_4052_c1 nmdc:mga09592_4052_c1_1309_2244 295
1029 3300050509 nmdc:mga0qj67_10319_c1 nmdc:mga0qj67_10319_c1_836_1771 295
1030 3300050510 nmdc:mga06r32_21997_c1 nmdc:mga06r32_21997_c1_145_1080 295
1031 3300050511 nmdc:mga08y16_136272_c1 nmdc:mga08y16_136272_c1_770_1705 295
1032 3300050512 nmdc:mga0n895_75353_c1 nmdc:mga0n895_75353_c1_649_1584 295
1033 3300050513 nmdc:mga0rr50_223505_c1 nmdc:mga0rr50_223505_c1_332_1267 295
1034 3300050515 nmdc:mga0a205_101699_c1 nmdc:mga0a205_101699_c1_554_1489 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02866

Ldh_1_C

lactate/malate dehydrogenase, alpha/beta C-terminal domain

159

320

0.95

PF00056

Ldh_1_N

lactate/malate dehydrogenase, NAD binding domain

10

156

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1guz-assembly1.cif.gz_C structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases 0.9586 3 288
1gv1-assembly1.cif.gz_C structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases 0.953 3 288
1uxi-assembly1.cif.gz_A large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface 0.9433 1 292
2hjr-assembly1.cif.gz_B crystal structure of cryptosporidium parvum malate dehydrogenase 0.9416 2 292
4ros-assembly1.cif.gz_A crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose 0.939 2 292
ID Description Score Start End Superfamily
4plhC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9778 2 142 3.40.50.720
1gv0A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9527 3 142 3.40.50.720
2d4aB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 4 142 3.40.50.720
4plhC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9425 2 142 3.40.50.720
6ihdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9413 2 134 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A838GIN4-F1-model_v4 Malate dehydrogenase 0.9907 1 61 GO:0016616
GO:0019752
AF-A0A357JJB3-F1-model_v4 Malate dehydrogenase 0.9885 3 63 GO:0016616
GO:0019752
AF-X0T3M2-F1-model_v4 Lactate/malate dehydrogenase N-terminal domain-containing protein 0.9829 2 204 GO:0004459
GO:0006089
GO:0006090
AF-A0A7V3PRZ4-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 0.9762 3 193 GO:0004459
GO:0006089
GO:0006090
GO:0030060
AF-A0A7Y2UZ01-F1-model_v4 Malate dehydrogenase 0.9759 3 115 GO:0004459
GO:0006089
GO:0006090

Feature Viewer

pLDDT pTM Quality
88.85 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map