F488626
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1032 | 480 | 1004 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100306015|Ga0070680_1003060152 |
| Length | 238 |
| Sequence | VILVVDNYDSFTFNLVQALEAAGADIRVVRNDALDRAGVEALVGDPGAGLRGIVISPGPGEPSAAGVSVDAVRVAAEQAIPLLGVCLGMQSLAVAFGGAVVRAPTLVHGEASEVTHDGDGLLAGLPASFPAARYHSLCVDPASLPGELRVTAMSEVDRVVMGIRHVALPLEGVQFHPESVLTPSGPRLLANFLRLAGEGHAATLDDAAGSFAVRGIADEPADAAPATHEAVASAGGVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 3 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 4 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 5 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 6 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 7 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 8 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 9 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 10 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 11 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 12 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 13 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 14 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 15 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 16 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 17 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 18 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 19 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 20 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 21 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 22 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 23 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 24 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 25 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 26 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 27 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 28 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 29 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 30 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 31 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 34 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 35 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 36 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 37 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 38 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 39 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 40 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 41 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 43 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 44 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 49 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 50 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 53 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 61 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 65 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 97 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 99 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 102 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 103 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 104 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 113 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 117 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 120 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 146 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 147 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 163 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 244 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 249 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 250 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 252 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 253 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 258 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 259 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 260 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 261 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 263 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 264 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 265 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 267 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 268 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 269 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 270 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 271 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 272 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 273 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 286 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 287 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 288 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 289 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 290 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 291 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 292 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 293 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 294 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 295 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 301 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 302 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 303 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 304 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 380 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 381 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 382 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 383 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 384 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 385 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 388 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 389 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 390 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 391 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 395 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 398 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 399 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 400 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 401 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 402 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 424 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 425 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 426 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 427 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 428 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 429 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 437 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 438 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 439 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 441 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 442 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 443 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 444 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 448 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 453 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 454 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 456 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 457 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 458 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 459 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 460 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 461 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 462 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 463 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 464 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 465 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 466 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 467 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 468 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 469 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 470 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 471 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 472 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 473 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 474 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 476 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 478 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 480 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.29 |
| Metatranscriptomes | 0 |
| Isolates | 2.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 11.63 |
| Nodule | 0.1 |
| Rhizoplane | 3.39 |
| Rhizosphere | 78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2906353 | 2162886007 | Bacteria | 28937 |
| 2 | JGI24741J21665_1009947 | 3300001915 | Bacteria | 1723 |
| 3 | JGI24746J21847_1001496 | 3300001977 | Bacteria | 3718 |
| 4 | JGI24740J21852_10112164 | 3300001979 | Bacteria | 687 |
| 5 | JGI24739J22299_10005219 | 3300001989 | Bacteria | 4950 |
| 6 | JGI24739J22299_10025799 | 3300001989 | Bacteria | 2066 |
| 7 | JGI24739J22299_10061099 | 3300001989 | Bacteria | 1191 |
| 8 | JGI24737J22298_10003186 | 3300001990 | Bacteria | 5820 |
| 9 | JGI24737J22298_10005631 | 3300001990 | Bacteria | 4316 |
| 10 | JGI24737J22298_10011515 | 3300001990 | Bacteria | 2899 |
| 11 | JGI24737J22298_10016864 | 3300001990 | Bacteria | 2357 |
| 12 | JGI24737J22298_10032429 | 3300001990 | Bacteria | 1626 |
| 13 | JGI24737J22298_10050299 | 3300001990 | Bacteria | 1267 |
| 14 | JGI24737J22298_10131621 | 3300001990 | Bacteria | 739 |
| 15 | JGI24743J22301_10021842 | 3300001991 | Bacteria | 1224 |
| 16 | JGI24735J21928_10001921 | 3300002067 | Bacteria | 7292 |
| 17 | JGI24735J21928_10026342 | 3300002067 | Bacteria | 1748 |
| 18 | JGI24735J21928_10030054 | 3300002067 | Bacteria | 1615 |
| 19 | JGI24735J21928_10030869 | 3300002067 | Bacteria | 1590 |
| 20 | JGI24735J21928_10058391 | 3300002067 | Bacteria | 1110 |
| 21 | JGI24735J21928_10060479 | 3300002067 | Bacteria | 1089 |
| 22 | JGI24738J21930_10000848 | 3300002075 | Bacteria | 8755 |
| 23 | JGI24738J21930_10004277 | 3300002075 | Bacteria | 3512 |
| 24 | JGI24738J21930_10020148 | 3300002075 | Bacteria | 1387 |
| 25 | JGI24744J21845_10000444 | 3300002077 | Bacteria | 7281 |
| 26 | JGI24034J26672_10000172 | 3300002239 | Bacteria | 8945 |
| 27 | JGI24034J26672_10039456 | 3300002239 | Bacteria | 789 |
| 28 | JGI24742J22300_10023398 | 3300002244 | Bacteria | 1061 |
| 29 | JGI25164J39214_1010460 | 3300002772 | Bacteria | 898 |
| 30 | JGI25406J46586_10091182 | 3300003203 | Bacteria | 919 |
| 31 | JGI25165J46597_1000040 | 3300003214 | Bacteria | 277491 |
| 32 | JGI25165J46597_1000089 | 3300003214 | Bacteria | 169547 |
| 33 | JGI25153J46596_10000002 | 3300003215 | Bacteria | 653569 |
| 34 | JGI25407J50210_10000517 | 3300003373 | Bacteria | 7761 |
| 35 | Ga0055525_1000051 | 3300003759 | Bacteria | 240942 |
| 36 | Ga0055542_1000020 | 3300003762 | Bacteria | 335745 |
| 37 | Ga0055542_1002673 | 3300003762 | Bacteria | 5522 |
| 38 | Ga0055529_1000016 | 3300003763 | Bacteria | 364775 |
| 39 | Ga0055536_1001024 | 3300003781 | Bacteria | 17654 |
| 40 | Ga0055536_1003233 | 3300003781 | Bacteria | 8830 |
| 41 | Ga0055536_1010161 | 3300003781 | Bacteria | 3776 |
| 42 | Ga0055534_1020141 | 3300003784 | Bacteria | 1133 |
| 43 | Ga0055530_10000013 | 3300003791 | Bacteria | 153390 |
| 44 | Ga0055530_10000901 | 3300003791 | Bacteria | 24454 |
| 45 | Ga0055531_10000583 | 3300003794 | Bacteria | 31858 |
| 46 | Ga0055531_10000627 | 3300003794 | Bacteria | 30500 |
| 47 | Ga0055531_10001679 | 3300003794 | Bacteria | 15929 |
| 48 | Ga0065165_1002265 | 3300005262 | Bacteria | 16983 |
| 49 | Ga0065714_10162484 | 3300005288 | Bacteria | 1044 |
| 50 | Ga0065704_10070237 | 3300005289 | Bacteria | 52535 |
| 51 | Ga0065704_10108965 | 3300005289 | Bacteria | 2010 |
| 52 | Ga0065704_10128058 | 3300005289 | Bacteria | 1667 |
| 53 | Ga0065707_10084488 | 3300005295 | Bacteria | 7152 |
| 54 | Ga0070658_10000022 | 3300005327 | Bacteria | 186706 |
| 55 | Ga0070658_10000125 | 3300005327 | Bacteria | 68211 |
| 56 | Ga0070658_10001598 | 3300005327 | Bacteria | 19148 |
| 57 | Ga0070658_10006112 | 3300005327 | Bacteria | 9765 |
| 58 | Ga0070658_10078427 | 3300005327 | Bacteria | 2711 |
| 59 | Ga0070658_10252945 | 3300005327 | Bacteria | 1495 |
| 60 | Ga0070658_10572825 | 3300005327 | Bacteria | 978 |
| 61 | Ga0070676_10000855 | 3300005328 | Bacteria | 15051 |
| 62 | Ga0070683_100810431 | 3300005329 | Bacteria | 898 |
| 63 | Ga0070683_101074809 | 3300005329 | Bacteria | 773 |
| 64 | Ga0070670_100073410 | 3300005331 | Bacteria | 2938 |
| 65 | Ga0070670_100203842 | 3300005331 | Bacteria | 1719 |
| 66 | Ga0068869_100000031 | 3300005334 | Bacteria | 60884 |
| 67 | Ga0068869_100207623 | 3300005334 | Bacteria | 1547 |
| 68 | Ga0068869_100243015 | 3300005334 | Bacteria | 1435 |
| 69 | Ga0070666_10050500 | 3300005335 | Bacteria | 2797 |
| 70 | Ga0070680_100004842 | 3300005336 | Bacteria | 10137 |
| 71 | Ga0070680_100306015 | 3300005336 | Bacteria | 1348 |
| 72 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 73 | Ga0068868_100000060 | 3300005338 | Bacteria | 61952 |
| 74 | Ga0070660_100000568 | 3300005339 | Bacteria | 24762 |
| 75 | Ga0070660_100000801 | 3300005339 | Bacteria | 20852 |
| 76 | Ga0070660_100005160 | 3300005339 | Bacteria | 9032 |
| 77 | Ga0070660_100297948 | 3300005339 | Bacteria | 1322 |
| 78 | Ga0070689_100255195 | 3300005340 | Bacteria | 1448 |
| 79 | Ga0070661_100010440 | 3300005344 | Bacteria | 6459 |
| 80 | Ga0070661_100239357 | 3300005344 | Bacteria | 1397 |
| 81 | Ga0070661_100398497 | 3300005344 | Bacteria | 1088 |
| 82 | Ga0070668_100031585 | 3300005347 | Bacteria | 4029 |
| 83 | Ga0070668_100075216 | 3300005347 | Bacteria | 2636 |
| 84 | Ga0070668_100083839 | 3300005347 | Bacteria | 2503 |
| 85 | Ga0070669_100000297 | 3300005353 | Bacteria | 38972 |
| 86 | Ga0070669_100000990 | 3300005353 | Bacteria | 20731 |
| 87 | Ga0070669_100270249 | 3300005353 | Bacteria | 1359 |
| 88 | Ga0070675_100006017 | 3300005354 | Bacteria | 9298 |
| 89 | Ga0070675_100181892 | 3300005354 | Bacteria | 1818 |
| 90 | Ga0070671_100000090 | 3300005355 | Bacteria | 58174 |
| 91 | Ga0070671_100004583 | 3300005355 | Bacteria | 10951 |
| 92 | Ga0070671_100071516 | 3300005355 | Bacteria | 2895 |
| 93 | Ga0070671_100090815 | 3300005355 | Bacteria | 2557 |
| 94 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 95 | Ga0070674_100000009 | 3300005356 | Bacteria | 143336 |
| 96 | Ga0070674_100000740 | 3300005356 | Bacteria | 16717 |
| 97 | Ga0070674_100088635 | 3300005356 | Bacteria | 2227 |
| 98 | Ga0070674_100166219 | 3300005356 | Bacteria | 1678 |
| 99 | Ga0070674_100442670 | 3300005356 | Bacteria | 1071 |
| 100 | Ga0070674_100861137 | 3300005356 | Bacteria | 787 |
| 101 | Ga0070673_100000009 | 3300005364 | Bacteria | 155005 |
| 102 | Ga0070673_100017694 | 3300005364 | Bacteria | 5076 |
| 103 | Ga0070673_100515654 | 3300005364 | Bacteria | 1083 |
| 104 | Ga0070673_100693518 | 3300005364 | Bacteria | 935 |
| 105 | Ga0070688_100000277 | 3300005365 | Bacteria | 26584 |
| 106 | Ga0070688_100087858 | 3300005365 | Bacteria | 2026 |
| 107 | Ga0070659_100004173 | 3300005366 | Bacteria | 10300 |
| 108 | Ga0070659_100064395 | 3300005366 | Bacteria | 2902 |
| 109 | Ga0070659_100217275 | 3300005366 | Bacteria | 1577 |
| 110 | Ga0070659_100549290 | 3300005366 | Bacteria | 989 |
| 111 | Ga0070667_100005081 | 3300005367 | Bacteria | 11014 |
| 112 | Ga0070667_100010899 | 3300005367 | Bacteria | 7519 |
| 113 | Ga0070667_100032672 | 3300005367 | Bacteria | 4341 |
| 114 | Ga0070714_100125748 | 3300005435 | Bacteria | 2286 |
| 115 | Ga0070714_100149575 | 3300005435 | Bacteria | 2103 |
| 116 | Ga0070713_100000058 | 3300005436 | Bacteria | 70009 |
| 117 | Ga0070711_100001969 | 3300005439 | Bacteria | 11529 |
| 118 | Ga0070711_100085494 | 3300005439 | Bacteria | 2260 |
| 119 | Ga0070708_100001562 | 3300005445 | Bacteria | 17554 |
| 120 | Ga0070708_100042003 | 3300005445 | Bacteria | 4011 |
| 121 | Ga0070663_100025418 | 3300005455 | Bacteria | 3998 |
| 122 | Ga0070678_100000011 | 3300005456 | Bacteria | 57959 |
| 123 | Ga0070678_100001799 | 3300005456 | Bacteria | 11550 |
| 124 | Ga0070678_100950524 | 3300005456 | Bacteria | 788 |
| 125 | Ga0070662_100000708 | 3300005457 | Bacteria | 20462 |
| 126 | Ga0070662_100045764 | 3300005457 | Bacteria | 3141 |
| 127 | Ga0070662_100107871 | 3300005457 | Bacteria | 2117 |
| 128 | Ga0070681_10073045 | 3300005458 | Bacteria | 3392 |
| 129 | Ga0068867_100000165 | 3300005459 | Bacteria | 42939 |
| 130 | Ga0068867_100268392 | 3300005459 | Bacteria | 1394 |
| 131 | Ga0068867_100812205 | 3300005459 | Bacteria | 835 |
| 132 | Ga0070685_10000013 | 3300005466 | Bacteria | 120875 |
| 133 | Ga0070706_100081837 | 3300005467 | Bacteria | 2990 |
| 134 | Ga0070707_100677801 | 3300005468 | Bacteria | 994 |
| 135 | Ga0070698_100014541 | 3300005471 | Bacteria | 8308 |
| 136 | Ga0070698_100561687 | 3300005471 | Bacteria | 1081 |
| 137 | Ga0070679_100140718 | 3300005530 | Bacteria | 2393 |
| 138 | Ga0070697_100091561 | 3300005536 | Bacteria | 2515 |
| 139 | Ga0068853_100000428 | 3300005539 | Bacteria | 28681 |
| 140 | Ga0068853_100013891 | 3300005539 | Bacteria | 6584 |
| 141 | Ga0068853_100060896 | 3300005539 | Bacteria | 3263 |
| 142 | Ga0068853_100377295 | 3300005539 | Bacteria | 1324 |
| 143 | Ga0068853_100404301 | 3300005539 | Bacteria | 1278 |
| 144 | Ga0070686_100385169 | 3300005544 | Unclassified | 1062 |
| 145 | Ga0070693_100041268 | 3300005547 | Bacteria | 2595 |
| 146 | Ga0070665_100001407 | 3300005548 | Bacteria | 28292 |
| 147 | Ga0070665_100013086 | 3300005548 | Bacteria | 8354 |
| 148 | Ga0070665_100045285 | 3300005548 | Bacteria | 4419 |
| 149 | Ga0070665_100123072 | 3300005548 | Bacteria | 2596 |
| 150 | Ga0070665_100311281 | 3300005548 | Bacteria | 1578 |
| 151 | Ga0070665_100379894 | 3300005548 | Bacteria | 1420 |
| 152 | Ga0068855_100000371 | 3300005563 | Bacteria | 55533 |
| 153 | Ga0068855_100004395 | 3300005563 | Bacteria | 17228 |
| 154 | Ga0068855_100004467 | 3300005563 | Bacteria | 17096 |
| 155 | Ga0068855_100076067 | 3300005563 | Bacteria | 3897 |
| 156 | Ga0068855_100078599 | 3300005563 | Bacteria | 3827 |
| 157 | Ga0068855_100163605 | 3300005563 | Bacteria | 2524 |
| 158 | Ga0068855_100286895 | 3300005563 | Bacteria | 1826 |
| 159 | Ga0068855_100499577 | 3300005563 | Bacteria | 1322 |
| 160 | Ga0068855_100501590 | 3300005563 | Bacteria | 1319 |
| 161 | Ga0068855_100819012 | 3300005563 | Bacteria | 988 |
| 162 | Ga0070664_100018632 | 3300005564 | Bacteria | 5706 |
| 163 | Ga0070664_100553453 | 3300005564 | Bacteria | 1064 |
| 164 | Ga0068857_100006008 | 3300005577 | Bacteria | 10368 |
| 165 | Ga0068857_100128132 | 3300005577 | Bacteria | 2287 |
| 166 | Ga0068854_100000333 | 3300005578 | Bacteria | 30901 |
| 167 | Ga0068854_100000439 | 3300005578 | Bacteria | 25752 |
| 168 | Ga0068854_100001819 | 3300005578 | Bacteria | 12981 |
| 169 | Ga0068854_100026592 | 3300005578 | Bacteria | 3979 |
| 170 | Ga0068856_100000237 | 3300005614 | Bacteria | 59854 |
| 171 | Ga0068856_100016235 | 3300005614 | Bacteria | 7204 |
| 172 | Ga0068856_100026512 | 3300005614 | Bacteria | 5650 |
| 173 | Ga0068856_100065400 | 3300005614 | Bacteria | 3594 |
| 174 | Ga0068856_100439192 | 3300005614 | Bacteria | 1325 |
| 175 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 176 | Ga0068852_100000387 | 3300005616 | Bacteria | 29490 |
| 177 | Ga0068852_100001240 | 3300005616 | Bacteria | 17006 |
| 178 | Ga0068852_100170285 | 3300005616 | Bacteria | 2041 |
| 179 | Ga0068859_100252954 | 3300005617 | Bacteria | 1852 |
| 180 | Ga0068859_100971900 | 3300005617 | Bacteria | 932 |
| 181 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 182 | Ga0068864_100000603 | 3300005618 | Bacteria | 30476 |
| 183 | Ga0068864_100006060 | 3300005618 | Bacteria | 9921 |
| 184 | Ga0068864_100420858 | 3300005618 | Bacteria | 1273 |
| 185 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 186 | Ga0068866_10003702 | 3300005718 | Bacteria | 6265 |
| 187 | Ga0068861_100000387 | 3300005719 | Bacteria | 25418 |
| 188 | Ga0068851_10000126 | 3300005834 | Bacteria | 41437 |
| 189 | Ga0068851_10005438 | 3300005834 | Bacteria | 5779 |
| 190 | Ga0068851_10012377 | 3300005834 | Bacteria | 4020 |
| 191 | Ga0068851_10308140 | 3300005834 | Bacteria | 912 |
| 192 | Ga0068863_100000779 | 3300005841 | Bacteria | 32033 |
| 193 | Ga0068863_100001344 | 3300005841 | Bacteria | 24467 |
| 194 | Ga0068863_100016733 | 3300005841 | Bacteria | 7036 |
| 195 | Ga0068863_100042676 | 3300005841 | Bacteria | 4310 |
| 196 | Ga0068858_100000069 | 3300005842 | Bacteria | 105617 |
| 197 | Ga0068858_100001528 | 3300005842 | Bacteria | 23768 |
| 198 | Ga0068858_100009846 | 3300005842 | Bacteria | 9089 |
| 199 | Ga0068858_100023504 | 3300005842 | Bacteria | 5741 |
| 200 | Ga0068858_100209899 | 3300005842 | Bacteria | 1843 |
| 201 | Ga0068860_100000008 | 3300005843 | Bacteria | 427367 |
| 202 | Ga0068860_100001200 | 3300005843 | Bacteria | 28270 |
| 203 | Ga0068860_100001714 | 3300005843 | Bacteria | 23425 |
| 204 | Ga0068860_100007666 | 3300005843 | Bacteria | 10787 |
| 205 | Ga0068860_100017153 | 3300005843 | Bacteria | 7059 |
| 206 | Ga0068860_100108660 | 3300005843 | Bacteria | 2651 |
| 207 | Ga0068860_100579238 | 3300005843 | Unclassified | 1126 |
| 208 | Ga0068860_100664292 | 3300005843 | Bacteria | 1050 |
| 209 | Ga0068862_100000067 | 3300005844 | Bacteria | 123668 |
| 210 | Ga0068862_100002787 | 3300005844 | Bacteria | 15321 |
| 211 | Ga0068862_100031480 | 3300005844 | Bacteria | 4479 |
| 212 | Ga0081538_10000010 | 3300005981 | Bacteria | 164857 |
| 213 | Ga0081538_10000346 | 3300005981 | Bacteria | 52797 |
| 214 | Ga0081540_1080044 | 3300005983 | Bacteria | 1474 |
| 215 | Ga0081539_10075667 | 3300005985 | Bacteria | 1787 |
| 216 | Ga0075365_10062021 | 3300006038 | Bacteria | 2499 |
| 217 | Ga0075365_10299861 | 3300006038 | Bacteria | 1131 |
| 218 | Ga0075363_100016646 | 3300006048 | Bacteria | 3635 |
| 219 | Ga0075364_10001034 | 3300006051 | Bacteria | 14802 |
| 220 | Ga0075364_10004936 | 3300006051 | Bacteria | 7727 |
| 221 | Ga0075432_10000049 | 3300006058 | Bacteria | 23148 |
| 222 | Ga0075362_10027008 | 3300006177 | Bacteria | 2456 |
| 223 | Ga0075362_10064391 | 3300006177 | Bacteria | 1663 |
| 224 | Ga0075367_10027653 | 3300006178 | Bacteria | 3229 |
| 225 | Ga0075367_10106389 | 3300006178 | Bacteria | 1719 |
| 226 | Ga0075369_10041906 | 3300006186 | Bacteria | 1961 |
| 227 | Ga0097621_100014855 | 3300006237 | Bacteria | 5841 |
| 228 | Ga0097621_100414609 | 3300006237 | Bacteria | 1208 |
| 229 | Ga0075370_10000025 | 3300006353 | Bacteria | 52081 |
| 230 | Ga0075370_10005297 | 3300006353 | Bacteria | 6390 |
| 231 | Ga0075370_10087395 | 3300006353 | Bacteria | 1796 |
| 232 | Ga0075370_10132958 | 3300006353 | Bacteria | 1452 |
| 233 | Ga0075370_10153160 | 3300006353 | Bacteria | 1351 |
| 234 | Ga0068871_100016115 | 3300006358 | Bacteria | 5616 |
| 235 | Ga0068871_100169241 | 3300006358 | Bacteria | 1872 |
| 236 | Ga0075431_100316702 | 3300006847 | Bacteria | 1574 |
| 237 | Ga0075433_10001805 | 3300006852 | Bacteria | 16060 |
| 238 | Ga0075434_100503424 | 3300006871 | Bacteria | 1232 |
| 239 | Ga0068865_100000014 | 3300006881 | Bacteria | 138727 |
| 240 | Ga0068865_100000042 | 3300006881 | Bacteria | 71057 |
| 241 | Ga0075436_100126079 | 3300006914 | Bacteria | 1794 |
| 242 | Ga0075436_100134099 | 3300006914 | Bacteria | 1738 |
| 243 | Ga0097620_100035787 | 3300006931 | Bacteria | 4983 |
| 244 | Ga0097620_100252952 | 3300006931 | Bacteria | 1852 |
| 245 | Ga0097620_100971533 | 3300006931 | Bacteria | 932 |
| 246 | Ga0079104_1012581 | 3300006946 | Bacteria | 2650 |
| 247 | Ga0105251_10001943 | 3300009011 | Bacteria | 16907 |
| 248 | Ga0105240_10088485 | 3300009093 | Bacteria | 3789 |
| 249 | Ga0105240_10149816 | 3300009093 | Bacteria | 2780 |
| 250 | Ga0105240_10159735 | 3300009093 | Bacteria | 2678 |
| 251 | Ga0105240_10407978 | 3300009093 | Bacteria | 1529 |
| 252 | Ga0105240_10464232 | 3300009093 | Bacteria | 1414 |
| 253 | Ga0105245_10000104 | 3300009098 | Bacteria | 80951 |
| 254 | Ga0105245_10000160 | 3300009098 | Bacteria | 63445 |
| 255 | Ga0105245_10034240 | 3300009098 | Bacteria | 4504 |
| 256 | Ga0105247_10029554 | 3300009101 | Bacteria | 3321 |
| 257 | Ga0114129_10360147 | 3300009147 | Bacteria | 1925 |
| 258 | Ga0105243_10000070 | 3300009148 | Bacteria | 120851 |
| 259 | Ga0105243_10000760 | 3300009148 | Bacteria | 30911 |
| 260 | Ga0105243_10140427 | 3300009148 | Bacteria | 2060 |
| 261 | Ga0105243_10200088 | 3300009148 | Bacteria | 1751 |
| 262 | Ga0105243_10460174 | 3300009148 | Bacteria | 1196 |
| 263 | Ga0105241_10276947 | 3300009174 | Bacteria | 1431 |
| 264 | Ga0105242_10000062 | 3300009176 | Bacteria | 74936 |
| 265 | Ga0105242_10000722 | 3300009176 | Bacteria | 25846 |
| 266 | Ga0105242_10092631 | 3300009176 | Bacteria | 2546 |
| 267 | Ga0105248_10000175 | 3300009177 | Bacteria | 74795 |
| 268 | Ga0105248_10029379 | 3300009177 | Bacteria | 6132 |
| 269 | Ga0105248_10060140 | 3300009177 | Bacteria | 4265 |
| 270 | Ga0105248_10382570 | 3300009177 | Bacteria | 1585 |
| 271 | Ga0105237_10007067 | 3300009545 | Bacteria | 12344 |
| 272 | Ga0105238_10086778 | 3300009551 | Bacteria | 3117 |
| 273 | Ga0105238_10178755 | 3300009551 | Bacteria | 2099 |
| 274 | Ga0105249_10000056 | 3300009553 | Bacteria | 160443 |
| 275 | Ga0105249_10048124 | 3300009553 | Bacteria | 3888 |
| 276 | Ga0105239_10176381 | 3300010375 | Bacteria | 2390 |
| 277 | Ga0105239_10227075 | 3300010375 | Bacteria | 2094 |
| 278 | Ga0105239_10331363 | 3300010375 | Bacteria | 1717 |
| 279 | Ga0105239_10618244 | 3300010375 | Bacteria | 1236 |
| 280 | Ga0105239_10840722 | 3300010375 | Bacteria | 1052 |
| 281 | Ga0105246_10000434 | 3300011119 | Bacteria | 22337 |
| 282 | Ga0105246_10001563 | 3300011119 | Bacteria | 13622 |
| 283 | Ga0157317_1005034 | 3300012475 | Bacteria | 881 |
| 284 | Ga0157326_1010593 | 3300012513 | Bacteria | 1029 |
| 285 | Ga0157373_10005789 | 3300013100 | Bacteria | 9259 |
| 286 | Ga0157373_10015197 | 3300013100 | Bacteria | 5631 |
| 287 | Ga0157371_10001422 | 3300013102 | Bacteria | 24868 |
| 288 | Ga0157371_10006328 | 3300013102 | Bacteria | 9796 |
| 289 | Ga0157371_10255031 | 3300013102 | Bacteria | 1264 |
| 290 | Ga0157370_10000117 | 3300013104 | Bacteria | 92168 |
| 291 | Ga0157370_10010517 | 3300013104 | Bacteria | 9743 |
| 292 | Ga0157370_10041056 | 3300013104 | Bacteria | 4466 |
| 293 | Ga0157370_10570332 | 3300013104 | Bacteria | 1037 |
| 294 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 295 | Ga0157369_10044079 | 3300013105 | Bacteria | 4858 |
| 296 | Ga0157369_10097146 | 3300013105 | Bacteria | 3142 |
| 297 | Ga0157369_10178719 | 3300013105 | Bacteria | 2234 |
| 298 | Ga0157374_10000542 | 3300013296 | Bacteria | 33699 |
| 299 | Ga0157374_10022241 | 3300013296 | Bacteria | 5655 |
| 300 | Ga0157374_10106555 | 3300013296 | Bacteria | 2693 |
| 301 | Ga0157374_10151378 | 3300013296 | Bacteria | 2256 |
| 302 | Ga0157374_10285653 | 3300013296 | Bacteria | 1629 |
| 303 | Ga0157374_10568412 | 3300013296 | Bacteria | 1142 |
| 304 | Ga0157378_10000624 | 3300013297 | Bacteria | 33307 |
| 305 | Ga0157378_10049551 | 3300013297 | Bacteria | 3737 |
| 306 | Ga0163162_10039028 | 3300013306 | Bacteria | 4741 |
| 307 | Ga0163162_10063074 | 3300013306 | Bacteria | 3747 |
| 308 | Ga0163162_11026964 | 3300013306 | Bacteria | 933 |
| 309 | Ga0157372_10000210 | 3300013307 | Bacteria | 65290 |
| 310 | Ga0157372_10002092 | 3300013307 | Bacteria | 21697 |
| 311 | Ga0157372_10004924 | 3300013307 | Bacteria | 14188 |
| 312 | Ga0157372_10260179 | 3300013307 | Bacteria | 2015 |
| 313 | Ga0157372_10506759 | 3300013307 | Bacteria | 1407 |
| 314 | Ga0157372_11011733 | 3300013307 | Bacteria | 962 |
| 315 | Ga0157372_11599357 | 3300013307 | Bacteria | 750 |
| 316 | Ga0157375_10000584 | 3300013308 | Bacteria | 32509 |
| 317 | Ga0157375_10001639 | 3300013308 | Bacteria | 19250 |
| 318 | Ga0157375_10376077 | 3300013308 | Bacteria | 1587 |
| 319 | Ga0157380_10001197 | 3300014326 | Bacteria | 16794 |
| 320 | Ga0157380_10070038 | 3300014326 | Bacteria | 2832 |
| 321 | Ga0157380_10261429 | 3300014326 | Bacteria | 1572 |
| 322 | Ga0157377_10611596 | 3300014745 | Bacteria | 779 |
| 323 | Ga0157379_10053843 | 3300014968 | Bacteria | 3595 |
| 324 | Ga0157379_10306989 | 3300014968 | Bacteria | 1447 |
| 325 | Ga0157376_10000096 | 3300014969 | Bacteria | 65482 |
| 326 | Ga0157376_10057248 | 3300014969 | Bacteria | 3260 |
| 327 | Ga0183363_1005 | 3300015690 | Bacteria | 403020 |
| 328 | Ga0163161_10000022 | 3300017792 | Bacteria | 207890 |
| 329 | Ga0163161_10005899 | 3300017792 | Bacteria | 8495 |
| 330 | Ga0163161_10398178 | 3300017792 | Bacteria | 1104 |
| 331 | Ga0163161_10404447 | 3300017792 | Bacteria | 1095 |
| 332 | Ga0213875_10000202 | 3300021388 | Bacteria | 60869 |
| 333 | Ga0209563_100019 | 3300025230 | Bacteria | 697828 |
| 334 | Ga0207427_101438 | 3300025231 | Bacteria | 8613 |
| 335 | Ga0209437_110657 | 3300025233 | Bacteria | 1398 |
| 336 | Ga0209026_1000641 | 3300025250 | Bacteria | 21580 |
| 337 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 338 | Ga0209148_1000147 | 3300025254 | Bacteria | 160231 |
| 339 | Ga0209148_1003079 | 3300025254 | Bacteria | 4896 |
| 340 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 341 | Ga0209233_1000154 | 3300025261 | Bacteria | 169616 |
| 342 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 343 | Ga0209455_1001163 | 3300025272 | Bacteria | 12666 |
| 344 | Ga0209675_1000808 | 3300025291 | Bacteria | 20627 |
| 345 | Ga0209676_1000221 | 3300025292 | Bacteria | 124715 |
| 346 | Ga0209676_1000453 | 3300025292 | Bacteria | 69137 |
| 347 | Ga0209676_1001826 | 3300025292 | Bacteria | 17683 |
| 348 | Ga0209025_1008523 | 3300025294 | Bacteria | 7365 |
| 349 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 350 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 351 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 352 | Ga0209050_1000217 | 3300025298 | Bacteria | 128833 |
| 353 | Ga0209050_1005032 | 3300025298 | Bacteria | 8570 |
| 354 | Ga0209050_1031450 | 3300025298 | Bacteria | 1653 |
| 355 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 356 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 357 | Ga0209257_1000487 | 3300025304 | Bacteria | 71315 |
| 358 | Ga0209257_1006386 | 3300025304 | Bacteria | 7625 |
| 359 | Ga0207697_10012093 | 3300025315 | Bacteria | 3633 |
| 360 | Ga0207656_10000241 | 3300025321 | Bacteria | 19100 |
| 361 | Ga0207713_1043917 | 3300025735 | Bacteria | 1842 |
| 362 | Ga0207682_10181100 | 3300025893 | Bacteria | 962 |
| 363 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 364 | Ga0207642_10002221 | 3300025899 | Bacteria | 6022 |
| 365 | Ga0207710_10026569 | 3300025900 | Bacteria | 2502 |
| 366 | Ga0207688_10025857 | 3300025901 | Bacteria | 3226 |
| 367 | Ga0207688_10042823 | 3300025901 | Bacteria | 2520 |
| 368 | Ga0207680_10042407 | 3300025903 | Bacteria | 2661 |
| 369 | Ga0207680_10374110 | 3300025903 | Unclassified | 1003 |
| 370 | Ga0207647_10003309 | 3300025904 | Bacteria | 12102 |
| 371 | Ga0207647_10006904 | 3300025904 | Bacteria | 8229 |
| 372 | Ga0207647_10017498 | 3300025904 | Bacteria | 4872 |
| 373 | Ga0207647_10028077 | 3300025904 | Bacteria | 3661 |
| 374 | Ga0207647_10046743 | 3300025904 | Bacteria | 2696 |
| 375 | Ga0207647_10155089 | 3300025904 | Bacteria | 1337 |
| 376 | Ga0207645_10002952 | 3300025907 | Bacteria | 13131 |
| 377 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 378 | Ga0207705_10000042 | 3300025909 | Bacteria | 182120 |
| 379 | Ga0207705_10000236 | 3300025909 | Bacteria | 54788 |
| 380 | Ga0207705_10009197 | 3300025909 | Bacteria | 7195 |
| 381 | Ga0207705_10030261 | 3300025909 | Bacteria | 3862 |
| 382 | Ga0207705_10333089 | 3300025909 | Bacteria | 1168 |
| 383 | Ga0207705_10384144 | 3300025909 | Bacteria | 1085 |
| 384 | Ga0207654_10165528 | 3300025911 | Bacteria | 1431 |
| 385 | Ga0207695_10067256 | 3300025913 | Bacteria | 3676 |
| 386 | Ga0207695_10143132 | 3300025913 | Bacteria | 2337 |
| 387 | Ga0207695_10296328 | 3300025913 | Bacteria | 1509 |
| 388 | Ga0207695_10358896 | 3300025913 | Bacteria | 1344 |
| 389 | Ga0207695_10414637 | 3300025913 | Bacteria | 1231 |
| 390 | Ga0207671_10023161 | 3300025914 | Bacteria | 4685 |
| 391 | Ga0207663_10020089 | 3300025916 | Bacteria | 3778 |
| 392 | Ga0207663_10199764 | 3300025916 | Bacteria | 1441 |
| 393 | Ga0207660_10022399 | 3300025917 | Bacteria | 4256 |
| 394 | Ga0207657_10000081 | 3300025919 | Bacteria | 90714 |
| 395 | Ga0207657_10001189 | 3300025919 | Bacteria | 27647 |
| 396 | Ga0207657_10008800 | 3300025919 | Bacteria | 10212 |
| 397 | Ga0207657_10047392 | 3300025919 | Bacteria | 3758 |
| 398 | Ga0207657_10203518 | 3300025919 | Bacteria | 1591 |
| 399 | Ga0207649_10033331 | 3300025920 | Bacteria | 3077 |
| 400 | Ga0207649_10270738 | 3300025920 | Bacteria | 1231 |
| 401 | Ga0207649_11023411 | 3300025920 | Bacteria | 650 |
| 402 | Ga0207652_10246966 | 3300025921 | Bacteria | 1609 |
| 403 | Ga0207646_10253688 | 3300025922 | Bacteria | 1589 |
| 404 | Ga0207681_10000242 | 3300025923 | Bacteria | 41825 |
| 405 | Ga0207681_10001749 | 3300025923 | Bacteria | 13940 |
| 406 | Ga0207681_10560239 | 3300025923 | Bacteria | 941 |
| 407 | Ga0207694_10053989 | 3300025924 | Bacteria | 3117 |
| 408 | Ga0207650_10129807 | 3300025925 | Bacteria | 1971 |
| 409 | Ga0207650_10313344 | 3300025925 | Bacteria | 1284 |
| 410 | Ga0207650_10347195 | 3300025925 | Bacteria | 1220 |
| 411 | Ga0207659_10004034 | 3300025926 | Bacteria | 8861 |
| 412 | Ga0207659_10554791 | 3300025926 | Bacteria | 977 |
| 413 | Ga0207687_10000015 | 3300025927 | Bacteria | 261701 |
| 414 | Ga0207687_10003175 | 3300025927 | Bacteria | 11159 |
| 415 | Ga0207687_10014513 | 3300025927 | Bacteria | 5157 |
| 416 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 417 | Ga0207664_10575216 | 3300025929 | Bacteria | 1011 |
| 418 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 419 | Ga0207644_10214149 | 3300025931 | Bacteria | 1524 |
| 420 | Ga0207690_10002915 | 3300025932 | Bacteria | 10309 |
| 421 | Ga0207690_10005010 | 3300025932 | Bacteria | 7824 |
| 422 | Ga0207690_10048973 | 3300025932 | Bacteria | 2814 |
| 423 | Ga0207690_10102863 | 3300025932 | Bacteria | 2043 |
| 424 | Ga0207706_10000112 | 3300025933 | Bacteria | 87100 |
| 425 | Ga0207706_10011098 | 3300025933 | Bacteria | 8211 |
| 426 | Ga0207706_10013408 | 3300025933 | Bacteria | 7452 |
| 427 | Ga0207706_10013706 | 3300025933 | Bacteria | 7357 |
| 428 | Ga0207706_10091730 | 3300025933 | Bacteria | 2671 |
| 429 | Ga0207706_10113122 | 3300025933 | Bacteria | 2388 |
| 430 | Ga0207706_10371749 | 3300025933 | Bacteria | 1241 |
| 431 | Ga0207686_10000231 | 3300025934 | Bacteria | 42432 |
| 432 | Ga0207686_10000489 | 3300025934 | Bacteria | 26020 |
| 433 | Ga0207686_10112928 | 3300025934 | Bacteria | 1836 |
| 434 | Ga0207686_10178462 | 3300025934 | Bacteria | 1504 |
| 435 | Ga0207709_10000031 | 3300025935 | Bacteria | 329046 |
| 436 | Ga0207709_10000066 | 3300025935 | Bacteria | 189194 |
| 437 | Ga0207709_10077005 | 3300025935 | Bacteria | 2136 |
| 438 | Ga0207709_10241413 | 3300025935 | Bacteria | 1314 |
| 439 | Ga0207709_10381789 | 3300025935 | Bacteria | 1072 |
| 440 | Ga0207670_10141961 | 3300025936 | Bacteria | 1772 |
| 441 | Ga0207670_10211466 | 3300025936 | Bacteria | 1480 |
| 442 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 443 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 444 | Ga0207669_10000073 | 3300025937 | Bacteria | 51684 |
| 445 | Ga0207669_10000718 | 3300025937 | Bacteria | 14326 |
| 446 | Ga0207669_10019929 | 3300025937 | Bacteria | 3504 |
| 447 | Ga0207669_10083820 | 3300025937 | Bacteria | 2052 |
| 448 | Ga0207669_10464025 | 3300025937 | Bacteria | 1006 |
| 449 | Ga0207704_10000002 | 3300025938 | Bacteria | 303025 |
| 450 | Ga0207704_10000007 | 3300025938 | Bacteria | 211230 |
| 451 | Ga0207704_10000181 | 3300025938 | Bacteria | 33316 |
| 452 | Ga0207704_10113553 | 3300025938 | Bacteria | 1837 |
| 453 | Ga0207665_10193561 | 3300025939 | Bacteria | 1478 |
| 454 | Ga0207691_10014326 | 3300025940 | Bacteria | 7560 |
| 455 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 456 | Ga0207711_10004612 | 3300025941 | Bacteria | 11719 |
| 457 | Ga0207711_10038590 | 3300025941 | Bacteria | 4062 |
| 458 | Ga0207689_10000060 | 3300025942 | Bacteria | 85326 |
| 459 | Ga0207689_10290111 | 3300025942 | Bacteria | 1355 |
| 460 | Ga0207689_10492263 | 3300025942 | Bacteria | 1027 |
| 461 | Ga0207661_10136885 | 3300025944 | Bacteria | 2104 |
| 462 | Ga0207661_10169639 | 3300025944 | Bacteria | 1899 |
| 463 | Ga0207661_11145385 | 3300025944 | Bacteria | 716 |
| 464 | Ga0207679_10056629 | 3300025945 | Bacteria | 2896 |
| 465 | Ga0207679_10661697 | 3300025945 | Bacteria | 945 |
| 466 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 467 | Ga0207667_10001784 | 3300025949 | Bacteria | 27089 |
| 468 | Ga0207667_10062071 | 3300025949 | Bacteria | 3909 |
| 469 | Ga0207667_10065036 | 3300025949 | Bacteria | 3805 |
| 470 | Ga0207667_10202034 | 3300025949 | Bacteria | 2039 |
| 471 | Ga0207667_10203211 | 3300025949 | Bacteria | 2032 |
| 472 | Ga0207667_10343626 | 3300025949 | Bacteria | 1523 |
| 473 | Ga0207667_10385383 | 3300025949 | Bacteria | 1428 |
| 474 | Ga0207651_10000004 | 3300025960 | Bacteria | 290191 |
| 475 | Ga0207651_10004579 | 3300025960 | Bacteria | 7000 |
| 476 | Ga0207651_10176139 | 3300025960 | Bacteria | 1692 |
| 477 | Ga0207712_10000015 | 3300025961 | Bacteria | 346689 |
| 478 | Ga0207712_10006048 | 3300025961 | Bacteria | 7634 |
| 479 | Ga0207712_10507662 | 3300025961 | Bacteria | 1031 |
| 480 | Ga0207668_10062723 | 3300025972 | Bacteria | 2618 |
| 481 | Ga0207668_10138161 | 3300025972 | Bacteria | 1870 |
| 482 | Ga0207640_10000110 | 3300025981 | Bacteria | 61907 |
| 483 | Ga0207640_10000653 | 3300025981 | Bacteria | 20274 |
| 484 | Ga0207640_10000977 | 3300025981 | Bacteria | 15868 |
| 485 | Ga0207640_10007464 | 3300025981 | Bacteria | 6040 |
| 486 | Ga0207640_10190802 | 3300025981 | Bacteria | 1544 |
| 487 | Ga0207658_10000291 | 3300025986 | Bacteria | 52585 |
| 488 | Ga0207658_10015627 | 3300025986 | Bacteria | 5209 |
| 489 | Ga0207658_10336403 | 3300025986 | Bacteria | 1311 |
| 490 | Ga0207677_10000231 | 3300026023 | Bacteria | 43615 |
| 491 | Ga0207703_10000123 | 3300026035 | Bacteria | 92590 |
| 492 | Ga0207703_10000169 | 3300026035 | Bacteria | 76131 |
| 493 | Ga0207703_10035047 | 3300026035 | Bacteria | 3987 |
| 494 | Ga0207703_10046555 | 3300026035 | Bacteria | 3493 |
| 495 | Ga0207703_10059475 | 3300026035 | Bacteria | 3121 |
| 496 | Ga0207703_10067257 | 3300026035 | Bacteria | 2949 |
| 497 | Ga0207639_10000312 | 3300026041 | Bacteria | 34360 |
| 498 | Ga0207639_10003914 | 3300026041 | Bacteria | 10048 |
| 499 | Ga0207639_10022289 | 3300026041 | Bacteria | 4561 |
| 500 | Ga0207639_10046665 | 3300026041 | Bacteria | 3270 |
| 501 | Ga0207639_10256756 | 3300026041 | Bacteria | 1527 |
| 502 | Ga0207639_10450568 | 3300026041 | Bacteria | 1168 |
| 503 | Ga0207639_10773249 | 3300026041 | Bacteria | 894 |
| 504 | Ga0207678_10000656 | 3300026067 | Bacteria | 31806 |
| 505 | Ga0207678_10128322 | 3300026067 | Bacteria | 2163 |
| 506 | Ga0207708_10697040 | 3300026075 | Bacteria | 868 |
| 507 | Ga0207708_11050470 | 3300026075 | Bacteria | 709 |
| 508 | Ga0207702_10000251 | 3300026078 | Bacteria | 62222 |
| 509 | Ga0207702_10006436 | 3300026078 | Bacteria | 10127 |
| 510 | Ga0207702_10018324 | 3300026078 | Bacteria | 5790 |
| 511 | Ga0207702_10043845 | 3300026078 | Bacteria | 3757 |
| 512 | Ga0207702_10311614 | 3300026078 | Bacteria | 1496 |
| 513 | Ga0207641_10000102 | 3300026088 | Bacteria | 122366 |
| 514 | Ga0207641_10000827 | 3300026088 | Bacteria | 32939 |
| 515 | Ga0207641_10016967 | 3300026088 | Bacteria | 5962 |
| 516 | Ga0207641_10020235 | 3300026088 | Bacteria | 5464 |
| 517 | Ga0207641_11199269 | 3300026088 | Bacteria | 759 |
| 518 | Ga0207648_10000003 | 3300026089 | Bacteria | 289983 |
| 519 | Ga0207648_10021289 | 3300026089 | Bacteria | 5828 |
| 520 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 521 | Ga0207676_10000552 | 3300026095 | Bacteria | 31180 |
| 522 | Ga0207674_10069407 | 3300026116 | Bacteria | 3544 |
| 523 | Ga0207674_10266128 | 3300026116 | Bacteria | 1662 |
| 524 | Ga0207674_10385388 | 3300026116 | Bacteria | 1355 |
| 525 | Ga0207675_100000016 | 3300026118 | Bacteria | 126353 |
| 526 | Ga0207675_100237065 | 3300026118 | Bacteria | 1762 |
| 527 | Ga0207683_10000086 | 3300026121 | Bacteria | 73510 |
| 528 | Ga0207683_10024502 | 3300026121 | Bacteria | 5198 |
| 529 | Ga0207683_10071169 | 3300026121 | Bacteria | 3074 |
| 530 | Ga0207683_10433437 | 3300026121 | Bacteria | 1211 |
| 531 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 532 | Ga0207698_10000193 | 3300026142 | Bacteria | 38052 |
| 533 | Ga0207698_10000385 | 3300026142 | Bacteria | 25510 |
| 534 | Ga0207698_10308051 | 3300026142 | Bacteria | 1477 |
| 535 | Ga0209813_10000053 | 3300027866 | Bacteria | 47000 |
| 536 | Ga0209974_10151896 | 3300027876 | Bacteria | 836 |
| 537 | Ga0207428_10116851 | 3300027907 | Bacteria | 2048 |
| 538 | Ga0268266_10001434 | 3300028379 | Bacteria | 28392 |
| 539 | Ga0268266_10009662 | 3300028379 | Bacteria | 8480 |
| 540 | Ga0268266_10264713 | 3300028379 | Bacteria | 1594 |
| 541 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 542 | Ga0268265_10002929 | 3300028380 | Bacteria | 12514 |
| 543 | Ga0268265_10012842 | 3300028380 | Bacteria | 5687 |
| 544 | Ga0268265_10022730 | 3300028380 | Bacteria | 4410 |
| 545 | Ga0268264_10000018 | 3300028381 | Bacteria | 495324 |
| 546 | Ga0268264_10000330 | 3300028381 | Bacteria | 74311 |
| 547 | Ga0268264_10000969 | 3300028381 | Bacteria | 29417 |
| 548 | Ga0268264_10002138 | 3300028381 | Bacteria | 17636 |
| 549 | Ga0268264_10023373 | 3300028381 | Bacteria | 5043 |
| 550 | Ga0268264_10367534 | 3300028381 | Bacteria | 1374 |
| 551 | Ga0265337_1000955 | 3300028556 | Bacteria | 15128 |
| 552 | Ga0265326_10000041 | 3300028558 | Bacteria | 83872 |
| 553 | Ga0265326_10042869 | 3300028558 | Bacteria | 1284 |
| 554 | Ga0265319_1000014 | 3300028563 | Bacteria | 177623 |
| 555 | Ga0265322_10000004 | 3300028654 | Bacteria | 275155 |
| 556 | Ga0265338_10000185 | 3300028800 | Bacteria | 116333 |
| 557 | Ga0265324_10000266 | 3300029957 | Bacteria | 38549 |
| 558 | Ga0307511_10058602 | 3300030521 | Bacteria | 2974 |
| 559 | Ga0265328_10003945 | 3300031239 | Bacteria | 6522 |
| 560 | Ga0265328_10105398 | 3300031239 | Bacteria | 1046 |
| 561 | Ga0265320_10000029 | 3300031240 | Bacteria | 159627 |
| 562 | Ga0265320_10263661 | 3300031240 | Bacteria | 763 |
| 563 | Ga0265325_10031082 | 3300031241 | Bacteria | 2860 |
| 564 | Ga0265329_10011465 | 3300031242 | Bacteria | 3220 |
| 565 | Ga0265339_10024105 | 3300031249 | Bacteria | 3511 |
| 566 | Ga0265331_10002379 | 3300031250 | Bacteria | 12770 |
| 567 | Ga0265331_10064275 | 3300031250 | Bacteria | 1727 |
| 568 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 569 | Ga0265316_10146252 | 3300031344 | Bacteria | 1772 |
| 570 | Ga0307513_10082859 | 3300031456 | Bacteria | 3300 |
| 571 | Ga0307513_10111268 | 3300031456 | Bacteria | 2732 |
| 572 | Ga0307513_10153196 | 3300031456 | Bacteria | 2210 |
| 573 | Ga0307408_100020835 | 3300031548 | Bacteria | 4430 |
| 574 | Ga0307408_100179098 | 3300031548 | Bacteria | 1698 |
| 575 | Ga0307508_10001087 | 3300031616 | Bacteria | 31474 |
| 576 | Ga0307508_10121828 | 3300031616 | Bacteria | 2211 |
| 577 | Ga0316579_10074567 | 3300031691 | Bacteria | 1611 |
| 578 | Ga0265314_10014685 | 3300031711 | Bacteria | 6251 |
| 579 | Ga0307410_10063140 | 3300031852 | Bacteria | 2540 |
| 580 | Ga0307410_10069496 | 3300031852 | Bacteria | 2436 |
| 581 | Ga0307410_10598170 | 3300031852 | Bacteria | 920 |
| 582 | Ga0307406_11093672 | 3300031901 | Bacteria | 688 |
| 583 | Ga0307407_10415807 | 3300031903 | Bacteria | 968 |
| 584 | Ga0307412_10000217 | 3300031911 | Bacteria | 38437 |
| 585 | Ga0307412_10088082 | 3300031911 | Bacteria | 2165 |
| 586 | Ga0307412_10459652 | 3300031911 | Bacteria | 1051 |
| 587 | Ga0307409_100615108 | 3300031995 | Bacteria | 1075 |
| 588 | Ga0307416_100025502 | 3300032002 | Bacteria | 4334 |
| 589 | Ga0307416_101124106 | 3300032002 | Bacteria | 890 |
| 590 | Ga0307416_101230978 | 3300032002 | Bacteria | 854 |
| 591 | Ga0307414_10000102 | 3300032004 | Bacteria | 61667 |
| 592 | Ga0307414_10095806 | 3300032004 | Bacteria | 2219 |
| 593 | Ga0307414_10143954 | 3300032004 | Bacteria | 1870 |
| 594 | Ga0307414_10180164 | 3300032004 | Bacteria | 1699 |
| 595 | Ga0307414_10180417 | 3300032004 | Bacteria | 1697 |
| 596 | Ga0307414_10341942 | 3300032004 | Bacteria | 1281 |
| 597 | Ga0307414_11229039 | 3300032004 | Bacteria | 694 |
| 598 | Ga0307411_10234335 | 3300032005 | Bacteria | 1433 |
| 599 | Ga0307411_10404654 | 3300032005 | Bacteria | 1129 |
| 600 | Ga0307411_10946091 | 3300032005 | Bacteria | 768 |
| 601 | Ga0307415_100602456 | 3300032126 | Bacteria | 978 |
| 602 | Ga0316583_10025382 | 3300032133 | Bacteria | 2117 |
| 603 | Ga0307510_10032849 | 3300033180 | Bacteria | 5841 |
| 604 | Ga0373955_0294863 | 3300035172 | Bacteria | 977 |
| 605 | Ga0373955_0404059 | 3300035172 | Bacteria | 830 |
| 606 | Ga0373937_0026530 | 3300036401 | Bacteria | 5234 |
| 607 | Ga0316582_0000403 | 3300036647 | Bacteria | 15769 |
| 608 | Ga0316584_0366060 | 3300036712 | Bacteria | 1033 |
| 609 | Ga0373925_0378810 | 3300037068 | Bacteria | 1152 |
| 610 | Ga0395899_0069029 | 3300037312 | Bacteria | 2589 |
| 611 | Ga0395899_0072345 | 3300037312 | Bacteria | 2523 |
| 612 | Ga0395900_0014470 | 3300037418 | Bacteria | 8052 |
| 613 | Ga0395900_0249634 | 3300037418 | Bacteria | 1776 |
| 614 | Ga0395900_0901660 | 3300037418 | Bacteria | 807 |
| 615 | Ga0395905_0040453 | 3300037471 | Bacteria | 4373 |
| 616 | Ga0395905_0065909 | 3300037471 | Bacteria | 3391 |
| 617 | Ga0436364_0380874 | 3300037853 | Bacteria | 90281 |
| 618 | Ga0395901_0019343 | 3300038443 | Bacteria | 6961 |
| 619 | Ga0395901_0883018 | 3300038443 | Bacteria | 877 |
| 620 | Ga0436365_1401057 | 3300039437 | Bacteria | 1120 |
| 621 | Ga0451795_0981501 | 3300041456 | Bacteria | 1655 |
| 622 | Ga0451843_1372541 | 3300041509 | Bacteria | 1160 |
| 623 | Ga0439448_0016115 | 3300042005 | Bacteria | 2271 |
| 624 | Ga0439448_0031454 | 3300042005 | Bacteria | 1685 |
| 625 | Ga0439448_0040880 | 3300042005 | Bacteria | 1498 |
| 626 | Ga0439455_0007890 | 3300042012 | Bacteria | 2266 |
| 627 | Ga0439455_0021674 | 3300042012 | Bacteria | 1534 |
| 628 | Ga0439458_0000728 | 3300042157 | Bacteria | 8480 |
| 629 | Ga0439458_0001986 | 3300042157 | Bacteria | 5072 |
| 630 | Ga0439458_0004167 | 3300042157 | Bacteria | 3338 |
| 631 | Ga0451577_0139182 | 3300042876 | Bacteria | 2180 |
| 632 | Ga0451577_0285439 | 3300042876 | Bacteria | 1495 |
| 633 | Ga0451577_0723991 | 3300042876 | Bacteria | 900 |
| 634 | Ga0451577_0758000 | 3300042876 | Bacteria | 878 |
| 635 | Ga0466972_0000559 | 3300044658 | Bacteria | 18168 |
| 636 | Ga0466965_0048807 | 3300044683 | Bacteria | 2098 |
| 637 | Ga0466966_0044471 | 3300044684 | Bacteria | 2843 |
| 638 | Ga0466961_0015796 | 3300044693 | Bacteria | 4844 |
| 639 | Ga0466961_0020191 | 3300044693 | Bacteria | 4288 |
| 640 | Ga0466963_0003840 | 3300044694 | Bacteria | 8663 |
| 641 | Ga0466963_0081189 | 3300044694 | Bacteria | 2196 |
| 642 | Ga0466963_0127592 | 3300044694 | Bacteria | 1754 |
| 643 | Ga0466964_0002332 | 3300044706 | Bacteria | 6733 |
| 644 | Ga0453684_0048400 | 3300044712 | Bacteria | 5623 |
| 645 | Ga0453684_0107494 | 3300044712 | Bacteria | 3397 |
| 646 | Ga0453684_0435864 | 3300044712 | Bacteria | 1461 |
| 647 | Ga0453684_0444889 | 3300044712 | Unclassified | 1443 |
| 648 | Ga0466971_0000456 | 3300044719 | Bacteria | 15975 |
| 649 | Ga0466968_0031684 | 3300044735 | Bacteria | 2194 |
| 650 | Ga0466970_0007333 | 3300044765 | Bacteria | 5526 |
| 651 | Ga0466970_0170830 | 3300044765 | Bacteria | 1205 |
| 652 | Ga0466970_0171690 | 3300044765 | Bacteria | 1202 |
| 653 | Ga0466957_0003429 | 3300044842 | Bacteria | 8705 |
| 654 | Ga0466957_0004680 | 3300044842 | Bacteria | 7652 |
| 655 | Ga0466957_0030923 | 3300044842 | Bacteria | 3198 |
| 656 | Ga0466957_0225348 | 3300044842 | Bacteria | 1239 |
| 657 | Ga0466960_0016084 | 3300044901 | Bacteria | 3238 |
| 658 | Ga0466959_0039342 | 3300045049 | Bacteria | 3494 |
| 659 | Ga0466959_0082513 | 3300045049 | Bacteria | 2316 |
| 660 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 661 | Ga0451576_0477661 | 3300045051 | Bacteria | 1309 |
| 662 | Ga0466958_0009712 | 3300045836 | Bacteria | 5368 |
| 663 | Ga0466958_0139879 | 3300045836 | Bacteria | 1524 |
| 664 | Ga0466967_0041410 | 3300045976 | Bacteria | 3971 |
| 665 | Ga0495592_0005546 | 3300046454 | Bacteria | 9332 |
| 666 | Ga0495592_0079544 | 3300046454 | Bacteria | 2373 |
| 667 | Ga0495592_0264117 | 3300046454 | Bacteria | 1132 |
| 668 | Ga0495603_0000033 | 3300046455 | Bacteria | 57940 |
| 669 | Ga0495603_0002227 | 3300046455 | Bacteria | 11397 |
| 670 | Ga0495603_0154788 | 3300046455 | Bacteria | 1331 |
| 671 | Ga0495629_0013075 | 3300046459 | Bacteria | 5998 |
| 672 | Ga0495629_0022727 | 3300046459 | Bacteria | 4470 |
| 673 | Ga0495629_0030983 | 3300046459 | Bacteria | 3789 |
| 674 | Ga0495629_0392763 | 3300046459 | Bacteria | 943 |
| 675 | Ga0495638_0001782 | 3300046460 | Bacteria | 18811 |
| 676 | Ga0495638_0022336 | 3300046460 | Bacteria | 4155 |
| 677 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 678 | Ga0495651_0121028 | 3300046462 | Bacteria | 1923 |
| 679 | Ga0495651_0219648 | 3300046462 | Bacteria | 1316 |
| 680 | Ga0495653_0077990 | 3300046463 | Bacteria | 2458 |
| 681 | Ga0495650_0000340 | 3300046471 | Bacteria | 83278 |
| 682 | Ga0495650_0000842 | 3300046471 | Bacteria | 36937 |
| 683 | Ga0495582_0000009 | 3300046473 | Bacteria | 123633 |
| 684 | Ga0495639_0265627 | 3300046475 | Bacteria | 851 |
| 685 | Ga0495662_0000698 | 3300046476 | Bacteria | 15931 |
| 686 | Ga0495585_0019033 | 3300046492 | Bacteria | 3962 |
| 687 | Ga0495585_0138231 | 3300046492 | Bacteria | 1277 |
| 688 | Ga0495596_0000288 | 3300046500 | Bacteria | 33511 |
| 689 | Ga0495596_0090126 | 3300046500 | Bacteria | 1190 |
| 690 | Ga0495607_0003392 | 3300046501 | Bacteria | 12215 |
| 691 | Ga0495583_0000996 | 3300046506 | Bacteria | 32401 |
| 692 | Ga0495583_0010754 | 3300046506 | Bacteria | 5306 |
| 693 | Ga0495583_0010824 | 3300046506 | Bacteria | 5282 |
| 694 | Ga0495583_0011374 | 3300046506 | Bacteria | 5114 |
| 695 | Ga0495583_0199221 | 3300046506 | Bacteria | 814 |
| 696 | Ga0495606_0000824 | 3300046507 | Bacteria | 47072 |
| 697 | Ga0495606_0030090 | 3300046507 | Bacteria | 3799 |
| 698 | Ga0495606_0118613 | 3300046507 | Bacteria | 1586 |
| 699 | Ga0495608_0000035 | 3300046511 | Bacteria | 133011 |
| 700 | Ga0495608_0003187 | 3300046511 | Bacteria | 11744 |
| 701 | Ga0495608_0006939 | 3300046511 | Bacteria | 8020 |
| 702 | Ga0495610_0002738 | 3300046512 | Bacteria | 14490 |
| 703 | Ga0495616_0106319 | 3300046513 | Bacteria | 1309 |
| 704 | Ga0495618_0000070 | 3300046514 | Bacteria | 72312 |
| 705 | Ga0495618_0409114 | 3300046514 | Bacteria | 829 |
| 706 | Ga0495620_0044437 | 3300046515 | Bacteria | 1930 |
| 707 | Ga0495628_0003299 | 3300046516 | Bacteria | 14431 |
| 708 | Ga0495628_0295387 | 3300046516 | Bacteria | 1200 |
| 709 | Ga0495630_0055249 | 3300046517 | Bacteria | 2975 |
| 710 | Ga0495631_0217209 | 3300046518 | Bacteria | 816 |
| 711 | Ga0495632_0004649 | 3300046519 | Bacteria | 9279 |
| 712 | Ga0495632_0037725 | 3300046519 | Bacteria | 2450 |
| 713 | Ga0495632_0359930 | 3300046519 | Bacteria | 639 |
| 714 | Ga0495643_0000132 | 3300046522 | Bacteria | 121567 |
| 715 | Ga0495643_0001032 | 3300046522 | Bacteria | 28383 |
| 716 | Ga0495643_0002580 | 3300046522 | Bacteria | 14155 |
| 717 | Ga0495643_0044416 | 3300046522 | Bacteria | 2415 |
| 718 | Ga0495643_0247246 | 3300046522 | Bacteria | 834 |
| 719 | Ga0495644_0003638 | 3300046523 | Bacteria | 6073 |
| 720 | Ga0495648_0052521 | 3300046524 | Bacteria | 2475 |
| 721 | Ga0495663_0010856 | 3300046525 | Bacteria | 2534 |
| 722 | Ga0495654_0082285 | 3300046530 | Bacteria | 1507 |
| 723 | Ga0495640_0017600 | 3300046533 | Bacteria | 5321 |
| 724 | Ga0495586_0001457 | 3300046535 | Bacteria | 13053 |
| 725 | Ga0495587_0019075 | 3300046536 | Bacteria | 4249 |
| 726 | Ga0495609_0006682 | 3300046538 | Bacteria | 5854 |
| 727 | Ga0495622_0003931 | 3300046557 | Bacteria | 6941 |
| 728 | Ga0495633_0003629 | 3300046558 | Bacteria | 10203 |
| 729 | Ga0495633_0024503 | 3300046558 | Bacteria | 2981 |
| 730 | Ga0495667_0135739 | 3300046559 | Bacteria | 1586 |
| 731 | Ga0495668_0021107 | 3300046616 | Bacteria | 3739 |
| 732 | Ga0495668_0184355 | 3300046616 | Bacteria | 1143 |
| 733 | Ga0495634_0000216 | 3300046642 | Bacteria | 53765 |
| 734 | Ga0495634_0090709 | 3300046642 | Bacteria | 1985 |
| 735 | Ga0495611_0014992 | 3300046648 | Bacteria | 3312 |
| 736 | Ga0495611_0119212 | 3300046648 | Bacteria | 1230 |
| 737 | Ga0495625_0000093 | 3300046660 | Bacteria | 145874 |
| 738 | Ga0495625_0000583 | 3300046660 | Bacteria | 53056 |
| 739 | Ga0495625_0001272 | 3300046660 | Bacteria | 31687 |
| 740 | Ga0495625_0024137 | 3300046660 | Bacteria | 4633 |
| 741 | Ga0495625_0036791 | 3300046660 | Bacteria | 3595 |
| 742 | Ga0495625_0037260 | 3300046660 | Bacteria | 3569 |
| 743 | Ga0495625_0049825 | 3300046660 | Bacteria | 3008 |
| 744 | Ga0495625_0388388 | 3300046660 | Bacteria | 874 |
| 745 | Ga0495625_0496866 | 3300046660 | Bacteria | 746 |
| 746 | Ga0495635_0000057 | 3300046663 | Bacteria | 67714 |
| 747 | Ga0495635_0444378 | 3300046663 | Bacteria | 858 |
| 748 | Ga0495661_0066888 | 3300046665 | Bacteria | 2113 |
| 749 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 750 | Ga0495657_0007638 | 3300046675 | Bacteria | 8330 |
| 751 | Ga0495623_0196081 | 3300046679 | Bacteria | 1164 |
| 752 | Ga0495646_0420645 | 3300046680 | Bacteria | 693 |
| 753 | Ga0495647_0003964 | 3300046681 | Bacteria | 4775 |
| 754 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 755 | Ga0495658_0001858 | 3300046683 | Bacteria | 10783 |
| 756 | Ga0495613_0001530 | 3300046689 | Bacteria | 17607 |
| 757 | Ga0495613_0002007 | 3300046689 | Bacteria | 15449 |
| 758 | Ga0495613_0067568 | 3300046689 | Bacteria | 2609 |
| 759 | Ga0495670_0024563 | 3300046691 | Bacteria | 2979 |
| 760 | Ga0495670_0058212 | 3300046691 | Bacteria | 1940 |
| 761 | Ga0495671_0083324 | 3300046692 | Bacteria | 1567 |
| 762 | Ga0495649_0193899 | 3300046694 | Bacteria | 1057 |
| 763 | Ga0495600_0004496 | 3300046809 | Bacteria | 8357 |
| 764 | Ga0495600_0006263 | 3300046809 | Bacteria | 7226 |
| 765 | Ga0495660_0124506 | 3300046810 | Bacteria | 1300 |
| 766 | Ga0495604_0000100 | 3300047317 | Bacteria | 72995 |
| 767 | Ga0495604_0000305 | 3300047317 | Bacteria | 44020 |
| 768 | Ga0495604_0064668 | 3300047317 | Bacteria | 2787 |
| 769 | Ga0495604_0534047 | 3300047317 | Bacteria | 758 |
| 770 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 771 | Ga0495676_0081293 | 3300047321 | Bacteria | 2456 |
| 772 | Ga0495680_0000312 | 3300047322 | Bacteria | 54495 |
| 773 | Ga0495680_0027207 | 3300047322 | Bacteria | 4702 |
| 774 | Ga0495683_0011593 | 3300047323 | Bacteria | 4637 |
| 775 | Ga0495683_0055376 | 3300047323 | Bacteria | 1974 |
| 776 | Ga0495687_000512 | 3300047443 | Bacteria | 46683 |
| 777 | Ga0495687_010555 | 3300047443 | Bacteria | 5057 |
| 778 | Ga0495687_057939 | 3300047443 | Bacteria | 1609 |
| 779 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 780 | Ga0495677_0001294 | 3300047445 | Bacteria | 9994 |
| 781 | Ga0495685_013985 | 3300047447 | Bacteria | 2723 |
| 782 | Ga0495673_0014313 | 3300047469 | Bacteria | 4128 |
| 783 | Ga0495681_0000020 | 3300047470 | Bacteria | 170007 |
| 784 | Ga0495681_0189462 | 3300047470 | Bacteria | 840 |
| 785 | Ga0495686_0000753 | 3300047472 | Bacteria | 42718 |
| 786 | Ga0495686_0000983 | 3300047472 | Bacteria | 34894 |
| 787 | Ga0495593_0106453 | 3300047673 | Bacteria | 1434 |
| 788 | Ga0495602_0000227 | 3300048088 | Bacteria | 52680 |
| 789 | Ga0495602_0001969 | 3300048088 | Bacteria | 20606 |
| 790 | Ga0495602_0015468 | 3300048088 | Bacteria | 7699 |
| 791 | Ga0495614_0026410 | 3300048089 | Bacteria | 2502 |
| 792 | Ga0495615_0000148 | 3300048090 | Bacteria | 17594 |
| 793 | Ga0495626_0002994 | 3300048091 | Bacteria | 11193 |
| 794 | Ga0495626_0258124 | 3300048091 | Bacteria | 697 |
| 795 | Ga0496100_0177923 | 3300048903 | Bacteria | 1537 |
| 796 | Ga0496100_0318505 | 3300048903 | Bacteria | 1168 |
| 797 | Ga0496101_0026473 | 3300048904 | Bacteria | 4033 |
| 798 | Ga0496101_1220515 | 3300048904 | Bacteria | 589 |
| 799 | Ga0496102_0002490 | 3300048905 | Bacteria | 15727 |
| 800 | Ga0496102_0170708 | 3300048905 | Bacteria | 2048 |
| 801 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 802 | Ga0496103_0032935 | 3300048906 | Bacteria | 3165 |
| 803 | Ga0496103_0153583 | 3300048906 | Bacteria | 1475 |
| 804 | Ga0496104_0026054 | 3300048907 | Bacteria | 5394 |
| 805 | Ga0496104_0228883 | 3300048907 | Bacteria | 1771 |
| 806 | Ga0496105_0003976 | 3300048908 | Bacteria | 11064 |
| 807 | Ga0496105_0424345 | 3300048908 | Bacteria | 1052 |
| 808 | Ga0496106_0000356 | 3300048909 | Bacteria | 32385 |
| 809 | Ga0496106_0002162 | 3300048909 | Bacteria | 14692 |
| 810 | Ga0496106_0981146 | 3300048909 | Bacteria | 665 |
| 811 | Ga0496107_0013198 | 3300048910 | Bacteria | 5772 |
| 812 | Ga0496107_0132119 | 3300048910 | Bacteria | 1843 |
| 813 | Ga0496107_0297851 | 3300048910 | Bacteria | 1200 |
| 814 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 815 | Ga0496108_0000232 | 3300048911 | Bacteria | 49846 |
| 816 | Ga0496108_0013086 | 3300048911 | Bacteria | 6762 |
| 817 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 818 | Ga0496109_0000044 | 3300048912 | Bacteria | 133779 |
| 819 | Ga0496110_0000357 | 3300048913 | Bacteria | 30636 |
| 820 | Ga0496110_0130680 | 3300048913 | Bacteria | 2267 |
| 821 | Ga0496110_1233306 | 3300048913 | Bacteria | 657 |
| 822 | Ga0496111_0000735 | 3300048914 | Bacteria | 17456 |
| 823 | Ga0496111_0087567 | 3300048914 | Bacteria | 2279 |
| 824 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 825 | Ga0496112_0450009 | 3300048915 | Bacteria | 1225 |
| 826 | Ga0496113_0002677 | 3300048916 | Bacteria | 10443 |
| 827 | Ga0496113_0053877 | 3300048916 | Bacteria | 3009 |
| 828 | Ga0496113_0087825 | 3300048916 | Bacteria | 2391 |
| 829 | Ga0496116_0000039 | 3300048919 | Bacteria | 349134 |
| 830 | Ga0496116_0033509 | 3300048919 | Bacteria | 3645 |
| 831 | Ga0496117_0007762 | 3300048920 | Bacteria | 10362 |
| 832 | Ga0496117_0070555 | 3300048920 | Bacteria | 2346 |
| 833 | Ga0496117_0075266 | 3300048920 | Bacteria | 2244 |
| 834 | Ga0496117_0079225 | 3300048920 | Bacteria | 2165 |
| 835 | Ga0496117_0088769 | 3300048920 | Bacteria | 1999 |
| 836 | Ga0496118_0020983 | 3300048921 | Bacteria | 5769 |
| 837 | Ga0496118_0212672 | 3300048921 | Bacteria | 1133 |
| 838 | Ga0496118_0357561 | 3300048921 | Bacteria | 775 |
| 839 | Ga0496119_0166789 | 3300048922 | Bacteria | 1166 |
| 840 | Ga0496120_0088813 | 3300048923 | Bacteria | 1656 |
| 841 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 842 | Ga0496121_0000222 | 3300048924 | Bacteria | 123595 |
| 843 | Ga0496121_0000367 | 3300048924 | Bacteria | 92745 |
| 844 | Ga0496121_0005224 | 3300048924 | Bacteria | 16810 |
| 845 | Ga0496121_0012226 | 3300048924 | Bacteria | 9404 |
| 846 | Ga0496121_0026796 | 3300048924 | Bacteria | 5416 |
| 847 | Ga0496121_0227511 | 3300048924 | Bacteria | 1309 |
| 848 | Ga0496122_0002484 | 3300048925 | Bacteria | 26064 |
| 849 | Ga0496122_0002744 | 3300048925 | Bacteria | 24327 |
| 850 | Ga0496122_0002932 | 3300048925 | Bacteria | 23269 |
| 851 | Ga0496122_0026354 | 3300048925 | Bacteria | 5014 |
| 852 | Ga0496123_0001272 | 3300048926 | Bacteria | 36131 |
| 853 | Ga0496123_0003115 | 3300048926 | Bacteria | 19022 |
| 854 | Ga0496123_0009457 | 3300048926 | Bacteria | 8774 |
| 855 | Ga0496123_0017586 | 3300048926 | Bacteria | 5741 |
| 856 | Ga0496123_0090996 | 3300048926 | Bacteria | 1811 |
| 857 | Ga0496123_0166632 | 3300048926 | Bacteria | 1167 |
| 858 | Ga0496123_0377356 | 3300048926 | Bacteria | 651 |
| 859 | Ga0496124_0006015 | 3300048927 | Bacteria | 13381 |
| 860 | Ga0496124_0035687 | 3300048927 | Bacteria | 4348 |
| 861 | Ga0496124_0099052 | 3300048927 | Bacteria | 2364 |
| 862 | Ga0496124_0174830 | 3300048927 | Bacteria | 1658 |
| 863 | Ga0496124_0228181 | 3300048927 | Bacteria | 1394 |
| 864 | Ga0496125_0000730 | 3300048928 | Bacteria | 54485 |
| 865 | Ga0496125_0033699 | 3300048928 | Bacteria | 4526 |
| 866 | Ga0496125_0056017 | 3300048928 | Bacteria | 3205 |
| 867 | Ga0496125_0395647 | 3300048928 | Bacteria | 809 |
| 868 | Ga0496126_0000041 | 3300048929 | Bacteria | 340389 |
| 869 | Ga0496126_0007482 | 3300048929 | Bacteria | 11964 |
| 870 | Ga0495682_0134769 | 3300049460 | Bacteria | 883 |
| 871 | Ga0501031_0130946 | 3300049568 | Bacteria | 1639 |
| 872 | Ga0501033_0683234 | 3300049570 | Bacteria | 699 |
| 873 | Ga0501034_0022938 | 3300049571 | Bacteria | 6359 |
| 874 | Ga0501034_0084595 | 3300049571 | Bacteria | 3174 |
| 875 | Ga0501034_0189465 | 3300049571 | Bacteria | 2019 |
| 876 | Ga0501034_0885834 | 3300049571 | Bacteria | 781 |
| 877 | Ga0501036_0027129 | 3300049572 | Bacteria | 4839 |
| 878 | Ga0501036_0283968 | 3300049572 | Bacteria | 1385 |
| 879 | Ga0501038_0012859 | 3300049574 | Bacteria | 7639 |
| 880 | Ga0501038_0017748 | 3300049574 | Bacteria | 6432 |
| 881 | Ga0501039_0008492 | 3300049575 | Bacteria | 7831 |
| 882 | Ga0501039_0783410 | 3300049575 | Bacteria | 744 |
| 883 | Ga0501040_0006764 | 3300049576 | Bacteria | 7438 |
| 884 | Ga0501042_0392672 | 3300049578 | Bacteria | 1005 |
| 885 | Ga0501043_0019073 | 3300049579 | Bacteria | 5385 |
| 886 | Ga0501047_0000729 | 3300049581 | Bacteria | 34190 |
| 887 | Ga0501047_0138935 | 3300049581 | Bacteria | 2308 |
| 888 | Ga0501047_0427836 | 3300049581 | Bacteria | 1155 |
| 889 | Ga0501048_0054879 | 3300049582 | Bacteria | 2830 |
| 890 | Ga0501048_0116574 | 3300049582 | Bacteria | 1887 |
| 891 | Ga0501067_0018170 | 3300049583 | Bacteria | 3894 |
| 892 | Ga0501068_0550340 | 3300049584 | Bacteria | 750 |
| 893 | Ga0501070_0955134 | 3300049586 | Bacteria | 666 |
| 894 | Ga0501071_0001878 | 3300049587 | Bacteria | 12472 |
| 895 | Ga0501072_0002415 | 3300049588 | Bacteria | 13996 |
| 896 | Ga0501072_0111146 | 3300049588 | Bacteria | 2181 |
| 897 | Ga0501073_0031702 | 3300049589 | Bacteria | 3771 |
| 898 | Ga0501073_0311097 | 3300049589 | Bacteria | 1087 |
| 899 | Ga0501073_0446177 | 3300049589 | Bacteria | 894 |
| 900 | Ga0501074_0038307 | 3300049590 | Bacteria | 3475 |
| 901 | Ga0501075_0000776 | 3300049591 | Bacteria | 19922 |
| 902 | Ga0501075_0004268 | 3300049591 | Bacteria | 9657 |
| 903 | Ga0501075_0245464 | 3300049591 | Bacteria | 1365 |
| 904 | Ga0501076_0004507 | 3300049592 | Bacteria | 9920 |
| 905 | Ga0501076_0206934 | 3300049592 | Bacteria | 1603 |
| 906 | Ga0501223_000997 | 3300049663 | Bacteria | 6698 |
| 907 | Ga0501224_000012 | 3300049664 | Bacteria | 92585 |
| 908 | Ga0501233_001789 | 3300049668 | Bacteria | 3719 |
| 909 | Ga0501235_002099 | 3300049669 | Bacteria | 4284 |
| 910 | Ga0501225_0000035 | 3300049705 | Bacteria | 46375 |
| 911 | Ga0501234_003699 | 3300049707 | Bacteria | 2404 |
| 912 | Ga0501079_0005158 | 3300049741 | Bacteria | 9711 |
| 913 | Ga0501080_0008721 | 3300049742 | Bacteria | 9208 |
| 914 | Ga0501081_0009562 | 3300049743 | Bacteria | 6321 |
| 915 | Ga0501083_0075082 | 3300049744 | Bacteria | 2245 |
| 916 | Ga0501035_0022734 | 3300049822 | Bacteria | 5759 |
| 917 | Ga0501035_0313230 | 3300049822 | Bacteria | 1320 |
| 918 | Ga0501044_0000608 | 3300049823 | Bacteria | 43410 |
| 919 | Ga0501044_0162231 | 3300049823 | Bacteria | 2211 |
| 920 | Ga0501044_0210285 | 3300049823 | Bacteria | 1900 |
| 921 | Ga0501045_0000920 | 3300049824 | Bacteria | 19221 |
| 922 | Ga0501226_000091 | 3300049853 | Bacteria | 23656 |
| 923 | nmdc:mga03683_24689_c1 | 3300050489 | Bacteria | 2354 |
| 924 | nmdc:mga03683_442_c1 | 3300050489 | Bacteria | 11972 |
| 925 | nmdc:mga00v17_1436_c2 | 3300050491 | Bacteria | 8289 |
| 926 | nmdc:mga00v17_4298_c1 | 3300050491 | Bacteria | 7397 |
| 927 | nmdc:mga00v17_4316_c1 | 3300050491 | Bacteria | 7385 |
| 928 | nmdc:mga0yw44_300128_c1 | 3300050492 | Bacteria | 1076 |
| 929 | nmdc:mga0yw44_5326_c1 | 3300050492 | Bacteria | 6053 |
| 930 | nmdc:mga0yw44_69494_c1 | 3300050492 | Bacteria | 2182 |
| 931 | nmdc:mga0k408_101603_c1 | 3300050493 | Bacteria | 1696 |
| 932 | nmdc:mga0k408_186578_c1 | 3300050493 | Bacteria | 1237 |
| 933 | nmdc:mga06z11_147_c1 | 3300050494 | Bacteria | 27767 |
| 934 | nmdc:mga06z11_83504_c1 | 3300050494 | Bacteria | 1719 |
| 935 | nmdc:mga04h51_24_c1 | 3300050495 | Bacteria | 59995 |
| 936 | nmdc:mga07m45_118996_c1 | 3300050496 | Bacteria | 1525 |
| 937 | nmdc:mga07m45_119180_c1 | 3300050496 | Bacteria | 1524 |
| 938 | nmdc:mga07m45_266835_c1 | 3300050496 | Bacteria | 996 |
| 939 | nmdc:mga07m45_31_c1 | 3300050496 | Bacteria | 81959 |
| 940 | nmdc:mga07m45_4597_c1 | 3300050496 | Bacteria | 6467 |
| 941 | nmdc:mga07m45_4_c1 | 3300050496 | Bacteria | 409607 |
| 942 | nmdc:mga05p37_498113_c1 | 3300050507 | Bacteria | 1399 |
| 943 | nmdc:mga06r32_1507377_c1 | 3300050510 | Bacteria | 612 |
| 944 | nmdc:mga0a205_386_c1 | 3300050515 | Bacteria | 33461 |
| 945 | nmdc:mga0sz30_160076_c1 | 3300050516 | Bacteria | 997 |
| 946 | nmdc:mga0sz30_6072_c1 | 3300050516 | Bacteria | 4469 |
| 947 | Ga0495601_0000057 | 3300053077 | Bacteria | 61510 |
| 948 | Ga0495601_0054073 | 3300053077 | Bacteria | 2539 |
| 949 | Ga0495601_0150345 | 3300053077 | Bacteria | 1520 |
| 950 | Ga0495655_0000578 | 3300053083 | Bacteria | 6031 |
| 951 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 952 | Ga0495595_0000130 | 3300053084 | Bacteria | 31250 |
| 953 | Ga0495595_0003783 | 3300053084 | Bacteria | 6021 |
| 954 | Ga0495619_0000010 | 3300053085 | Bacteria | 302390 |
| 955 | Ga0495619_0000144 | 3300053085 | Bacteria | 52554 |
| 956 | Ga0495619_0000146 | 3300053085 | Bacteria | 52136 |
| 957 | Ga0495619_0001050 | 3300053085 | Bacteria | 18097 |
| 958 | Ga0495619_0008902 | 3300053085 | Bacteria | 6340 |
| 959 | Ga0495619_0038268 | 3300053085 | Bacteria | 3129 |
| 960 | Ga0500643_000241 | 3300053087 | Bacteria | 50801 |
| 961 | Ga0500643_004098 | 3300053087 | Bacteria | 6716 |
| 962 | Ga0500651_0110789 | 3300053093 | Bacteria | 1675 |
| 963 | Ga0500566_0000943 | 3300053094 | Bacteria | 16679 |
| 964 | Ga0500566_0075934 | 3300053094 | Bacteria | 1879 |
| 965 | Ga0500641_0033015 | 3300053096 | Bacteria | 2051 |
| 966 | Ga0500641_0233121 | 3300053096 | Bacteria | 777 |
| 967 | Ga0500556_0184704 | 3300053104 | Bacteria | 824 |
| 968 | Ga0500562_006799 | 3300053108 | Bacteria | 2884 |
| 969 | Ga0500592_013598 | 3300053116 | Bacteria | 1305 |
| 970 | Ga0500595_001141 | 3300053119 | Bacteria | 14732 |
| 971 | Ga0500595_003373 | 3300053119 | Bacteria | 7481 |
| 972 | Ga0500595_037448 | 3300053119 | Bacteria | 1582 |
| 973 | Ga0500607_000042 | 3300053121 | Bacteria | 85000 |
| 974 | Ga0500607_001017 | 3300053121 | Bacteria | 26626 |
| 975 | Ga0500607_176261 | 3300053121 | Bacteria | 955 |
| 976 | Ga0500614_000630 | 3300053123 | Bacteria | 8976 |
| 977 | Ga0500618_001039 | 3300053125 | Bacteria | 13911 |
| 978 | Ga0500642_0001053 | 3300053130 | Bacteria | 7963 |
| 979 | Ga0500559_0000337 | 3300053136 | Bacteria | 35168 |
| 980 | Ga0500559_0004769 | 3300053136 | Bacteria | 6353 |
| 981 | Ga0500559_0105695 | 3300053136 | Bacteria | 1301 |
| 982 | Ga0500568_0008653 | 3300053139 | Bacteria | 4888 |
| 983 | Ga0500568_0092471 | 3300053139 | Bacteria | 1140 |
| 984 | Ga0500573_0000016 | 3300053140 | Bacteria | 182675 |
| 985 | Ga0500577_0105030 | 3300053142 | Bacteria | 1159 |
| 986 | Ga0500590_015737 | 3300053148 | Bacteria | 3906 |
| 987 | Ga0500604_0000078 | 3300053151 | Bacteria | 34635 |
| 988 | Ga0500604_0038496 | 3300053151 | Bacteria | 1435 |
| 989 | Ga0500616_0003477 | 3300053153 | Bacteria | 12001 |
| 990 | Ga0500616_0093290 | 3300053153 | Bacteria | 1486 |
| 991 | Ga0500619_028904 | 3300053154 | Bacteria | 1673 |
| 992 | Ga0500622_0001060 | 3300053156 | Bacteria | 22915 |
| 993 | Ga0500637_0015050 | 3300053178 | Bacteria | 4090 |
| 994 | Ga0500645_001601 | 3300053730 | Bacteria | 11250 |
| 995 | Ga0500645_006083 | 3300053730 | Bacteria | 4352 |
| 996 | Ga0500645_016146 | 3300053730 | Bacteria | 2356 |
| 997 | Ga0500645_069322 | 3300053730 | Bacteria | 1013 |
| 998 | Ga0500596_001728 | 3300053735 | Bacteria | 4425 |
| 999 | Ga0501084_0005800 | 3300054114 | Bacteria | 10160 |
| 1000 | Ga0501084_0103877 | 3300054114 | Bacteria | 2386 |
| 1001 | Ga0500661_020399 | 3300055283 | Bacteria | 1178 |
| 1002 | Ga0501082_0006081 | 3300060353 | Bacteria | 10477 |
| 1003 | Ga0466962_0000368 | 3300061719 | Bacteria | 19430 |
| 1004 | Ga0466962_0245570 | 3300061719 | Bacteria | 879 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048904 | Ga0496101_1220515 | Ga0496101_1220515_23_553 | 175 |
| 2 | 3300048921 | Ga0496118_0357561 | Ga0496118_0357561_22_552 | 175 |
| 3 | 3300048926 | Ga0496123_0377356 | Ga0496123_0377356_93_632 | 179 |
| 4 | 3300013307 | Ga0157372_11599357 | Ga0157372_115993572 | 180 |
| 5 | 3300025937 | Ga0207669_10083820 | Ga0207669_100838202 | 180 |
| 6 | 3300003203 | JGI25406J46586_10091182 | JGI25406J46586_100911821 | 181 |
| 7 | 3300005356 | Ga0070674_100000009 | Ga0070674_10000000930 | 181 |
| 8 | 3300005364 | Ga0070673_100017694 | Ga0070673_1000176943 | 181 |
| 9 | 3300005459 | Ga0068867_100268392 | Ga0068867_1002683922 | 181 |
| 10 | 3300005563 | Ga0068855_100499577 | Ga0068855_1004995772 | 181 |
| 11 | 3300005718 | Ga0068866_10000003 | Ga0068866_10000003112 | 181 |
| 12 | 3300005843 | Ga0068860_100007666 | Ga0068860_1000076666 | 181 |
| 13 | 3300005985 | Ga0081539_10075667 | Ga0081539_100756672 | 181 |
| 14 | 3300006038 | Ga0075365_10299861 | Ga0075365_102998612 | 181 |
| 15 | 3300006051 | Ga0075364_10001034 | Ga0075364_100010347 | 181 |
| 16 | 3300006871 | Ga0075434_100503424 | Ga0075434_1005034242 | 181 |
| 17 | 3300009147 | Ga0114129_10360147 | Ga0114129_103601472 | 181 |
| 18 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002364 | 181 |
| 19 | 3300025936 | Ga0207670_10211466 | Ga0207670_102114662 | 181 |
| 20 | 3300025937 | Ga0207669_10000001 | Ga0207669_10000001178 | 181 |
| 21 | 3300025960 | Ga0207651_10004579 | Ga0207651_100045796 | 181 |
| 22 | 3300026089 | Ga0207648_10021289 | Ga0207648_100212892 | 181 |
| 23 | 3300026118 | Ga0207675_100237065 | Ga0207675_1002370652 | 181 |
| 24 | 3300026121 | Ga0207683_10433437 | Ga0207683_104334372 | 181 |
| 25 | 3300028381 | Ga0268264_10000969 | Ga0268264_1000096928 | 181 |
| 26 | 3300046475 | Ga0495639_0265627 | Ga0495639_0265627_234_794 | 181 |
| 27 | 3300047469 | Ga0495673_0014313 | Ga0495673_0014313_1805_2362 | 181 |
| 28 | 3300048910 | Ga0496107_0132119 | Ga0496107_0132119_276_857 | 181 |
| 29 | 3300050491 | nmdc:mga00v17_4298_c1 | nmdc:mga00v17_4298_c1_591_1148 | 181 |
| 30 | 3300050492 | nmdc:mga0yw44_300128_c1 | nmdc:mga0yw44_300128_c1_396_956 | 181 |
| 31 | 3300050492 | nmdc:mga0yw44_5326_c1 | nmdc:mga0yw44_5326_c1_3467_4024 | 181 |
| 32 | 3300050507 | nmdc:mga05p37_498113_c1 | nmdc:mga05p37_498113_c1_680_1237 | 181 |
| 33 | 3300050510 | nmdc:mga06r32_1507377_c1 | nmdc:mga06r32_1507377_c1_45_602 | 181 |
| 34 | 3300005981 | Ga0081538_10000010 | Ga0081538_10000010132 | 182 |
| 35 | 3300006847 | Ga0075431_100316702 | Ga0075431_1003167022 | 182 |
| 36 | 3300017792 | Ga0163161_10404447 | Ga0163161_104044471 | 182 |
| 37 | 3300046455 | Ga0495603_0154788 | Ga0495603_0154788_363_926 | 182 |
| 38 | 3300046459 | Ga0495629_0030983 | Ga0495629_0030983_2264_2827 | 182 |
| 39 | 3300046462 | Ga0495651_0121028 | Ga0495651_0121028_1057_1620 | 182 |
| 40 | 3300046463 | Ga0495653_0077990 | Ga0495653_0077990_992_1555 | 182 |
| 41 | 3300048088 | Ga0495602_0001969 | Ga0495602_0001969_5049_5612 | 182 |
| 42 | 3300048911 | Ga0496108_0000232 | Ga0496108_0000232_41231_41794 | 182 |
| 43 | 3300048912 | Ga0496109_0000044 | Ga0496109_0000044_125139_125702 | 182 |
| 44 | 3300049592 | Ga0501076_0206934 | Ga0501076_0206934_592_1152 | 182 |
| 45 | 3300002239 | JGI24034J26672_10000172 | JGI24034J26672_100001723 | 183 |
| 46 | 3300005327 | Ga0070658_10572825 | Ga0070658_105728251 | 183 |
| 47 | 3300005334 | Ga0068869_100207623 | Ga0068869_1002076232 | 183 |
| 48 | 3300005334 | Ga0068869_100243015 | Ga0068869_1002430152 | 183 |
| 49 | 3300005337 | Ga0070682_100000011 | Ga0070682_100000011191 | 183 |
| 50 | 3300005439 | Ga0070711_100001969 | Ga0070711_1000019692 | 183 |
| 51 | 3300005547 | Ga0070693_100041268 | Ga0070693_1000412682 | 183 |
| 52 | 3300005578 | Ga0068854_100000333 | Ga0068854_10000033311 | 183 |
| 53 | 3300005841 | Ga0068863_100000779 | Ga0068863_10000077930 | 183 |
| 54 | 3300009093 | Ga0105240_10464232 | Ga0105240_104642322 | 183 |
| 55 | 3300009098 | Ga0105245_10034240 | Ga0105245_100342403 | 183 |
| 56 | 3300009176 | Ga0105242_10000062 | Ga0105242_1000006264 | 183 |
| 57 | 3300013105 | Ga0157369_10000014 | Ga0157369_10000014124 | 183 |
| 58 | 3300013296 | Ga0157374_10151378 | Ga0157374_101513783 | 183 |
| 59 | 3300013308 | Ga0157375_10000584 | Ga0157375_1000058417 | 183 |
| 60 | 3300014326 | Ga0157380_10001197 | Ga0157380_1000119717 | 183 |
| 61 | 3300014745 | Ga0157377_10611596 | Ga0157377_106115961 | 183 |
| 62 | 3300025913 | Ga0207695_10358896 | Ga0207695_103588962 | 183 |
| 63 | 3300025916 | Ga0207663_10199764 | Ga0207663_101997642 | 183 |
| 64 | 3300025927 | Ga0207687_10014513 | Ga0207687_100145135 | 183 |
| 65 | 3300025929 | Ga0207664_10575216 | Ga0207664_105752162 | 183 |
| 66 | 3300025934 | Ga0207686_10000231 | Ga0207686_1000023124 | 183 |
| 67 | 3300025939 | Ga0207665_10193561 | Ga0207665_101935612 | 183 |
| 68 | 3300025942 | Ga0207689_10290111 | Ga0207689_102901112 | 183 |
| 69 | 3300025942 | Ga0207689_10492263 | Ga0207689_104922632 | 183 |
| 70 | 3300025961 | Ga0207712_10507662 | Ga0207712_105076622 | 183 |
| 71 | 3300025981 | Ga0207640_10000110 | Ga0207640_1000011010 | 183 |
| 72 | 3300026075 | Ga0207708_10697040 | Ga0207708_106970402 | 183 |
| 73 | 3300026088 | Ga0207641_10000827 | Ga0207641_100008273 | 183 |
| 74 | 3300028556 | Ga0265337_1000955 | Ga0265337_10009554 | 183 |
| 75 | 3300028558 | Ga0265326_10000041 | Ga0265326_1000004178 | 183 |
| 76 | 3300028563 | Ga0265319_1000014 | Ga0265319_100001414 | 183 |
| 77 | 3300028654 | Ga0265322_10000004 | Ga0265322_1000000478 | 183 |
| 78 | 3300028800 | Ga0265338_10000185 | Ga0265338_1000018512 | 183 |
| 79 | 3300029957 | Ga0265324_10000266 | Ga0265324_1000026613 | 183 |
| 80 | 3300031239 | Ga0265328_10003945 | Ga0265328_100039453 | 183 |
| 81 | 3300031240 | Ga0265320_10000029 | Ga0265320_1000002977 | 183 |
| 82 | 3300031241 | Ga0265325_10031082 | Ga0265325_100310822 | 183 |
| 83 | 3300031242 | Ga0265329_10011465 | Ga0265329_100114654 | 183 |
| 84 | 3300031249 | Ga0265339_10024105 | Ga0265339_100241054 | 183 |
| 85 | 3300031250 | Ga0265331_10002379 | Ga0265331_100023795 | 183 |
| 86 | 3300031250 | Ga0265331_10064275 | Ga0265331_100642752 | 183 |
| 87 | 3300031251 | Ga0265327_10000015 | Ga0265327_1000001532 | 183 |
| 88 | 3300031344 | Ga0265316_10146252 | Ga0265316_101462522 | 183 |
| 89 | 3300031456 | Ga0307513_10111268 | Ga0307513_101112682 | 183 |
| 90 | 3300046455 | Ga0495603_0000033 | Ga0495603_0000033_49178_49741 | 183 |
| 91 | 3300046459 | Ga0495629_0013075 | Ga0495629_0013075_2289_2855 | 183 |
| 92 | 3300046459 | Ga0495629_0022727 | Ga0495629_0022727_2068_2634 | 183 |
| 93 | 3300046473 | Ga0495582_0000009 | Ga0495582_0000009_28386_28949 | 183 |
| 94 | 3300046511 | Ga0495608_0006939 | Ga0495608_0006939_3086_3649 | 183 |
| 95 | 3300046516 | Ga0495628_0295387 | Ga0495628_0295387_316_879 | 183 |
| 96 | 3300046523 | Ga0495644_0003638 | Ga0495644_0003638_5043_5606 | 183 |
| 97 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_28381_28944 | 183 |
| 98 | 3300046689 | Ga0495613_0067568 | Ga0495613_0067568_582_1157 | 183 |
| 99 | 3300047321 | Ga0495676_0081293 | Ga0495676_0081293_874_1437 | 183 |
| 100 | 3300048089 | Ga0495614_0026410 | Ga0495614_0026410_1762_2325 | 183 |
| 101 | 3300048905 | Ga0496102_0002490 | Ga0496102_0002490_5069_5632 | 183 |
| 102 | 3300048906 | Ga0496103_0000057 | Ga0496103_0000057_95820_96383 | 183 |
| 103 | 3300049591 | Ga0501075_0004268 | Ga0501075_0004268_4744_5307 | 183 |
| 104 | 3300053085 | Ga0495619_0000010 | Ga0495619_0000010_230159_230734 | 183 |
| 105 | 3300053094 | Ga0500566_0000943 | Ga0500566_0000943_11666_12232 | 183 |
| 106 | 3300001977 | JGI24746J21847_1001496 | JGI24746J21847_10014962 | 184 |
| 107 | 3300005365 | Ga0070688_100000277 | Ga0070688_10000027714 | 184 |
| 108 | 3300005365 | Ga0070688_100087858 | Ga0070688_1000878582 | 184 |
| 109 | 3300005366 | Ga0070659_100004173 | Ga0070659_1000041734 | 184 |
| 110 | 3300005435 | Ga0070714_100125748 | Ga0070714_1001257482 | 184 |
| 111 | 3300005436 | Ga0070713_100000058 | Ga0070713_10000005812 | 184 |
| 112 | 3300005439 | Ga0070711_100085494 | Ga0070711_1000854942 | 184 |
| 113 | 3300005466 | Ga0070685_10000013 | Ga0070685_10000013121 | 184 |
| 114 | 3300005471 | Ga0070698_100014541 | Ga0070698_1000145411 | 184 |
| 115 | 3300005614 | Ga0068856_100000237 | Ga0068856_10000023717 | 184 |
| 116 | 3300005614 | Ga0068856_100065400 | Ga0068856_1000654002 | 184 |
| 117 | 3300005616 | Ga0068852_100000002 | Ga0068852_10000000227 | 184 |
| 118 | 3300005834 | Ga0068851_10000126 | Ga0068851_1000012634 | 184 |
| 119 | 3300005842 | Ga0068858_100000069 | Ga0068858_10000006941 | 184 |
| 120 | 3300006881 | Ga0068865_100000042 | Ga0068865_10000004251 | 184 |
| 121 | 3300006914 | Ga0075436_100134099 | Ga0075436_1001340992 | 184 |
| 122 | 3300009098 | Ga0105245_10000104 | Ga0105245_1000010435 | 184 |
| 123 | 3300009177 | Ga0105248_10000175 | Ga0105248_1000017530 | 184 |
| 124 | 3300010375 | Ga0105239_10176381 | Ga0105239_101763812 | 184 |
| 125 | 3300010375 | Ga0105239_10331363 | Ga0105239_103313632 | 184 |
| 126 | 3300013102 | Ga0157371_10006328 | Ga0157371_100063286 | 184 |
| 127 | 3300013104 | Ga0157370_10041056 | Ga0157370_100410562 | 184 |
| 128 | 3300013296 | Ga0157374_10022241 | Ga0157374_100222412 | 184 |
| 129 | 3300013307 | Ga0157372_10000210 | Ga0157372_1000021025 | 184 |
| 130 | 3300017792 | Ga0163161_10000022 | Ga0163161_10000022159 | 184 |
| 131 | 3300025321 | Ga0207656_10000241 | Ga0207656_100002415 | 184 |
| 132 | 3300025916 | Ga0207663_10020089 | Ga0207663_100200894 | 184 |
| 133 | 3300025925 | Ga0207650_10347195 | Ga0207650_103471952 | 184 |
| 134 | 3300025927 | Ga0207687_10000015 | Ga0207687_10000015229 | 184 |
| 135 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003480 | 184 |
| 136 | 3300025932 | Ga0207690_10002915 | Ga0207690_100029155 | 184 |
| 137 | 3300025938 | Ga0207704_10000181 | Ga0207704_1000018116 | 184 |
| 138 | 3300025941 | Ga0207711_10000006 | Ga0207711_1000000653 | 184 |
| 139 | 3300026035 | Ga0207703_10000169 | Ga0207703_100001697 | 184 |
| 140 | 3300026078 | Ga0207702_10000251 | Ga0207702_1000025153 | 184 |
| 141 | 3300026078 | Ga0207702_10018324 | Ga0207702_100183244 | 184 |
| 142 | 3300026142 | Ga0207698_10000004 | Ga0207698_10000004258 | 184 |
| 143 | 3300030521 | Ga0307511_10058602 | Ga0307511_100586023 | 184 |
| 144 | 3300035172 | Ga0373955_0294863 | Ga0373955_0294863_114_680 | 184 |
| 145 | 3300036401 | Ga0373937_0026530 | Ga0373937_0026530_3756_4322 | 184 |
| 146 | 3300044694 | Ga0466963_0127592 | Ga0466963_0127592_658_1239 | 184 |
| 147 | 3300044842 | Ga0466957_0003429 | Ga0466957_0003429_8088_8651 | 184 |
| 148 | 3300044842 | Ga0466957_0030923 | Ga0466957_0030923_38_610 | 184 |
| 149 | 3300046454 | Ga0495592_0005546 | Ga0495592_0005546_514_1080 | 184 |
| 150 | 3300046454 | Ga0495592_0079544 | Ga0495592_0079544_568_1134 | 184 |
| 151 | 3300046454 | Ga0495592_0264117 | Ga0495592_0264117_511_1080 | 184 |
| 152 | 3300046459 | Ga0495629_0392763 | Ga0495629_0392763_138_704 | 184 |
| 153 | 3300046461 | Ga0495641_0000014 | Ga0495641_0000014_5063_5629 | 184 |
| 154 | 3300046462 | Ga0495651_0219648 | Ga0495651_0219648_437_1003 | 184 |
| 155 | 3300046476 | Ga0495662_0000698 | Ga0495662_0000698_8206_8772 | 184 |
| 156 | 3300046511 | Ga0495608_0000035 | Ga0495608_0000035_4050_4616 | 184 |
| 157 | 3300046511 | Ga0495608_0003187 | Ga0495608_0003187_3087_3653 | 184 |
| 158 | 3300046514 | Ga0495618_0000070 | Ga0495618_0000070_9669_10247 | 184 |
| 159 | 3300046516 | Ga0495628_0003299 | Ga0495628_0003299_10516_11082 | 184 |
| 160 | 3300046517 | Ga0495630_0055249 | Ga0495630_0055249_614_1180 | 184 |
| 161 | 3300046533 | Ga0495640_0017600 | Ga0495640_0017600_2861_3430 | 184 |
| 162 | 3300046535 | Ga0495586_0001457 | Ga0495586_0001457_5177_5743 | 184 |
| 163 | 3300046536 | Ga0495587_0019075 | Ga0495587_0019075_1577_2143 | 184 |
| 164 | 3300046559 | Ga0495667_0135739 | Ga0495667_0135739_221_799 | 184 |
| 165 | 3300046642 | Ga0495634_0090709 | Ga0495634_0090709_1083_1649 | 184 |
| 166 | 3300046663 | Ga0495635_0000057 | Ga0495635_0000057_62003_62569 | 184 |
| 167 | 3300046675 | Ga0495657_0000026 | Ga0495657_0000026_128396_128962 | 184 |
| 168 | 3300046675 | Ga0495657_0007638 | Ga0495657_0007638_2547_3113 | 184 |
| 169 | 3300046679 | Ga0495623_0196081 | Ga0495623_0196081_78_644 | 184 |
| 170 | 3300046681 | Ga0495647_0003964 | Ga0495647_0003964_2102_2668 | 184 |
| 171 | 3300046683 | Ga0495658_0001858 | Ga0495658_0001858_119_697 | 184 |
| 172 | 3300046689 | Ga0495613_0001530 | Ga0495613_0001530_1988_2554 | 184 |
| 173 | 3300046689 | Ga0495613_0002007 | Ga0495613_0002007_9718_10284 | 184 |
| 174 | 3300046691 | Ga0495670_0024563 | Ga0495670_0024563_1578_2144 | 184 |
| 175 | 3300046809 | Ga0495600_0004496 | Ga0495600_0004496_6951_7529 | 184 |
| 176 | 3300046809 | Ga0495600_0006263 | Ga0495600_0006263_4870_5436 | 184 |
| 177 | 3300047317 | Ga0495604_0000100 | Ga0495604_0000100_8490_9056 | 184 |
| 178 | 3300047317 | Ga0495604_0000305 | Ga0495604_0000305_22300_22866 | 184 |
| 179 | 3300047317 | Ga0495604_0064668 | Ga0495604_0064668_290_856 | 184 |
| 180 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_160578_161147 | 184 |
| 181 | 3300047322 | Ga0495680_0000312 | Ga0495680_0000312_48707_49273 | 184 |
| 182 | 3300047322 | Ga0495680_0027207 | Ga0495680_0027207_1330_1896 | 184 |
| 183 | 3300047444 | Ga0495675_0000015 | Ga0495675_0000015_128389_128955 | 184 |
| 184 | 3300047447 | Ga0495685_013985 | Ga0495685_013985_48_614 | 184 |
| 185 | 3300047673 | Ga0495593_0106453 | Ga0495593_0106453_829_1401 | 184 |
| 186 | 3300048088 | Ga0495602_0000227 | Ga0495602_0000227_37489_38055 | 184 |
| 187 | 3300048088 | Ga0495602_0015468 | Ga0495602_0015468_4351_4917 | 184 |
| 188 | 3300048907 | Ga0496104_0228883 | Ga0496104_0228883_258_824 | 184 |
| 189 | 3300048909 | Ga0496106_0000356 | Ga0496106_0000356_24778_25344 | 184 |
| 190 | 3300048910 | Ga0496107_0297851 | Ga0496107_0297851_315_881 | 184 |
| 191 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_118711_119304 | 184 |
| 192 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_415788_416381 | 184 |
| 193 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_145596_146162 | 184 |
| 194 | 3300049578 | Ga0501042_0392672 | Ga0501042_0392672_23_589 | 184 |
| 195 | 3300049591 | Ga0501075_0245464 | Ga0501075_0245464_699_1265 | 184 |
| 196 | 3300053077 | Ga0495601_0000057 | Ga0495601_0000057_15045_15611 | 184 |
| 197 | 3300053083 | Ga0495655_0000578 | Ga0495655_0000578_1281_1847 | 184 |
| 198 | 3300053084 | Ga0495595_0000017 | Ga0495595_0000017_128396_128962 | 184 |
| 199 | 3300053084 | Ga0495595_0000130 | Ga0495595_0000130_19215_19781 | 184 |
| 200 | 3300053084 | Ga0495595_0003783 | Ga0495595_0003783_1690_2256 | 184 |
| 201 | 3300053085 | Ga0495619_0000144 | Ga0495619_0000144_49272_49844 | 184 |
| 202 | 3300053085 | Ga0495619_0000146 | Ga0495619_0000146_8322_8888 | 184 |
| 203 | 3300053085 | Ga0495619_0001050 | Ga0495619_0001050_13482_14048 | 184 |
| 204 | 3300053085 | Ga0495619_0008902 | Ga0495619_0008902_4846_5412 | 184 |
| 205 | 3300053123 | Ga0500614_000630 | Ga0500614_000630_3230_3796 | 184 |
| 206 | iso_pu_bacteria | 8057101203 | 8057105706 | 184 |
| 207 | 3300003373 | JGI25407J50210_10000517 | JGI25407J50210_100005174 | 185 |
| 208 | 3300005356 | Ga0070674_100000002 | Ga0070674_100000002154 | 185 |
| 209 | 3300005564 | Ga0070664_100553453 | Ga0070664_1005534532 | 185 |
| 210 | 3300005618 | Ga0068864_100000015 | Ga0068864_10000001527 | 185 |
| 211 | 3300005718 | Ga0068866_10003702 | Ga0068866_100037027 | 185 |
| 212 | 3300005981 | Ga0081538_10000346 | Ga0081538_1000034623 | 185 |
| 213 | 3300009148 | Ga0105243_10200088 | Ga0105243_102000882 | 185 |
| 214 | 3300009148 | Ga0105243_10460174 | Ga0105243_104601742 | 185 |
| 215 | 3300010375 | Ga0105239_10840722 | Ga0105239_108407222 | 185 |
| 216 | 3300013296 | Ga0157374_10568412 | Ga0157374_105684121 | 185 |
| 217 | 3300014326 | Ga0157380_10261429 | Ga0157380_102614292 | 185 |
| 218 | 3300014969 | Ga0157376_10057248 | Ga0157376_100572484 | 185 |
| 219 | 3300025899 | Ga0207642_10002221 | Ga0207642_100022212 | 185 |
| 220 | 3300025933 | Ga0207706_10371749 | Ga0207706_103717491 | 185 |
| 221 | 3300025934 | Ga0207686_10178462 | Ga0207686_101784622 | 185 |
| 222 | 3300025935 | Ga0207709_10077005 | Ga0207709_100770053 | 185 |
| 223 | 3300025935 | Ga0207709_10381789 | Ga0207709_103817891 | 185 |
| 224 | 3300025937 | Ga0207669_10000003 | Ga0207669_10000003140 | 185 |
| 225 | 3300025945 | Ga0207679_10661697 | Ga0207679_106616972 | 185 |
| 226 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018273 | 185 |
| 227 | 3300044694 | Ga0466963_0081189 | Ga0466963_0081189_202_807 | 185 |
| 228 | 3300044712 | Ga0453684_0444889 | Ga0453684_0444889_530_1111 | 185 |
| 229 | 3300046514 | Ga0495618_0409114 | Ga0495618_0409114_38_616 | 185 |
| 230 | 3300046642 | Ga0495634_0000216 | Ga0495634_0000216_36029_36607 | 185 |
| 231 | 3300047317 | Ga0495604_0534047 | Ga0495604_0534047_77_655 | 185 |
| 232 | 3300048913 | Ga0496110_0000357 | Ga0496110_0000357_5022_5597 | 185 |
| 233 | 3300048913 | Ga0496110_1233306 | Ga0496110_1233306_39_605 | 185 |
| 234 | 3300048914 | Ga0496111_0000735 | Ga0496111_0000735_11845_12420 | 185 |
| 235 | 3300049570 | Ga0501033_0683234 | Ga0501033_0683234_54_629 | 185 |
| 236 | 3300049572 | Ga0501036_0283968 | Ga0501036_0283968_741_1313 | 185 |
| 237 | 3300049589 | Ga0501073_0446177 | Ga0501073_0446177_254_829 | 185 |
| 238 | 3300049822 | Ga0501035_0313230 | Ga0501035_0313230_344_919 | 185 |
| 239 | 3300005364 | Ga0070673_100515654 | Ga0070673_1005156542 | 186 |
| 240 | 3300005544 | Ga0070686_100385169 | Ga0070686_1003851692 | 186 |
| 241 | 3300005842 | Ga0068858_100009846 | Ga0068858_10000984610 | 186 |
| 242 | 3300005843 | Ga0068860_100579238 | Ga0068860_1005792381 | 186 |
| 243 | 3300025903 | Ga0207680_10374110 | Ga0207680_103741102 | 186 |
| 244 | 3300026035 | Ga0207703_10059475 | Ga0207703_100594754 | 186 |
| 245 | 3300028381 | Ga0268264_10367534 | Ga0268264_103675342 | 186 |
| 246 | 3300046455 | Ga0495603_0002227 | Ga0495603_0002227_9669_10280 | 186 |
| 247 | 3300046680 | Ga0495646_0420645 | Ga0495646_0420645_66_677 | 186 |
| 248 | 3300048911 | Ga0496108_0013086 | Ga0496108_0013086_3981_4589 | 186 |
| 249 | 3300048916 | Ga0496113_0087825 | Ga0496113_0087825_321_929 | 186 |
| 250 | 3300053085 | Ga0495619_0038268 | Ga0495619_0038268_66_641 | 186 |
| 251 | 3300035172 | Ga0373955_0404059 | Ga0373955_0404059_156_734 | 187 |
| 252 | 3300044842 | Ga0466957_0225348 | Ga0466957_0225348_284_862 | 187 |
| 253 | 3300049586 | Ga0501070_0955134 | Ga0501070_0955134_18_599 | 187 |
| 254 | 3300005435 | Ga0070714_100149575 | Ga0070714_1001495751 | 188 |
| 255 | 3300005548 | Ga0070665_100123072 | Ga0070665_1001230722 | 188 |
| 256 | 3300028379 | Ga0268266_10264713 | Ga0268266_102647132 | 188 |
| 257 | 3300031239 | Ga0265328_10105398 | Ga0265328_101053982 | 188 |
| 258 | 3300031240 | Ga0265320_10263661 | Ga0265320_102636612 | 188 |
| 259 | 3300031711 | Ga0265314_10014685 | Ga0265314_100146855 | 188 |
| 260 | 3300042876 | Ga0451577_0139182 | Ga0451577_0139182_72_665 | 188 |
| 261 | 3300042876 | Ga0451577_0285439 | Ga0451577_0285439_139_765 | 188 |
| 262 | 3300042876 | Ga0451577_0723991 | Ga0451577_0723991_75_668 | 188 |
| 263 | 3300042876 | Ga0451577_0758000 | Ga0451577_0758000_245_838 | 188 |
| 264 | 3300044712 | Ga0453684_0048400 | Ga0453684_0048400_1828_2421 | 188 |
| 265 | 3300044712 | Ga0453684_0435864 | Ga0453684_0435864_469_1062 | 188 |
| 266 | 3300053077 | Ga0495601_0054073 | Ga0495601_0054073_437_1021 | 188 |
| 267 | 3300026075 | Ga0207708_11050470 | Ga0207708_110504701 | 189 |
| 268 | 3300049572 | Ga0501036_0027129 | Ga0501036_0027129_333_944 | 189 |
| 269 | 3300049574 | Ga0501038_0017748 | Ga0501038_0017748_3898_4509 | 189 |
| 270 | 3300049575 | Ga0501039_0008492 | Ga0501039_0008492_2096_2707 | 189 |
| 271 | 3300049576 | Ga0501040_0006764 | Ga0501040_0006764_454_1065 | 189 |
| 272 | 3300049582 | Ga0501048_0054879 | Ga0501048_0054879_1098_1709 | 189 |
| 273 | 3300049583 | Ga0501067_0018170 | Ga0501067_0018170_37_618 | 189 |
| 274 | 3300049584 | Ga0501068_0550340 | Ga0501068_0550340_50_661 | 189 |
| 275 | 3300049587 | Ga0501071_0001878 | Ga0501071_0001878_4792_5403 | 189 |
| 276 | 3300049588 | Ga0501072_0002415 | Ga0501072_0002415_2001_2612 | 189 |
| 277 | 3300049588 | Ga0501072_0111146 | Ga0501072_0111146_1171_1752 | 189 |
| 278 | 3300049589 | Ga0501073_0031702 | Ga0501073_0031702_2876_3457 | 189 |
| 279 | 3300049590 | Ga0501074_0038307 | Ga0501074_0038307_1982_2563 | 189 |
| 280 | 3300049591 | Ga0501075_0000776 | Ga0501075_0000776_5252_5863 | 189 |
| 281 | 3300049592 | Ga0501076_0004507 | Ga0501076_0004507_3376_3987 | 189 |
| 282 | 3300049741 | Ga0501079_0005158 | Ga0501079_0005158_3248_3859 | 189 |
| 283 | 3300049742 | Ga0501080_0008721 | Ga0501080_0008721_7486_8067 | 189 |
| 284 | 3300049743 | Ga0501081_0009562 | Ga0501081_0009562_554_1165 | 189 |
| 285 | 3300049744 | Ga0501083_0075082 | Ga0501083_0075082_1561_2142 | 189 |
| 286 | 3300049822 | Ga0501035_0022734 | Ga0501035_0022734_1312_1923 | 189 |
| 287 | 3300049824 | Ga0501045_0000920 | Ga0501045_0000920_13547_14158 | 189 |
| 288 | 3300054114 | Ga0501084_0005800 | Ga0501084_0005800_5417_6028 | 189 |
| 289 | 3300054114 | Ga0501084_0103877 | Ga0501084_0103877_1437_2018 | 189 |
| 290 | 3300060353 | Ga0501082_0006081 | Ga0501082_0006081_5981_6562 | 189 |
| 291 | iso_pu_bacteria | 2643221563 | 2643835823 | 189 |
| 292 | iso_pu_bacteria | 2643221608 | 2644056749 | 189 |
| 293 | iso_pu_bacteria | 2852653556 | 2852655109 | 189 |
| 294 | iso_pu_bacteria | 2852680915 | 2852681332 | 189 |
| 295 | iso_pu_bacteria | 2738541275 | 2738711889 | 190 |
| 296 | iso_pu_bacteria | 2738541301 | 2738850314 | 190 |
| 297 | iso_pu_bacteria | 2738541304 | 2738866043 | 190 |
| 298 | iso_pu_bacteria | 2738543022 | 2739298561 | 190 |
| 299 | iso_pu_bacteria | 2738543033 | 2739360239 | 190 |
| 300 | iso_pu_bacteria | 2818991466 | 2819712427 | 190 |
| 301 | iso_pu_bacteria | 2879163058 | 2879164447 | 190 |
| 302 | iso_pu_bacteria | 2882806704 | 2882807698 | 190 |
| 303 | iso_pu_bacteria | 2885429604 | 2885429854 | 190 |
| 304 | iso_pu_bacteria | 2895880812 | 2895886337 | 190 |
| 305 | iso_pu_bacteria | 2928100450 | 2928101528 | 190 |
| 306 | iso_pu_bacteria | 2928526807 | 2928526937 | 190 |
| 307 | iso_pu_bacteria | 2928959182 | 2928959619 | 190 |
| 308 | iso_pu_bacteria | 3000865235 | 3000866155 | 190 |
| 309 | 3300006852 | Ga0075433_10001805 | Ga0075433_1000180518 | 191 |
| 310 | 3300032004 | Ga0307414_10341942 | Ga0307414_103419422 | 191 |
| 311 | 3300032005 | Ga0307411_10234335 | Ga0307411_102343352 | 191 |
| 312 | 3300046663 | Ga0495635_0444378 | Ga0495635_0444378_107_745 | 191 |
| 313 | 3300050515 | nmdc:mga0a205_386_c1 | nmdc:mga0a205_386_c1_1683_2294 | 191 |
| 314 | 3300005563 | Ga0068855_100078599 | Ga0068855_1000785994 | 192 |
| 315 | 3300013306 | Ga0163162_11026964 | Ga0163162_110269642 | 192 |
| 316 | 3300053096 | Ga0500641_0233121 | Ga0500641_0233121_84_674 | 192 |
| 317 | 3300053108 | Ga0500562_006799 | Ga0500562_006799_799_1389 | 192 |
| 318 | 3300003781 | Ga0055536_1001024 | Ga0055536_10010246 | 193 |
| 319 | 3300003781 | Ga0055536_1003233 | Ga0055536_10032335 | 193 |
| 320 | 3300003781 | Ga0055536_1010161 | Ga0055536_10101612 | 193 |
| 321 | 3300003784 | Ga0055534_1020141 | Ga0055534_10201411 | 193 |
| 322 | 3300003791 | Ga0055530_10000013 | Ga0055530_10000013104 | 193 |
| 323 | 3300003794 | Ga0055531_10000627 | Ga0055531_1000062725 | 193 |
| 324 | 3300003794 | Ga0055531_10001679 | Ga0055531_100016799 | 193 |
| 325 | 3300005563 | Ga0068855_100286895 | Ga0068855_1002868952 | 193 |
| 326 | 3300005834 | Ga0068851_10308140 | Ga0068851_103081402 | 193 |
| 327 | 3300009148 | Ga0105243_10140427 | Ga0105243_101404272 | 193 |
| 328 | 3300025291 | Ga0209675_1000808 | Ga0209675_100080821 | 193 |
| 329 | 3300025292 | Ga0209676_1000221 | Ga0209676_1000221102 | 193 |
| 330 | 3300025292 | Ga0209676_1000453 | Ga0209676_100045350 | 193 |
| 331 | 3300025292 | Ga0209676_1001826 | Ga0209676_100182613 | 193 |
| 332 | 3300025294 | Ga0209025_1008523 | Ga0209025_10085237 | 193 |
| 333 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042285 | 193 |
| 334 | 3300025298 | Ga0209050_1005032 | Ga0209050_10050323 | 193 |
| 335 | 3300025298 | Ga0209050_1031450 | Ga0209050_10314502 | 193 |
| 336 | 3300025304 | Ga0209257_1000135 | Ga0209257_1000135102 | 193 |
| 337 | 3300025304 | Ga0209257_1000487 | Ga0209257_100048739 | 193 |
| 338 | 3300025304 | Ga0209257_1006386 | Ga0209257_10063862 | 193 |
| 339 | 3300025949 | Ga0207667_10203211 | Ga0207667_102032112 | 193 |
| 340 | 3300031616 | Ga0307508_10121828 | Ga0307508_101218282 | 193 |
| 341 | 3300031901 | Ga0307406_11093672 | Ga0307406_110936721 | 193 |
| 342 | 3300031911 | Ga0307412_10088082 | Ga0307412_100880822 | 193 |
| 343 | 3300032004 | Ga0307414_10095806 | Ga0307414_100958062 | 193 |
| 344 | 3300032004 | Ga0307414_10143954 | Ga0307414_101439542 | 193 |
| 345 | 3300032004 | Ga0307414_11229039 | Ga0307414_112290391 | 193 |
| 346 | 3300044658 | Ga0466972_0000559 | Ga0466972_0000559_2933_3520 | 193 |
| 347 | 3300044693 | Ga0466961_0020191 | Ga0466961_0020191_26_613 | 193 |
| 348 | 3300044694 | Ga0466963_0003840 | Ga0466963_0003840_3816_4403 | 193 |
| 349 | 3300044706 | Ga0466964_0002332 | Ga0466964_0002332_34_621 | 193 |
| 350 | 3300044712 | Ga0453684_0107494 | Ga0453684_0107494_833_1417 | 193 |
| 351 | 3300044719 | Ga0466971_0000456 | Ga0466971_0000456_6256_6843 | 193 |
| 352 | 3300044735 | Ga0466968_0031684 | Ga0466968_0031684_797_1396 | 193 |
| 353 | 3300044765 | Ga0466970_0170830 | Ga0466970_0170830_73_660 | 193 |
| 354 | 3300044842 | Ga0466957_0004680 | Ga0466957_0004680_2129_2716 | 193 |
| 355 | 3300044901 | Ga0466960_0016084 | Ga0466960_0016084_2161_2763 | 193 |
| 356 | 3300045049 | Ga0466959_0082513 | Ga0466959_0082513_306_893 | 193 |
| 357 | 3300045836 | Ga0466958_0009712 | Ga0466958_0009712_4381_4968 | 193 |
| 358 | 3300045976 | Ga0466967_0041410 | Ga0466967_0041410_1151_1738 | 193 |
| 359 | 3300046500 | Ga0495596_0090126 | Ga0495596_0090126_415_1005 | 193 |
| 360 | 3300046522 | Ga0495643_0044416 | Ga0495643_0044416_1044_1634 | 193 |
| 361 | 3300046660 | Ga0495625_0001272 | Ga0495625_0001272_28619_29209 | 193 |
| 362 | 3300048906 | Ga0496103_0153583 | Ga0496103_0153583_487_1071 | 193 |
| 363 | 3300049571 | Ga0501034_0022938 | Ga0501034_0022938_3822_4412 | 193 |
| 364 | 3300049574 | Ga0501038_0012859 | Ga0501038_0012859_4072_4662 | 193 |
| 365 | 3300049579 | Ga0501043_0019073 | Ga0501043_0019073_1214_1804 | 193 |
| 366 | 3300049582 | Ga0501048_0116574 | Ga0501048_0116574_945_1535 | 193 |
| 367 | 3300049823 | Ga0501044_0210285 | Ga0501044_0210285_510_1094 | 193 |
| 368 | 3300061719 | Ga0466962_0000368 | Ga0466962_0000368_16175_16762 | 193 |
| 369 | iso_pu_bacteria | 2919138771 | 2919139687 | 193 |
| 370 | 3300001915 | JGI24741J21665_1009947 | JGI24741J21665_10099472 | 194 |
| 371 | 3300001979 | JGI24740J21852_10112164 | JGI24740J21852_101121641 | 194 |
| 372 | 3300001989 | JGI24739J22299_10005219 | JGI24739J22299_100052195 | 194 |
| 373 | 3300001989 | JGI24739J22299_10025799 | JGI24739J22299_100257993 | 194 |
| 374 | 3300001989 | JGI24739J22299_10061099 | JGI24739J22299_100610992 | 194 |
| 375 | 3300001990 | JGI24737J22298_10003186 | JGI24737J22298_100031865 | 194 |
| 376 | 3300001990 | JGI24737J22298_10005631 | JGI24737J22298_100056316 | 194 |
| 377 | 3300001990 | JGI24737J22298_10011515 | JGI24737J22298_100115154 | 194 |
| 378 | 3300001990 | JGI24737J22298_10016864 | JGI24737J22298_100168642 | 194 |
| 379 | 3300001990 | JGI24737J22298_10032429 | JGI24737J22298_100324292 | 194 |
| 380 | 3300001990 | JGI24737J22298_10050299 | JGI24737J22298_100502992 | 194 |
| 381 | 3300001990 | JGI24737J22298_10131621 | JGI24737J22298_101316212 | 194 |
| 382 | 3300001991 | JGI24743J22301_10021842 | JGI24743J22301_100218422 | 194 |
| 383 | 3300002067 | JGI24735J21928_10001921 | JGI24735J21928_100019213 | 194 |
| 384 | 3300002067 | JGI24735J21928_10026342 | JGI24735J21928_100263422 | 194 |
| 385 | 3300002067 | JGI24735J21928_10030054 | JGI24735J21928_100300542 | 194 |
| 386 | 3300002067 | JGI24735J21928_10030869 | JGI24735J21928_100308693 | 194 |
| 387 | 3300002067 | JGI24735J21928_10058391 | JGI24735J21928_100583911 | 194 |
| 388 | 3300002067 | JGI24735J21928_10060479 | JGI24735J21928_100604792 | 194 |
| 389 | 3300002075 | JGI24738J21930_10000848 | JGI24738J21930_100008489 | 194 |
| 390 | 3300002075 | JGI24738J21930_10004277 | JGI24738J21930_100042774 | 194 |
| 391 | 3300002075 | JGI24738J21930_10020148 | JGI24738J21930_100201483 | 194 |
| 392 | 3300002077 | JGI24744J21845_10000444 | JGI24744J21845_100004444 | 194 |
| 393 | 3300002239 | JGI24034J26672_10039456 | JGI24034J26672_100394562 | 194 |
| 394 | 3300002244 | JGI24742J22300_10023398 | JGI24742J22300_100233981 | 194 |
| 395 | 3300002772 | JGI25164J39214_1010460 | JGI25164J39214_10104601 | 194 |
| 396 | 3300003214 | JGI25165J46597_1000040 | JGI25165J46597_100004072 | 194 |
| 397 | 3300003214 | JGI25165J46597_1000089 | JGI25165J46597_100008935 | 194 |
| 398 | 3300003215 | JGI25153J46596_10000002 | JGI25153J46596_10000002508 | 194 |
| 399 | 3300003759 | Ga0055525_1000051 | Ga0055525_100005111 | 194 |
| 400 | 3300003762 | Ga0055542_1000020 | Ga0055542_1000020128 | 194 |
| 401 | 3300003762 | Ga0055542_1002673 | Ga0055542_10026732 | 194 |
| 402 | 3300003763 | Ga0055529_1000016 | Ga0055529_1000016219 | 194 |
| 403 | 3300003791 | Ga0055530_10000901 | Ga0055530_1000090114 | 194 |
| 404 | 3300003794 | Ga0055531_10000583 | Ga0055531_1000058314 | 194 |
| 405 | 3300005262 | Ga0065165_1002265 | Ga0065165_10022652 | 194 |
| 406 | 3300005288 | Ga0065714_10162484 | Ga0065714_101624842 | 194 |
| 407 | 3300005289 | Ga0065704_10128058 | Ga0065704_101280582 | 194 |
| 408 | 3300005295 | Ga0065707_10084488 | Ga0065707_100844887 | 194 |
| 409 | 3300005327 | Ga0070658_10000022 | Ga0070658_10000022118 | 194 |
| 410 | 3300005327 | Ga0070658_10001598 | Ga0070658_1000159812 | 194 |
| 411 | 3300005327 | Ga0070658_10006112 | Ga0070658_100061127 | 194 |
| 412 | 3300005327 | Ga0070658_10078427 | Ga0070658_100784273 | 194 |
| 413 | 3300005327 | Ga0070658_10252945 | Ga0070658_102529452 | 194 |
| 414 | 3300005328 | Ga0070676_10000855 | Ga0070676_1000085518 | 194 |
| 415 | 3300005329 | Ga0070683_100810431 | Ga0070683_1008104312 | 194 |
| 416 | 3300005329 | Ga0070683_101074809 | Ga0070683_1010748091 | 194 |
| 417 | 3300005334 | Ga0068869_100000031 | Ga0068869_10000003137 | 194 |
| 418 | 3300005336 | Ga0070680_100004842 | Ga0070680_1000048429 | 194 |
| 419 | 3300005338 | Ga0068868_100000060 | Ga0068868_10000006026 | 194 |
| 420 | 3300005339 | Ga0070660_100000568 | Ga0070660_1000005686 | 194 |
| 421 | 3300005339 | Ga0070660_100000801 | Ga0070660_10000080125 | 194 |
| 422 | 3300005339 | Ga0070660_100005160 | Ga0070660_1000051606 | 194 |
| 423 | 3300005339 | Ga0070660_100297948 | Ga0070660_1002979481 | 194 |
| 424 | 3300005344 | Ga0070661_100010440 | Ga0070661_1000104403 | 194 |
| 425 | 3300005344 | Ga0070661_100239357 | Ga0070661_1002393571 | 194 |
| 426 | 3300005344 | Ga0070661_100398497 | Ga0070661_1003984972 | 194 |
| 427 | 3300005347 | Ga0070668_100031585 | Ga0070668_1000315854 | 194 |
| 428 | 3300005353 | Ga0070669_100270249 | Ga0070669_1002702492 | 194 |
| 429 | 3300005354 | Ga0070675_100006017 | Ga0070675_1000060175 | 194 |
| 430 | 3300005354 | Ga0070675_100181892 | Ga0070675_1001818923 | 194 |
| 431 | 3300005355 | Ga0070671_100090815 | Ga0070671_1000908154 | 194 |
| 432 | 3300005356 | Ga0070674_100000740 | Ga0070674_10000074013 | 194 |
| 433 | 3300005356 | Ga0070674_100088635 | Ga0070674_1000886353 | 194 |
| 434 | 3300005356 | Ga0070674_100166219 | Ga0070674_1001662192 | 194 |
| 435 | 3300005356 | Ga0070674_100861137 | Ga0070674_1008611371 | 194 |
| 436 | 3300005364 | Ga0070673_100000009 | Ga0070673_10000000926 | 194 |
| 437 | 3300005364 | Ga0070673_100693518 | Ga0070673_1006935182 | 194 |
| 438 | 3300005366 | Ga0070659_100064395 | Ga0070659_1000643953 | 194 |
| 439 | 3300005366 | Ga0070659_100217275 | Ga0070659_1002172752 | 194 |
| 440 | 3300005366 | Ga0070659_100549290 | Ga0070659_1005492902 | 194 |
| 441 | 3300005367 | Ga0070667_100032672 | Ga0070667_1000326722 | 194 |
| 442 | 3300005445 | Ga0070708_100001562 | Ga0070708_10000156218 | 194 |
| 443 | 3300005455 | Ga0070663_100025418 | Ga0070663_1000254184 | 194 |
| 444 | 3300005456 | Ga0070678_100000011 | Ga0070678_10000001161 | 194 |
| 445 | 3300005456 | Ga0070678_100001799 | Ga0070678_1000017995 | 194 |
| 446 | 3300005457 | Ga0070662_100000708 | Ga0070662_1000007086 | 194 |
| 447 | 3300005457 | Ga0070662_100045764 | Ga0070662_1000457644 | 194 |
| 448 | 3300005457 | Ga0070662_100107871 | Ga0070662_1001078712 | 194 |
| 449 | 3300005458 | Ga0070681_10073045 | Ga0070681_100730454 | 194 |
| 450 | 3300005459 | Ga0068867_100000165 | Ga0068867_10000016513 | 194 |
| 451 | 3300005459 | Ga0068867_100812205 | Ga0068867_1008122052 | 194 |
| 452 | 3300005471 | Ga0070698_100561687 | Ga0070698_1005616871 | 194 |
| 453 | 3300005530 | Ga0070679_100140718 | Ga0070679_1001407183 | 194 |
| 454 | 3300005539 | Ga0068853_100000428 | Ga0068853_10000042815 | 194 |
| 455 | 3300005539 | Ga0068853_100013891 | Ga0068853_1000138916 | 194 |
| 456 | 3300005539 | Ga0068853_100060896 | Ga0068853_1000608962 | 194 |
| 457 | 3300005539 | Ga0068853_100377295 | Ga0068853_1003772952 | 194 |
| 458 | 3300005539 | Ga0068853_100404301 | Ga0068853_1004043012 | 194 |
| 459 | 3300005548 | Ga0070665_100013086 | Ga0070665_1000130863 | 194 |
| 460 | 3300005563 | Ga0068855_100000371 | Ga0068855_10000037126 | 194 |
| 461 | 3300005563 | Ga0068855_100004395 | Ga0068855_1000043955 | 194 |
| 462 | 3300005563 | Ga0068855_100076067 | Ga0068855_1000760673 | 194 |
| 463 | 3300005563 | Ga0068855_100163605 | Ga0068855_1001636052 | 194 |
| 464 | 3300005563 | Ga0068855_100501590 | Ga0068855_1005015902 | 194 |
| 465 | 3300005564 | Ga0070664_100018632 | Ga0070664_1000186325 | 194 |
| 466 | 3300005577 | Ga0068857_100006008 | Ga0068857_10000600811 | 194 |
| 467 | 3300005577 | Ga0068857_100128132 | Ga0068857_1001281322 | 194 |
| 468 | 3300005578 | Ga0068854_100001819 | Ga0068854_1000018196 | 194 |
| 469 | 3300005578 | Ga0068854_100026592 | Ga0068854_1000265924 | 194 |
| 470 | 3300005614 | Ga0068856_100016235 | Ga0068856_1000162356 | 194 |
| 471 | 3300005614 | Ga0068856_100026512 | Ga0068856_1000265125 | 194 |
| 472 | 3300005616 | Ga0068852_100001240 | Ga0068852_1000012403 | 194 |
| 473 | 3300005617 | Ga0068859_100971900 | Ga0068859_1009719002 | 194 |
| 474 | 3300005618 | Ga0068864_100006060 | Ga0068864_1000060604 | 194 |
| 475 | 3300005834 | Ga0068851_10012377 | Ga0068851_100123773 | 194 |
| 476 | 3300005841 | Ga0068863_100001344 | Ga0068863_1000013448 | 194 |
| 477 | 3300005842 | Ga0068858_100001528 | Ga0068858_1000015287 | 194 |
| 478 | 3300005842 | Ga0068858_100023504 | Ga0068858_1000235045 | 194 |
| 479 | 3300005843 | Ga0068860_100000008 | Ga0068860_100000008184 | 194 |
| 480 | 3300005843 | Ga0068860_100001200 | Ga0068860_10000120019 | 194 |
| 481 | 3300005843 | Ga0068860_100001714 | Ga0068860_10000171413 | 194 |
| 482 | 3300005843 | Ga0068860_100108660 | Ga0068860_1001086603 | 194 |
| 483 | 3300005844 | Ga0068862_100000067 | Ga0068862_100000067127 | 194 |
| 484 | 3300005983 | Ga0081540_1080044 | Ga0081540_10800442 | 194 |
| 485 | 3300006038 | Ga0075365_10062021 | Ga0075365_100620212 | 194 |
| 486 | 3300006048 | Ga0075363_100016646 | Ga0075363_1000166462 | 194 |
| 487 | 3300006051 | Ga0075364_10004936 | Ga0075364_100049362 | 194 |
| 488 | 3300006058 | Ga0075432_10000049 | Ga0075432_100000497 | 194 |
| 489 | 3300006177 | Ga0075362_10027008 | Ga0075362_100270082 | 194 |
| 490 | 3300006177 | Ga0075362_10064391 | Ga0075362_100643912 | 194 |
| 491 | 3300006178 | Ga0075367_10027653 | Ga0075367_100276532 | 194 |
| 492 | 3300006178 | Ga0075367_10106389 | Ga0075367_101063892 | 194 |
| 493 | 3300006186 | Ga0075369_10041906 | Ga0075369_100419062 | 194 |
| 494 | 3300006237 | Ga0097621_100014855 | Ga0097621_1000148555 | 194 |
| 495 | 3300006237 | Ga0097621_100414609 | Ga0097621_1004146091 | 194 |
| 496 | 3300006353 | Ga0075370_10000025 | Ga0075370_1000002529 | 194 |
| 497 | 3300006353 | Ga0075370_10005297 | Ga0075370_100052977 | 194 |
| 498 | 3300006353 | Ga0075370_10087395 | Ga0075370_100873953 | 194 |
| 499 | 3300006353 | Ga0075370_10132958 | Ga0075370_101329582 | 194 |
| 500 | 3300006353 | Ga0075370_10153160 | Ga0075370_101531602 | 194 |
| 501 | 3300006358 | Ga0068871_100016115 | Ga0068871_1000161155 | 194 |
| 502 | 3300006358 | Ga0068871_100169241 | Ga0068871_1001692413 | 194 |
| 503 | 3300006881 | Ga0068865_100000014 | Ga0068865_100000014117 | 194 |
| 504 | 3300006914 | Ga0075436_100126079 | Ga0075436_1001260792 | 194 |
| 505 | 3300006931 | Ga0097620_100035787 | Ga0097620_1000357876 | 194 |
| 506 | 3300006931 | Ga0097620_100971533 | Ga0097620_1009715332 | 194 |
| 507 | 3300006946 | Ga0079104_1012581 | Ga0079104_10125813 | 194 |
| 508 | 3300009093 | Ga0105240_10088485 | Ga0105240_100884853 | 194 |
| 509 | 3300009093 | Ga0105240_10407978 | Ga0105240_104079781 | 194 |
| 510 | 3300009098 | Ga0105245_10000160 | Ga0105245_1000016040 | 194 |
| 511 | 3300009101 | Ga0105247_10029554 | Ga0105247_100295544 | 194 |
| 512 | 3300009148 | Ga0105243_10000070 | Ga0105243_1000007096 | 194 |
| 513 | 3300009148 | Ga0105243_10000760 | Ga0105243_1000076027 | 194 |
| 514 | 3300009174 | Ga0105241_10276947 | Ga0105241_102769472 | 194 |
| 515 | 3300009176 | Ga0105242_10000722 | Ga0105242_1000072226 | 194 |
| 516 | 3300009176 | Ga0105242_10092631 | Ga0105242_100926313 | 194 |
| 517 | 3300009545 | Ga0105237_10007067 | Ga0105237_100070674 | 194 |
| 518 | 3300009551 | Ga0105238_10086778 | Ga0105238_100867783 | 194 |
| 519 | 3300009553 | Ga0105249_10000056 | Ga0105249_10000056160 | 194 |
| 520 | 3300009553 | Ga0105249_10048124 | Ga0105249_100481244 | 194 |
| 521 | 3300010375 | Ga0105239_10227075 | Ga0105239_102270752 | 194 |
| 522 | 3300010375 | Ga0105239_10618244 | Ga0105239_106182442 | 194 |
| 523 | 3300011119 | Ga0105246_10000434 | Ga0105246_1000043413 | 194 |
| 524 | 3300011119 | Ga0105246_10001563 | Ga0105246_100015633 | 194 |
| 525 | 3300012475 | Ga0157317_1005034 | Ga0157317_10050341 | 194 |
| 526 | 3300012513 | Ga0157326_1010593 | Ga0157326_10105931 | 194 |
| 527 | 3300013100 | Ga0157373_10005789 | Ga0157373_100057892 | 194 |
| 528 | 3300013100 | Ga0157373_10015197 | Ga0157373_100151973 | 194 |
| 529 | 3300013102 | Ga0157371_10001422 | Ga0157371_100014225 | 194 |
| 530 | 3300013102 | Ga0157371_10255031 | Ga0157371_102550311 | 194 |
| 531 | 3300013104 | Ga0157370_10000117 | Ga0157370_1000011738 | 194 |
| 532 | 3300013104 | Ga0157370_10010517 | Ga0157370_100105177 | 194 |
| 533 | 3300013104 | Ga0157370_10570332 | Ga0157370_105703322 | 194 |
| 534 | 3300013105 | Ga0157369_10044079 | Ga0157369_100440795 | 194 |
| 535 | 3300013105 | Ga0157369_10097146 | Ga0157369_100971462 | 194 |
| 536 | 3300013105 | Ga0157369_10178719 | Ga0157369_101787192 | 194 |
| 537 | 3300013296 | Ga0157374_10000542 | Ga0157374_100005425 | 194 |
| 538 | 3300013296 | Ga0157374_10106555 | Ga0157374_101065552 | 194 |
| 539 | 3300013296 | Ga0157374_10285653 | Ga0157374_102856532 | 194 |
| 540 | 3300013297 | Ga0157378_10000624 | Ga0157378_100006245 | 194 |
| 541 | 3300013297 | Ga0157378_10049551 | Ga0157378_100495515 | 194 |
| 542 | 3300013307 | Ga0157372_10002092 | Ga0157372_100020927 | 194 |
| 543 | 3300013307 | Ga0157372_10004924 | Ga0157372_100049245 | 194 |
| 544 | 3300013307 | Ga0157372_10260179 | Ga0157372_102601792 | 194 |
| 545 | 3300013307 | Ga0157372_10506759 | Ga0157372_105067591 | 194 |
| 546 | 3300013307 | Ga0157372_11011733 | Ga0157372_110117332 | 194 |
| 547 | 3300013308 | Ga0157375_10001639 | Ga0157375_100016395 | 194 |
| 548 | 3300013308 | Ga0157375_10376077 | Ga0157375_103760772 | 194 |
| 549 | 3300014326 | Ga0157380_10070038 | Ga0157380_100700384 | 194 |
| 550 | 3300014969 | Ga0157376_10000096 | Ga0157376_1000009626 | 194 |
| 551 | 3300015690 | Ga0183363_1005 | Ga0183363_100575 | 194 |
| 552 | 3300017792 | Ga0163161_10005899 | Ga0163161_100058999 | 194 |
| 553 | 3300017792 | Ga0163161_10398178 | Ga0163161_103981782 | 194 |
| 554 | 3300025230 | Ga0209563_100019 | Ga0209563_100019495 | 194 |
| 555 | 3300025231 | Ga0207427_101438 | Ga0207427_1014382 | 194 |
| 556 | 3300025233 | Ga0209437_110657 | Ga0209437_1106573 | 194 |
| 557 | 3300025250 | Ga0209026_1000641 | Ga0209026_10006412 | 194 |
| 558 | 3300025254 | Ga0209148_1000017 | Ga0209148_1000017529 | 194 |
| 559 | 3300025254 | Ga0209148_1000147 | Ga0209148_1000147142 | 194 |
| 560 | 3300025254 | Ga0209148_1003079 | Ga0209148_10030795 | 194 |
| 561 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003411 | 194 |
| 562 | 3300025261 | Ga0209233_1000154 | Ga0209233_1000154118 | 194 |
| 563 | 3300025272 | Ga0209455_1000005 | Ga0209455_1000005529 | 194 |
| 564 | 3300025272 | Ga0209455_1001163 | Ga0209455_10011635 | 194 |
| 565 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011305 | 194 |
| 566 | 3300025298 | Ga0209050_1000010 | Ga0209050_1000010433 | 194 |
| 567 | 3300025304 | Ga0209257_1000009 | Ga0209257_1000009682 | 194 |
| 568 | 3300025893 | Ga0207682_10181100 | Ga0207682_101811001 | 194 |
| 569 | 3300025900 | Ga0207710_10026569 | Ga0207710_100265693 | 194 |
| 570 | 3300025901 | Ga0207688_10025857 | Ga0207688_100258573 | 194 |
| 571 | 3300025901 | Ga0207688_10042823 | Ga0207688_100428233 | 194 |
| 572 | 3300025904 | Ga0207647_10003309 | Ga0207647_100033092 | 194 |
| 573 | 3300025904 | Ga0207647_10006904 | Ga0207647_100069043 | 194 |
| 574 | 3300025904 | Ga0207647_10017498 | Ga0207647_100174983 | 194 |
| 575 | 3300025904 | Ga0207647_10028077 | Ga0207647_100280774 | 194 |
| 576 | 3300025904 | Ga0207647_10155089 | Ga0207647_101550892 | 194 |
| 577 | 3300025907 | Ga0207645_10002952 | Ga0207645_1000295214 | 194 |
| 578 | 3300025909 | Ga0207705_10000042 | Ga0207705_10000042121 | 194 |
| 579 | 3300025909 | Ga0207705_10000236 | Ga0207705_1000023652 | 194 |
| 580 | 3300025909 | Ga0207705_10009197 | Ga0207705_100091976 | 194 |
| 581 | 3300025909 | Ga0207705_10030261 | Ga0207705_100302612 | 194 |
| 582 | 3300025909 | Ga0207705_10333089 | Ga0207705_103330891 | 194 |
| 583 | 3300025909 | Ga0207705_10384144 | Ga0207705_103841442 | 194 |
| 584 | 3300025911 | Ga0207654_10165528 | Ga0207654_101655282 | 194 |
| 585 | 3300025913 | Ga0207695_10067256 | Ga0207695_100672565 | 194 |
| 586 | 3300025913 | Ga0207695_10414637 | Ga0207695_104146371 | 194 |
| 587 | 3300025914 | Ga0207671_10023161 | Ga0207671_100231614 | 194 |
| 588 | 3300025917 | Ga0207660_10022399 | Ga0207660_100223994 | 194 |
| 589 | 3300025919 | Ga0207657_10000081 | Ga0207657_1000008169 | 194 |
| 590 | 3300025919 | Ga0207657_10001189 | Ga0207657_1000118923 | 194 |
| 591 | 3300025919 | Ga0207657_10008800 | Ga0207657_100088005 | 194 |
| 592 | 3300025919 | Ga0207657_10047392 | Ga0207657_100473923 | 194 |
| 593 | 3300025919 | Ga0207657_10203518 | Ga0207657_102035182 | 194 |
| 594 | 3300025920 | Ga0207649_10033331 | Ga0207649_100333313 | 194 |
| 595 | 3300025920 | Ga0207649_10270738 | Ga0207649_102707382 | 194 |
| 596 | 3300025920 | Ga0207649_11023411 | Ga0207649_110234111 | 194 |
| 597 | 3300025921 | Ga0207652_10246966 | Ga0207652_102469661 | 194 |
| 598 | 3300025923 | Ga0207681_10560239 | Ga0207681_105602392 | 194 |
| 599 | 3300025924 | Ga0207694_10053989 | Ga0207694_100539893 | 194 |
| 600 | 3300025926 | Ga0207659_10004034 | Ga0207659_100040347 | 194 |
| 601 | 3300025926 | Ga0207659_10554791 | Ga0207659_105547912 | 194 |
| 602 | 3300025927 | Ga0207687_10003175 | Ga0207687_100031754 | 194 |
| 603 | 3300025932 | Ga0207690_10005010 | Ga0207690_100050105 | 194 |
| 604 | 3300025932 | Ga0207690_10048973 | Ga0207690_100489732 | 194 |
| 605 | 3300025932 | Ga0207690_10102863 | Ga0207690_101028632 | 194 |
| 606 | 3300025933 | Ga0207706_10000112 | Ga0207706_1000011251 | 194 |
| 607 | 3300025933 | Ga0207706_10011098 | Ga0207706_100110984 | 194 |
| 608 | 3300025933 | Ga0207706_10013408 | Ga0207706_100134087 | 194 |
| 609 | 3300025933 | Ga0207706_10013706 | Ga0207706_100137064 | 194 |
| 610 | 3300025933 | Ga0207706_10091730 | Ga0207706_100917302 | 194 |
| 611 | 3300025933 | Ga0207706_10113122 | Ga0207706_101131223 | 194 |
| 612 | 3300025934 | Ga0207686_10000489 | Ga0207686_1000048926 | 194 |
| 613 | 3300025934 | Ga0207686_10112928 | Ga0207686_101129281 | 194 |
| 614 | 3300025935 | Ga0207709_10000031 | Ga0207709_1000003152 | 194 |
| 615 | 3300025935 | Ga0207709_10000066 | Ga0207709_100000664 | 194 |
| 616 | 3300025935 | Ga0207709_10241413 | Ga0207709_102414131 | 194 |
| 617 | 3300025937 | Ga0207669_10000073 | Ga0207669_1000007363 | 194 |
| 618 | 3300025937 | Ga0207669_10000718 | Ga0207669_1000071810 | 194 |
| 619 | 3300025937 | Ga0207669_10019929 | Ga0207669_100199292 | 194 |
| 620 | 3300025938 | Ga0207704_10000002 | Ga0207704_10000002194 | 194 |
| 621 | 3300025938 | Ga0207704_10000007 | Ga0207704_10000007194 | 194 |
| 622 | 3300025938 | Ga0207704_10113553 | Ga0207704_101135532 | 194 |
| 623 | 3300025940 | Ga0207691_10014326 | Ga0207691_100143263 | 194 |
| 624 | 3300025942 | Ga0207689_10000060 | Ga0207689_1000006061 | 194 |
| 625 | 3300025944 | Ga0207661_10136885 | Ga0207661_101368853 | 194 |
| 626 | 3300025944 | Ga0207661_10169639 | Ga0207661_101696393 | 194 |
| 627 | 3300025944 | Ga0207661_11145385 | Ga0207661_111453851 | 194 |
| 628 | 3300025945 | Ga0207679_10056629 | Ga0207679_100566293 | 194 |
| 629 | 3300025949 | Ga0207667_10000017 | Ga0207667_10000017320 | 194 |
| 630 | 3300025949 | Ga0207667_10062071 | Ga0207667_100620713 | 194 |
| 631 | 3300025949 | Ga0207667_10065036 | Ga0207667_100650363 | 194 |
| 632 | 3300025949 | Ga0207667_10202034 | Ga0207667_102020343 | 194 |
| 633 | 3300025949 | Ga0207667_10385383 | Ga0207667_103853832 | 194 |
| 634 | 3300025960 | Ga0207651_10000004 | Ga0207651_10000004263 | 194 |
| 635 | 3300025960 | Ga0207651_10176139 | Ga0207651_101761392 | 194 |
| 636 | 3300025961 | Ga0207712_10000015 | Ga0207712_10000015135 | 194 |
| 637 | 3300025961 | Ga0207712_10006048 | Ga0207712_100060488 | 194 |
| 638 | 3300025972 | Ga0207668_10138161 | Ga0207668_101381613 | 194 |
| 639 | 3300025981 | Ga0207640_10000653 | Ga0207640_1000065315 | 194 |
| 640 | 3300025981 | Ga0207640_10007464 | Ga0207640_100074644 | 194 |
| 641 | 3300025981 | Ga0207640_10190802 | Ga0207640_101908022 | 194 |
| 642 | 3300025986 | Ga0207658_10015627 | Ga0207658_100156272 | 194 |
| 643 | 3300026023 | Ga0207677_10000231 | Ga0207677_1000023144 | 194 |
| 644 | 3300026035 | Ga0207703_10000123 | Ga0207703_1000012368 | 194 |
| 645 | 3300026035 | Ga0207703_10067257 | Ga0207703_100672572 | 194 |
| 646 | 3300026041 | Ga0207639_10000312 | Ga0207639_100003126 | 194 |
| 647 | 3300026041 | Ga0207639_10003914 | Ga0207639_100039149 | 194 |
| 648 | 3300026041 | Ga0207639_10022289 | Ga0207639_100222894 | 194 |
| 649 | 3300026041 | Ga0207639_10046665 | Ga0207639_100466652 | 194 |
| 650 | 3300026041 | Ga0207639_10256756 | Ga0207639_102567562 | 194 |
| 651 | 3300026041 | Ga0207639_10450568 | Ga0207639_104505682 | 194 |
| 652 | 3300026067 | Ga0207678_10000656 | Ga0207678_1000065632 | 194 |
| 653 | 3300026067 | Ga0207678_10128322 | Ga0207678_101283222 | 194 |
| 654 | 3300026078 | Ga0207702_10006436 | Ga0207702_100064362 | 194 |
| 655 | 3300026078 | Ga0207702_10043845 | Ga0207702_100438454 | 194 |
| 656 | 3300026078 | Ga0207702_10311614 | Ga0207702_103116142 | 194 |
| 657 | 3300026088 | Ga0207641_10000102 | Ga0207641_1000010285 | 194 |
| 658 | 3300026089 | Ga0207648_10000003 | Ga0207648_1000000326 | 194 |
| 659 | 3300026116 | Ga0207674_10069407 | Ga0207674_100694074 | 194 |
| 660 | 3300026116 | Ga0207674_10266128 | Ga0207674_102661282 | 194 |
| 661 | 3300026116 | Ga0207674_10385388 | Ga0207674_103853882 | 194 |
| 662 | 3300026121 | Ga0207683_10000086 | Ga0207683_1000008665 | 194 |
| 663 | 3300026121 | Ga0207683_10024502 | Ga0207683_100245024 | 194 |
| 664 | 3300026121 | Ga0207683_10071169 | Ga0207683_100711693 | 194 |
| 665 | 3300026142 | Ga0207698_10000385 | Ga0207698_1000038517 | 194 |
| 666 | 3300027866 | Ga0209813_10000053 | Ga0209813_1000005342 | 194 |
| 667 | 3300027876 | Ga0209974_10151896 | Ga0209974_101518962 | 194 |
| 668 | 3300027907 | Ga0207428_10116851 | Ga0207428_101168513 | 194 |
| 669 | 3300028379 | Ga0268266_10009662 | Ga0268266_100096626 | 194 |
| 670 | 3300028380 | Ga0268265_10000021 | Ga0268265_10000021105 | 194 |
| 671 | 3300028380 | Ga0268265_10012842 | Ga0268265_100128425 | 194 |
| 672 | 3300028381 | Ga0268264_10000018 | Ga0268264_10000018349 | 194 |
| 673 | 3300028381 | Ga0268264_10000330 | Ga0268264_1000033031 | 194 |
| 674 | 3300028381 | Ga0268264_10002138 | Ga0268264_1000213810 | 194 |
| 675 | 3300031456 | Ga0307513_10082859 | Ga0307513_100828594 | 194 |
| 676 | 3300031548 | Ga0307408_100179098 | Ga0307408_1001790982 | 194 |
| 677 | 3300031616 | Ga0307508_10001087 | Ga0307508_1000108715 | 194 |
| 678 | 3300031691 | Ga0316579_10074567 | Ga0316579_100745672 | 194 |
| 679 | 3300031852 | Ga0307410_10063140 | Ga0307410_100631402 | 194 |
| 680 | 3300031852 | Ga0307410_10069496 | Ga0307410_100694963 | 194 |
| 681 | 3300031852 | Ga0307410_10598170 | Ga0307410_105981702 | 194 |
| 682 | 3300031903 | Ga0307407_10415807 | Ga0307407_104158072 | 194 |
| 683 | 3300031911 | Ga0307412_10459652 | Ga0307412_104596522 | 194 |
| 684 | 3300031995 | Ga0307409_100615108 | Ga0307409_1006151082 | 194 |
| 685 | 3300032002 | Ga0307416_101124106 | Ga0307416_1011241062 | 194 |
| 686 | 3300032002 | Ga0307416_101230978 | Ga0307416_1012309781 | 194 |
| 687 | 3300032004 | Ga0307414_10180164 | Ga0307414_101801642 | 194 |
| 688 | 3300032004 | Ga0307414_10180417 | Ga0307414_101804172 | 194 |
| 689 | 3300032005 | Ga0307411_10404654 | Ga0307411_104046542 | 194 |
| 690 | 3300032005 | Ga0307411_10946091 | Ga0307411_109460911 | 194 |
| 691 | 3300032126 | Ga0307415_100602456 | Ga0307415_1006024562 | 194 |
| 692 | 3300032133 | Ga0316583_10025382 | Ga0316583_100253822 | 194 |
| 693 | 3300036647 | Ga0316582_0000403 | Ga0316582_0000403_9261_9845 | 194 |
| 694 | 3300036712 | Ga0316584_0366060 | Ga0316584_0366060_59_643 | 194 |
| 695 | 3300037312 | Ga0395899_0069029 | Ga0395899_0069029_1711_2298 | 194 |
| 696 | 3300037312 | Ga0395899_0072345 | Ga0395899_0072345_883_1467 | 194 |
| 697 | 3300037418 | Ga0395900_0014470 | Ga0395900_0014470_2775_3362 | 194 |
| 698 | 3300037418 | Ga0395900_0249634 | Ga0395900_0249634_323_910 | 194 |
| 699 | 3300037418 | Ga0395900_0901660 | Ga0395900_0901660_198_785 | 194 |
| 700 | 3300037471 | Ga0395905_0040453 | Ga0395905_0040453_2366_2953 | 194 |
| 701 | 3300037471 | Ga0395905_0065909 | Ga0395905_0065909_912_1511 | 194 |
| 702 | 3300038443 | Ga0395901_0019343 | Ga0395901_0019343_1704_2291 | 194 |
| 703 | 3300038443 | Ga0395901_0883018 | Ga0395901_0883018_178_765 | 194 |
| 704 | 3300041456 | Ga0451795_0981501 | Ga0451795_0981501_321_905 | 194 |
| 705 | 3300042005 | Ga0439448_0016115 | Ga0439448_0016115_1573_2160 | 194 |
| 706 | 3300042005 | Ga0439448_0031454 | Ga0439448_0031454_425_1012 | 194 |
| 707 | 3300042005 | Ga0439448_0040880 | Ga0439448_0040880_533_1120 | 194 |
| 708 | 3300042012 | Ga0439455_0007890 | Ga0439455_0007890_1057_1644 | 194 |
| 709 | 3300042012 | Ga0439455_0021674 | Ga0439455_0021674_117_704 | 194 |
| 710 | 3300042157 | Ga0439458_0000728 | Ga0439458_0000728_1981_2568 | 194 |
| 711 | 3300042157 | Ga0439458_0001986 | Ga0439458_0001986_4164_4751 | 194 |
| 712 | 3300042157 | Ga0439458_0004167 | Ga0439458_0004167_1239_1826 | 194 |
| 713 | 3300044683 | Ga0466965_0048807 | Ga0466965_0048807_1469_2068 | 194 |
| 714 | 3300044684 | Ga0466966_0044471 | Ga0466966_0044471_584_1183 | 194 |
| 715 | 3300044693 | Ga0466961_0015796 | Ga0466961_0015796_3971_4570 | 194 |
| 716 | 3300044765 | Ga0466970_0007333 | Ga0466970_0007333_1663_2262 | 194 |
| 717 | 3300044765 | Ga0466970_0171690 | Ga0466970_0171690_456_1043 | 194 |
| 718 | 3300045049 | Ga0466959_0039342 | Ga0466959_0039342_1664_2263 | 194 |
| 719 | 3300045051 | Ga0451576_0000023 | Ga0451576_0000023_6097_6708 | 194 |
| 720 | 3300045051 | Ga0451576_0477661 | Ga0451576_0477661_672_1295 | 194 |
| 721 | 3300045836 | Ga0466958_0139879 | Ga0466958_0139879_771_1358 | 194 |
| 722 | 3300046460 | Ga0495638_0001782 | Ga0495638_0001782_4480_5064 | 194 |
| 723 | 3300046460 | Ga0495638_0022336 | Ga0495638_0022336_3485_4084 | 194 |
| 724 | 3300046471 | Ga0495650_0000340 | Ga0495650_0000340_55060_55644 | 194 |
| 725 | 3300046492 | Ga0495585_0019033 | Ga0495585_0019033_2139_2723 | 194 |
| 726 | 3300046492 | Ga0495585_0138231 | Ga0495585_0138231_138_722 | 194 |
| 727 | 3300046500 | Ga0495596_0000288 | Ga0495596_0000288_8996_9607 | 194 |
| 728 | 3300046501 | Ga0495607_0003392 | Ga0495607_0003392_1577_2188 | 194 |
| 729 | 3300046506 | Ga0495583_0000996 | Ga0495583_0000996_12700_13284 | 194 |
| 730 | 3300046506 | Ga0495583_0010824 | Ga0495583_0010824_1050_1661 | 194 |
| 731 | 3300046506 | Ga0495583_0011374 | Ga0495583_0011374_3705_4289 | 194 |
| 732 | 3300046506 | Ga0495583_0199221 | Ga0495583_0199221_123_707 | 194 |
| 733 | 3300046507 | Ga0495606_0000824 | Ga0495606_0000824_38247_38831 | 194 |
| 734 | 3300046507 | Ga0495606_0118613 | Ga0495606_0118613_351_938 | 194 |
| 735 | 3300046513 | Ga0495616_0106319 | Ga0495616_0106319_485_1069 | 194 |
| 736 | 3300046518 | Ga0495631_0217209 | Ga0495631_0217209_134_718 | 194 |
| 737 | 3300046519 | Ga0495632_0037725 | Ga0495632_0037725_476_1087 | 194 |
| 738 | 3300046522 | Ga0495643_0000132 | Ga0495643_0000132_41852_42481 | 194 |
| 739 | 3300046522 | Ga0495643_0001032 | Ga0495643_0001032_19864_20448 | 194 |
| 740 | 3300046522 | Ga0495643_0002580 | Ga0495643_0002580_5876_6487 | 194 |
| 741 | 3300046522 | Ga0495643_0247246 | Ga0495643_0247246_211_795 | 194 |
| 742 | 3300046524 | Ga0495648_0052521 | Ga0495648_0052521_685_1368 | 194 |
| 743 | 3300046525 | Ga0495663_0010856 | Ga0495663_0010856_1625_2209 | 194 |
| 744 | 3300046530 | Ga0495654_0082285 | Ga0495654_0082285_417_1001 | 194 |
| 745 | 3300046538 | Ga0495609_0006682 | Ga0495609_0006682_804_1415 | 194 |
| 746 | 3300046557 | Ga0495622_0003931 | Ga0495622_0003931_602_1186 | 194 |
| 747 | 3300046558 | Ga0495633_0003629 | Ga0495633_0003629_7778_8362 | 194 |
| 748 | 3300046558 | Ga0495633_0024503 | Ga0495633_0024503_1703_2287 | 194 |
| 749 | 3300046616 | Ga0495668_0184355 | Ga0495668_0184355_347_931 | 194 |
| 750 | 3300046648 | Ga0495611_0014992 | Ga0495611_0014992_793_1377 | 194 |
| 751 | 3300046648 | Ga0495611_0119212 | Ga0495611_0119212_505_1089 | 194 |
| 752 | 3300046660 | Ga0495625_0000093 | Ga0495625_0000093_5447_6043 | 194 |
| 753 | 3300046660 | Ga0495625_0000583 | Ga0495625_0000583_10891_11475 | 194 |
| 754 | 3300046660 | Ga0495625_0024137 | Ga0495625_0024137_1200_1811 | 194 |
| 755 | 3300046660 | Ga0495625_0036791 | Ga0495625_0036791_253_837 | 194 |
| 756 | 3300046660 | Ga0495625_0037260 | Ga0495625_0037260_857_1441 | 194 |
| 757 | 3300046660 | Ga0495625_0388388 | Ga0495625_0388388_36_620 | 194 |
| 758 | 3300046660 | Ga0495625_0496866 | Ga0495625_0496866_130_714 | 194 |
| 759 | 3300046665 | Ga0495661_0066888 | Ga0495661_0066888_873_1457 | 194 |
| 760 | 3300046691 | Ga0495670_0058212 | Ga0495670_0058212_372_956 | 194 |
| 761 | 3300046692 | Ga0495671_0083324 | Ga0495671_0083324_16_627 | 194 |
| 762 | 3300046694 | Ga0495649_0193899 | Ga0495649_0193899_163_750 | 194 |
| 763 | 3300046810 | Ga0495660_0124506 | Ga0495660_0124506_516_1100 | 194 |
| 764 | 3300047323 | Ga0495683_0011593 | Ga0495683_0011593_526_1110 | 194 |
| 765 | 3300047323 | Ga0495683_0055376 | Ga0495683_0055376_1038_1622 | 194 |
| 766 | 3300047443 | Ga0495687_000512 | Ga0495687_000512_19003_19587 | 194 |
| 767 | 3300047443 | Ga0495687_010555 | Ga0495687_010555_660_1244 | 194 |
| 768 | 3300047443 | Ga0495687_057939 | Ga0495687_057939_325_912 | 194 |
| 769 | 3300047470 | Ga0495681_0189462 | Ga0495681_0189462_216_800 | 194 |
| 770 | 3300047472 | Ga0495686_0000753 | Ga0495686_0000753_28855_29442 | 194 |
| 771 | 3300047472 | Ga0495686_0000983 | Ga0495686_0000983_27753_28340 | 194 |
| 772 | 3300048091 | Ga0495626_0258124 | Ga0495626_0258124_31_615 | 194 |
| 773 | 3300048903 | Ga0496100_0177923 | Ga0496100_0177923_854_1441 | 194 |
| 774 | 3300048905 | Ga0496102_0170708 | Ga0496102_0170708_1121_1708 | 194 |
| 775 | 3300048908 | Ga0496105_0003976 | Ga0496105_0003976_9809_10396 | 194 |
| 776 | 3300048916 | Ga0496113_0053877 | Ga0496113_0053877_632_1216 | 194 |
| 777 | 3300048920 | Ga0496117_0070555 | Ga0496117_0070555_757_1344 | 194 |
| 778 | 3300048921 | Ga0496118_0020983 | Ga0496118_0020983_1107_1694 | 194 |
| 779 | 3300048924 | Ga0496121_0000222 | Ga0496121_0000222_53478_54065 | 194 |
| 780 | 3300048924 | Ga0496121_0000367 | Ga0496121_0000367_59717_60301 | 194 |
| 781 | 3300048924 | Ga0496121_0227511 | Ga0496121_0227511_410_994 | 194 |
| 782 | 3300048925 | Ga0496122_0002744 | Ga0496122_0002744_7438_8025 | 194 |
| 783 | 3300048926 | Ga0496123_0001272 | Ga0496123_0001272_29689_30276 | 194 |
| 784 | 3300048926 | Ga0496123_0090996 | Ga0496123_0090996_427_1011 | 194 |
| 785 | 3300048926 | Ga0496123_0166632 | Ga0496123_0166632_549_1133 | 194 |
| 786 | 3300048927 | Ga0496124_0035687 | Ga0496124_0035687_647_1234 | 194 |
| 787 | 3300048927 | Ga0496124_0099052 | Ga0496124_0099052_1359_1943 | 194 |
| 788 | 3300048928 | Ga0496125_0000730 | Ga0496125_0000730_33138_33722 | 194 |
| 789 | 3300049460 | Ga0495682_0134769 | Ga0495682_0134769_152_736 | 194 |
| 790 | 3300049568 | Ga0501031_0130946 | Ga0501031_0130946_744_1352 | 194 |
| 791 | 3300049571 | Ga0501034_0084595 | Ga0501034_0084595_192_791 | 194 |
| 792 | 3300049571 | Ga0501034_0885834 | Ga0501034_0885834_15_614 | 194 |
| 793 | 3300049575 | Ga0501039_0783410 | Ga0501039_0783410_20_604 | 194 |
| 794 | 3300049581 | Ga0501047_0000729 | Ga0501047_0000729_15596_16216 | 194 |
| 795 | 3300049581 | Ga0501047_0138935 | Ga0501047_0138935_1699_2283 | 194 |
| 796 | 3300049581 | Ga0501047_0427836 | Ga0501047_0427836_144_728 | 194 |
| 797 | 3300049589 | Ga0501073_0311097 | Ga0501073_0311097_177_785 | 194 |
| 798 | 3300049823 | Ga0501044_0000608 | Ga0501044_0000608_6532_7116 | 194 |
| 799 | 3300049823 | Ga0501044_0162231 | Ga0501044_0162231_839_1438 | 194 |
| 800 | 3300050489 | nmdc:mga03683_24689_c1 | nmdc:mga03683_24689_c1_339_923 | 194 |
| 801 | 3300050489 | nmdc:mga03683_442_c1 | nmdc:mga03683_442_c1_7073_7657 | 194 |
| 802 | 3300050491 | nmdc:mga00v17_1436_c2 | nmdc:mga00v17_1436_c2_6249_6833 | 194 |
| 803 | 3300050491 | nmdc:mga00v17_4316_c1 | nmdc:mga00v17_4316_c1_4337_4921 | 194 |
| 804 | 3300050492 | nmdc:mga0yw44_69494_c1 | nmdc:mga0yw44_69494_c1_1357_1941 | 194 |
| 805 | 3300050493 | nmdc:mga0k408_101603_c1 | nmdc:mga0k408_101603_c1_663_1247 | 194 |
| 806 | 3300050494 | nmdc:mga06z11_147_c1 | nmdc:mga06z11_147_c1_3454_4038 | 194 |
| 807 | 3300050494 | nmdc:mga06z11_83504_c1 | nmdc:mga06z11_83504_c1_574_1173 | 194 |
| 808 | 3300050495 | nmdc:mga04h51_24_c1 | nmdc:mga04h51_24_c1_42021_42605 | 194 |
| 809 | 3300050496 | nmdc:mga07m45_118996_c1 | nmdc:mga07m45_118996_c1_670_1254 | 194 |
| 810 | 3300050496 | nmdc:mga07m45_119180_c1 | nmdc:mga07m45_119180_c1_727_1311 | 194 |
| 811 | 3300050496 | nmdc:mga07m45_31_c1 | nmdc:mga07m45_31_c1_27165_27764 | 194 |
| 812 | 3300050496 | nmdc:mga07m45_4597_c1 | nmdc:mga07m45_4597_c1_5609_6193 | 194 |
| 813 | 3300050496 | nmdc:mga07m45_4_c1 | nmdc:mga07m45_4_c1_233130_233714 | 194 |
| 814 | 3300050516 | nmdc:mga0sz30_160076_c1 | nmdc:mga0sz30_160076_c1_354_941 | 194 |
| 815 | 3300050516 | nmdc:mga0sz30_6072_c1 | nmdc:mga0sz30_6072_c1_2677_3261 | 194 |
| 816 | 3300053077 | Ga0495601_0150345 | Ga0495601_0150345_564_1178 | 194 |
| 817 | 3300053093 | Ga0500651_0110789 | Ga0500651_0110789_769_1365 | 194 |
| 818 | 3300053096 | Ga0500641_0033015 | Ga0500641_0033015_1432_2016 | 194 |
| 819 | 3300053104 | Ga0500556_0184704 | Ga0500556_0184704_132_716 | 194 |
| 820 | 3300053116 | Ga0500592_013598 | Ga0500592_013598_598_1182 | 194 |
| 821 | 3300053119 | Ga0500595_001141 | Ga0500595_001141_10077_10661 | 194 |
| 822 | 3300053119 | Ga0500595_003373 | Ga0500595_003373_4326_4910 | 194 |
| 823 | 3300053119 | Ga0500595_037448 | Ga0500595_037448_559_1143 | 194 |
| 824 | 3300053121 | Ga0500607_001017 | Ga0500607_001017_13014_13598 | 194 |
| 825 | 3300053121 | Ga0500607_176261 | Ga0500607_176261_148_732 | 194 |
| 826 | 3300053130 | Ga0500642_0001053 | Ga0500642_0001053_3891_4475 | 194 |
| 827 | 3300053136 | Ga0500559_0004769 | Ga0500559_0004769_1166_1753 | 194 |
| 828 | 3300053139 | Ga0500568_0008653 | Ga0500568_0008653_1086_1688 | 194 |
| 829 | 3300053139 | Ga0500568_0092471 | Ga0500568_0092471_150_734 | 194 |
| 830 | 3300053140 | Ga0500573_0000016 | Ga0500573_0000016_23319_23903 | 194 |
| 831 | 3300053142 | Ga0500577_0105030 | Ga0500577_0105030_330_917 | 194 |
| 832 | 3300053148 | Ga0500590_015737 | Ga0500590_015737_1519_2121 | 194 |
| 833 | 3300053151 | Ga0500604_0000078 | Ga0500604_0000078_3320_3922 | 194 |
| 834 | 3300053151 | Ga0500604_0038496 | Ga0500604_0038496_257_844 | 194 |
| 835 | 3300053153 | Ga0500616_0003477 | Ga0500616_0003477_1116_1715 | 194 |
| 836 | 3300053153 | Ga0500616_0093290 | Ga0500616_0093290_404_991 | 194 |
| 837 | 3300053154 | Ga0500619_028904 | Ga0500619_028904_626_1210 | 194 |
| 838 | 3300053156 | Ga0500622_0001060 | Ga0500622_0001060_8216_8800 | 194 |
| 839 | 3300053178 | Ga0500637_0015050 | Ga0500637_0015050_2501_3085 | 194 |
| 840 | 3300053730 | Ga0500645_001601 | Ga0500645_001601_4526_5110 | 194 |
| 841 | 3300053730 | Ga0500645_016146 | Ga0500645_016146_438_1022 | 194 |
| 842 | 3300053730 | Ga0500645_069322 | Ga0500645_069322_123_707 | 194 |
| 843 | 3300053735 | Ga0500596_001728 | Ga0500596_001728_877_1461 | 194 |
| 844 | 3300055283 | Ga0500661_020399 | Ga0500661_020399_219_803 | 194 |
| 845 | 3300061719 | Ga0466962_0245570 | Ga0466962_0245570_125_712 | 194 |
| 846 | iso_pu_bacteria | 2739367664 | 2739650046 | 194 |
| 847 | iso_pu_bacteria | 2739367865 | 2740028519 | 194 |
| 848 | iso_pu_bacteria | 2751185897 | 2753765209 | 194 |
| 849 | iso_pu_bacteria | 2818991438 | 2819550548 | 194 |
| 850 | iso_pu_bacteria | 2928027323 | 2928028921 | 194 |
| 851 | iso_pu_bacteria | 2984555340 | 2984557848 | 194 |
| 852 | iso_pu_bacteria | 2984564862 | 2984567787 | 194 |
| 853 | iso_pu_bacteria | 2993356040 | 2993358838 | 194 |
| 854 | 3300021388 | Ga0213875_10000202 | Ga0213875_1000020225 | 195 |
| 855 | 3300026088 | Ga0207641_11199269 | Ga0207641_111992692 | 195 |
| 856 | 3300037853 | Ga0436364_0380874 | Ga0436364_0380874_33537_34235 | 195 |
| 857 | 3300039437 | Ga0436365_1401057 | Ga0436365_1401057_404_1009 | 195 |
| 858 | 3300048903 | Ga0496100_0318505 | Ga0496100_0318505_325_942 | 195 |
| 859 | 3300050493 | nmdc:mga0k408_186578_c1 | nmdc:mga0k408_186578_c1_403_990 | 195 |
| 860 | 3300050496 | nmdc:mga07m45_266835_c1 | nmdc:mga07m45_266835_c1_170_757 | 195 |
| 861 | 3300053094 | Ga0500566_0075934 | Ga0500566_0075934_450_1037 | 195 |
| 862 | 3300053121 | Ga0500607_000042 | Ga0500607_000042_11960_12547 | 195 |
| 863 | 3300053136 | Ga0500559_0000337 | Ga0500559_0000337_11973_12560 | 195 |
| 864 | 3300053730 | Ga0500645_006083 | Ga0500645_006083_2697_3284 | 195 |
| 865 | 3300005356 | Ga0070674_100442670 | Ga0070674_1004426701 | 196 |
| 866 | 3300005456 | Ga0070678_100950524 | Ga0070678_1009505242 | 196 |
| 867 | 3300005548 | Ga0070665_100379894 | Ga0070665_1003798942 | 196 |
| 868 | 3300005616 | Ga0068852_100170285 | Ga0068852_1001702852 | 196 |
| 869 | 3300005618 | Ga0068864_100000603 | Ga0068864_10000060318 | 196 |
| 870 | 3300005834 | Ga0068851_10005438 | Ga0068851_100054381 | 196 |
| 871 | 3300009177 | Ga0105248_10060140 | Ga0105248_100601404 | 196 |
| 872 | 3300014968 | Ga0157379_10053843 | Ga0157379_100538435 | 196 |
| 873 | 3300025937 | Ga0207669_10464025 | Ga0207669_104640251 | 196 |
| 874 | 3300025941 | Ga0207711_10038590 | Ga0207711_100385904 | 196 |
| 875 | 3300026095 | Ga0207676_10000552 | Ga0207676_1000055215 | 196 |
| 876 | 3300026142 | Ga0207698_10308051 | Ga0207698_103080511 | 196 |
| 877 | 3300031456 | Ga0307513_10153196 | Ga0307513_101531962 | 196 |
| 878 | 3300031548 | Ga0307408_100020835 | Ga0307408_1000208352 | 196 |
| 879 | 3300031911 | Ga0307412_10000217 | Ga0307412_1000021711 | 196 |
| 880 | 3300032002 | Ga0307416_100025502 | Ga0307416_1000255023 | 196 |
| 881 | 3300032004 | Ga0307414_10000102 | Ga0307414_1000010236 | 196 |
| 882 | 3300033180 | Ga0307510_10032849 | Ga0307510_100328494 | 196 |
| 883 | 3300037068 | Ga0373925_0378810 | Ga0373925_0378810_45_662 | 196 |
| 884 | 3300046506 | Ga0495583_0010754 | Ga0495583_0010754_4022_4621 | 196 |
| 885 | 3300046616 | Ga0495668_0021107 | Ga0495668_0021107_2264_2863 | 196 |
| 886 | 3300046660 | Ga0495625_0049825 | Ga0495625_0049825_31_630 | 196 |
| 887 | 3300047445 | Ga0495677_0001294 | Ga0495677_0001294_4334_4933 | 196 |
| 888 | 3300049571 | Ga0501034_0189465 | Ga0501034_0189465_432_1022 | 196 |
| 889 | 3300049663 | Ga0501223_000997 | Ga0501223_000997_4264_4854 | 196 |
| 890 | 3300049664 | Ga0501224_000012 | Ga0501224_000012_87720_88310 | 196 |
| 891 | 3300049668 | Ga0501233_001789 | Ga0501233_001789_1743_2333 | 196 |
| 892 | 3300049669 | Ga0501235_002099 | Ga0501235_002099_1890_2480 | 196 |
| 893 | 3300049705 | Ga0501225_0000035 | Ga0501225_0000035_34444_35034 | 196 |
| 894 | 3300049707 | Ga0501234_003699 | Ga0501234_003699_593_1183 | 196 |
| 895 | 3300049853 | Ga0501226_000091 | Ga0501226_000091_4234_4824 | 196 |
| 896 | 3300053087 | Ga0500643_000241 | Ga0500643_000241_19515_20108 | 196 |
| 897 | 3300053087 | Ga0500643_004098 | Ga0500643_004098_3175_3774 | 196 |
| 898 | 3300053136 | Ga0500559_0105695 | Ga0500559_0105695_161_760 | 196 |
| 899 | 3300005336 | Ga0070680_100306015 | Ga0070680_1003060152 | 197 |
| 900 | 3300005445 | Ga0070708_100042003 | Ga0070708_1000420032 | 197 |
| 901 | 3300005467 | Ga0070706_100081837 | Ga0070706_1000818372 | 197 |
| 902 | 3300005468 | Ga0070707_100677801 | Ga0070707_1006778011 | 197 |
| 903 | 3300005536 | Ga0070697_100091561 | Ga0070697_1000915612 | 197 |
| 904 | 3300025922 | Ga0207646_10253688 | Ga0207646_102536882 | 197 |
| 905 | 3300028558 | Ga0265326_10042869 | Ga0265326_100428692 | 197 |
| 906 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_449002_449610 | 197 |
| 907 | 3300053125 | Ga0500618_001039 | Ga0500618_001039_3660_4268 | 197 |
| 908 | 2162886007 | SwRhRL2b_contig_2906353 | SwRhRL2b_0406.00008000 | 198 |
| 909 | 3300005289 | Ga0065704_10070237 | Ga0065704_1007023737 | 198 |
| 910 | 3300005289 | Ga0065704_10108965 | Ga0065704_101089653 | 198 |
| 911 | 3300005327 | Ga0070658_10000125 | Ga0070658_1000012534 | 198 |
| 912 | 3300005331 | Ga0070670_100073410 | Ga0070670_1000734103 | 198 |
| 913 | 3300005331 | Ga0070670_100203842 | Ga0070670_1002038422 | 198 |
| 914 | 3300005335 | Ga0070666_10050500 | Ga0070666_100505003 | 198 |
| 915 | 3300005340 | Ga0070689_100255195 | Ga0070689_1002551952 | 198 |
| 916 | 3300005347 | Ga0070668_100075216 | Ga0070668_1000752163 | 198 |
| 917 | 3300005347 | Ga0070668_100083839 | Ga0070668_1000838391 | 198 |
| 918 | 3300005353 | Ga0070669_100000297 | Ga0070669_1000002979 | 198 |
| 919 | 3300005353 | Ga0070669_100000990 | Ga0070669_1000009903 | 198 |
| 920 | 3300005355 | Ga0070671_100000090 | Ga0070671_10000009010 | 198 |
| 921 | 3300005355 | Ga0070671_100004583 | Ga0070671_1000045835 | 198 |
| 922 | 3300005355 | Ga0070671_100071516 | Ga0070671_1000715163 | 198 |
| 923 | 3300005367 | Ga0070667_100005081 | Ga0070667_1000050812 | 198 |
| 924 | 3300005367 | Ga0070667_100010899 | Ga0070667_1000108997 | 198 |
| 925 | 3300005548 | Ga0070665_100001407 | Ga0070665_10000140721 | 198 |
| 926 | 3300005548 | Ga0070665_100045285 | Ga0070665_1000452855 | 198 |
| 927 | 3300005548 | Ga0070665_100311281 | Ga0070665_1003112812 | 198 |
| 928 | 3300005563 | Ga0068855_100004467 | Ga0068855_1000044677 | 198 |
| 929 | 3300005563 | Ga0068855_100819012 | Ga0068855_1008190122 | 198 |
| 930 | 3300005578 | Ga0068854_100000439 | Ga0068854_1000004396 | 198 |
| 931 | 3300005614 | Ga0068856_100439192 | Ga0068856_1004391922 | 198 |
| 932 | 3300005616 | Ga0068852_100000387 | Ga0068852_1000003875 | 198 |
| 933 | 3300005617 | Ga0068859_100252954 | Ga0068859_1002529542 | 198 |
| 934 | 3300005618 | Ga0068864_100420858 | Ga0068864_1004208581 | 198 |
| 935 | 3300005719 | Ga0068861_100000387 | Ga0068861_1000003876 | 198 |
| 936 | 3300005841 | Ga0068863_100016733 | Ga0068863_1000167335 | 198 |
| 937 | 3300005841 | Ga0068863_100042676 | Ga0068863_1000426762 | 198 |
| 938 | 3300005842 | Ga0068858_100209899 | Ga0068858_1002098992 | 198 |
| 939 | 3300005843 | Ga0068860_100017153 | Ga0068860_1000171536 | 198 |
| 940 | 3300005843 | Ga0068860_100664292 | Ga0068860_1006642922 | 198 |
| 941 | 3300005844 | Ga0068862_100002787 | Ga0068862_10000278717 | 198 |
| 942 | 3300005844 | Ga0068862_100031480 | Ga0068862_1000314806 | 198 |
| 943 | 3300006931 | Ga0097620_100252952 | Ga0097620_1002529522 | 198 |
| 944 | 3300009011 | Ga0105251_10001943 | Ga0105251_1000194310 | 198 |
| 945 | 3300009093 | Ga0105240_10149816 | Ga0105240_101498163 | 198 |
| 946 | 3300009093 | Ga0105240_10159735 | Ga0105240_101597352 | 198 |
| 947 | 3300009177 | Ga0105248_10029379 | Ga0105248_100293793 | 198 |
| 948 | 3300009177 | Ga0105248_10382570 | Ga0105248_103825702 | 198 |
| 949 | 3300009551 | Ga0105238_10178755 | Ga0105238_101787552 | 198 |
| 950 | 3300013306 | Ga0163162_10039028 | Ga0163162_100390284 | 198 |
| 951 | 3300013306 | Ga0163162_10063074 | Ga0163162_100630742 | 198 |
| 952 | 3300014968 | Ga0157379_10306989 | Ga0157379_103069892 | 198 |
| 953 | 3300025298 | Ga0209050_1000217 | Ga0209050_100021714 | 198 |
| 954 | 3300025315 | Ga0207697_10012093 | Ga0207697_100120933 | 198 |
| 955 | 3300025735 | Ga0207713_1043917 | Ga0207713_10439172 | 198 |
| 956 | 3300025903 | Ga0207680_10042407 | Ga0207680_100424072 | 198 |
| 957 | 3300025904 | Ga0207647_10046743 | Ga0207647_100467432 | 198 |
| 958 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004631 | 198 |
| 959 | 3300025913 | Ga0207695_10143132 | Ga0207695_101431323 | 198 |
| 960 | 3300025913 | Ga0207695_10296328 | Ga0207695_102963282 | 198 |
| 961 | 3300025923 | Ga0207681_10000242 | Ga0207681_100002429 | 198 |
| 962 | 3300025923 | Ga0207681_10001749 | Ga0207681_100017493 | 198 |
| 963 | 3300025925 | Ga0207650_10129807 | Ga0207650_101298072 | 198 |
| 964 | 3300025925 | Ga0207650_10313344 | Ga0207650_103133442 | 198 |
| 965 | 3300025931 | Ga0207644_10000003 | Ga0207644_10000003163 | 198 |
| 966 | 3300025931 | Ga0207644_10214149 | Ga0207644_102141492 | 198 |
| 967 | 3300025936 | Ga0207670_10141961 | Ga0207670_101419612 | 198 |
| 968 | 3300025941 | Ga0207711_10004612 | Ga0207711_100046124 | 198 |
| 969 | 3300025949 | Ga0207667_10001784 | Ga0207667_1000178419 | 198 |
| 970 | 3300025949 | Ga0207667_10343626 | Ga0207667_103436261 | 198 |
| 971 | 3300025972 | Ga0207668_10062723 | Ga0207668_100627233 | 198 |
| 972 | 3300025981 | Ga0207640_10000977 | Ga0207640_1000097716 | 198 |
| 973 | 3300025986 | Ga0207658_10000291 | Ga0207658_100002912 | 198 |
| 974 | 3300025986 | Ga0207658_10336403 | Ga0207658_103364032 | 198 |
| 975 | 3300026035 | Ga0207703_10035047 | Ga0207703_100350472 | 198 |
| 976 | 3300026035 | Ga0207703_10046555 | Ga0207703_100465552 | 198 |
| 977 | 3300026041 | Ga0207639_10773249 | Ga0207639_107732492 | 198 |
| 978 | 3300026088 | Ga0207641_10016967 | Ga0207641_100169672 | 198 |
| 979 | 3300026088 | Ga0207641_10020235 | Ga0207641_100202353 | 198 |
| 980 | 3300026118 | Ga0207675_100000016 | Ga0207675_10000001622 | 198 |
| 981 | 3300026142 | Ga0207698_10000193 | Ga0207698_100001933 | 198 |
| 982 | 3300028379 | Ga0268266_10001434 | Ga0268266_1000143421 | 198 |
| 983 | 3300028380 | Ga0268265_10002929 | Ga0268265_1000292915 | 198 |
| 984 | 3300028380 | Ga0268265_10022730 | Ga0268265_100227305 | 198 |
| 985 | 3300028381 | Ga0268264_10023373 | Ga0268264_100233733 | 198 |
| 986 | 3300041509 | Ga0451843_1372541 | Ga0451843_1372541_135_731 | 198 |
| 987 | 3300046471 | Ga0495650_0000842 | Ga0495650_0000842_22069_22668 | 198 |
| 988 | 3300046507 | Ga0495606_0030090 | Ga0495606_0030090_1683_2279 | 198 |
| 989 | 3300046512 | Ga0495610_0002738 | Ga0495610_0002738_4339_4935 | 198 |
| 990 | 3300046515 | Ga0495620_0044437 | Ga0495620_0044437_975_1574 | 198 |
| 991 | 3300046519 | Ga0495632_0004649 | Ga0495632_0004649_566_1165 | 198 |
| 992 | 3300046519 | Ga0495632_0359930 | Ga0495632_0359930_13_609 | 198 |
| 993 | 3300047470 | Ga0495681_0000020 | Ga0495681_0000020_112248_112847 | 198 |
| 994 | 3300048090 | Ga0495615_0000148 | Ga0495615_0000148_11915_12511 | 198 |
| 995 | 3300048091 | Ga0495626_0002994 | Ga0495626_0002994_5871_6467 | 198 |
| 996 | 3300048904 | Ga0496101_0026473 | Ga0496101_0026473_2233_2832 | 198 |
| 997 | 3300048906 | Ga0496103_0032935 | Ga0496103_0032935_791_1387 | 198 |
| 998 | 3300048907 | Ga0496104_0026054 | Ga0496104_0026054_2456_3055 | 198 |
| 999 | 3300048908 | Ga0496105_0424345 | Ga0496105_0424345_397_996 | 198 |
| 1000 | 3300048909 | Ga0496106_0002162 | Ga0496106_0002162_11067_11666 | 198 |
| 1001 | 3300048909 | Ga0496106_0981146 | Ga0496106_0981146_36_650 | 198 |
| 1002 | 3300048910 | Ga0496107_0013198 | Ga0496107_0013198_3362_3961 | 198 |
| 1003 | 3300048913 | Ga0496110_0130680 | Ga0496110_0130680_263_862 | 198 |
| 1004 | 3300048914 | Ga0496111_0087567 | Ga0496111_0087567_1505_2104 | 198 |
| 1005 | 3300048915 | Ga0496112_0450009 | Ga0496112_0450009_317_916 | 198 |
| 1006 | 3300048916 | Ga0496113_0002677 | Ga0496113_0002677_7435_8034 | 198 |
| 1007 | 3300048919 | Ga0496116_0000039 | Ga0496116_0000039_186157_186753 | 198 |
| 1008 | 3300048919 | Ga0496116_0033509 | Ga0496116_0033509_886_1482 | 198 |
| 1009 | 3300048920 | Ga0496117_0007762 | Ga0496117_0007762_6399_6998 | 198 |
| 1010 | 3300048920 | Ga0496117_0075266 | Ga0496117_0075266_1563_2159 | 198 |
| 1011 | 3300048920 | Ga0496117_0079225 | Ga0496117_0079225_293_889 | 198 |
| 1012 | 3300048920 | Ga0496117_0088769 | Ga0496117_0088769_24_620 | 198 |
| 1013 | 3300048921 | Ga0496118_0212672 | Ga0496118_0212672_330_929 | 198 |
| 1014 | 3300048922 | Ga0496119_0166789 | Ga0496119_0166789_496_1092 | 198 |
| 1015 | 3300048923 | Ga0496120_0088813 | Ga0496120_0088813_891_1490 | 198 |
| 1016 | 3300048924 | Ga0496121_0005224 | Ga0496121_0005224_6155_6751 | 198 |
| 1017 | 3300048924 | Ga0496121_0012226 | Ga0496121_0012226_8417_9013 | 198 |
| 1018 | 3300048924 | Ga0496121_0026796 | Ga0496121_0026796_3834_4433 | 198 |
| 1019 | 3300048925 | Ga0496122_0002484 | Ga0496122_0002484_11896_12492 | 198 |
| 1020 | 3300048925 | Ga0496122_0002932 | Ga0496122_0002932_21125_21721 | 198 |
| 1021 | 3300048925 | Ga0496122_0026354 | Ga0496122_0026354_606_1205 | 198 |
| 1022 | 3300048926 | Ga0496123_0003115 | Ga0496123_0003115_6548_7144 | 198 |
| 1023 | 3300048926 | Ga0496123_0009457 | Ga0496123_0009457_7651_8247 | 198 |
| 1024 | 3300048926 | Ga0496123_0017586 | Ga0496123_0017586_4884_5483 | 198 |
| 1025 | 3300048927 | Ga0496124_0006015 | Ga0496124_0006015_6634_7230 | 198 |
| 1026 | 3300048927 | Ga0496124_0174830 | Ga0496124_0174830_535_1131 | 198 |
| 1027 | 3300048927 | Ga0496124_0228181 | Ga0496124_0228181_535_1131 | 198 |
| 1028 | 3300048928 | Ga0496125_0033699 | Ga0496125_0033699_3723_4319 | 198 |
| 1029 | 3300048928 | Ga0496125_0056017 | Ga0496125_0056017_2082_2678 | 198 |
| 1030 | 3300048928 | Ga0496125_0395647 | Ga0496125_0395647_90_689 | 198 |
| 1031 | 3300048929 | Ga0496126_0000041 | Ga0496126_0000041_155147_155743 | 198 |
| 1032 | 3300048929 | Ga0496126_0007482 | Ga0496126_0007482_987_1583 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d7j-assembly1.cif.gz_A | crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 | 0.9233 | 1 | 188 |
| 1qdl-assembly1.cif.gz_B-2 | the crystal structure of anthranilate synthase from sulfolobus solfataricus | 0.9224 | 2 | 183 |
| 8gr1-assembly4.cif.gz_D | crystal structure of d110v/k151l mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase | 0.9196 | 1 | 191 |
| 7d97-assembly3.cif.gz_C | crystal structure of n109p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase | 0.9196 | 1 | 188 |
| 8gr3-assembly4.cif.gz_D | crystal structure of k151l/y158f mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase | 0.9191 | 1 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9575 | 1 | 184 | 3.40.50.880 |
| af_K7L2D7_74_267_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9475 | 2 | 184 | 3.40.50.880 |
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9376 | 1 | 184 | 3.40.50.880 |
| af_Q57690_3_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9323 | 2 | 184 | 3.40.50.880 |
| af_P9WN35_1_200_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9284 | 2 | 195 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6RZU6-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II (EC 2.6.1.85) | 1.006 | 1 | 88 |
GO:0000162
GO:0004049 GO:0005829 GO:0046820 |
| AF-A0A3B9AZP0-F1-model_v4 | deleted | 0.9894 | 2 | 154 |
|
| AF-A0A7V9DP49-F1-model_v4 | Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) | 0.9877 | 2 | 91 |
GO:0000162
GO:0004049 GO:0005829 |
| AF-A0A520XY99-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II (EC 2.6.1.85) | 0.9875 | 1 | 166 |
GO:0000162
GO:0004049 GO:0005829 GO:0046820 |
| AF-A0A533RQB3-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 0.9841 | 1 | 165 |
GO:0000162
GO:0004049 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar