F488626

General Info

Members Datasets Scaffolds Average Seq Length
1032 480 1004 195

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100306015|Ga0070680_1003060152
Length 238
Sequence VILVVDNYDSFTFNLVQALEAAGADIRVVRNDALDRAGVEALVGDPGAGLRGIVISPGPGEPSAAGVSVDAVRVAAEQAIPLLGVCLGMQSLAVAFGGAVVRAPTLVHGEASEVTHDGDGLLAGLPASFPAARYHSLCVDPASLPGELRVTAMSEVDRVVMGIRHVALPLEGVQFHPESVLTPSGPRLLANFLRLAGEGHAATLDDAAGSFAVRGIADEPADAAPATHEAVASAGGVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
12 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
13 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
14 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
15 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
16 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
17 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
18 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
19 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
20 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
21 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
22 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
23 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
24 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
25 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
26 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
27 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
28 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
29 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
30 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
37 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
38 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
39 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
78 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
79 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
80 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
88 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
112 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
120 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
146 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
163 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
174 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
243 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
244 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
245 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
248 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
249 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
250 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
251 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
252 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
253 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
254 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
257 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
261 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
264 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
265 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
285 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
286 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
287 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
288 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
291 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
292 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
293 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
294 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
295 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
310 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
311 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
312 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
313 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
314 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
319 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
320 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
333 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
334 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
335 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
336 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
337 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
338 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
339 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
340 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
341 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
342 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
343 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
344 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
345 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
346 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
357 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
365 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
366 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
367 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
368 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
369 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
370 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
371 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
372 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
373 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
374 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
375 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
376 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
381 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
382 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
385 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
386 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
387 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
388 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
389 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
390 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
391 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
392 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
393 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
394 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
395 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
402 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
403 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
416 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
417 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
418 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
419 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
420 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
421 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
422 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
423 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
424 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
425 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
426 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
427 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
428 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
429 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
430 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
431 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
432 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
433 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
437 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
438 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
439 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
440 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
441 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
442 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
443 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
444 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
445 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
446 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
447 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
448 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
449 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
450 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
451 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
452 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
455 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
456 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
457 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
458 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
459 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
460 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
461 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
462 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
463 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
464 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
465 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
466 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
467 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
468 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
469 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
470 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
471 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
472 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
473 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
474 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
475 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
476 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
477 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
478 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
479 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
480 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.29
Metatranscriptomes 0
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 11.63
Nodule 0.1
Rhizoplane 3.39
Rhizosphere 78
Stem 0
Stem Tuber 0
Unclassified 6.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2906353 2162886007 Bacteria 28937
2 JGI24741J21665_1009947 3300001915 Bacteria 1723
3 JGI24746J21847_1001496 3300001977 Bacteria 3718
4 JGI24740J21852_10112164 3300001979 Bacteria 687
5 JGI24739J22299_10005219 3300001989 Bacteria 4950
6 JGI24739J22299_10025799 3300001989 Bacteria 2066
7 JGI24739J22299_10061099 3300001989 Bacteria 1191
8 JGI24737J22298_10003186 3300001990 Bacteria 5820
9 JGI24737J22298_10005631 3300001990 Bacteria 4316
10 JGI24737J22298_10011515 3300001990 Bacteria 2899
11 JGI24737J22298_10016864 3300001990 Bacteria 2357
12 JGI24737J22298_10032429 3300001990 Bacteria 1626
13 JGI24737J22298_10050299 3300001990 Bacteria 1267
14 JGI24737J22298_10131621 3300001990 Bacteria 739
15 JGI24743J22301_10021842 3300001991 Bacteria 1224
16 JGI24735J21928_10001921 3300002067 Bacteria 7292
17 JGI24735J21928_10026342 3300002067 Bacteria 1748
18 JGI24735J21928_10030054 3300002067 Bacteria 1615
19 JGI24735J21928_10030869 3300002067 Bacteria 1590
20 JGI24735J21928_10058391 3300002067 Bacteria 1110
21 JGI24735J21928_10060479 3300002067 Bacteria 1089
22 JGI24738J21930_10000848 3300002075 Bacteria 8755
23 JGI24738J21930_10004277 3300002075 Bacteria 3512
24 JGI24738J21930_10020148 3300002075 Bacteria 1387
25 JGI24744J21845_10000444 3300002077 Bacteria 7281
26 JGI24034J26672_10000172 3300002239 Bacteria 8945
27 JGI24034J26672_10039456 3300002239 Bacteria 789
28 JGI24742J22300_10023398 3300002244 Bacteria 1061
29 JGI25164J39214_1010460 3300002772 Bacteria 898
30 JGI25406J46586_10091182 3300003203 Bacteria 919
31 JGI25165J46597_1000040 3300003214 Bacteria 277491
32 JGI25165J46597_1000089 3300003214 Bacteria 169547
33 JGI25153J46596_10000002 3300003215 Bacteria 653569
34 JGI25407J50210_10000517 3300003373 Bacteria 7761
35 Ga0055525_1000051 3300003759 Bacteria 240942
36 Ga0055542_1000020 3300003762 Bacteria 335745
37 Ga0055542_1002673 3300003762 Bacteria 5522
38 Ga0055529_1000016 3300003763 Bacteria 364775
39 Ga0055536_1001024 3300003781 Bacteria 17654
40 Ga0055536_1003233 3300003781 Bacteria 8830
41 Ga0055536_1010161 3300003781 Bacteria 3776
42 Ga0055534_1020141 3300003784 Bacteria 1133
43 Ga0055530_10000013 3300003791 Bacteria 153390
44 Ga0055530_10000901 3300003791 Bacteria 24454
45 Ga0055531_10000583 3300003794 Bacteria 31858
46 Ga0055531_10000627 3300003794 Bacteria 30500
47 Ga0055531_10001679 3300003794 Bacteria 15929
48 Ga0065165_1002265 3300005262 Bacteria 16983
49 Ga0065714_10162484 3300005288 Bacteria 1044
50 Ga0065704_10070237 3300005289 Bacteria 52535
51 Ga0065704_10108965 3300005289 Bacteria 2010
52 Ga0065704_10128058 3300005289 Bacteria 1667
53 Ga0065707_10084488 3300005295 Bacteria 7152
54 Ga0070658_10000022 3300005327 Bacteria 186706
55 Ga0070658_10000125 3300005327 Bacteria 68211
56 Ga0070658_10001598 3300005327 Bacteria 19148
57 Ga0070658_10006112 3300005327 Bacteria 9765
58 Ga0070658_10078427 3300005327 Bacteria 2711
59 Ga0070658_10252945 3300005327 Bacteria 1495
60 Ga0070658_10572825 3300005327 Bacteria 978
61 Ga0070676_10000855 3300005328 Bacteria 15051
62 Ga0070683_100810431 3300005329 Bacteria 898
63 Ga0070683_101074809 3300005329 Bacteria 773
64 Ga0070670_100073410 3300005331 Bacteria 2938
65 Ga0070670_100203842 3300005331 Bacteria 1719
66 Ga0068869_100000031 3300005334 Bacteria 60884
67 Ga0068869_100207623 3300005334 Bacteria 1547
68 Ga0068869_100243015 3300005334 Bacteria 1435
69 Ga0070666_10050500 3300005335 Bacteria 2797
70 Ga0070680_100004842 3300005336 Bacteria 10137
71 Ga0070680_100306015 3300005336 Bacteria 1348
72 Ga0070682_100000011 3300005337 Bacteria 266253
73 Ga0068868_100000060 3300005338 Bacteria 61952
74 Ga0070660_100000568 3300005339 Bacteria 24762
75 Ga0070660_100000801 3300005339 Bacteria 20852
76 Ga0070660_100005160 3300005339 Bacteria 9032
77 Ga0070660_100297948 3300005339 Bacteria 1322
78 Ga0070689_100255195 3300005340 Bacteria 1448
79 Ga0070661_100010440 3300005344 Bacteria 6459
80 Ga0070661_100239357 3300005344 Bacteria 1397
81 Ga0070661_100398497 3300005344 Bacteria 1088
82 Ga0070668_100031585 3300005347 Bacteria 4029
83 Ga0070668_100075216 3300005347 Bacteria 2636
84 Ga0070668_100083839 3300005347 Bacteria 2503
85 Ga0070669_100000297 3300005353 Bacteria 38972
86 Ga0070669_100000990 3300005353 Bacteria 20731
87 Ga0070669_100270249 3300005353 Bacteria 1359
88 Ga0070675_100006017 3300005354 Bacteria 9298
89 Ga0070675_100181892 3300005354 Bacteria 1818
90 Ga0070671_100000090 3300005355 Bacteria 58174
91 Ga0070671_100004583 3300005355 Bacteria 10951
92 Ga0070671_100071516 3300005355 Bacteria 2895
93 Ga0070671_100090815 3300005355 Bacteria 2557
94 Ga0070674_100000002 3300005356 Bacteria 271088
95 Ga0070674_100000009 3300005356 Bacteria 143336
96 Ga0070674_100000740 3300005356 Bacteria 16717
97 Ga0070674_100088635 3300005356 Bacteria 2227
98 Ga0070674_100166219 3300005356 Bacteria 1678
99 Ga0070674_100442670 3300005356 Bacteria 1071
100 Ga0070674_100861137 3300005356 Bacteria 787
101 Ga0070673_100000009 3300005364 Bacteria 155005
102 Ga0070673_100017694 3300005364 Bacteria 5076
103 Ga0070673_100515654 3300005364 Bacteria 1083
104 Ga0070673_100693518 3300005364 Bacteria 935
105 Ga0070688_100000277 3300005365 Bacteria 26584
106 Ga0070688_100087858 3300005365 Bacteria 2026
107 Ga0070659_100004173 3300005366 Bacteria 10300
108 Ga0070659_100064395 3300005366 Bacteria 2902
109 Ga0070659_100217275 3300005366 Bacteria 1577
110 Ga0070659_100549290 3300005366 Bacteria 989
111 Ga0070667_100005081 3300005367 Bacteria 11014
112 Ga0070667_100010899 3300005367 Bacteria 7519
113 Ga0070667_100032672 3300005367 Bacteria 4341
114 Ga0070714_100125748 3300005435 Bacteria 2286
115 Ga0070714_100149575 3300005435 Bacteria 2103
116 Ga0070713_100000058 3300005436 Bacteria 70009
117 Ga0070711_100001969 3300005439 Bacteria 11529
118 Ga0070711_100085494 3300005439 Bacteria 2260
119 Ga0070708_100001562 3300005445 Bacteria 17554
120 Ga0070708_100042003 3300005445 Bacteria 4011
121 Ga0070663_100025418 3300005455 Bacteria 3998
122 Ga0070678_100000011 3300005456 Bacteria 57959
123 Ga0070678_100001799 3300005456 Bacteria 11550
124 Ga0070678_100950524 3300005456 Bacteria 788
125 Ga0070662_100000708 3300005457 Bacteria 20462
126 Ga0070662_100045764 3300005457 Bacteria 3141
127 Ga0070662_100107871 3300005457 Bacteria 2117
128 Ga0070681_10073045 3300005458 Bacteria 3392
129 Ga0068867_100000165 3300005459 Bacteria 42939
130 Ga0068867_100268392 3300005459 Bacteria 1394
131 Ga0068867_100812205 3300005459 Bacteria 835
132 Ga0070685_10000013 3300005466 Bacteria 120875
133 Ga0070706_100081837 3300005467 Bacteria 2990
134 Ga0070707_100677801 3300005468 Bacteria 994
135 Ga0070698_100014541 3300005471 Bacteria 8308
136 Ga0070698_100561687 3300005471 Bacteria 1081
137 Ga0070679_100140718 3300005530 Bacteria 2393
138 Ga0070697_100091561 3300005536 Bacteria 2515
139 Ga0068853_100000428 3300005539 Bacteria 28681
140 Ga0068853_100013891 3300005539 Bacteria 6584
141 Ga0068853_100060896 3300005539 Bacteria 3263
142 Ga0068853_100377295 3300005539 Bacteria 1324
143 Ga0068853_100404301 3300005539 Bacteria 1278
144 Ga0070686_100385169 3300005544 Unclassified 1062
145 Ga0070693_100041268 3300005547 Bacteria 2595
146 Ga0070665_100001407 3300005548 Bacteria 28292
147 Ga0070665_100013086 3300005548 Bacteria 8354
148 Ga0070665_100045285 3300005548 Bacteria 4419
149 Ga0070665_100123072 3300005548 Bacteria 2596
150 Ga0070665_100311281 3300005548 Bacteria 1578
151 Ga0070665_100379894 3300005548 Bacteria 1420
152 Ga0068855_100000371 3300005563 Bacteria 55533
153 Ga0068855_100004395 3300005563 Bacteria 17228
154 Ga0068855_100004467 3300005563 Bacteria 17096
155 Ga0068855_100076067 3300005563 Bacteria 3897
156 Ga0068855_100078599 3300005563 Bacteria 3827
157 Ga0068855_100163605 3300005563 Bacteria 2524
158 Ga0068855_100286895 3300005563 Bacteria 1826
159 Ga0068855_100499577 3300005563 Bacteria 1322
160 Ga0068855_100501590 3300005563 Bacteria 1319
161 Ga0068855_100819012 3300005563 Bacteria 988
162 Ga0070664_100018632 3300005564 Bacteria 5706
163 Ga0070664_100553453 3300005564 Bacteria 1064
164 Ga0068857_100006008 3300005577 Bacteria 10368
165 Ga0068857_100128132 3300005577 Bacteria 2287
166 Ga0068854_100000333 3300005578 Bacteria 30901
167 Ga0068854_100000439 3300005578 Bacteria 25752
168 Ga0068854_100001819 3300005578 Bacteria 12981
169 Ga0068854_100026592 3300005578 Bacteria 3979
170 Ga0068856_100000237 3300005614 Bacteria 59854
171 Ga0068856_100016235 3300005614 Bacteria 7204
172 Ga0068856_100026512 3300005614 Bacteria 5650
173 Ga0068856_100065400 3300005614 Bacteria 3594
174 Ga0068856_100439192 3300005614 Bacteria 1325
175 Ga0068852_100000002 3300005616 Bacteria 268221
176 Ga0068852_100000387 3300005616 Bacteria 29490
177 Ga0068852_100001240 3300005616 Bacteria 17006
178 Ga0068852_100170285 3300005616 Bacteria 2041
179 Ga0068859_100252954 3300005617 Bacteria 1852
180 Ga0068859_100971900 3300005617 Bacteria 932
181 Ga0068864_100000015 3300005618 Bacteria 303368
182 Ga0068864_100000603 3300005618 Bacteria 30476
183 Ga0068864_100006060 3300005618 Bacteria 9921
184 Ga0068864_100420858 3300005618 Bacteria 1273
185 Ga0068866_10000003 3300005718 Bacteria 281675
186 Ga0068866_10003702 3300005718 Bacteria 6265
187 Ga0068861_100000387 3300005719 Bacteria 25418
188 Ga0068851_10000126 3300005834 Bacteria 41437
189 Ga0068851_10005438 3300005834 Bacteria 5779
190 Ga0068851_10012377 3300005834 Bacteria 4020
191 Ga0068851_10308140 3300005834 Bacteria 912
192 Ga0068863_100000779 3300005841 Bacteria 32033
193 Ga0068863_100001344 3300005841 Bacteria 24467
194 Ga0068863_100016733 3300005841 Bacteria 7036
195 Ga0068863_100042676 3300005841 Bacteria 4310
196 Ga0068858_100000069 3300005842 Bacteria 105617
197 Ga0068858_100001528 3300005842 Bacteria 23768
198 Ga0068858_100009846 3300005842 Bacteria 9089
199 Ga0068858_100023504 3300005842 Bacteria 5741
200 Ga0068858_100209899 3300005842 Bacteria 1843
201 Ga0068860_100000008 3300005843 Bacteria 427367
202 Ga0068860_100001200 3300005843 Bacteria 28270
203 Ga0068860_100001714 3300005843 Bacteria 23425
204 Ga0068860_100007666 3300005843 Bacteria 10787
205 Ga0068860_100017153 3300005843 Bacteria 7059
206 Ga0068860_100108660 3300005843 Bacteria 2651
207 Ga0068860_100579238 3300005843 Unclassified 1126
208 Ga0068860_100664292 3300005843 Bacteria 1050
209 Ga0068862_100000067 3300005844 Bacteria 123668
210 Ga0068862_100002787 3300005844 Bacteria 15321
211 Ga0068862_100031480 3300005844 Bacteria 4479
212 Ga0081538_10000010 3300005981 Bacteria 164857
213 Ga0081538_10000346 3300005981 Bacteria 52797
214 Ga0081540_1080044 3300005983 Bacteria 1474
215 Ga0081539_10075667 3300005985 Bacteria 1787
216 Ga0075365_10062021 3300006038 Bacteria 2499
217 Ga0075365_10299861 3300006038 Bacteria 1131
218 Ga0075363_100016646 3300006048 Bacteria 3635
219 Ga0075364_10001034 3300006051 Bacteria 14802
220 Ga0075364_10004936 3300006051 Bacteria 7727
221 Ga0075432_10000049 3300006058 Bacteria 23148
222 Ga0075362_10027008 3300006177 Bacteria 2456
223 Ga0075362_10064391 3300006177 Bacteria 1663
224 Ga0075367_10027653 3300006178 Bacteria 3229
225 Ga0075367_10106389 3300006178 Bacteria 1719
226 Ga0075369_10041906 3300006186 Bacteria 1961
227 Ga0097621_100014855 3300006237 Bacteria 5841
228 Ga0097621_100414609 3300006237 Bacteria 1208
229 Ga0075370_10000025 3300006353 Bacteria 52081
230 Ga0075370_10005297 3300006353 Bacteria 6390
231 Ga0075370_10087395 3300006353 Bacteria 1796
232 Ga0075370_10132958 3300006353 Bacteria 1452
233 Ga0075370_10153160 3300006353 Bacteria 1351
234 Ga0068871_100016115 3300006358 Bacteria 5616
235 Ga0068871_100169241 3300006358 Bacteria 1872
236 Ga0075431_100316702 3300006847 Bacteria 1574
237 Ga0075433_10001805 3300006852 Bacteria 16060
238 Ga0075434_100503424 3300006871 Bacteria 1232
239 Ga0068865_100000014 3300006881 Bacteria 138727
240 Ga0068865_100000042 3300006881 Bacteria 71057
241 Ga0075436_100126079 3300006914 Bacteria 1794
242 Ga0075436_100134099 3300006914 Bacteria 1738
243 Ga0097620_100035787 3300006931 Bacteria 4983
244 Ga0097620_100252952 3300006931 Bacteria 1852
245 Ga0097620_100971533 3300006931 Bacteria 932
246 Ga0079104_1012581 3300006946 Bacteria 2650
247 Ga0105251_10001943 3300009011 Bacteria 16907
248 Ga0105240_10088485 3300009093 Bacteria 3789
249 Ga0105240_10149816 3300009093 Bacteria 2780
250 Ga0105240_10159735 3300009093 Bacteria 2678
251 Ga0105240_10407978 3300009093 Bacteria 1529
252 Ga0105240_10464232 3300009093 Bacteria 1414
253 Ga0105245_10000104 3300009098 Bacteria 80951
254 Ga0105245_10000160 3300009098 Bacteria 63445
255 Ga0105245_10034240 3300009098 Bacteria 4504
256 Ga0105247_10029554 3300009101 Bacteria 3321
257 Ga0114129_10360147 3300009147 Bacteria 1925
258 Ga0105243_10000070 3300009148 Bacteria 120851
259 Ga0105243_10000760 3300009148 Bacteria 30911
260 Ga0105243_10140427 3300009148 Bacteria 2060
261 Ga0105243_10200088 3300009148 Bacteria 1751
262 Ga0105243_10460174 3300009148 Bacteria 1196
263 Ga0105241_10276947 3300009174 Bacteria 1431
264 Ga0105242_10000062 3300009176 Bacteria 74936
265 Ga0105242_10000722 3300009176 Bacteria 25846
266 Ga0105242_10092631 3300009176 Bacteria 2546
267 Ga0105248_10000175 3300009177 Bacteria 74795
268 Ga0105248_10029379 3300009177 Bacteria 6132
269 Ga0105248_10060140 3300009177 Bacteria 4265
270 Ga0105248_10382570 3300009177 Bacteria 1585
271 Ga0105237_10007067 3300009545 Bacteria 12344
272 Ga0105238_10086778 3300009551 Bacteria 3117
273 Ga0105238_10178755 3300009551 Bacteria 2099
274 Ga0105249_10000056 3300009553 Bacteria 160443
275 Ga0105249_10048124 3300009553 Bacteria 3888
276 Ga0105239_10176381 3300010375 Bacteria 2390
277 Ga0105239_10227075 3300010375 Bacteria 2094
278 Ga0105239_10331363 3300010375 Bacteria 1717
279 Ga0105239_10618244 3300010375 Bacteria 1236
280 Ga0105239_10840722 3300010375 Bacteria 1052
281 Ga0105246_10000434 3300011119 Bacteria 22337
282 Ga0105246_10001563 3300011119 Bacteria 13622
283 Ga0157317_1005034 3300012475 Bacteria 881
284 Ga0157326_1010593 3300012513 Bacteria 1029
285 Ga0157373_10005789 3300013100 Bacteria 9259
286 Ga0157373_10015197 3300013100 Bacteria 5631
287 Ga0157371_10001422 3300013102 Bacteria 24868
288 Ga0157371_10006328 3300013102 Bacteria 9796
289 Ga0157371_10255031 3300013102 Bacteria 1264
290 Ga0157370_10000117 3300013104 Bacteria 92168
291 Ga0157370_10010517 3300013104 Bacteria 9743
292 Ga0157370_10041056 3300013104 Bacteria 4466
293 Ga0157370_10570332 3300013104 Bacteria 1037
294 Ga0157369_10000014 3300013105 Bacteria 266411
295 Ga0157369_10044079 3300013105 Bacteria 4858
296 Ga0157369_10097146 3300013105 Bacteria 3142
297 Ga0157369_10178719 3300013105 Bacteria 2234
298 Ga0157374_10000542 3300013296 Bacteria 33699
299 Ga0157374_10022241 3300013296 Bacteria 5655
300 Ga0157374_10106555 3300013296 Bacteria 2693
301 Ga0157374_10151378 3300013296 Bacteria 2256
302 Ga0157374_10285653 3300013296 Bacteria 1629
303 Ga0157374_10568412 3300013296 Bacteria 1142
304 Ga0157378_10000624 3300013297 Bacteria 33307
305 Ga0157378_10049551 3300013297 Bacteria 3737
306 Ga0163162_10039028 3300013306 Bacteria 4741
307 Ga0163162_10063074 3300013306 Bacteria 3747
308 Ga0163162_11026964 3300013306 Bacteria 933
309 Ga0157372_10000210 3300013307 Bacteria 65290
310 Ga0157372_10002092 3300013307 Bacteria 21697
311 Ga0157372_10004924 3300013307 Bacteria 14188
312 Ga0157372_10260179 3300013307 Bacteria 2015
313 Ga0157372_10506759 3300013307 Bacteria 1407
314 Ga0157372_11011733 3300013307 Bacteria 962
315 Ga0157372_11599357 3300013307 Bacteria 750
316 Ga0157375_10000584 3300013308 Bacteria 32509
317 Ga0157375_10001639 3300013308 Bacteria 19250
318 Ga0157375_10376077 3300013308 Bacteria 1587
319 Ga0157380_10001197 3300014326 Bacteria 16794
320 Ga0157380_10070038 3300014326 Bacteria 2832
321 Ga0157380_10261429 3300014326 Bacteria 1572
322 Ga0157377_10611596 3300014745 Bacteria 779
323 Ga0157379_10053843 3300014968 Bacteria 3595
324 Ga0157379_10306989 3300014968 Bacteria 1447
325 Ga0157376_10000096 3300014969 Bacteria 65482
326 Ga0157376_10057248 3300014969 Bacteria 3260
327 Ga0183363_1005 3300015690 Bacteria 403020
328 Ga0163161_10000022 3300017792 Bacteria 207890
329 Ga0163161_10005899 3300017792 Bacteria 8495
330 Ga0163161_10398178 3300017792 Bacteria 1104
331 Ga0163161_10404447 3300017792 Bacteria 1095
332 Ga0213875_10000202 3300021388 Bacteria 60869
333 Ga0209563_100019 3300025230 Bacteria 697828
334 Ga0207427_101438 3300025231 Bacteria 8613
335 Ga0209437_110657 3300025233 Bacteria 1398
336 Ga0209026_1000641 3300025250 Bacteria 21580
337 Ga0209148_1000017 3300025254 Bacteria 787064
338 Ga0209148_1000147 3300025254 Bacteria 160231
339 Ga0209148_1003079 3300025254 Bacteria 4896
340 Ga0209233_1000003 3300025261 Bacteria 1607366
341 Ga0209233_1000154 3300025261 Bacteria 169616
342 Ga0209455_1000005 3300025272 Bacteria 1416756
343 Ga0209455_1001163 3300025272 Bacteria 12666
344 Ga0209675_1000808 3300025291 Bacteria 20627
345 Ga0209676_1000221 3300025292 Bacteria 124715
346 Ga0209676_1000453 3300025292 Bacteria 69137
347 Ga0209676_1001826 3300025292 Bacteria 17683
348 Ga0209025_1008523 3300025294 Bacteria 7365
349 Ga0209758_1000001 3300025297 Bacteria 1981790
350 Ga0209050_1000010 3300025298 Bacteria 980454
351 Ga0209050_1000042 3300025298 Bacteria 402842
352 Ga0209050_1000217 3300025298 Bacteria 128833
353 Ga0209050_1005032 3300025298 Bacteria 8570
354 Ga0209050_1031450 3300025298 Bacteria 1653
355 Ga0209257_1000009 3300025304 Bacteria 1205047
356 Ga0209257_1000135 3300025304 Bacteria 205668
357 Ga0209257_1000487 3300025304 Bacteria 71315
358 Ga0209257_1006386 3300025304 Bacteria 7625
359 Ga0207697_10012093 3300025315 Bacteria 3633
360 Ga0207656_10000241 3300025321 Bacteria 19100
361 Ga0207713_1043917 3300025735 Bacteria 1842
362 Ga0207682_10181100 3300025893 Bacteria 962
363 Ga0207642_10000002 3300025899 Bacteria 658166
364 Ga0207642_10002221 3300025899 Bacteria 6022
365 Ga0207710_10026569 3300025900 Bacteria 2502
366 Ga0207688_10025857 3300025901 Bacteria 3226
367 Ga0207688_10042823 3300025901 Bacteria 2520
368 Ga0207680_10042407 3300025903 Bacteria 2661
369 Ga0207680_10374110 3300025903 Unclassified 1003
370 Ga0207647_10003309 3300025904 Bacteria 12102
371 Ga0207647_10006904 3300025904 Bacteria 8229
372 Ga0207647_10017498 3300025904 Bacteria 4872
373 Ga0207647_10028077 3300025904 Bacteria 3661
374 Ga0207647_10046743 3300025904 Bacteria 2696
375 Ga0207647_10155089 3300025904 Bacteria 1337
376 Ga0207645_10002952 3300025907 Bacteria 13131
377 Ga0207705_10000004 3300025909 Bacteria 705756
378 Ga0207705_10000042 3300025909 Bacteria 182120
379 Ga0207705_10000236 3300025909 Bacteria 54788
380 Ga0207705_10009197 3300025909 Bacteria 7195
381 Ga0207705_10030261 3300025909 Bacteria 3862
382 Ga0207705_10333089 3300025909 Bacteria 1168
383 Ga0207705_10384144 3300025909 Bacteria 1085
384 Ga0207654_10165528 3300025911 Bacteria 1431
385 Ga0207695_10067256 3300025913 Bacteria 3676
386 Ga0207695_10143132 3300025913 Bacteria 2337
387 Ga0207695_10296328 3300025913 Bacteria 1509
388 Ga0207695_10358896 3300025913 Bacteria 1344
389 Ga0207695_10414637 3300025913 Bacteria 1231
390 Ga0207671_10023161 3300025914 Bacteria 4685
391 Ga0207663_10020089 3300025916 Bacteria 3778
392 Ga0207663_10199764 3300025916 Bacteria 1441
393 Ga0207660_10022399 3300025917 Bacteria 4256
394 Ga0207657_10000081 3300025919 Bacteria 90714
395 Ga0207657_10001189 3300025919 Bacteria 27647
396 Ga0207657_10008800 3300025919 Bacteria 10212
397 Ga0207657_10047392 3300025919 Bacteria 3758
398 Ga0207657_10203518 3300025919 Bacteria 1591
399 Ga0207649_10033331 3300025920 Bacteria 3077
400 Ga0207649_10270738 3300025920 Bacteria 1231
401 Ga0207649_11023411 3300025920 Bacteria 650
402 Ga0207652_10246966 3300025921 Bacteria 1609
403 Ga0207646_10253688 3300025922 Bacteria 1589
404 Ga0207681_10000242 3300025923 Bacteria 41825
405 Ga0207681_10001749 3300025923 Bacteria 13940
406 Ga0207681_10560239 3300025923 Bacteria 941
407 Ga0207694_10053989 3300025924 Bacteria 3117
408 Ga0207650_10129807 3300025925 Bacteria 1971
409 Ga0207650_10313344 3300025925 Bacteria 1284
410 Ga0207650_10347195 3300025925 Bacteria 1220
411 Ga0207659_10004034 3300025926 Bacteria 8861
412 Ga0207659_10554791 3300025926 Bacteria 977
413 Ga0207687_10000015 3300025927 Bacteria 261701
414 Ga0207687_10003175 3300025927 Bacteria 11159
415 Ga0207687_10014513 3300025927 Bacteria 5157
416 Ga0207700_10000003 3300025928 Bacteria 500797
417 Ga0207664_10575216 3300025929 Bacteria 1011
418 Ga0207644_10000003 3300025931 Bacteria 585905
419 Ga0207644_10214149 3300025931 Bacteria 1524
420 Ga0207690_10002915 3300025932 Bacteria 10309
421 Ga0207690_10005010 3300025932 Bacteria 7824
422 Ga0207690_10048973 3300025932 Bacteria 2814
423 Ga0207690_10102863 3300025932 Bacteria 2043
424 Ga0207706_10000112 3300025933 Bacteria 87100
425 Ga0207706_10011098 3300025933 Bacteria 8211
426 Ga0207706_10013408 3300025933 Bacteria 7452
427 Ga0207706_10013706 3300025933 Bacteria 7357
428 Ga0207706_10091730 3300025933 Bacteria 2671
429 Ga0207706_10113122 3300025933 Bacteria 2388
430 Ga0207706_10371749 3300025933 Bacteria 1241
431 Ga0207686_10000231 3300025934 Bacteria 42432
432 Ga0207686_10000489 3300025934 Bacteria 26020
433 Ga0207686_10112928 3300025934 Bacteria 1836
434 Ga0207686_10178462 3300025934 Bacteria 1504
435 Ga0207709_10000031 3300025935 Bacteria 329046
436 Ga0207709_10000066 3300025935 Bacteria 189194
437 Ga0207709_10077005 3300025935 Bacteria 2136
438 Ga0207709_10241413 3300025935 Bacteria 1314
439 Ga0207709_10381789 3300025935 Bacteria 1072
440 Ga0207670_10141961 3300025936 Bacteria 1772
441 Ga0207670_10211466 3300025936 Bacteria 1480
442 Ga0207669_10000001 3300025937 Bacteria 377747
443 Ga0207669_10000003 3300025937 Bacteria 252239
444 Ga0207669_10000073 3300025937 Bacteria 51684
445 Ga0207669_10000718 3300025937 Bacteria 14326
446 Ga0207669_10019929 3300025937 Bacteria 3504
447 Ga0207669_10083820 3300025937 Bacteria 2052
448 Ga0207669_10464025 3300025937 Bacteria 1006
449 Ga0207704_10000002 3300025938 Bacteria 303025
450 Ga0207704_10000007 3300025938 Bacteria 211230
451 Ga0207704_10000181 3300025938 Bacteria 33316
452 Ga0207704_10113553 3300025938 Bacteria 1837
453 Ga0207665_10193561 3300025939 Bacteria 1478
454 Ga0207691_10014326 3300025940 Bacteria 7560
455 Ga0207711_10000006 3300025941 Bacteria 792692
456 Ga0207711_10004612 3300025941 Bacteria 11719
457 Ga0207711_10038590 3300025941 Bacteria 4062
458 Ga0207689_10000060 3300025942 Bacteria 85326
459 Ga0207689_10290111 3300025942 Bacteria 1355
460 Ga0207689_10492263 3300025942 Bacteria 1027
461 Ga0207661_10136885 3300025944 Bacteria 2104
462 Ga0207661_10169639 3300025944 Bacteria 1899
463 Ga0207661_11145385 3300025944 Bacteria 716
464 Ga0207679_10056629 3300025945 Bacteria 2896
465 Ga0207679_10661697 3300025945 Bacteria 945
466 Ga0207667_10000017 3300025949 Bacteria 390654
467 Ga0207667_10001784 3300025949 Bacteria 27089
468 Ga0207667_10062071 3300025949 Bacteria 3909
469 Ga0207667_10065036 3300025949 Bacteria 3805
470 Ga0207667_10202034 3300025949 Bacteria 2039
471 Ga0207667_10203211 3300025949 Bacteria 2032
472 Ga0207667_10343626 3300025949 Bacteria 1523
473 Ga0207667_10385383 3300025949 Bacteria 1428
474 Ga0207651_10000004 3300025960 Bacteria 290191
475 Ga0207651_10004579 3300025960 Bacteria 7000
476 Ga0207651_10176139 3300025960 Bacteria 1692
477 Ga0207712_10000015 3300025961 Bacteria 346689
478 Ga0207712_10006048 3300025961 Bacteria 7634
479 Ga0207712_10507662 3300025961 Bacteria 1031
480 Ga0207668_10062723 3300025972 Bacteria 2618
481 Ga0207668_10138161 3300025972 Bacteria 1870
482 Ga0207640_10000110 3300025981 Bacteria 61907
483 Ga0207640_10000653 3300025981 Bacteria 20274
484 Ga0207640_10000977 3300025981 Bacteria 15868
485 Ga0207640_10007464 3300025981 Bacteria 6040
486 Ga0207640_10190802 3300025981 Bacteria 1544
487 Ga0207658_10000291 3300025986 Bacteria 52585
488 Ga0207658_10015627 3300025986 Bacteria 5209
489 Ga0207658_10336403 3300025986 Bacteria 1311
490 Ga0207677_10000231 3300026023 Bacteria 43615
491 Ga0207703_10000123 3300026035 Bacteria 92590
492 Ga0207703_10000169 3300026035 Bacteria 76131
493 Ga0207703_10035047 3300026035 Bacteria 3987
494 Ga0207703_10046555 3300026035 Bacteria 3493
495 Ga0207703_10059475 3300026035 Bacteria 3121
496 Ga0207703_10067257 3300026035 Bacteria 2949
497 Ga0207639_10000312 3300026041 Bacteria 34360
498 Ga0207639_10003914 3300026041 Bacteria 10048
499 Ga0207639_10022289 3300026041 Bacteria 4561
500 Ga0207639_10046665 3300026041 Bacteria 3270
501 Ga0207639_10256756 3300026041 Bacteria 1527
502 Ga0207639_10450568 3300026041 Bacteria 1168
503 Ga0207639_10773249 3300026041 Bacteria 894
504 Ga0207678_10000656 3300026067 Bacteria 31806
505 Ga0207678_10128322 3300026067 Bacteria 2163
506 Ga0207708_10697040 3300026075 Bacteria 868
507 Ga0207708_11050470 3300026075 Bacteria 709
508 Ga0207702_10000251 3300026078 Bacteria 62222
509 Ga0207702_10006436 3300026078 Bacteria 10127
510 Ga0207702_10018324 3300026078 Bacteria 5790
511 Ga0207702_10043845 3300026078 Bacteria 3757
512 Ga0207702_10311614 3300026078 Bacteria 1496
513 Ga0207641_10000102 3300026088 Bacteria 122366
514 Ga0207641_10000827 3300026088 Bacteria 32939
515 Ga0207641_10016967 3300026088 Bacteria 5962
516 Ga0207641_10020235 3300026088 Bacteria 5464
517 Ga0207641_11199269 3300026088 Bacteria 759
518 Ga0207648_10000003 3300026089 Bacteria 289983
519 Ga0207648_10021289 3300026089 Bacteria 5828
520 Ga0207676_10000018 3300026095 Bacteria 306375
521 Ga0207676_10000552 3300026095 Bacteria 31180
522 Ga0207674_10069407 3300026116 Bacteria 3544
523 Ga0207674_10266128 3300026116 Bacteria 1662
524 Ga0207674_10385388 3300026116 Bacteria 1355
525 Ga0207675_100000016 3300026118 Bacteria 126353
526 Ga0207675_100237065 3300026118 Bacteria 1762
527 Ga0207683_10000086 3300026121 Bacteria 73510
528 Ga0207683_10024502 3300026121 Bacteria 5198
529 Ga0207683_10071169 3300026121 Bacteria 3074
530 Ga0207683_10433437 3300026121 Bacteria 1211
531 Ga0207698_10000004 3300026142 Bacteria 313614
532 Ga0207698_10000193 3300026142 Bacteria 38052
533 Ga0207698_10000385 3300026142 Bacteria 25510
534 Ga0207698_10308051 3300026142 Bacteria 1477
535 Ga0209813_10000053 3300027866 Bacteria 47000
536 Ga0209974_10151896 3300027876 Bacteria 836
537 Ga0207428_10116851 3300027907 Bacteria 2048
538 Ga0268266_10001434 3300028379 Bacteria 28392
539 Ga0268266_10009662 3300028379 Bacteria 8480
540 Ga0268266_10264713 3300028379 Bacteria 1594
541 Ga0268265_10000021 3300028380 Bacteria 272292
542 Ga0268265_10002929 3300028380 Bacteria 12514
543 Ga0268265_10012842 3300028380 Bacteria 5687
544 Ga0268265_10022730 3300028380 Bacteria 4410
545 Ga0268264_10000018 3300028381 Bacteria 495324
546 Ga0268264_10000330 3300028381 Bacteria 74311
547 Ga0268264_10000969 3300028381 Bacteria 29417
548 Ga0268264_10002138 3300028381 Bacteria 17636
549 Ga0268264_10023373 3300028381 Bacteria 5043
550 Ga0268264_10367534 3300028381 Bacteria 1374
551 Ga0265337_1000955 3300028556 Bacteria 15128
552 Ga0265326_10000041 3300028558 Bacteria 83872
553 Ga0265326_10042869 3300028558 Bacteria 1284
554 Ga0265319_1000014 3300028563 Bacteria 177623
555 Ga0265322_10000004 3300028654 Bacteria 275155
556 Ga0265338_10000185 3300028800 Bacteria 116333
557 Ga0265324_10000266 3300029957 Bacteria 38549
558 Ga0307511_10058602 3300030521 Bacteria 2974
559 Ga0265328_10003945 3300031239 Bacteria 6522
560 Ga0265328_10105398 3300031239 Bacteria 1046
561 Ga0265320_10000029 3300031240 Bacteria 159627
562 Ga0265320_10263661 3300031240 Bacteria 763
563 Ga0265325_10031082 3300031241 Bacteria 2860
564 Ga0265329_10011465 3300031242 Bacteria 3220
565 Ga0265339_10024105 3300031249 Bacteria 3511
566 Ga0265331_10002379 3300031250 Bacteria 12770
567 Ga0265331_10064275 3300031250 Bacteria 1727
568 Ga0265327_10000015 3300031251 Bacteria 496677
569 Ga0265316_10146252 3300031344 Bacteria 1772
570 Ga0307513_10082859 3300031456 Bacteria 3300
571 Ga0307513_10111268 3300031456 Bacteria 2732
572 Ga0307513_10153196 3300031456 Bacteria 2210
573 Ga0307408_100020835 3300031548 Bacteria 4430
574 Ga0307408_100179098 3300031548 Bacteria 1698
575 Ga0307508_10001087 3300031616 Bacteria 31474
576 Ga0307508_10121828 3300031616 Bacteria 2211
577 Ga0316579_10074567 3300031691 Bacteria 1611
578 Ga0265314_10014685 3300031711 Bacteria 6251
579 Ga0307410_10063140 3300031852 Bacteria 2540
580 Ga0307410_10069496 3300031852 Bacteria 2436
581 Ga0307410_10598170 3300031852 Bacteria 920
582 Ga0307406_11093672 3300031901 Bacteria 688
583 Ga0307407_10415807 3300031903 Bacteria 968
584 Ga0307412_10000217 3300031911 Bacteria 38437
585 Ga0307412_10088082 3300031911 Bacteria 2165
586 Ga0307412_10459652 3300031911 Bacteria 1051
587 Ga0307409_100615108 3300031995 Bacteria 1075
588 Ga0307416_100025502 3300032002 Bacteria 4334
589 Ga0307416_101124106 3300032002 Bacteria 890
590 Ga0307416_101230978 3300032002 Bacteria 854
591 Ga0307414_10000102 3300032004 Bacteria 61667
592 Ga0307414_10095806 3300032004 Bacteria 2219
593 Ga0307414_10143954 3300032004 Bacteria 1870
594 Ga0307414_10180164 3300032004 Bacteria 1699
595 Ga0307414_10180417 3300032004 Bacteria 1697
596 Ga0307414_10341942 3300032004 Bacteria 1281
597 Ga0307414_11229039 3300032004 Bacteria 694
598 Ga0307411_10234335 3300032005 Bacteria 1433
599 Ga0307411_10404654 3300032005 Bacteria 1129
600 Ga0307411_10946091 3300032005 Bacteria 768
601 Ga0307415_100602456 3300032126 Bacteria 978
602 Ga0316583_10025382 3300032133 Bacteria 2117
603 Ga0307510_10032849 3300033180 Bacteria 5841
604 Ga0373955_0294863 3300035172 Bacteria 977
605 Ga0373955_0404059 3300035172 Bacteria 830
606 Ga0373937_0026530 3300036401 Bacteria 5234
607 Ga0316582_0000403 3300036647 Bacteria 15769
608 Ga0316584_0366060 3300036712 Bacteria 1033
609 Ga0373925_0378810 3300037068 Bacteria 1152
610 Ga0395899_0069029 3300037312 Bacteria 2589
611 Ga0395899_0072345 3300037312 Bacteria 2523
612 Ga0395900_0014470 3300037418 Bacteria 8052
613 Ga0395900_0249634 3300037418 Bacteria 1776
614 Ga0395900_0901660 3300037418 Bacteria 807
615 Ga0395905_0040453 3300037471 Bacteria 4373
616 Ga0395905_0065909 3300037471 Bacteria 3391
617 Ga0436364_0380874 3300037853 Bacteria 90281
618 Ga0395901_0019343 3300038443 Bacteria 6961
619 Ga0395901_0883018 3300038443 Bacteria 877
620 Ga0436365_1401057 3300039437 Bacteria 1120
621 Ga0451795_0981501 3300041456 Bacteria 1655
622 Ga0451843_1372541 3300041509 Bacteria 1160
623 Ga0439448_0016115 3300042005 Bacteria 2271
624 Ga0439448_0031454 3300042005 Bacteria 1685
625 Ga0439448_0040880 3300042005 Bacteria 1498
626 Ga0439455_0007890 3300042012 Bacteria 2266
627 Ga0439455_0021674 3300042012 Bacteria 1534
628 Ga0439458_0000728 3300042157 Bacteria 8480
629 Ga0439458_0001986 3300042157 Bacteria 5072
630 Ga0439458_0004167 3300042157 Bacteria 3338
631 Ga0451577_0139182 3300042876 Bacteria 2180
632 Ga0451577_0285439 3300042876 Bacteria 1495
633 Ga0451577_0723991 3300042876 Bacteria 900
634 Ga0451577_0758000 3300042876 Bacteria 878
635 Ga0466972_0000559 3300044658 Bacteria 18168
636 Ga0466965_0048807 3300044683 Bacteria 2098
637 Ga0466966_0044471 3300044684 Bacteria 2843
638 Ga0466961_0015796 3300044693 Bacteria 4844
639 Ga0466961_0020191 3300044693 Bacteria 4288
640 Ga0466963_0003840 3300044694 Bacteria 8663
641 Ga0466963_0081189 3300044694 Bacteria 2196
642 Ga0466963_0127592 3300044694 Bacteria 1754
643 Ga0466964_0002332 3300044706 Bacteria 6733
644 Ga0453684_0048400 3300044712 Bacteria 5623
645 Ga0453684_0107494 3300044712 Bacteria 3397
646 Ga0453684_0435864 3300044712 Bacteria 1461
647 Ga0453684_0444889 3300044712 Unclassified 1443
648 Ga0466971_0000456 3300044719 Bacteria 15975
649 Ga0466968_0031684 3300044735 Bacteria 2194
650 Ga0466970_0007333 3300044765 Bacteria 5526
651 Ga0466970_0170830 3300044765 Bacteria 1205
652 Ga0466970_0171690 3300044765 Bacteria 1202
653 Ga0466957_0003429 3300044842 Bacteria 8705
654 Ga0466957_0004680 3300044842 Bacteria 7652
655 Ga0466957_0030923 3300044842 Bacteria 3198
656 Ga0466957_0225348 3300044842 Bacteria 1239
657 Ga0466960_0016084 3300044901 Bacteria 3238
658 Ga0466959_0039342 3300045049 Bacteria 3494
659 Ga0466959_0082513 3300045049 Bacteria 2316
660 Ga0451576_0000023 3300045051 Bacteria 477965
661 Ga0451576_0477661 3300045051 Bacteria 1309
662 Ga0466958_0009712 3300045836 Bacteria 5368
663 Ga0466958_0139879 3300045836 Bacteria 1524
664 Ga0466967_0041410 3300045976 Bacteria 3971
665 Ga0495592_0005546 3300046454 Bacteria 9332
666 Ga0495592_0079544 3300046454 Bacteria 2373
667 Ga0495592_0264117 3300046454 Bacteria 1132
668 Ga0495603_0000033 3300046455 Bacteria 57940
669 Ga0495603_0002227 3300046455 Bacteria 11397
670 Ga0495603_0154788 3300046455 Bacteria 1331
671 Ga0495629_0013075 3300046459 Bacteria 5998
672 Ga0495629_0022727 3300046459 Bacteria 4470
673 Ga0495629_0030983 3300046459 Bacteria 3789
674 Ga0495629_0392763 3300046459 Bacteria 943
675 Ga0495638_0001782 3300046460 Bacteria 18811
676 Ga0495638_0022336 3300046460 Bacteria 4155
677 Ga0495641_0000014 3300046461 Bacteria 140908
678 Ga0495651_0121028 3300046462 Bacteria 1923
679 Ga0495651_0219648 3300046462 Bacteria 1316
680 Ga0495653_0077990 3300046463 Bacteria 2458
681 Ga0495650_0000340 3300046471 Bacteria 83278
682 Ga0495650_0000842 3300046471 Bacteria 36937
683 Ga0495582_0000009 3300046473 Bacteria 123633
684 Ga0495639_0265627 3300046475 Bacteria 851
685 Ga0495662_0000698 3300046476 Bacteria 15931
686 Ga0495585_0019033 3300046492 Bacteria 3962
687 Ga0495585_0138231 3300046492 Bacteria 1277
688 Ga0495596_0000288 3300046500 Bacteria 33511
689 Ga0495596_0090126 3300046500 Bacteria 1190
690 Ga0495607_0003392 3300046501 Bacteria 12215
691 Ga0495583_0000996 3300046506 Bacteria 32401
692 Ga0495583_0010754 3300046506 Bacteria 5306
693 Ga0495583_0010824 3300046506 Bacteria 5282
694 Ga0495583_0011374 3300046506 Bacteria 5114
695 Ga0495583_0199221 3300046506 Bacteria 814
696 Ga0495606_0000824 3300046507 Bacteria 47072
697 Ga0495606_0030090 3300046507 Bacteria 3799
698 Ga0495606_0118613 3300046507 Bacteria 1586
699 Ga0495608_0000035 3300046511 Bacteria 133011
700 Ga0495608_0003187 3300046511 Bacteria 11744
701 Ga0495608_0006939 3300046511 Bacteria 8020
702 Ga0495610_0002738 3300046512 Bacteria 14490
703 Ga0495616_0106319 3300046513 Bacteria 1309
704 Ga0495618_0000070 3300046514 Bacteria 72312
705 Ga0495618_0409114 3300046514 Bacteria 829
706 Ga0495620_0044437 3300046515 Bacteria 1930
707 Ga0495628_0003299 3300046516 Bacteria 14431
708 Ga0495628_0295387 3300046516 Bacteria 1200
709 Ga0495630_0055249 3300046517 Bacteria 2975
710 Ga0495631_0217209 3300046518 Bacteria 816
711 Ga0495632_0004649 3300046519 Bacteria 9279
712 Ga0495632_0037725 3300046519 Bacteria 2450
713 Ga0495632_0359930 3300046519 Bacteria 639
714 Ga0495643_0000132 3300046522 Bacteria 121567
715 Ga0495643_0001032 3300046522 Bacteria 28383
716 Ga0495643_0002580 3300046522 Bacteria 14155
717 Ga0495643_0044416 3300046522 Bacteria 2415
718 Ga0495643_0247246 3300046522 Bacteria 834
719 Ga0495644_0003638 3300046523 Bacteria 6073
720 Ga0495648_0052521 3300046524 Bacteria 2475
721 Ga0495663_0010856 3300046525 Bacteria 2534
722 Ga0495654_0082285 3300046530 Bacteria 1507
723 Ga0495640_0017600 3300046533 Bacteria 5321
724 Ga0495586_0001457 3300046535 Bacteria 13053
725 Ga0495587_0019075 3300046536 Bacteria 4249
726 Ga0495609_0006682 3300046538 Bacteria 5854
727 Ga0495622_0003931 3300046557 Bacteria 6941
728 Ga0495633_0003629 3300046558 Bacteria 10203
729 Ga0495633_0024503 3300046558 Bacteria 2981
730 Ga0495667_0135739 3300046559 Bacteria 1586
731 Ga0495668_0021107 3300046616 Bacteria 3739
732 Ga0495668_0184355 3300046616 Bacteria 1143
733 Ga0495634_0000216 3300046642 Bacteria 53765
734 Ga0495634_0090709 3300046642 Bacteria 1985
735 Ga0495611_0014992 3300046648 Bacteria 3312
736 Ga0495611_0119212 3300046648 Bacteria 1230
737 Ga0495625_0000093 3300046660 Bacteria 145874
738 Ga0495625_0000583 3300046660 Bacteria 53056
739 Ga0495625_0001272 3300046660 Bacteria 31687
740 Ga0495625_0024137 3300046660 Bacteria 4633
741 Ga0495625_0036791 3300046660 Bacteria 3595
742 Ga0495625_0037260 3300046660 Bacteria 3569
743 Ga0495625_0049825 3300046660 Bacteria 3008
744 Ga0495625_0388388 3300046660 Bacteria 874
745 Ga0495625_0496866 3300046660 Bacteria 746
746 Ga0495635_0000057 3300046663 Bacteria 67714
747 Ga0495635_0444378 3300046663 Bacteria 858
748 Ga0495661_0066888 3300046665 Bacteria 2113
749 Ga0495657_0000026 3300046675 Bacteria 133011
750 Ga0495657_0007638 3300046675 Bacteria 8330
751 Ga0495623_0196081 3300046679 Bacteria 1164
752 Ga0495646_0420645 3300046680 Bacteria 693
753 Ga0495647_0003964 3300046681 Bacteria 4775
754 Ga0495658_0000002 3300046683 Bacteria 309651
755 Ga0495658_0001858 3300046683 Bacteria 10783
756 Ga0495613_0001530 3300046689 Bacteria 17607
757 Ga0495613_0002007 3300046689 Bacteria 15449
758 Ga0495613_0067568 3300046689 Bacteria 2609
759 Ga0495670_0024563 3300046691 Bacteria 2979
760 Ga0495670_0058212 3300046691 Bacteria 1940
761 Ga0495671_0083324 3300046692 Bacteria 1567
762 Ga0495649_0193899 3300046694 Bacteria 1057
763 Ga0495600_0004496 3300046809 Bacteria 8357
764 Ga0495600_0006263 3300046809 Bacteria 7226
765 Ga0495660_0124506 3300046810 Bacteria 1300
766 Ga0495604_0000100 3300047317 Bacteria 72995
767 Ga0495604_0000305 3300047317 Bacteria 44020
768 Ga0495604_0064668 3300047317 Bacteria 2787
769 Ga0495604_0534047 3300047317 Bacteria 758
770 Ga0495674_0000010 3300047319 Bacteria 285794
771 Ga0495676_0081293 3300047321 Bacteria 2456
772 Ga0495680_0000312 3300047322 Bacteria 54495
773 Ga0495680_0027207 3300047322 Bacteria 4702
774 Ga0495683_0011593 3300047323 Bacteria 4637
775 Ga0495683_0055376 3300047323 Bacteria 1974
776 Ga0495687_000512 3300047443 Bacteria 46683
777 Ga0495687_010555 3300047443 Bacteria 5057
778 Ga0495687_057939 3300047443 Bacteria 1609
779 Ga0495675_0000015 3300047444 Bacteria 133004
780 Ga0495677_0001294 3300047445 Bacteria 9994
781 Ga0495685_013985 3300047447 Bacteria 2723
782 Ga0495673_0014313 3300047469 Bacteria 4128
783 Ga0495681_0000020 3300047470 Bacteria 170007
784 Ga0495681_0189462 3300047470 Bacteria 840
785 Ga0495686_0000753 3300047472 Bacteria 42718
786 Ga0495686_0000983 3300047472 Bacteria 34894
787 Ga0495593_0106453 3300047673 Bacteria 1434
788 Ga0495602_0000227 3300048088 Bacteria 52680
789 Ga0495602_0001969 3300048088 Bacteria 20606
790 Ga0495602_0015468 3300048088 Bacteria 7699
791 Ga0495614_0026410 3300048089 Bacteria 2502
792 Ga0495615_0000148 3300048090 Bacteria 17594
793 Ga0495626_0002994 3300048091 Bacteria 11193
794 Ga0495626_0258124 3300048091 Bacteria 697
795 Ga0496100_0177923 3300048903 Bacteria 1537
796 Ga0496100_0318505 3300048903 Bacteria 1168
797 Ga0496101_0026473 3300048904 Bacteria 4033
798 Ga0496101_1220515 3300048904 Bacteria 589
799 Ga0496102_0002490 3300048905 Bacteria 15727
800 Ga0496102_0170708 3300048905 Bacteria 2048
801 Ga0496103_0000057 3300048906 Bacteria 142223
802 Ga0496103_0032935 3300048906 Bacteria 3165
803 Ga0496103_0153583 3300048906 Bacteria 1475
804 Ga0496104_0026054 3300048907 Bacteria 5394
805 Ga0496104_0228883 3300048907 Bacteria 1771
806 Ga0496105_0003976 3300048908 Bacteria 11064
807 Ga0496105_0424345 3300048908 Bacteria 1052
808 Ga0496106_0000356 3300048909 Bacteria 32385
809 Ga0496106_0002162 3300048909 Bacteria 14692
810 Ga0496106_0981146 3300048909 Bacteria 665
811 Ga0496107_0013198 3300048910 Bacteria 5772
812 Ga0496107_0132119 3300048910 Bacteria 1843
813 Ga0496107_0297851 3300048910 Bacteria 1200
814 Ga0496108_0000005 3300048911 Bacteria 535059
815 Ga0496108_0000232 3300048911 Bacteria 49846
816 Ga0496108_0013086 3300048911 Bacteria 6762
817 Ga0496109_0000002 3300048912 Bacteria 443393
818 Ga0496109_0000044 3300048912 Bacteria 133779
819 Ga0496110_0000357 3300048913 Bacteria 30636
820 Ga0496110_0130680 3300048913 Bacteria 2267
821 Ga0496110_1233306 3300048913 Bacteria 657
822 Ga0496111_0000735 3300048914 Bacteria 17456
823 Ga0496111_0087567 3300048914 Bacteria 2279
824 Ga0496112_0000006 3300048915 Bacteria 365227
825 Ga0496112_0450009 3300048915 Bacteria 1225
826 Ga0496113_0002677 3300048916 Bacteria 10443
827 Ga0496113_0053877 3300048916 Bacteria 3009
828 Ga0496113_0087825 3300048916 Bacteria 2391
829 Ga0496116_0000039 3300048919 Bacteria 349134
830 Ga0496116_0033509 3300048919 Bacteria 3645
831 Ga0496117_0007762 3300048920 Bacteria 10362
832 Ga0496117_0070555 3300048920 Bacteria 2346
833 Ga0496117_0075266 3300048920 Bacteria 2244
834 Ga0496117_0079225 3300048920 Bacteria 2165
835 Ga0496117_0088769 3300048920 Bacteria 1999
836 Ga0496118_0020983 3300048921 Bacteria 5769
837 Ga0496118_0212672 3300048921 Bacteria 1133
838 Ga0496118_0357561 3300048921 Bacteria 775
839 Ga0496119_0166789 3300048922 Bacteria 1166
840 Ga0496120_0088813 3300048923 Bacteria 1656
841 Ga0496121_0000022 3300048924 Bacteria 472849
842 Ga0496121_0000222 3300048924 Bacteria 123595
843 Ga0496121_0000367 3300048924 Bacteria 92745
844 Ga0496121_0005224 3300048924 Bacteria 16810
845 Ga0496121_0012226 3300048924 Bacteria 9404
846 Ga0496121_0026796 3300048924 Bacteria 5416
847 Ga0496121_0227511 3300048924 Bacteria 1309
848 Ga0496122_0002484 3300048925 Bacteria 26064
849 Ga0496122_0002744 3300048925 Bacteria 24327
850 Ga0496122_0002932 3300048925 Bacteria 23269
851 Ga0496122_0026354 3300048925 Bacteria 5014
852 Ga0496123_0001272 3300048926 Bacteria 36131
853 Ga0496123_0003115 3300048926 Bacteria 19022
854 Ga0496123_0009457 3300048926 Bacteria 8774
855 Ga0496123_0017586 3300048926 Bacteria 5741
856 Ga0496123_0090996 3300048926 Bacteria 1811
857 Ga0496123_0166632 3300048926 Bacteria 1167
858 Ga0496123_0377356 3300048926 Bacteria 651
859 Ga0496124_0006015 3300048927 Bacteria 13381
860 Ga0496124_0035687 3300048927 Bacteria 4348
861 Ga0496124_0099052 3300048927 Bacteria 2364
862 Ga0496124_0174830 3300048927 Bacteria 1658
863 Ga0496124_0228181 3300048927 Bacteria 1394
864 Ga0496125_0000730 3300048928 Bacteria 54485
865 Ga0496125_0033699 3300048928 Bacteria 4526
866 Ga0496125_0056017 3300048928 Bacteria 3205
867 Ga0496125_0395647 3300048928 Bacteria 809
868 Ga0496126_0000041 3300048929 Bacteria 340389
869 Ga0496126_0007482 3300048929 Bacteria 11964
870 Ga0495682_0134769 3300049460 Bacteria 883
871 Ga0501031_0130946 3300049568 Bacteria 1639
872 Ga0501033_0683234 3300049570 Bacteria 699
873 Ga0501034_0022938 3300049571 Bacteria 6359
874 Ga0501034_0084595 3300049571 Bacteria 3174
875 Ga0501034_0189465 3300049571 Bacteria 2019
876 Ga0501034_0885834 3300049571 Bacteria 781
877 Ga0501036_0027129 3300049572 Bacteria 4839
878 Ga0501036_0283968 3300049572 Bacteria 1385
879 Ga0501038_0012859 3300049574 Bacteria 7639
880 Ga0501038_0017748 3300049574 Bacteria 6432
881 Ga0501039_0008492 3300049575 Bacteria 7831
882 Ga0501039_0783410 3300049575 Bacteria 744
883 Ga0501040_0006764 3300049576 Bacteria 7438
884 Ga0501042_0392672 3300049578 Bacteria 1005
885 Ga0501043_0019073 3300049579 Bacteria 5385
886 Ga0501047_0000729 3300049581 Bacteria 34190
887 Ga0501047_0138935 3300049581 Bacteria 2308
888 Ga0501047_0427836 3300049581 Bacteria 1155
889 Ga0501048_0054879 3300049582 Bacteria 2830
890 Ga0501048_0116574 3300049582 Bacteria 1887
891 Ga0501067_0018170 3300049583 Bacteria 3894
892 Ga0501068_0550340 3300049584 Bacteria 750
893 Ga0501070_0955134 3300049586 Bacteria 666
894 Ga0501071_0001878 3300049587 Bacteria 12472
895 Ga0501072_0002415 3300049588 Bacteria 13996
896 Ga0501072_0111146 3300049588 Bacteria 2181
897 Ga0501073_0031702 3300049589 Bacteria 3771
898 Ga0501073_0311097 3300049589 Bacteria 1087
899 Ga0501073_0446177 3300049589 Bacteria 894
900 Ga0501074_0038307 3300049590 Bacteria 3475
901 Ga0501075_0000776 3300049591 Bacteria 19922
902 Ga0501075_0004268 3300049591 Bacteria 9657
903 Ga0501075_0245464 3300049591 Bacteria 1365
904 Ga0501076_0004507 3300049592 Bacteria 9920
905 Ga0501076_0206934 3300049592 Bacteria 1603
906 Ga0501223_000997 3300049663 Bacteria 6698
907 Ga0501224_000012 3300049664 Bacteria 92585
908 Ga0501233_001789 3300049668 Bacteria 3719
909 Ga0501235_002099 3300049669 Bacteria 4284
910 Ga0501225_0000035 3300049705 Bacteria 46375
911 Ga0501234_003699 3300049707 Bacteria 2404
912 Ga0501079_0005158 3300049741 Bacteria 9711
913 Ga0501080_0008721 3300049742 Bacteria 9208
914 Ga0501081_0009562 3300049743 Bacteria 6321
915 Ga0501083_0075082 3300049744 Bacteria 2245
916 Ga0501035_0022734 3300049822 Bacteria 5759
917 Ga0501035_0313230 3300049822 Bacteria 1320
918 Ga0501044_0000608 3300049823 Bacteria 43410
919 Ga0501044_0162231 3300049823 Bacteria 2211
920 Ga0501044_0210285 3300049823 Bacteria 1900
921 Ga0501045_0000920 3300049824 Bacteria 19221
922 Ga0501226_000091 3300049853 Bacteria 23656
923 nmdc:mga03683_24689_c1 3300050489 Bacteria 2354
924 nmdc:mga03683_442_c1 3300050489 Bacteria 11972
925 nmdc:mga00v17_1436_c2 3300050491 Bacteria 8289
926 nmdc:mga00v17_4298_c1 3300050491 Bacteria 7397
927 nmdc:mga00v17_4316_c1 3300050491 Bacteria 7385
928 nmdc:mga0yw44_300128_c1 3300050492 Bacteria 1076
929 nmdc:mga0yw44_5326_c1 3300050492 Bacteria 6053
930 nmdc:mga0yw44_69494_c1 3300050492 Bacteria 2182
931 nmdc:mga0k408_101603_c1 3300050493 Bacteria 1696
932 nmdc:mga0k408_186578_c1 3300050493 Bacteria 1237
933 nmdc:mga06z11_147_c1 3300050494 Bacteria 27767
934 nmdc:mga06z11_83504_c1 3300050494 Bacteria 1719
935 nmdc:mga04h51_24_c1 3300050495 Bacteria 59995
936 nmdc:mga07m45_118996_c1 3300050496 Bacteria 1525
937 nmdc:mga07m45_119180_c1 3300050496 Bacteria 1524
938 nmdc:mga07m45_266835_c1 3300050496 Bacteria 996
939 nmdc:mga07m45_31_c1 3300050496 Bacteria 81959
940 nmdc:mga07m45_4597_c1 3300050496 Bacteria 6467
941 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
942 nmdc:mga05p37_498113_c1 3300050507 Bacteria 1399
943 nmdc:mga06r32_1507377_c1 3300050510 Bacteria 612
944 nmdc:mga0a205_386_c1 3300050515 Bacteria 33461
945 nmdc:mga0sz30_160076_c1 3300050516 Bacteria 997
946 nmdc:mga0sz30_6072_c1 3300050516 Bacteria 4469
947 Ga0495601_0000057 3300053077 Bacteria 61510
948 Ga0495601_0054073 3300053077 Bacteria 2539
949 Ga0495601_0150345 3300053077 Bacteria 1520
950 Ga0495655_0000578 3300053083 Bacteria 6031
951 Ga0495595_0000017 3300053084 Bacteria 133011
952 Ga0495595_0000130 3300053084 Bacteria 31250
953 Ga0495595_0003783 3300053084 Bacteria 6021
954 Ga0495619_0000010 3300053085 Bacteria 302390
955 Ga0495619_0000144 3300053085 Bacteria 52554
956 Ga0495619_0000146 3300053085 Bacteria 52136
957 Ga0495619_0001050 3300053085 Bacteria 18097
958 Ga0495619_0008902 3300053085 Bacteria 6340
959 Ga0495619_0038268 3300053085 Bacteria 3129
960 Ga0500643_000241 3300053087 Bacteria 50801
961 Ga0500643_004098 3300053087 Bacteria 6716
962 Ga0500651_0110789 3300053093 Bacteria 1675
963 Ga0500566_0000943 3300053094 Bacteria 16679
964 Ga0500566_0075934 3300053094 Bacteria 1879
965 Ga0500641_0033015 3300053096 Bacteria 2051
966 Ga0500641_0233121 3300053096 Bacteria 777
967 Ga0500556_0184704 3300053104 Bacteria 824
968 Ga0500562_006799 3300053108 Bacteria 2884
969 Ga0500592_013598 3300053116 Bacteria 1305
970 Ga0500595_001141 3300053119 Bacteria 14732
971 Ga0500595_003373 3300053119 Bacteria 7481
972 Ga0500595_037448 3300053119 Bacteria 1582
973 Ga0500607_000042 3300053121 Bacteria 85000
974 Ga0500607_001017 3300053121 Bacteria 26626
975 Ga0500607_176261 3300053121 Bacteria 955
976 Ga0500614_000630 3300053123 Bacteria 8976
977 Ga0500618_001039 3300053125 Bacteria 13911
978 Ga0500642_0001053 3300053130 Bacteria 7963
979 Ga0500559_0000337 3300053136 Bacteria 35168
980 Ga0500559_0004769 3300053136 Bacteria 6353
981 Ga0500559_0105695 3300053136 Bacteria 1301
982 Ga0500568_0008653 3300053139 Bacteria 4888
983 Ga0500568_0092471 3300053139 Bacteria 1140
984 Ga0500573_0000016 3300053140 Bacteria 182675
985 Ga0500577_0105030 3300053142 Bacteria 1159
986 Ga0500590_015737 3300053148 Bacteria 3906
987 Ga0500604_0000078 3300053151 Bacteria 34635
988 Ga0500604_0038496 3300053151 Bacteria 1435
989 Ga0500616_0003477 3300053153 Bacteria 12001
990 Ga0500616_0093290 3300053153 Bacteria 1486
991 Ga0500619_028904 3300053154 Bacteria 1673
992 Ga0500622_0001060 3300053156 Bacteria 22915
993 Ga0500637_0015050 3300053178 Bacteria 4090
994 Ga0500645_001601 3300053730 Bacteria 11250
995 Ga0500645_006083 3300053730 Bacteria 4352
996 Ga0500645_016146 3300053730 Bacteria 2356
997 Ga0500645_069322 3300053730 Bacteria 1013
998 Ga0500596_001728 3300053735 Bacteria 4425
999 Ga0501084_0005800 3300054114 Bacteria 10160
1000 Ga0501084_0103877 3300054114 Bacteria 2386
1001 Ga0500661_020399 3300055283 Bacteria 1178
1002 Ga0501082_0006081 3300060353 Bacteria 10477
1003 Ga0466962_0000368 3300061719 Bacteria 19430
1004 Ga0466962_0245570 3300061719 Bacteria 879

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_1220515 Ga0496101_1220515_23_553 175
2 3300048921 Ga0496118_0357561 Ga0496118_0357561_22_552 175
3 3300048926 Ga0496123_0377356 Ga0496123_0377356_93_632 179
4 3300013307 Ga0157372_11599357 Ga0157372_115993572 180
5 3300025937 Ga0207669_10083820 Ga0207669_100838202 180
6 3300003203 JGI25406J46586_10091182 JGI25406J46586_100911821 181
7 3300005356 Ga0070674_100000009 Ga0070674_10000000930 181
8 3300005364 Ga0070673_100017694 Ga0070673_1000176943 181
9 3300005459 Ga0068867_100268392 Ga0068867_1002683922 181
10 3300005563 Ga0068855_100499577 Ga0068855_1004995772 181
11 3300005718 Ga0068866_10000003 Ga0068866_10000003112 181
12 3300005843 Ga0068860_100007666 Ga0068860_1000076666 181
13 3300005985 Ga0081539_10075667 Ga0081539_100756672 181
14 3300006038 Ga0075365_10299861 Ga0075365_102998612 181
15 3300006051 Ga0075364_10001034 Ga0075364_100010347 181
16 3300006871 Ga0075434_100503424 Ga0075434_1005034242 181
17 3300009147 Ga0114129_10360147 Ga0114129_103601472 181
18 3300025899 Ga0207642_10000002 Ga0207642_10000002364 181
19 3300025936 Ga0207670_10211466 Ga0207670_102114662 181
20 3300025937 Ga0207669_10000001 Ga0207669_10000001178 181
21 3300025960 Ga0207651_10004579 Ga0207651_100045796 181
22 3300026089 Ga0207648_10021289 Ga0207648_100212892 181
23 3300026118 Ga0207675_100237065 Ga0207675_1002370652 181
24 3300026121 Ga0207683_10433437 Ga0207683_104334372 181
25 3300028381 Ga0268264_10000969 Ga0268264_1000096928 181
26 3300046475 Ga0495639_0265627 Ga0495639_0265627_234_794 181
27 3300047469 Ga0495673_0014313 Ga0495673_0014313_1805_2362 181
28 3300048910 Ga0496107_0132119 Ga0496107_0132119_276_857 181
29 3300050491 nmdc:mga00v17_4298_c1 nmdc:mga00v17_4298_c1_591_1148 181
30 3300050492 nmdc:mga0yw44_300128_c1 nmdc:mga0yw44_300128_c1_396_956 181
31 3300050492 nmdc:mga0yw44_5326_c1 nmdc:mga0yw44_5326_c1_3467_4024 181
32 3300050507 nmdc:mga05p37_498113_c1 nmdc:mga05p37_498113_c1_680_1237 181
33 3300050510 nmdc:mga06r32_1507377_c1 nmdc:mga06r32_1507377_c1_45_602 181
34 3300005981 Ga0081538_10000010 Ga0081538_10000010132 182
35 3300006847 Ga0075431_100316702 Ga0075431_1003167022 182
36 3300017792 Ga0163161_10404447 Ga0163161_104044471 182
37 3300046455 Ga0495603_0154788 Ga0495603_0154788_363_926 182
38 3300046459 Ga0495629_0030983 Ga0495629_0030983_2264_2827 182
39 3300046462 Ga0495651_0121028 Ga0495651_0121028_1057_1620 182
40 3300046463 Ga0495653_0077990 Ga0495653_0077990_992_1555 182
41 3300048088 Ga0495602_0001969 Ga0495602_0001969_5049_5612 182
42 3300048911 Ga0496108_0000232 Ga0496108_0000232_41231_41794 182
43 3300048912 Ga0496109_0000044 Ga0496109_0000044_125139_125702 182
44 3300049592 Ga0501076_0206934 Ga0501076_0206934_592_1152 182
45 3300002239 JGI24034J26672_10000172 JGI24034J26672_100001723 183
46 3300005327 Ga0070658_10572825 Ga0070658_105728251 183
47 3300005334 Ga0068869_100207623 Ga0068869_1002076232 183
48 3300005334 Ga0068869_100243015 Ga0068869_1002430152 183
49 3300005337 Ga0070682_100000011 Ga0070682_100000011191 183
50 3300005439 Ga0070711_100001969 Ga0070711_1000019692 183
51 3300005547 Ga0070693_100041268 Ga0070693_1000412682 183
52 3300005578 Ga0068854_100000333 Ga0068854_10000033311 183
53 3300005841 Ga0068863_100000779 Ga0068863_10000077930 183
54 3300009093 Ga0105240_10464232 Ga0105240_104642322 183
55 3300009098 Ga0105245_10034240 Ga0105245_100342403 183
56 3300009176 Ga0105242_10000062 Ga0105242_1000006264 183
57 3300013105 Ga0157369_10000014 Ga0157369_10000014124 183
58 3300013296 Ga0157374_10151378 Ga0157374_101513783 183
59 3300013308 Ga0157375_10000584 Ga0157375_1000058417 183
60 3300014326 Ga0157380_10001197 Ga0157380_1000119717 183
61 3300014745 Ga0157377_10611596 Ga0157377_106115961 183
62 3300025913 Ga0207695_10358896 Ga0207695_103588962 183
63 3300025916 Ga0207663_10199764 Ga0207663_101997642 183
64 3300025927 Ga0207687_10014513 Ga0207687_100145135 183
65 3300025929 Ga0207664_10575216 Ga0207664_105752162 183
66 3300025934 Ga0207686_10000231 Ga0207686_1000023124 183
67 3300025939 Ga0207665_10193561 Ga0207665_101935612 183
68 3300025942 Ga0207689_10290111 Ga0207689_102901112 183
69 3300025942 Ga0207689_10492263 Ga0207689_104922632 183
70 3300025961 Ga0207712_10507662 Ga0207712_105076622 183
71 3300025981 Ga0207640_10000110 Ga0207640_1000011010 183
72 3300026075 Ga0207708_10697040 Ga0207708_106970402 183
73 3300026088 Ga0207641_10000827 Ga0207641_100008273 183
74 3300028556 Ga0265337_1000955 Ga0265337_10009554 183
75 3300028558 Ga0265326_10000041 Ga0265326_1000004178 183
76 3300028563 Ga0265319_1000014 Ga0265319_100001414 183
77 3300028654 Ga0265322_10000004 Ga0265322_1000000478 183
78 3300028800 Ga0265338_10000185 Ga0265338_1000018512 183
79 3300029957 Ga0265324_10000266 Ga0265324_1000026613 183
80 3300031239 Ga0265328_10003945 Ga0265328_100039453 183
81 3300031240 Ga0265320_10000029 Ga0265320_1000002977 183
82 3300031241 Ga0265325_10031082 Ga0265325_100310822 183
83 3300031242 Ga0265329_10011465 Ga0265329_100114654 183
84 3300031249 Ga0265339_10024105 Ga0265339_100241054 183
85 3300031250 Ga0265331_10002379 Ga0265331_100023795 183
86 3300031250 Ga0265331_10064275 Ga0265331_100642752 183
87 3300031251 Ga0265327_10000015 Ga0265327_1000001532 183
88 3300031344 Ga0265316_10146252 Ga0265316_101462522 183
89 3300031456 Ga0307513_10111268 Ga0307513_101112682 183
90 3300046455 Ga0495603_0000033 Ga0495603_0000033_49178_49741 183
91 3300046459 Ga0495629_0013075 Ga0495629_0013075_2289_2855 183
92 3300046459 Ga0495629_0022727 Ga0495629_0022727_2068_2634 183
93 3300046473 Ga0495582_0000009 Ga0495582_0000009_28386_28949 183
94 3300046511 Ga0495608_0006939 Ga0495608_0006939_3086_3649 183
95 3300046516 Ga0495628_0295387 Ga0495628_0295387_316_879 183
96 3300046523 Ga0495644_0003638 Ga0495644_0003638_5043_5606 183
97 3300046683 Ga0495658_0000002 Ga0495658_0000002_28381_28944 183
98 3300046689 Ga0495613_0067568 Ga0495613_0067568_582_1157 183
99 3300047321 Ga0495676_0081293 Ga0495676_0081293_874_1437 183
100 3300048089 Ga0495614_0026410 Ga0495614_0026410_1762_2325 183
101 3300048905 Ga0496102_0002490 Ga0496102_0002490_5069_5632 183
102 3300048906 Ga0496103_0000057 Ga0496103_0000057_95820_96383 183
103 3300049591 Ga0501075_0004268 Ga0501075_0004268_4744_5307 183
104 3300053085 Ga0495619_0000010 Ga0495619_0000010_230159_230734 183
105 3300053094 Ga0500566_0000943 Ga0500566_0000943_11666_12232 183
106 3300001977 JGI24746J21847_1001496 JGI24746J21847_10014962 184
107 3300005365 Ga0070688_100000277 Ga0070688_10000027714 184
108 3300005365 Ga0070688_100087858 Ga0070688_1000878582 184
109 3300005366 Ga0070659_100004173 Ga0070659_1000041734 184
110 3300005435 Ga0070714_100125748 Ga0070714_1001257482 184
111 3300005436 Ga0070713_100000058 Ga0070713_10000005812 184
112 3300005439 Ga0070711_100085494 Ga0070711_1000854942 184
113 3300005466 Ga0070685_10000013 Ga0070685_10000013121 184
114 3300005471 Ga0070698_100014541 Ga0070698_1000145411 184
115 3300005614 Ga0068856_100000237 Ga0068856_10000023717 184
116 3300005614 Ga0068856_100065400 Ga0068856_1000654002 184
117 3300005616 Ga0068852_100000002 Ga0068852_10000000227 184
118 3300005834 Ga0068851_10000126 Ga0068851_1000012634 184
119 3300005842 Ga0068858_100000069 Ga0068858_10000006941 184
120 3300006881 Ga0068865_100000042 Ga0068865_10000004251 184
121 3300006914 Ga0075436_100134099 Ga0075436_1001340992 184
122 3300009098 Ga0105245_10000104 Ga0105245_1000010435 184
123 3300009177 Ga0105248_10000175 Ga0105248_1000017530 184
124 3300010375 Ga0105239_10176381 Ga0105239_101763812 184
125 3300010375 Ga0105239_10331363 Ga0105239_103313632 184
126 3300013102 Ga0157371_10006328 Ga0157371_100063286 184
127 3300013104 Ga0157370_10041056 Ga0157370_100410562 184
128 3300013296 Ga0157374_10022241 Ga0157374_100222412 184
129 3300013307 Ga0157372_10000210 Ga0157372_1000021025 184
130 3300017792 Ga0163161_10000022 Ga0163161_10000022159 184
131 3300025321 Ga0207656_10000241 Ga0207656_100002415 184
132 3300025916 Ga0207663_10020089 Ga0207663_100200894 184
133 3300025925 Ga0207650_10347195 Ga0207650_103471952 184
134 3300025927 Ga0207687_10000015 Ga0207687_10000015229 184
135 3300025928 Ga0207700_10000003 Ga0207700_10000003480 184
136 3300025932 Ga0207690_10002915 Ga0207690_100029155 184
137 3300025938 Ga0207704_10000181 Ga0207704_1000018116 184
138 3300025941 Ga0207711_10000006 Ga0207711_1000000653 184
139 3300026035 Ga0207703_10000169 Ga0207703_100001697 184
140 3300026078 Ga0207702_10000251 Ga0207702_1000025153 184
141 3300026078 Ga0207702_10018324 Ga0207702_100183244 184
142 3300026142 Ga0207698_10000004 Ga0207698_10000004258 184
143 3300030521 Ga0307511_10058602 Ga0307511_100586023 184
144 3300035172 Ga0373955_0294863 Ga0373955_0294863_114_680 184
145 3300036401 Ga0373937_0026530 Ga0373937_0026530_3756_4322 184
146 3300044694 Ga0466963_0127592 Ga0466963_0127592_658_1239 184
147 3300044842 Ga0466957_0003429 Ga0466957_0003429_8088_8651 184
148 3300044842 Ga0466957_0030923 Ga0466957_0030923_38_610 184
149 3300046454 Ga0495592_0005546 Ga0495592_0005546_514_1080 184
150 3300046454 Ga0495592_0079544 Ga0495592_0079544_568_1134 184
151 3300046454 Ga0495592_0264117 Ga0495592_0264117_511_1080 184
152 3300046459 Ga0495629_0392763 Ga0495629_0392763_138_704 184
153 3300046461 Ga0495641_0000014 Ga0495641_0000014_5063_5629 184
154 3300046462 Ga0495651_0219648 Ga0495651_0219648_437_1003 184
155 3300046476 Ga0495662_0000698 Ga0495662_0000698_8206_8772 184
156 3300046511 Ga0495608_0000035 Ga0495608_0000035_4050_4616 184
157 3300046511 Ga0495608_0003187 Ga0495608_0003187_3087_3653 184
158 3300046514 Ga0495618_0000070 Ga0495618_0000070_9669_10247 184
159 3300046516 Ga0495628_0003299 Ga0495628_0003299_10516_11082 184
160 3300046517 Ga0495630_0055249 Ga0495630_0055249_614_1180 184
161 3300046533 Ga0495640_0017600 Ga0495640_0017600_2861_3430 184
162 3300046535 Ga0495586_0001457 Ga0495586_0001457_5177_5743 184
163 3300046536 Ga0495587_0019075 Ga0495587_0019075_1577_2143 184
164 3300046559 Ga0495667_0135739 Ga0495667_0135739_221_799 184
165 3300046642 Ga0495634_0090709 Ga0495634_0090709_1083_1649 184
166 3300046663 Ga0495635_0000057 Ga0495635_0000057_62003_62569 184
167 3300046675 Ga0495657_0000026 Ga0495657_0000026_128396_128962 184
168 3300046675 Ga0495657_0007638 Ga0495657_0007638_2547_3113 184
169 3300046679 Ga0495623_0196081 Ga0495623_0196081_78_644 184
170 3300046681 Ga0495647_0003964 Ga0495647_0003964_2102_2668 184
171 3300046683 Ga0495658_0001858 Ga0495658_0001858_119_697 184
172 3300046689 Ga0495613_0001530 Ga0495613_0001530_1988_2554 184
173 3300046689 Ga0495613_0002007 Ga0495613_0002007_9718_10284 184
174 3300046691 Ga0495670_0024563 Ga0495670_0024563_1578_2144 184
175 3300046809 Ga0495600_0004496 Ga0495600_0004496_6951_7529 184
176 3300046809 Ga0495600_0006263 Ga0495600_0006263_4870_5436 184
177 3300047317 Ga0495604_0000100 Ga0495604_0000100_8490_9056 184
178 3300047317 Ga0495604_0000305 Ga0495604_0000305_22300_22866 184
179 3300047317 Ga0495604_0064668 Ga0495604_0064668_290_856 184
180 3300047319 Ga0495674_0000010 Ga0495674_0000010_160578_161147 184
181 3300047322 Ga0495680_0000312 Ga0495680_0000312_48707_49273 184
182 3300047322 Ga0495680_0027207 Ga0495680_0027207_1330_1896 184
183 3300047444 Ga0495675_0000015 Ga0495675_0000015_128389_128955 184
184 3300047447 Ga0495685_013985 Ga0495685_013985_48_614 184
185 3300047673 Ga0495593_0106453 Ga0495593_0106453_829_1401 184
186 3300048088 Ga0495602_0000227 Ga0495602_0000227_37489_38055 184
187 3300048088 Ga0495602_0015468 Ga0495602_0015468_4351_4917 184
188 3300048907 Ga0496104_0228883 Ga0496104_0228883_258_824 184
189 3300048909 Ga0496106_0000356 Ga0496106_0000356_24778_25344 184
190 3300048910 Ga0496107_0297851 Ga0496107_0297851_315_881 184
191 3300048911 Ga0496108_0000005 Ga0496108_0000005_118711_119304 184
192 3300048912 Ga0496109_0000002 Ga0496109_0000002_415788_416381 184
193 3300048915 Ga0496112_0000006 Ga0496112_0000006_145596_146162 184
194 3300049578 Ga0501042_0392672 Ga0501042_0392672_23_589 184
195 3300049591 Ga0501075_0245464 Ga0501075_0245464_699_1265 184
196 3300053077 Ga0495601_0000057 Ga0495601_0000057_15045_15611 184
197 3300053083 Ga0495655_0000578 Ga0495655_0000578_1281_1847 184
198 3300053084 Ga0495595_0000017 Ga0495595_0000017_128396_128962 184
199 3300053084 Ga0495595_0000130 Ga0495595_0000130_19215_19781 184
200 3300053084 Ga0495595_0003783 Ga0495595_0003783_1690_2256 184
201 3300053085 Ga0495619_0000144 Ga0495619_0000144_49272_49844 184
202 3300053085 Ga0495619_0000146 Ga0495619_0000146_8322_8888 184
203 3300053085 Ga0495619_0001050 Ga0495619_0001050_13482_14048 184
204 3300053085 Ga0495619_0008902 Ga0495619_0008902_4846_5412 184
205 3300053123 Ga0500614_000630 Ga0500614_000630_3230_3796 184
206 iso_pu_bacteria 8057101203 8057105706 184
207 3300003373 JGI25407J50210_10000517 JGI25407J50210_100005174 185
208 3300005356 Ga0070674_100000002 Ga0070674_100000002154 185
209 3300005564 Ga0070664_100553453 Ga0070664_1005534532 185
210 3300005618 Ga0068864_100000015 Ga0068864_10000001527 185
211 3300005718 Ga0068866_10003702 Ga0068866_100037027 185
212 3300005981 Ga0081538_10000346 Ga0081538_1000034623 185
213 3300009148 Ga0105243_10200088 Ga0105243_102000882 185
214 3300009148 Ga0105243_10460174 Ga0105243_104601742 185
215 3300010375 Ga0105239_10840722 Ga0105239_108407222 185
216 3300013296 Ga0157374_10568412 Ga0157374_105684121 185
217 3300014326 Ga0157380_10261429 Ga0157380_102614292 185
218 3300014969 Ga0157376_10057248 Ga0157376_100572484 185
219 3300025899 Ga0207642_10002221 Ga0207642_100022212 185
220 3300025933 Ga0207706_10371749 Ga0207706_103717491 185
221 3300025934 Ga0207686_10178462 Ga0207686_101784622 185
222 3300025935 Ga0207709_10077005 Ga0207709_100770053 185
223 3300025935 Ga0207709_10381789 Ga0207709_103817891 185
224 3300025937 Ga0207669_10000003 Ga0207669_10000003140 185
225 3300025945 Ga0207679_10661697 Ga0207679_106616972 185
226 3300026095 Ga0207676_10000018 Ga0207676_10000018273 185
227 3300044694 Ga0466963_0081189 Ga0466963_0081189_202_807 185
228 3300044712 Ga0453684_0444889 Ga0453684_0444889_530_1111 185
229 3300046514 Ga0495618_0409114 Ga0495618_0409114_38_616 185
230 3300046642 Ga0495634_0000216 Ga0495634_0000216_36029_36607 185
231 3300047317 Ga0495604_0534047 Ga0495604_0534047_77_655 185
232 3300048913 Ga0496110_0000357 Ga0496110_0000357_5022_5597 185
233 3300048913 Ga0496110_1233306 Ga0496110_1233306_39_605 185
234 3300048914 Ga0496111_0000735 Ga0496111_0000735_11845_12420 185
235 3300049570 Ga0501033_0683234 Ga0501033_0683234_54_629 185
236 3300049572 Ga0501036_0283968 Ga0501036_0283968_741_1313 185
237 3300049589 Ga0501073_0446177 Ga0501073_0446177_254_829 185
238 3300049822 Ga0501035_0313230 Ga0501035_0313230_344_919 185
239 3300005364 Ga0070673_100515654 Ga0070673_1005156542 186
240 3300005544 Ga0070686_100385169 Ga0070686_1003851692 186
241 3300005842 Ga0068858_100009846 Ga0068858_10000984610 186
242 3300005843 Ga0068860_100579238 Ga0068860_1005792381 186
243 3300025903 Ga0207680_10374110 Ga0207680_103741102 186
244 3300026035 Ga0207703_10059475 Ga0207703_100594754 186
245 3300028381 Ga0268264_10367534 Ga0268264_103675342 186
246 3300046455 Ga0495603_0002227 Ga0495603_0002227_9669_10280 186
247 3300046680 Ga0495646_0420645 Ga0495646_0420645_66_677 186
248 3300048911 Ga0496108_0013086 Ga0496108_0013086_3981_4589 186
249 3300048916 Ga0496113_0087825 Ga0496113_0087825_321_929 186
250 3300053085 Ga0495619_0038268 Ga0495619_0038268_66_641 186
251 3300035172 Ga0373955_0404059 Ga0373955_0404059_156_734 187
252 3300044842 Ga0466957_0225348 Ga0466957_0225348_284_862 187
253 3300049586 Ga0501070_0955134 Ga0501070_0955134_18_599 187
254 3300005435 Ga0070714_100149575 Ga0070714_1001495751 188
255 3300005548 Ga0070665_100123072 Ga0070665_1001230722 188
256 3300028379 Ga0268266_10264713 Ga0268266_102647132 188
257 3300031239 Ga0265328_10105398 Ga0265328_101053982 188
258 3300031240 Ga0265320_10263661 Ga0265320_102636612 188
259 3300031711 Ga0265314_10014685 Ga0265314_100146855 188
260 3300042876 Ga0451577_0139182 Ga0451577_0139182_72_665 188
261 3300042876 Ga0451577_0285439 Ga0451577_0285439_139_765 188
262 3300042876 Ga0451577_0723991 Ga0451577_0723991_75_668 188
263 3300042876 Ga0451577_0758000 Ga0451577_0758000_245_838 188
264 3300044712 Ga0453684_0048400 Ga0453684_0048400_1828_2421 188
265 3300044712 Ga0453684_0435864 Ga0453684_0435864_469_1062 188
266 3300053077 Ga0495601_0054073 Ga0495601_0054073_437_1021 188
267 3300026075 Ga0207708_11050470 Ga0207708_110504701 189
268 3300049572 Ga0501036_0027129 Ga0501036_0027129_333_944 189
269 3300049574 Ga0501038_0017748 Ga0501038_0017748_3898_4509 189
270 3300049575 Ga0501039_0008492 Ga0501039_0008492_2096_2707 189
271 3300049576 Ga0501040_0006764 Ga0501040_0006764_454_1065 189
272 3300049582 Ga0501048_0054879 Ga0501048_0054879_1098_1709 189
273 3300049583 Ga0501067_0018170 Ga0501067_0018170_37_618 189
274 3300049584 Ga0501068_0550340 Ga0501068_0550340_50_661 189
275 3300049587 Ga0501071_0001878 Ga0501071_0001878_4792_5403 189
276 3300049588 Ga0501072_0002415 Ga0501072_0002415_2001_2612 189
277 3300049588 Ga0501072_0111146 Ga0501072_0111146_1171_1752 189
278 3300049589 Ga0501073_0031702 Ga0501073_0031702_2876_3457 189
279 3300049590 Ga0501074_0038307 Ga0501074_0038307_1982_2563 189
280 3300049591 Ga0501075_0000776 Ga0501075_0000776_5252_5863 189
281 3300049592 Ga0501076_0004507 Ga0501076_0004507_3376_3987 189
282 3300049741 Ga0501079_0005158 Ga0501079_0005158_3248_3859 189
283 3300049742 Ga0501080_0008721 Ga0501080_0008721_7486_8067 189
284 3300049743 Ga0501081_0009562 Ga0501081_0009562_554_1165 189
285 3300049744 Ga0501083_0075082 Ga0501083_0075082_1561_2142 189
286 3300049822 Ga0501035_0022734 Ga0501035_0022734_1312_1923 189
287 3300049824 Ga0501045_0000920 Ga0501045_0000920_13547_14158 189
288 3300054114 Ga0501084_0005800 Ga0501084_0005800_5417_6028 189
289 3300054114 Ga0501084_0103877 Ga0501084_0103877_1437_2018 189
290 3300060353 Ga0501082_0006081 Ga0501082_0006081_5981_6562 189
291 iso_pu_bacteria 2643221563 2643835823 189
292 iso_pu_bacteria 2643221608 2644056749 189
293 iso_pu_bacteria 2852653556 2852655109 189
294 iso_pu_bacteria 2852680915 2852681332 189
295 iso_pu_bacteria 2738541275 2738711889 190
296 iso_pu_bacteria 2738541301 2738850314 190
297 iso_pu_bacteria 2738541304 2738866043 190
298 iso_pu_bacteria 2738543022 2739298561 190
299 iso_pu_bacteria 2738543033 2739360239 190
300 iso_pu_bacteria 2818991466 2819712427 190
301 iso_pu_bacteria 2879163058 2879164447 190
302 iso_pu_bacteria 2882806704 2882807698 190
303 iso_pu_bacteria 2885429604 2885429854 190
304 iso_pu_bacteria 2895880812 2895886337 190
305 iso_pu_bacteria 2928100450 2928101528 190
306 iso_pu_bacteria 2928526807 2928526937 190
307 iso_pu_bacteria 2928959182 2928959619 190
308 iso_pu_bacteria 3000865235 3000866155 190
309 3300006852 Ga0075433_10001805 Ga0075433_1000180518 191
310 3300032004 Ga0307414_10341942 Ga0307414_103419422 191
311 3300032005 Ga0307411_10234335 Ga0307411_102343352 191
312 3300046663 Ga0495635_0444378 Ga0495635_0444378_107_745 191
313 3300050515 nmdc:mga0a205_386_c1 nmdc:mga0a205_386_c1_1683_2294 191
314 3300005563 Ga0068855_100078599 Ga0068855_1000785994 192
315 3300013306 Ga0163162_11026964 Ga0163162_110269642 192
316 3300053096 Ga0500641_0233121 Ga0500641_0233121_84_674 192
317 3300053108 Ga0500562_006799 Ga0500562_006799_799_1389 192
318 3300003781 Ga0055536_1001024 Ga0055536_10010246 193
319 3300003781 Ga0055536_1003233 Ga0055536_10032335 193
320 3300003781 Ga0055536_1010161 Ga0055536_10101612 193
321 3300003784 Ga0055534_1020141 Ga0055534_10201411 193
322 3300003791 Ga0055530_10000013 Ga0055530_10000013104 193
323 3300003794 Ga0055531_10000627 Ga0055531_1000062725 193
324 3300003794 Ga0055531_10001679 Ga0055531_100016799 193
325 3300005563 Ga0068855_100286895 Ga0068855_1002868952 193
326 3300005834 Ga0068851_10308140 Ga0068851_103081402 193
327 3300009148 Ga0105243_10140427 Ga0105243_101404272 193
328 3300025291 Ga0209675_1000808 Ga0209675_100080821 193
329 3300025292 Ga0209676_1000221 Ga0209676_1000221102 193
330 3300025292 Ga0209676_1000453 Ga0209676_100045350 193
331 3300025292 Ga0209676_1001826 Ga0209676_100182613 193
332 3300025294 Ga0209025_1008523 Ga0209025_10085237 193
333 3300025298 Ga0209050_1000042 Ga0209050_1000042285 193
334 3300025298 Ga0209050_1005032 Ga0209050_10050323 193
335 3300025298 Ga0209050_1031450 Ga0209050_10314502 193
336 3300025304 Ga0209257_1000135 Ga0209257_1000135102 193
337 3300025304 Ga0209257_1000487 Ga0209257_100048739 193
338 3300025304 Ga0209257_1006386 Ga0209257_10063862 193
339 3300025949 Ga0207667_10203211 Ga0207667_102032112 193
340 3300031616 Ga0307508_10121828 Ga0307508_101218282 193
341 3300031901 Ga0307406_11093672 Ga0307406_110936721 193
342 3300031911 Ga0307412_10088082 Ga0307412_100880822 193
343 3300032004 Ga0307414_10095806 Ga0307414_100958062 193
344 3300032004 Ga0307414_10143954 Ga0307414_101439542 193
345 3300032004 Ga0307414_11229039 Ga0307414_112290391 193
346 3300044658 Ga0466972_0000559 Ga0466972_0000559_2933_3520 193
347 3300044693 Ga0466961_0020191 Ga0466961_0020191_26_613 193
348 3300044694 Ga0466963_0003840 Ga0466963_0003840_3816_4403 193
349 3300044706 Ga0466964_0002332 Ga0466964_0002332_34_621 193
350 3300044712 Ga0453684_0107494 Ga0453684_0107494_833_1417 193
351 3300044719 Ga0466971_0000456 Ga0466971_0000456_6256_6843 193
352 3300044735 Ga0466968_0031684 Ga0466968_0031684_797_1396 193
353 3300044765 Ga0466970_0170830 Ga0466970_0170830_73_660 193
354 3300044842 Ga0466957_0004680 Ga0466957_0004680_2129_2716 193
355 3300044901 Ga0466960_0016084 Ga0466960_0016084_2161_2763 193
356 3300045049 Ga0466959_0082513 Ga0466959_0082513_306_893 193
357 3300045836 Ga0466958_0009712 Ga0466958_0009712_4381_4968 193
358 3300045976 Ga0466967_0041410 Ga0466967_0041410_1151_1738 193
359 3300046500 Ga0495596_0090126 Ga0495596_0090126_415_1005 193
360 3300046522 Ga0495643_0044416 Ga0495643_0044416_1044_1634 193
361 3300046660 Ga0495625_0001272 Ga0495625_0001272_28619_29209 193
362 3300048906 Ga0496103_0153583 Ga0496103_0153583_487_1071 193
363 3300049571 Ga0501034_0022938 Ga0501034_0022938_3822_4412 193
364 3300049574 Ga0501038_0012859 Ga0501038_0012859_4072_4662 193
365 3300049579 Ga0501043_0019073 Ga0501043_0019073_1214_1804 193
366 3300049582 Ga0501048_0116574 Ga0501048_0116574_945_1535 193
367 3300049823 Ga0501044_0210285 Ga0501044_0210285_510_1094 193
368 3300061719 Ga0466962_0000368 Ga0466962_0000368_16175_16762 193
369 iso_pu_bacteria 2919138771 2919139687 193
370 3300001915 JGI24741J21665_1009947 JGI24741J21665_10099472 194
371 3300001979 JGI24740J21852_10112164 JGI24740J21852_101121641 194
372 3300001989 JGI24739J22299_10005219 JGI24739J22299_100052195 194
373 3300001989 JGI24739J22299_10025799 JGI24739J22299_100257993 194
374 3300001989 JGI24739J22299_10061099 JGI24739J22299_100610992 194
375 3300001990 JGI24737J22298_10003186 JGI24737J22298_100031865 194
376 3300001990 JGI24737J22298_10005631 JGI24737J22298_100056316 194
377 3300001990 JGI24737J22298_10011515 JGI24737J22298_100115154 194
378 3300001990 JGI24737J22298_10016864 JGI24737J22298_100168642 194
379 3300001990 JGI24737J22298_10032429 JGI24737J22298_100324292 194
380 3300001990 JGI24737J22298_10050299 JGI24737J22298_100502992 194
381 3300001990 JGI24737J22298_10131621 JGI24737J22298_101316212 194
382 3300001991 JGI24743J22301_10021842 JGI24743J22301_100218422 194
383 3300002067 JGI24735J21928_10001921 JGI24735J21928_100019213 194
384 3300002067 JGI24735J21928_10026342 JGI24735J21928_100263422 194
385 3300002067 JGI24735J21928_10030054 JGI24735J21928_100300542 194
386 3300002067 JGI24735J21928_10030869 JGI24735J21928_100308693 194
387 3300002067 JGI24735J21928_10058391 JGI24735J21928_100583911 194
388 3300002067 JGI24735J21928_10060479 JGI24735J21928_100604792 194
389 3300002075 JGI24738J21930_10000848 JGI24738J21930_100008489 194
390 3300002075 JGI24738J21930_10004277 JGI24738J21930_100042774 194
391 3300002075 JGI24738J21930_10020148 JGI24738J21930_100201483 194
392 3300002077 JGI24744J21845_10000444 JGI24744J21845_100004444 194
393 3300002239 JGI24034J26672_10039456 JGI24034J26672_100394562 194
394 3300002244 JGI24742J22300_10023398 JGI24742J22300_100233981 194
395 3300002772 JGI25164J39214_1010460 JGI25164J39214_10104601 194
396 3300003214 JGI25165J46597_1000040 JGI25165J46597_100004072 194
397 3300003214 JGI25165J46597_1000089 JGI25165J46597_100008935 194
398 3300003215 JGI25153J46596_10000002 JGI25153J46596_10000002508 194
399 3300003759 Ga0055525_1000051 Ga0055525_100005111 194
400 3300003762 Ga0055542_1000020 Ga0055542_1000020128 194
401 3300003762 Ga0055542_1002673 Ga0055542_10026732 194
402 3300003763 Ga0055529_1000016 Ga0055529_1000016219 194
403 3300003791 Ga0055530_10000901 Ga0055530_1000090114 194
404 3300003794 Ga0055531_10000583 Ga0055531_1000058314 194
405 3300005262 Ga0065165_1002265 Ga0065165_10022652 194
406 3300005288 Ga0065714_10162484 Ga0065714_101624842 194
407 3300005289 Ga0065704_10128058 Ga0065704_101280582 194
408 3300005295 Ga0065707_10084488 Ga0065707_100844887 194
409 3300005327 Ga0070658_10000022 Ga0070658_10000022118 194
410 3300005327 Ga0070658_10001598 Ga0070658_1000159812 194
411 3300005327 Ga0070658_10006112 Ga0070658_100061127 194
412 3300005327 Ga0070658_10078427 Ga0070658_100784273 194
413 3300005327 Ga0070658_10252945 Ga0070658_102529452 194
414 3300005328 Ga0070676_10000855 Ga0070676_1000085518 194
415 3300005329 Ga0070683_100810431 Ga0070683_1008104312 194
416 3300005329 Ga0070683_101074809 Ga0070683_1010748091 194
417 3300005334 Ga0068869_100000031 Ga0068869_10000003137 194
418 3300005336 Ga0070680_100004842 Ga0070680_1000048429 194
419 3300005338 Ga0068868_100000060 Ga0068868_10000006026 194
420 3300005339 Ga0070660_100000568 Ga0070660_1000005686 194
421 3300005339 Ga0070660_100000801 Ga0070660_10000080125 194
422 3300005339 Ga0070660_100005160 Ga0070660_1000051606 194
423 3300005339 Ga0070660_100297948 Ga0070660_1002979481 194
424 3300005344 Ga0070661_100010440 Ga0070661_1000104403 194
425 3300005344 Ga0070661_100239357 Ga0070661_1002393571 194
426 3300005344 Ga0070661_100398497 Ga0070661_1003984972 194
427 3300005347 Ga0070668_100031585 Ga0070668_1000315854 194
428 3300005353 Ga0070669_100270249 Ga0070669_1002702492 194
429 3300005354 Ga0070675_100006017 Ga0070675_1000060175 194
430 3300005354 Ga0070675_100181892 Ga0070675_1001818923 194
431 3300005355 Ga0070671_100090815 Ga0070671_1000908154 194
432 3300005356 Ga0070674_100000740 Ga0070674_10000074013 194
433 3300005356 Ga0070674_100088635 Ga0070674_1000886353 194
434 3300005356 Ga0070674_100166219 Ga0070674_1001662192 194
435 3300005356 Ga0070674_100861137 Ga0070674_1008611371 194
436 3300005364 Ga0070673_100000009 Ga0070673_10000000926 194
437 3300005364 Ga0070673_100693518 Ga0070673_1006935182 194
438 3300005366 Ga0070659_100064395 Ga0070659_1000643953 194
439 3300005366 Ga0070659_100217275 Ga0070659_1002172752 194
440 3300005366 Ga0070659_100549290 Ga0070659_1005492902 194
441 3300005367 Ga0070667_100032672 Ga0070667_1000326722 194
442 3300005445 Ga0070708_100001562 Ga0070708_10000156218 194
443 3300005455 Ga0070663_100025418 Ga0070663_1000254184 194
444 3300005456 Ga0070678_100000011 Ga0070678_10000001161 194
445 3300005456 Ga0070678_100001799 Ga0070678_1000017995 194
446 3300005457 Ga0070662_100000708 Ga0070662_1000007086 194
447 3300005457 Ga0070662_100045764 Ga0070662_1000457644 194
448 3300005457 Ga0070662_100107871 Ga0070662_1001078712 194
449 3300005458 Ga0070681_10073045 Ga0070681_100730454 194
450 3300005459 Ga0068867_100000165 Ga0068867_10000016513 194
451 3300005459 Ga0068867_100812205 Ga0068867_1008122052 194
452 3300005471 Ga0070698_100561687 Ga0070698_1005616871 194
453 3300005530 Ga0070679_100140718 Ga0070679_1001407183 194
454 3300005539 Ga0068853_100000428 Ga0068853_10000042815 194
455 3300005539 Ga0068853_100013891 Ga0068853_1000138916 194
456 3300005539 Ga0068853_100060896 Ga0068853_1000608962 194
457 3300005539 Ga0068853_100377295 Ga0068853_1003772952 194
458 3300005539 Ga0068853_100404301 Ga0068853_1004043012 194
459 3300005548 Ga0070665_100013086 Ga0070665_1000130863 194
460 3300005563 Ga0068855_100000371 Ga0068855_10000037126 194
461 3300005563 Ga0068855_100004395 Ga0068855_1000043955 194
462 3300005563 Ga0068855_100076067 Ga0068855_1000760673 194
463 3300005563 Ga0068855_100163605 Ga0068855_1001636052 194
464 3300005563 Ga0068855_100501590 Ga0068855_1005015902 194
465 3300005564 Ga0070664_100018632 Ga0070664_1000186325 194
466 3300005577 Ga0068857_100006008 Ga0068857_10000600811 194
467 3300005577 Ga0068857_100128132 Ga0068857_1001281322 194
468 3300005578 Ga0068854_100001819 Ga0068854_1000018196 194
469 3300005578 Ga0068854_100026592 Ga0068854_1000265924 194
470 3300005614 Ga0068856_100016235 Ga0068856_1000162356 194
471 3300005614 Ga0068856_100026512 Ga0068856_1000265125 194
472 3300005616 Ga0068852_100001240 Ga0068852_1000012403 194
473 3300005617 Ga0068859_100971900 Ga0068859_1009719002 194
474 3300005618 Ga0068864_100006060 Ga0068864_1000060604 194
475 3300005834 Ga0068851_10012377 Ga0068851_100123773 194
476 3300005841 Ga0068863_100001344 Ga0068863_1000013448 194
477 3300005842 Ga0068858_100001528 Ga0068858_1000015287 194
478 3300005842 Ga0068858_100023504 Ga0068858_1000235045 194
479 3300005843 Ga0068860_100000008 Ga0068860_100000008184 194
480 3300005843 Ga0068860_100001200 Ga0068860_10000120019 194
481 3300005843 Ga0068860_100001714 Ga0068860_10000171413 194
482 3300005843 Ga0068860_100108660 Ga0068860_1001086603 194
483 3300005844 Ga0068862_100000067 Ga0068862_100000067127 194
484 3300005983 Ga0081540_1080044 Ga0081540_10800442 194
485 3300006038 Ga0075365_10062021 Ga0075365_100620212 194
486 3300006048 Ga0075363_100016646 Ga0075363_1000166462 194
487 3300006051 Ga0075364_10004936 Ga0075364_100049362 194
488 3300006058 Ga0075432_10000049 Ga0075432_100000497 194
489 3300006177 Ga0075362_10027008 Ga0075362_100270082 194
490 3300006177 Ga0075362_10064391 Ga0075362_100643912 194
491 3300006178 Ga0075367_10027653 Ga0075367_100276532 194
492 3300006178 Ga0075367_10106389 Ga0075367_101063892 194
493 3300006186 Ga0075369_10041906 Ga0075369_100419062 194
494 3300006237 Ga0097621_100014855 Ga0097621_1000148555 194
495 3300006237 Ga0097621_100414609 Ga0097621_1004146091 194
496 3300006353 Ga0075370_10000025 Ga0075370_1000002529 194
497 3300006353 Ga0075370_10005297 Ga0075370_100052977 194
498 3300006353 Ga0075370_10087395 Ga0075370_100873953 194
499 3300006353 Ga0075370_10132958 Ga0075370_101329582 194
500 3300006353 Ga0075370_10153160 Ga0075370_101531602 194
501 3300006358 Ga0068871_100016115 Ga0068871_1000161155 194
502 3300006358 Ga0068871_100169241 Ga0068871_1001692413 194
503 3300006881 Ga0068865_100000014 Ga0068865_100000014117 194
504 3300006914 Ga0075436_100126079 Ga0075436_1001260792 194
505 3300006931 Ga0097620_100035787 Ga0097620_1000357876 194
506 3300006931 Ga0097620_100971533 Ga0097620_1009715332 194
507 3300006946 Ga0079104_1012581 Ga0079104_10125813 194
508 3300009093 Ga0105240_10088485 Ga0105240_100884853 194
509 3300009093 Ga0105240_10407978 Ga0105240_104079781 194
510 3300009098 Ga0105245_10000160 Ga0105245_1000016040 194
511 3300009101 Ga0105247_10029554 Ga0105247_100295544 194
512 3300009148 Ga0105243_10000070 Ga0105243_1000007096 194
513 3300009148 Ga0105243_10000760 Ga0105243_1000076027 194
514 3300009174 Ga0105241_10276947 Ga0105241_102769472 194
515 3300009176 Ga0105242_10000722 Ga0105242_1000072226 194
516 3300009176 Ga0105242_10092631 Ga0105242_100926313 194
517 3300009545 Ga0105237_10007067 Ga0105237_100070674 194
518 3300009551 Ga0105238_10086778 Ga0105238_100867783 194
519 3300009553 Ga0105249_10000056 Ga0105249_10000056160 194
520 3300009553 Ga0105249_10048124 Ga0105249_100481244 194
521 3300010375 Ga0105239_10227075 Ga0105239_102270752 194
522 3300010375 Ga0105239_10618244 Ga0105239_106182442 194
523 3300011119 Ga0105246_10000434 Ga0105246_1000043413 194
524 3300011119 Ga0105246_10001563 Ga0105246_100015633 194
525 3300012475 Ga0157317_1005034 Ga0157317_10050341 194
526 3300012513 Ga0157326_1010593 Ga0157326_10105931 194
527 3300013100 Ga0157373_10005789 Ga0157373_100057892 194
528 3300013100 Ga0157373_10015197 Ga0157373_100151973 194
529 3300013102 Ga0157371_10001422 Ga0157371_100014225 194
530 3300013102 Ga0157371_10255031 Ga0157371_102550311 194
531 3300013104 Ga0157370_10000117 Ga0157370_1000011738 194
532 3300013104 Ga0157370_10010517 Ga0157370_100105177 194
533 3300013104 Ga0157370_10570332 Ga0157370_105703322 194
534 3300013105 Ga0157369_10044079 Ga0157369_100440795 194
535 3300013105 Ga0157369_10097146 Ga0157369_100971462 194
536 3300013105 Ga0157369_10178719 Ga0157369_101787192 194
537 3300013296 Ga0157374_10000542 Ga0157374_100005425 194
538 3300013296 Ga0157374_10106555 Ga0157374_101065552 194
539 3300013296 Ga0157374_10285653 Ga0157374_102856532 194
540 3300013297 Ga0157378_10000624 Ga0157378_100006245 194
541 3300013297 Ga0157378_10049551 Ga0157378_100495515 194
542 3300013307 Ga0157372_10002092 Ga0157372_100020927 194
543 3300013307 Ga0157372_10004924 Ga0157372_100049245 194
544 3300013307 Ga0157372_10260179 Ga0157372_102601792 194
545 3300013307 Ga0157372_10506759 Ga0157372_105067591 194
546 3300013307 Ga0157372_11011733 Ga0157372_110117332 194
547 3300013308 Ga0157375_10001639 Ga0157375_100016395 194
548 3300013308 Ga0157375_10376077 Ga0157375_103760772 194
549 3300014326 Ga0157380_10070038 Ga0157380_100700384 194
550 3300014969 Ga0157376_10000096 Ga0157376_1000009626 194
551 3300015690 Ga0183363_1005 Ga0183363_100575 194
552 3300017792 Ga0163161_10005899 Ga0163161_100058999 194
553 3300017792 Ga0163161_10398178 Ga0163161_103981782 194
554 3300025230 Ga0209563_100019 Ga0209563_100019495 194
555 3300025231 Ga0207427_101438 Ga0207427_1014382 194
556 3300025233 Ga0209437_110657 Ga0209437_1106573 194
557 3300025250 Ga0209026_1000641 Ga0209026_10006412 194
558 3300025254 Ga0209148_1000017 Ga0209148_1000017529 194
559 3300025254 Ga0209148_1000147 Ga0209148_1000147142 194
560 3300025254 Ga0209148_1003079 Ga0209148_10030795 194
561 3300025261 Ga0209233_1000003 Ga0209233_1000003411 194
562 3300025261 Ga0209233_1000154 Ga0209233_1000154118 194
563 3300025272 Ga0209455_1000005 Ga0209455_1000005529 194
564 3300025272 Ga0209455_1001163 Ga0209455_10011635 194
565 3300025297 Ga0209758_1000001 Ga0209758_10000011305 194
566 3300025298 Ga0209050_1000010 Ga0209050_1000010433 194
567 3300025304 Ga0209257_1000009 Ga0209257_1000009682 194
568 3300025893 Ga0207682_10181100 Ga0207682_101811001 194
569 3300025900 Ga0207710_10026569 Ga0207710_100265693 194
570 3300025901 Ga0207688_10025857 Ga0207688_100258573 194
571 3300025901 Ga0207688_10042823 Ga0207688_100428233 194
572 3300025904 Ga0207647_10003309 Ga0207647_100033092 194
573 3300025904 Ga0207647_10006904 Ga0207647_100069043 194
574 3300025904 Ga0207647_10017498 Ga0207647_100174983 194
575 3300025904 Ga0207647_10028077 Ga0207647_100280774 194
576 3300025904 Ga0207647_10155089 Ga0207647_101550892 194
577 3300025907 Ga0207645_10002952 Ga0207645_1000295214 194
578 3300025909 Ga0207705_10000042 Ga0207705_10000042121 194
579 3300025909 Ga0207705_10000236 Ga0207705_1000023652 194
580 3300025909 Ga0207705_10009197 Ga0207705_100091976 194
581 3300025909 Ga0207705_10030261 Ga0207705_100302612 194
582 3300025909 Ga0207705_10333089 Ga0207705_103330891 194
583 3300025909 Ga0207705_10384144 Ga0207705_103841442 194
584 3300025911 Ga0207654_10165528 Ga0207654_101655282 194
585 3300025913 Ga0207695_10067256 Ga0207695_100672565 194
586 3300025913 Ga0207695_10414637 Ga0207695_104146371 194
587 3300025914 Ga0207671_10023161 Ga0207671_100231614 194
588 3300025917 Ga0207660_10022399 Ga0207660_100223994 194
589 3300025919 Ga0207657_10000081 Ga0207657_1000008169 194
590 3300025919 Ga0207657_10001189 Ga0207657_1000118923 194
591 3300025919 Ga0207657_10008800 Ga0207657_100088005 194
592 3300025919 Ga0207657_10047392 Ga0207657_100473923 194
593 3300025919 Ga0207657_10203518 Ga0207657_102035182 194
594 3300025920 Ga0207649_10033331 Ga0207649_100333313 194
595 3300025920 Ga0207649_10270738 Ga0207649_102707382 194
596 3300025920 Ga0207649_11023411 Ga0207649_110234111 194
597 3300025921 Ga0207652_10246966 Ga0207652_102469661 194
598 3300025923 Ga0207681_10560239 Ga0207681_105602392 194
599 3300025924 Ga0207694_10053989 Ga0207694_100539893 194
600 3300025926 Ga0207659_10004034 Ga0207659_100040347 194
601 3300025926 Ga0207659_10554791 Ga0207659_105547912 194
602 3300025927 Ga0207687_10003175 Ga0207687_100031754 194
603 3300025932 Ga0207690_10005010 Ga0207690_100050105 194
604 3300025932 Ga0207690_10048973 Ga0207690_100489732 194
605 3300025932 Ga0207690_10102863 Ga0207690_101028632 194
606 3300025933 Ga0207706_10000112 Ga0207706_1000011251 194
607 3300025933 Ga0207706_10011098 Ga0207706_100110984 194
608 3300025933 Ga0207706_10013408 Ga0207706_100134087 194
609 3300025933 Ga0207706_10013706 Ga0207706_100137064 194
610 3300025933 Ga0207706_10091730 Ga0207706_100917302 194
611 3300025933 Ga0207706_10113122 Ga0207706_101131223 194
612 3300025934 Ga0207686_10000489 Ga0207686_1000048926 194
613 3300025934 Ga0207686_10112928 Ga0207686_101129281 194
614 3300025935 Ga0207709_10000031 Ga0207709_1000003152 194
615 3300025935 Ga0207709_10000066 Ga0207709_100000664 194
616 3300025935 Ga0207709_10241413 Ga0207709_102414131 194
617 3300025937 Ga0207669_10000073 Ga0207669_1000007363 194
618 3300025937 Ga0207669_10000718 Ga0207669_1000071810 194
619 3300025937 Ga0207669_10019929 Ga0207669_100199292 194
620 3300025938 Ga0207704_10000002 Ga0207704_10000002194 194
621 3300025938 Ga0207704_10000007 Ga0207704_10000007194 194
622 3300025938 Ga0207704_10113553 Ga0207704_101135532 194
623 3300025940 Ga0207691_10014326 Ga0207691_100143263 194
624 3300025942 Ga0207689_10000060 Ga0207689_1000006061 194
625 3300025944 Ga0207661_10136885 Ga0207661_101368853 194
626 3300025944 Ga0207661_10169639 Ga0207661_101696393 194
627 3300025944 Ga0207661_11145385 Ga0207661_111453851 194
628 3300025945 Ga0207679_10056629 Ga0207679_100566293 194
629 3300025949 Ga0207667_10000017 Ga0207667_10000017320 194
630 3300025949 Ga0207667_10062071 Ga0207667_100620713 194
631 3300025949 Ga0207667_10065036 Ga0207667_100650363 194
632 3300025949 Ga0207667_10202034 Ga0207667_102020343 194
633 3300025949 Ga0207667_10385383 Ga0207667_103853832 194
634 3300025960 Ga0207651_10000004 Ga0207651_10000004263 194
635 3300025960 Ga0207651_10176139 Ga0207651_101761392 194
636 3300025961 Ga0207712_10000015 Ga0207712_10000015135 194
637 3300025961 Ga0207712_10006048 Ga0207712_100060488 194
638 3300025972 Ga0207668_10138161 Ga0207668_101381613 194
639 3300025981 Ga0207640_10000653 Ga0207640_1000065315 194
640 3300025981 Ga0207640_10007464 Ga0207640_100074644 194
641 3300025981 Ga0207640_10190802 Ga0207640_101908022 194
642 3300025986 Ga0207658_10015627 Ga0207658_100156272 194
643 3300026023 Ga0207677_10000231 Ga0207677_1000023144 194
644 3300026035 Ga0207703_10000123 Ga0207703_1000012368 194
645 3300026035 Ga0207703_10067257 Ga0207703_100672572 194
646 3300026041 Ga0207639_10000312 Ga0207639_100003126 194
647 3300026041 Ga0207639_10003914 Ga0207639_100039149 194
648 3300026041 Ga0207639_10022289 Ga0207639_100222894 194
649 3300026041 Ga0207639_10046665 Ga0207639_100466652 194
650 3300026041 Ga0207639_10256756 Ga0207639_102567562 194
651 3300026041 Ga0207639_10450568 Ga0207639_104505682 194
652 3300026067 Ga0207678_10000656 Ga0207678_1000065632 194
653 3300026067 Ga0207678_10128322 Ga0207678_101283222 194
654 3300026078 Ga0207702_10006436 Ga0207702_100064362 194
655 3300026078 Ga0207702_10043845 Ga0207702_100438454 194
656 3300026078 Ga0207702_10311614 Ga0207702_103116142 194
657 3300026088 Ga0207641_10000102 Ga0207641_1000010285 194
658 3300026089 Ga0207648_10000003 Ga0207648_1000000326 194
659 3300026116 Ga0207674_10069407 Ga0207674_100694074 194
660 3300026116 Ga0207674_10266128 Ga0207674_102661282 194
661 3300026116 Ga0207674_10385388 Ga0207674_103853882 194
662 3300026121 Ga0207683_10000086 Ga0207683_1000008665 194
663 3300026121 Ga0207683_10024502 Ga0207683_100245024 194
664 3300026121 Ga0207683_10071169 Ga0207683_100711693 194
665 3300026142 Ga0207698_10000385 Ga0207698_1000038517 194
666 3300027866 Ga0209813_10000053 Ga0209813_1000005342 194
667 3300027876 Ga0209974_10151896 Ga0209974_101518962 194
668 3300027907 Ga0207428_10116851 Ga0207428_101168513 194
669 3300028379 Ga0268266_10009662 Ga0268266_100096626 194
670 3300028380 Ga0268265_10000021 Ga0268265_10000021105 194
671 3300028380 Ga0268265_10012842 Ga0268265_100128425 194
672 3300028381 Ga0268264_10000018 Ga0268264_10000018349 194
673 3300028381 Ga0268264_10000330 Ga0268264_1000033031 194
674 3300028381 Ga0268264_10002138 Ga0268264_1000213810 194
675 3300031456 Ga0307513_10082859 Ga0307513_100828594 194
676 3300031548 Ga0307408_100179098 Ga0307408_1001790982 194
677 3300031616 Ga0307508_10001087 Ga0307508_1000108715 194
678 3300031691 Ga0316579_10074567 Ga0316579_100745672 194
679 3300031852 Ga0307410_10063140 Ga0307410_100631402 194
680 3300031852 Ga0307410_10069496 Ga0307410_100694963 194
681 3300031852 Ga0307410_10598170 Ga0307410_105981702 194
682 3300031903 Ga0307407_10415807 Ga0307407_104158072 194
683 3300031911 Ga0307412_10459652 Ga0307412_104596522 194
684 3300031995 Ga0307409_100615108 Ga0307409_1006151082 194
685 3300032002 Ga0307416_101124106 Ga0307416_1011241062 194
686 3300032002 Ga0307416_101230978 Ga0307416_1012309781 194
687 3300032004 Ga0307414_10180164 Ga0307414_101801642 194
688 3300032004 Ga0307414_10180417 Ga0307414_101804172 194
689 3300032005 Ga0307411_10404654 Ga0307411_104046542 194
690 3300032005 Ga0307411_10946091 Ga0307411_109460911 194
691 3300032126 Ga0307415_100602456 Ga0307415_1006024562 194
692 3300032133 Ga0316583_10025382 Ga0316583_100253822 194
693 3300036647 Ga0316582_0000403 Ga0316582_0000403_9261_9845 194
694 3300036712 Ga0316584_0366060 Ga0316584_0366060_59_643 194
695 3300037312 Ga0395899_0069029 Ga0395899_0069029_1711_2298 194
696 3300037312 Ga0395899_0072345 Ga0395899_0072345_883_1467 194
697 3300037418 Ga0395900_0014470 Ga0395900_0014470_2775_3362 194
698 3300037418 Ga0395900_0249634 Ga0395900_0249634_323_910 194
699 3300037418 Ga0395900_0901660 Ga0395900_0901660_198_785 194
700 3300037471 Ga0395905_0040453 Ga0395905_0040453_2366_2953 194
701 3300037471 Ga0395905_0065909 Ga0395905_0065909_912_1511 194
702 3300038443 Ga0395901_0019343 Ga0395901_0019343_1704_2291 194
703 3300038443 Ga0395901_0883018 Ga0395901_0883018_178_765 194
704 3300041456 Ga0451795_0981501 Ga0451795_0981501_321_905 194
705 3300042005 Ga0439448_0016115 Ga0439448_0016115_1573_2160 194
706 3300042005 Ga0439448_0031454 Ga0439448_0031454_425_1012 194
707 3300042005 Ga0439448_0040880 Ga0439448_0040880_533_1120 194
708 3300042012 Ga0439455_0007890 Ga0439455_0007890_1057_1644 194
709 3300042012 Ga0439455_0021674 Ga0439455_0021674_117_704 194
710 3300042157 Ga0439458_0000728 Ga0439458_0000728_1981_2568 194
711 3300042157 Ga0439458_0001986 Ga0439458_0001986_4164_4751 194
712 3300042157 Ga0439458_0004167 Ga0439458_0004167_1239_1826 194
713 3300044683 Ga0466965_0048807 Ga0466965_0048807_1469_2068 194
714 3300044684 Ga0466966_0044471 Ga0466966_0044471_584_1183 194
715 3300044693 Ga0466961_0015796 Ga0466961_0015796_3971_4570 194
716 3300044765 Ga0466970_0007333 Ga0466970_0007333_1663_2262 194
717 3300044765 Ga0466970_0171690 Ga0466970_0171690_456_1043 194
718 3300045049 Ga0466959_0039342 Ga0466959_0039342_1664_2263 194
719 3300045051 Ga0451576_0000023 Ga0451576_0000023_6097_6708 194
720 3300045051 Ga0451576_0477661 Ga0451576_0477661_672_1295 194
721 3300045836 Ga0466958_0139879 Ga0466958_0139879_771_1358 194
722 3300046460 Ga0495638_0001782 Ga0495638_0001782_4480_5064 194
723 3300046460 Ga0495638_0022336 Ga0495638_0022336_3485_4084 194
724 3300046471 Ga0495650_0000340 Ga0495650_0000340_55060_55644 194
725 3300046492 Ga0495585_0019033 Ga0495585_0019033_2139_2723 194
726 3300046492 Ga0495585_0138231 Ga0495585_0138231_138_722 194
727 3300046500 Ga0495596_0000288 Ga0495596_0000288_8996_9607 194
728 3300046501 Ga0495607_0003392 Ga0495607_0003392_1577_2188 194
729 3300046506 Ga0495583_0000996 Ga0495583_0000996_12700_13284 194
730 3300046506 Ga0495583_0010824 Ga0495583_0010824_1050_1661 194
731 3300046506 Ga0495583_0011374 Ga0495583_0011374_3705_4289 194
732 3300046506 Ga0495583_0199221 Ga0495583_0199221_123_707 194
733 3300046507 Ga0495606_0000824 Ga0495606_0000824_38247_38831 194
734 3300046507 Ga0495606_0118613 Ga0495606_0118613_351_938 194
735 3300046513 Ga0495616_0106319 Ga0495616_0106319_485_1069 194
736 3300046518 Ga0495631_0217209 Ga0495631_0217209_134_718 194
737 3300046519 Ga0495632_0037725 Ga0495632_0037725_476_1087 194
738 3300046522 Ga0495643_0000132 Ga0495643_0000132_41852_42481 194
739 3300046522 Ga0495643_0001032 Ga0495643_0001032_19864_20448 194
740 3300046522 Ga0495643_0002580 Ga0495643_0002580_5876_6487 194
741 3300046522 Ga0495643_0247246 Ga0495643_0247246_211_795 194
742 3300046524 Ga0495648_0052521 Ga0495648_0052521_685_1368 194
743 3300046525 Ga0495663_0010856 Ga0495663_0010856_1625_2209 194
744 3300046530 Ga0495654_0082285 Ga0495654_0082285_417_1001 194
745 3300046538 Ga0495609_0006682 Ga0495609_0006682_804_1415 194
746 3300046557 Ga0495622_0003931 Ga0495622_0003931_602_1186 194
747 3300046558 Ga0495633_0003629 Ga0495633_0003629_7778_8362 194
748 3300046558 Ga0495633_0024503 Ga0495633_0024503_1703_2287 194
749 3300046616 Ga0495668_0184355 Ga0495668_0184355_347_931 194
750 3300046648 Ga0495611_0014992 Ga0495611_0014992_793_1377 194
751 3300046648 Ga0495611_0119212 Ga0495611_0119212_505_1089 194
752 3300046660 Ga0495625_0000093 Ga0495625_0000093_5447_6043 194
753 3300046660 Ga0495625_0000583 Ga0495625_0000583_10891_11475 194
754 3300046660 Ga0495625_0024137 Ga0495625_0024137_1200_1811 194
755 3300046660 Ga0495625_0036791 Ga0495625_0036791_253_837 194
756 3300046660 Ga0495625_0037260 Ga0495625_0037260_857_1441 194
757 3300046660 Ga0495625_0388388 Ga0495625_0388388_36_620 194
758 3300046660 Ga0495625_0496866 Ga0495625_0496866_130_714 194
759 3300046665 Ga0495661_0066888 Ga0495661_0066888_873_1457 194
760 3300046691 Ga0495670_0058212 Ga0495670_0058212_372_956 194
761 3300046692 Ga0495671_0083324 Ga0495671_0083324_16_627 194
762 3300046694 Ga0495649_0193899 Ga0495649_0193899_163_750 194
763 3300046810 Ga0495660_0124506 Ga0495660_0124506_516_1100 194
764 3300047323 Ga0495683_0011593 Ga0495683_0011593_526_1110 194
765 3300047323 Ga0495683_0055376 Ga0495683_0055376_1038_1622 194
766 3300047443 Ga0495687_000512 Ga0495687_000512_19003_19587 194
767 3300047443 Ga0495687_010555 Ga0495687_010555_660_1244 194
768 3300047443 Ga0495687_057939 Ga0495687_057939_325_912 194
769 3300047470 Ga0495681_0189462 Ga0495681_0189462_216_800 194
770 3300047472 Ga0495686_0000753 Ga0495686_0000753_28855_29442 194
771 3300047472 Ga0495686_0000983 Ga0495686_0000983_27753_28340 194
772 3300048091 Ga0495626_0258124 Ga0495626_0258124_31_615 194
773 3300048903 Ga0496100_0177923 Ga0496100_0177923_854_1441 194
774 3300048905 Ga0496102_0170708 Ga0496102_0170708_1121_1708 194
775 3300048908 Ga0496105_0003976 Ga0496105_0003976_9809_10396 194
776 3300048916 Ga0496113_0053877 Ga0496113_0053877_632_1216 194
777 3300048920 Ga0496117_0070555 Ga0496117_0070555_757_1344 194
778 3300048921 Ga0496118_0020983 Ga0496118_0020983_1107_1694 194
779 3300048924 Ga0496121_0000222 Ga0496121_0000222_53478_54065 194
780 3300048924 Ga0496121_0000367 Ga0496121_0000367_59717_60301 194
781 3300048924 Ga0496121_0227511 Ga0496121_0227511_410_994 194
782 3300048925 Ga0496122_0002744 Ga0496122_0002744_7438_8025 194
783 3300048926 Ga0496123_0001272 Ga0496123_0001272_29689_30276 194
784 3300048926 Ga0496123_0090996 Ga0496123_0090996_427_1011 194
785 3300048926 Ga0496123_0166632 Ga0496123_0166632_549_1133 194
786 3300048927 Ga0496124_0035687 Ga0496124_0035687_647_1234 194
787 3300048927 Ga0496124_0099052 Ga0496124_0099052_1359_1943 194
788 3300048928 Ga0496125_0000730 Ga0496125_0000730_33138_33722 194
789 3300049460 Ga0495682_0134769 Ga0495682_0134769_152_736 194
790 3300049568 Ga0501031_0130946 Ga0501031_0130946_744_1352 194
791 3300049571 Ga0501034_0084595 Ga0501034_0084595_192_791 194
792 3300049571 Ga0501034_0885834 Ga0501034_0885834_15_614 194
793 3300049575 Ga0501039_0783410 Ga0501039_0783410_20_604 194
794 3300049581 Ga0501047_0000729 Ga0501047_0000729_15596_16216 194
795 3300049581 Ga0501047_0138935 Ga0501047_0138935_1699_2283 194
796 3300049581 Ga0501047_0427836 Ga0501047_0427836_144_728 194
797 3300049589 Ga0501073_0311097 Ga0501073_0311097_177_785 194
798 3300049823 Ga0501044_0000608 Ga0501044_0000608_6532_7116 194
799 3300049823 Ga0501044_0162231 Ga0501044_0162231_839_1438 194
800 3300050489 nmdc:mga03683_24689_c1 nmdc:mga03683_24689_c1_339_923 194
801 3300050489 nmdc:mga03683_442_c1 nmdc:mga03683_442_c1_7073_7657 194
802 3300050491 nmdc:mga00v17_1436_c2 nmdc:mga00v17_1436_c2_6249_6833 194
803 3300050491 nmdc:mga00v17_4316_c1 nmdc:mga00v17_4316_c1_4337_4921 194
804 3300050492 nmdc:mga0yw44_69494_c1 nmdc:mga0yw44_69494_c1_1357_1941 194
805 3300050493 nmdc:mga0k408_101603_c1 nmdc:mga0k408_101603_c1_663_1247 194
806 3300050494 nmdc:mga06z11_147_c1 nmdc:mga06z11_147_c1_3454_4038 194
807 3300050494 nmdc:mga06z11_83504_c1 nmdc:mga06z11_83504_c1_574_1173 194
808 3300050495 nmdc:mga04h51_24_c1 nmdc:mga04h51_24_c1_42021_42605 194
809 3300050496 nmdc:mga07m45_118996_c1 nmdc:mga07m45_118996_c1_670_1254 194
810 3300050496 nmdc:mga07m45_119180_c1 nmdc:mga07m45_119180_c1_727_1311 194
811 3300050496 nmdc:mga07m45_31_c1 nmdc:mga07m45_31_c1_27165_27764 194
812 3300050496 nmdc:mga07m45_4597_c1 nmdc:mga07m45_4597_c1_5609_6193 194
813 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_233130_233714 194
814 3300050516 nmdc:mga0sz30_160076_c1 nmdc:mga0sz30_160076_c1_354_941 194
815 3300050516 nmdc:mga0sz30_6072_c1 nmdc:mga0sz30_6072_c1_2677_3261 194
816 3300053077 Ga0495601_0150345 Ga0495601_0150345_564_1178 194
817 3300053093 Ga0500651_0110789 Ga0500651_0110789_769_1365 194
818 3300053096 Ga0500641_0033015 Ga0500641_0033015_1432_2016 194
819 3300053104 Ga0500556_0184704 Ga0500556_0184704_132_716 194
820 3300053116 Ga0500592_013598 Ga0500592_013598_598_1182 194
821 3300053119 Ga0500595_001141 Ga0500595_001141_10077_10661 194
822 3300053119 Ga0500595_003373 Ga0500595_003373_4326_4910 194
823 3300053119 Ga0500595_037448 Ga0500595_037448_559_1143 194
824 3300053121 Ga0500607_001017 Ga0500607_001017_13014_13598 194
825 3300053121 Ga0500607_176261 Ga0500607_176261_148_732 194
826 3300053130 Ga0500642_0001053 Ga0500642_0001053_3891_4475 194
827 3300053136 Ga0500559_0004769 Ga0500559_0004769_1166_1753 194
828 3300053139 Ga0500568_0008653 Ga0500568_0008653_1086_1688 194
829 3300053139 Ga0500568_0092471 Ga0500568_0092471_150_734 194
830 3300053140 Ga0500573_0000016 Ga0500573_0000016_23319_23903 194
831 3300053142 Ga0500577_0105030 Ga0500577_0105030_330_917 194
832 3300053148 Ga0500590_015737 Ga0500590_015737_1519_2121 194
833 3300053151 Ga0500604_0000078 Ga0500604_0000078_3320_3922 194
834 3300053151 Ga0500604_0038496 Ga0500604_0038496_257_844 194
835 3300053153 Ga0500616_0003477 Ga0500616_0003477_1116_1715 194
836 3300053153 Ga0500616_0093290 Ga0500616_0093290_404_991 194
837 3300053154 Ga0500619_028904 Ga0500619_028904_626_1210 194
838 3300053156 Ga0500622_0001060 Ga0500622_0001060_8216_8800 194
839 3300053178 Ga0500637_0015050 Ga0500637_0015050_2501_3085 194
840 3300053730 Ga0500645_001601 Ga0500645_001601_4526_5110 194
841 3300053730 Ga0500645_016146 Ga0500645_016146_438_1022 194
842 3300053730 Ga0500645_069322 Ga0500645_069322_123_707 194
843 3300053735 Ga0500596_001728 Ga0500596_001728_877_1461 194
844 3300055283 Ga0500661_020399 Ga0500661_020399_219_803 194
845 3300061719 Ga0466962_0245570 Ga0466962_0245570_125_712 194
846 iso_pu_bacteria 2739367664 2739650046 194
847 iso_pu_bacteria 2739367865 2740028519 194
848 iso_pu_bacteria 2751185897 2753765209 194
849 iso_pu_bacteria 2818991438 2819550548 194
850 iso_pu_bacteria 2928027323 2928028921 194
851 iso_pu_bacteria 2984555340 2984557848 194
852 iso_pu_bacteria 2984564862 2984567787 194
853 iso_pu_bacteria 2993356040 2993358838 194
854 3300021388 Ga0213875_10000202 Ga0213875_1000020225 195
855 3300026088 Ga0207641_11199269 Ga0207641_111992692 195
856 3300037853 Ga0436364_0380874 Ga0436364_0380874_33537_34235 195
857 3300039437 Ga0436365_1401057 Ga0436365_1401057_404_1009 195
858 3300048903 Ga0496100_0318505 Ga0496100_0318505_325_942 195
859 3300050493 nmdc:mga0k408_186578_c1 nmdc:mga0k408_186578_c1_403_990 195
860 3300050496 nmdc:mga07m45_266835_c1 nmdc:mga07m45_266835_c1_170_757 195
861 3300053094 Ga0500566_0075934 Ga0500566_0075934_450_1037 195
862 3300053121 Ga0500607_000042 Ga0500607_000042_11960_12547 195
863 3300053136 Ga0500559_0000337 Ga0500559_0000337_11973_12560 195
864 3300053730 Ga0500645_006083 Ga0500645_006083_2697_3284 195
865 3300005356 Ga0070674_100442670 Ga0070674_1004426701 196
866 3300005456 Ga0070678_100950524 Ga0070678_1009505242 196
867 3300005548 Ga0070665_100379894 Ga0070665_1003798942 196
868 3300005616 Ga0068852_100170285 Ga0068852_1001702852 196
869 3300005618 Ga0068864_100000603 Ga0068864_10000060318 196
870 3300005834 Ga0068851_10005438 Ga0068851_100054381 196
871 3300009177 Ga0105248_10060140 Ga0105248_100601404 196
872 3300014968 Ga0157379_10053843 Ga0157379_100538435 196
873 3300025937 Ga0207669_10464025 Ga0207669_104640251 196
874 3300025941 Ga0207711_10038590 Ga0207711_100385904 196
875 3300026095 Ga0207676_10000552 Ga0207676_1000055215 196
876 3300026142 Ga0207698_10308051 Ga0207698_103080511 196
877 3300031456 Ga0307513_10153196 Ga0307513_101531962 196
878 3300031548 Ga0307408_100020835 Ga0307408_1000208352 196
879 3300031911 Ga0307412_10000217 Ga0307412_1000021711 196
880 3300032002 Ga0307416_100025502 Ga0307416_1000255023 196
881 3300032004 Ga0307414_10000102 Ga0307414_1000010236 196
882 3300033180 Ga0307510_10032849 Ga0307510_100328494 196
883 3300037068 Ga0373925_0378810 Ga0373925_0378810_45_662 196
884 3300046506 Ga0495583_0010754 Ga0495583_0010754_4022_4621 196
885 3300046616 Ga0495668_0021107 Ga0495668_0021107_2264_2863 196
886 3300046660 Ga0495625_0049825 Ga0495625_0049825_31_630 196
887 3300047445 Ga0495677_0001294 Ga0495677_0001294_4334_4933 196
888 3300049571 Ga0501034_0189465 Ga0501034_0189465_432_1022 196
889 3300049663 Ga0501223_000997 Ga0501223_000997_4264_4854 196
890 3300049664 Ga0501224_000012 Ga0501224_000012_87720_88310 196
891 3300049668 Ga0501233_001789 Ga0501233_001789_1743_2333 196
892 3300049669 Ga0501235_002099 Ga0501235_002099_1890_2480 196
893 3300049705 Ga0501225_0000035 Ga0501225_0000035_34444_35034 196
894 3300049707 Ga0501234_003699 Ga0501234_003699_593_1183 196
895 3300049853 Ga0501226_000091 Ga0501226_000091_4234_4824 196
896 3300053087 Ga0500643_000241 Ga0500643_000241_19515_20108 196
897 3300053087 Ga0500643_004098 Ga0500643_004098_3175_3774 196
898 3300053136 Ga0500559_0105695 Ga0500559_0105695_161_760 196
899 3300005336 Ga0070680_100306015 Ga0070680_1003060152 197
900 3300005445 Ga0070708_100042003 Ga0070708_1000420032 197
901 3300005467 Ga0070706_100081837 Ga0070706_1000818372 197
902 3300005468 Ga0070707_100677801 Ga0070707_1006778011 197
903 3300005536 Ga0070697_100091561 Ga0070697_1000915612 197
904 3300025922 Ga0207646_10253688 Ga0207646_102536882 197
905 3300028558 Ga0265326_10042869 Ga0265326_100428692 197
906 3300048924 Ga0496121_0000022 Ga0496121_0000022_449002_449610 197
907 3300053125 Ga0500618_001039 Ga0500618_001039_3660_4268 197
908 2162886007 SwRhRL2b_contig_2906353 SwRhRL2b_0406.00008000 198
909 3300005289 Ga0065704_10070237 Ga0065704_1007023737 198
910 3300005289 Ga0065704_10108965 Ga0065704_101089653 198
911 3300005327 Ga0070658_10000125 Ga0070658_1000012534 198
912 3300005331 Ga0070670_100073410 Ga0070670_1000734103 198
913 3300005331 Ga0070670_100203842 Ga0070670_1002038422 198
914 3300005335 Ga0070666_10050500 Ga0070666_100505003 198
915 3300005340 Ga0070689_100255195 Ga0070689_1002551952 198
916 3300005347 Ga0070668_100075216 Ga0070668_1000752163 198
917 3300005347 Ga0070668_100083839 Ga0070668_1000838391 198
918 3300005353 Ga0070669_100000297 Ga0070669_1000002979 198
919 3300005353 Ga0070669_100000990 Ga0070669_1000009903 198
920 3300005355 Ga0070671_100000090 Ga0070671_10000009010 198
921 3300005355 Ga0070671_100004583 Ga0070671_1000045835 198
922 3300005355 Ga0070671_100071516 Ga0070671_1000715163 198
923 3300005367 Ga0070667_100005081 Ga0070667_1000050812 198
924 3300005367 Ga0070667_100010899 Ga0070667_1000108997 198
925 3300005548 Ga0070665_100001407 Ga0070665_10000140721 198
926 3300005548 Ga0070665_100045285 Ga0070665_1000452855 198
927 3300005548 Ga0070665_100311281 Ga0070665_1003112812 198
928 3300005563 Ga0068855_100004467 Ga0068855_1000044677 198
929 3300005563 Ga0068855_100819012 Ga0068855_1008190122 198
930 3300005578 Ga0068854_100000439 Ga0068854_1000004396 198
931 3300005614 Ga0068856_100439192 Ga0068856_1004391922 198
932 3300005616 Ga0068852_100000387 Ga0068852_1000003875 198
933 3300005617 Ga0068859_100252954 Ga0068859_1002529542 198
934 3300005618 Ga0068864_100420858 Ga0068864_1004208581 198
935 3300005719 Ga0068861_100000387 Ga0068861_1000003876 198
936 3300005841 Ga0068863_100016733 Ga0068863_1000167335 198
937 3300005841 Ga0068863_100042676 Ga0068863_1000426762 198
938 3300005842 Ga0068858_100209899 Ga0068858_1002098992 198
939 3300005843 Ga0068860_100017153 Ga0068860_1000171536 198
940 3300005843 Ga0068860_100664292 Ga0068860_1006642922 198
941 3300005844 Ga0068862_100002787 Ga0068862_10000278717 198
942 3300005844 Ga0068862_100031480 Ga0068862_1000314806 198
943 3300006931 Ga0097620_100252952 Ga0097620_1002529522 198
944 3300009011 Ga0105251_10001943 Ga0105251_1000194310 198
945 3300009093 Ga0105240_10149816 Ga0105240_101498163 198
946 3300009093 Ga0105240_10159735 Ga0105240_101597352 198
947 3300009177 Ga0105248_10029379 Ga0105248_100293793 198
948 3300009177 Ga0105248_10382570 Ga0105248_103825702 198
949 3300009551 Ga0105238_10178755 Ga0105238_101787552 198
950 3300013306 Ga0163162_10039028 Ga0163162_100390284 198
951 3300013306 Ga0163162_10063074 Ga0163162_100630742 198
952 3300014968 Ga0157379_10306989 Ga0157379_103069892 198
953 3300025298 Ga0209050_1000217 Ga0209050_100021714 198
954 3300025315 Ga0207697_10012093 Ga0207697_100120933 198
955 3300025735 Ga0207713_1043917 Ga0207713_10439172 198
956 3300025903 Ga0207680_10042407 Ga0207680_100424072 198
957 3300025904 Ga0207647_10046743 Ga0207647_100467432 198
958 3300025909 Ga0207705_10000004 Ga0207705_10000004631 198
959 3300025913 Ga0207695_10143132 Ga0207695_101431323 198
960 3300025913 Ga0207695_10296328 Ga0207695_102963282 198
961 3300025923 Ga0207681_10000242 Ga0207681_100002429 198
962 3300025923 Ga0207681_10001749 Ga0207681_100017493 198
963 3300025925 Ga0207650_10129807 Ga0207650_101298072 198
964 3300025925 Ga0207650_10313344 Ga0207650_103133442 198
965 3300025931 Ga0207644_10000003 Ga0207644_10000003163 198
966 3300025931 Ga0207644_10214149 Ga0207644_102141492 198
967 3300025936 Ga0207670_10141961 Ga0207670_101419612 198
968 3300025941 Ga0207711_10004612 Ga0207711_100046124 198
969 3300025949 Ga0207667_10001784 Ga0207667_1000178419 198
970 3300025949 Ga0207667_10343626 Ga0207667_103436261 198
971 3300025972 Ga0207668_10062723 Ga0207668_100627233 198
972 3300025981 Ga0207640_10000977 Ga0207640_1000097716 198
973 3300025986 Ga0207658_10000291 Ga0207658_100002912 198
974 3300025986 Ga0207658_10336403 Ga0207658_103364032 198
975 3300026035 Ga0207703_10035047 Ga0207703_100350472 198
976 3300026035 Ga0207703_10046555 Ga0207703_100465552 198
977 3300026041 Ga0207639_10773249 Ga0207639_107732492 198
978 3300026088 Ga0207641_10016967 Ga0207641_100169672 198
979 3300026088 Ga0207641_10020235 Ga0207641_100202353 198
980 3300026118 Ga0207675_100000016 Ga0207675_10000001622 198
981 3300026142 Ga0207698_10000193 Ga0207698_100001933 198
982 3300028379 Ga0268266_10001434 Ga0268266_1000143421 198
983 3300028380 Ga0268265_10002929 Ga0268265_1000292915 198
984 3300028380 Ga0268265_10022730 Ga0268265_100227305 198
985 3300028381 Ga0268264_10023373 Ga0268264_100233733 198
986 3300041509 Ga0451843_1372541 Ga0451843_1372541_135_731 198
987 3300046471 Ga0495650_0000842 Ga0495650_0000842_22069_22668 198
988 3300046507 Ga0495606_0030090 Ga0495606_0030090_1683_2279 198
989 3300046512 Ga0495610_0002738 Ga0495610_0002738_4339_4935 198
990 3300046515 Ga0495620_0044437 Ga0495620_0044437_975_1574 198
991 3300046519 Ga0495632_0004649 Ga0495632_0004649_566_1165 198
992 3300046519 Ga0495632_0359930 Ga0495632_0359930_13_609 198
993 3300047470 Ga0495681_0000020 Ga0495681_0000020_112248_112847 198
994 3300048090 Ga0495615_0000148 Ga0495615_0000148_11915_12511 198
995 3300048091 Ga0495626_0002994 Ga0495626_0002994_5871_6467 198
996 3300048904 Ga0496101_0026473 Ga0496101_0026473_2233_2832 198
997 3300048906 Ga0496103_0032935 Ga0496103_0032935_791_1387 198
998 3300048907 Ga0496104_0026054 Ga0496104_0026054_2456_3055 198
999 3300048908 Ga0496105_0424345 Ga0496105_0424345_397_996 198
1000 3300048909 Ga0496106_0002162 Ga0496106_0002162_11067_11666 198
1001 3300048909 Ga0496106_0981146 Ga0496106_0981146_36_650 198
1002 3300048910 Ga0496107_0013198 Ga0496107_0013198_3362_3961 198
1003 3300048913 Ga0496110_0130680 Ga0496110_0130680_263_862 198
1004 3300048914 Ga0496111_0087567 Ga0496111_0087567_1505_2104 198
1005 3300048915 Ga0496112_0450009 Ga0496112_0450009_317_916 198
1006 3300048916 Ga0496113_0002677 Ga0496113_0002677_7435_8034 198
1007 3300048919 Ga0496116_0000039 Ga0496116_0000039_186157_186753 198
1008 3300048919 Ga0496116_0033509 Ga0496116_0033509_886_1482 198
1009 3300048920 Ga0496117_0007762 Ga0496117_0007762_6399_6998 198
1010 3300048920 Ga0496117_0075266 Ga0496117_0075266_1563_2159 198
1011 3300048920 Ga0496117_0079225 Ga0496117_0079225_293_889 198
1012 3300048920 Ga0496117_0088769 Ga0496117_0088769_24_620 198
1013 3300048921 Ga0496118_0212672 Ga0496118_0212672_330_929 198
1014 3300048922 Ga0496119_0166789 Ga0496119_0166789_496_1092 198
1015 3300048923 Ga0496120_0088813 Ga0496120_0088813_891_1490 198
1016 3300048924 Ga0496121_0005224 Ga0496121_0005224_6155_6751 198
1017 3300048924 Ga0496121_0012226 Ga0496121_0012226_8417_9013 198
1018 3300048924 Ga0496121_0026796 Ga0496121_0026796_3834_4433 198
1019 3300048925 Ga0496122_0002484 Ga0496122_0002484_11896_12492 198
1020 3300048925 Ga0496122_0002932 Ga0496122_0002932_21125_21721 198
1021 3300048925 Ga0496122_0026354 Ga0496122_0026354_606_1205 198
1022 3300048926 Ga0496123_0003115 Ga0496123_0003115_6548_7144 198
1023 3300048926 Ga0496123_0009457 Ga0496123_0009457_7651_8247 198
1024 3300048926 Ga0496123_0017586 Ga0496123_0017586_4884_5483 198
1025 3300048927 Ga0496124_0006015 Ga0496124_0006015_6634_7230 198
1026 3300048927 Ga0496124_0174830 Ga0496124_0174830_535_1131 198
1027 3300048927 Ga0496124_0228181 Ga0496124_0228181_535_1131 198
1028 3300048928 Ga0496125_0033699 Ga0496125_0033699_3723_4319 198
1029 3300048928 Ga0496125_0056017 Ga0496125_0056017_2082_2678 198
1030 3300048928 Ga0496125_0395647 Ga0496125_0395647_90_689 198
1031 3300048929 Ga0496126_0000041 Ga0496126_0000041_155147_155743 198
1032 3300048929 Ga0496126_0007482 Ga0496126_0007482_987_1583 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

3

196

0.96

PF07722

Peptidase_C26

Peptidase C26

61

178

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7j-assembly1.cif.gz_A crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 0.9233 1 188
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9224 2 183
8gr1-assembly4.cif.gz_D crystal structure of d110v/k151l mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.9196 1 191
7d97-assembly3.cif.gz_C crystal structure of n109p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.9196 1 188
8gr3-assembly4.cif.gz_D crystal structure of k151l/y158f mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.9191 1 191
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9575 1 184 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9475 2 184 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9376 1 184 3.40.50.880
af_Q57690_3_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9323 2 184 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9284 2 195 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2W6RZU6-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II (EC 2.6.1.85) 1.006 1 88 GO:0000162
GO:0004049
GO:0005829
GO:0046820
AF-A0A3B9AZP0-F1-model_v4 deleted 0.9894 2 154
AF-A0A7V9DP49-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9877 2 91 GO:0000162
GO:0004049
GO:0005829
AF-A0A520XY99-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II (EC 2.6.1.85) 0.9875 1 166 GO:0000162
GO:0004049
GO:0005829
GO:0046820
AF-A0A533RQB3-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9841 1 165 GO:0000162
GO:0004049
GO:0005829

Feature Viewer

pLDDT pTM Quality
93.2 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map