F488597

General Info

Members Datasets Scaffolds Average Seq Length
1030 423 2060 121

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0100371|Ga0453684_0100371_1867_2250
Length 127
Sequence MVQSLSRLKVADNSGAKEIMIIQVLGVKKGSGYRRYARVGDIVSASVKDAIPNGTVKKGEVLHAVVIRTTKEVRRADGSYLRFDDNAAVIIDKEKKEPKATRIFGPVARELKEKGFAKIISLASEVL

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
167 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
172 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
173 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
174 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
175 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
206 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
208 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
242 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
248 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
249 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
250 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
251 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
252 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
253 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
254 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
255 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
258 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
259 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
260 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
261 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
262 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
263 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
264 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
265 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
305 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
329 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
362 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
363 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
369 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
373 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
385 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
386 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
387 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
388 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
389 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
390 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
391 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
414 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
415 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
416 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
417 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
418 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
419 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
420 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
421 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
422 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
423 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.51
Metatranscriptomes 9.42
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.1
Rhizoplane 1.07
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0100371 3300044712 Bacteria 3543
2 Ga0006777J48905_1054038 3300003308 Bacteria 1116
3 rootH2_10006221 3300003320 Bacteria 7866
4 rootH1_10011452 3300003323 Bacteria 12825
5 JGI25160J50197_1078321 3300003354 Bacteria 617
6 Ga0007417J51691_1023280 3300003544 Bacteria 1861
7 Ga0007410J51695_1028777 3300003574 Bacteria 1142
8 Ga0007429J51699_1028655 3300003579 Bacteria 1309
9 Ga0032354_1039933 3300003693 Bacteria 1244
10 Ga0006780_1016914 3300003735 Bacteria 1313
11 Ga0055542_1011755 3300003762 Bacteria 1541
12 Ga0055529_1002705 3300003763 Bacteria 3261
13 Ga0058863_10105546 3300004799 Bacteria 676
14 Ga0058863_10168574 3300004799 Bacteria 566
15 Ga0058861_10069211 3300004800 Bacteria 2465
16 Ga0058862_12647723 3300004803 Bacteria 605
17 Ga0065704_10078969 3300005289 Bacteria 4290
18 Ga0070658_10083891 3300005327 Bacteria 2620
19 Ga0070658_11091948 3300005327 Bacteria 694
20 Ga0070658_11119305 3300005327 Bacteria 685
21 Ga0070683_100036500 3300005329 Bacteria 4497
22 Ga0070683_100067211 3300005329 Bacteria 3339
23 Ga0070690_100066157 3300005330 Bacteria 2339
24 Ga0068869_100000006 3300005334 Bacteria 87287
25 Ga0068869_100843880 3300005334 Bacteria 790
26 Ga0068869_101198253 3300005334 Bacteria 667
27 Ga0068868_100042332 3300005338 Bacteria 3554
28 Ga0070660_100222987 3300005339 Bacteria 1532
29 Ga0070689_100142969 3300005340 Bacteria 1925
30 Ga0070689_101141608 3300005340 Bacteria 698
31 Ga0070661_100042151 3300005344 Bacteria 3331
32 Ga0070674_101543769 3300005356 Bacteria 598
33 Ga0070688_101488295 3300005365 Bacteria 551
34 Ga0070659_100148080 3300005366 Bacteria 1913
35 Ga0070667_100334472 3300005367 Bacteria 1369
36 Ga0070667_101171600 3300005367 Bacteria 719
37 Ga0070709_10131060 3300005434 Bacteria 1712
38 Ga0070714_100172422 3300005435 Bacteria 1964
39 Ga0070714_101045638 3300005435 Bacteria 795
40 Ga0070713_100016910 3300005436 Bacteria 5497
41 Ga0070713_100065811 3300005436 Bacteria 3046
42 Ga0070713_100302103 3300005436 Bacteria 1473
43 Ga0070711_100017546 3300005439 Bacteria 4560
44 Ga0070711_100227918 3300005439 Bacteria 1452
45 Ga0070708_101034260 3300005445 Bacteria 770
46 Ga0070678_100194014 3300005456 Bacteria 1672
47 Ga0070678_100824134 3300005456 Bacteria 844
48 Ga0070678_101265432 3300005456 Bacteria 686
49 Ga0070662_100453556 3300005457 Bacteria 1065
50 Ga0070681_10379217 3300005458 Bacteria 1325
51 Ga0070681_11135569 3300005458 Bacteria 703
52 Ga0068867_100003491 3300005459 Bacteria 11055
53 Ga0068867_100119426 3300005459 Bacteria 2035
54 Ga0068867_100233586 3300005459 Bacteria 1488
55 Ga0070706_100000179 3300005467 Bacteria 80520
56 Ga0070698_100391326 3300005471 Bacteria 1323
57 Ga0070679_100012053 3300005530 Bacteria 8254
58 Ga0070679_100356782 3300005530 Bacteria 1409
59 Ga0070679_100760746 3300005530 Bacteria 912
60 Ga0070684_100056261 3300005535 Bacteria 3432
61 Ga0070684_101218842 3300005535 Bacteria 708
62 Ga0068853_101410620 3300005539 Bacteria 674
63 Ga0070686_100113763 3300005544 Bacteria 1848
64 Ga0070686_100637224 3300005544 Bacteria 844
65 Ga0070696_100143017 3300005546 Bacteria 1750
66 Ga0070693_100486756 3300005547 Bacteria 873
67 Ga0070665_101421879 3300005548 Bacteria 702
68 Ga0070704_100111312 3300005549 Bacteria 2084
69 Ga0068855_100031040 3300005563 Bacteria 6386
70 Ga0068855_100032846 3300005563 Bacteria 6196
71 Ga0068855_100265352 3300005563 Bacteria 1911
72 Ga0068855_100314312 3300005563 Bacteria 1732
73 Ga0068855_101197100 3300005563 Bacteria 790
74 Ga0068855_101268513 3300005563 Bacteria 764
75 Ga0068855_101657858 3300005563 Bacteria 653
76 Ga0070664_100172619 3300005564 Bacteria 1918
77 Ga0070664_101057146 3300005564 Bacteria 764
78 Ga0068857_100084743 3300005577 Bacteria 2832
79 Ga0068857_100537741 3300005577 Bacteria 1100
80 Ga0068857_101981486 3300005577 Bacteria 571
81 Ga0068856_100000665 3300005614 Bacteria 37258
82 Ga0068856_100009374 3300005614 Bacteria 9508
83 Ga0068856_100022229 3300005614 Bacteria 6166
84 Ga0068856_100123991 3300005614 Bacteria 2586
85 Ga0068856_100661667 3300005614 Bacteria 1065
86 Ga0068856_100740360 3300005614 Bacteria 1003
87 Ga0068856_100890320 3300005614 Bacteria 909
88 Ga0068856_101022393 3300005614 Bacteria 845
89 Ga0068856_102659267 3300005614 Bacteria 506
90 Ga0068859_100569330 3300005617 Bacteria 1227
91 Ga0068859_101308813 3300005617 Bacteria 799
92 Ga0068859_101365862 3300005617 Bacteria 781
93 Ga0068864_101278271 3300005618 Bacteria 734
94 Ga0068864_101454499 3300005618 Bacteria 688
95 Ga0068866_10012814 3300005718 Bacteria 3662
96 Ga0068866_10463997 3300005718 Bacteria 831
97 Ga0068863_100331351 3300005841 Bacteria 1480
98 Ga0068863_101909736 3300005841 Bacteria 604
99 Ga0068858_101139743 3300005842 Bacteria 766
100 Ga0068858_101968062 3300005842 Bacteria 578
101 Ga0068860_100260330 3300005843 Bacteria 1691
102 Ga0068860_100311844 3300005843 Bacteria 1543
103 Ga0068860_101219106 3300005843 Bacteria 773
104 Ga0068860_101945657 3300005843 Bacteria 609
105 Ga0081455_10197589 3300005937 Bacteria 1509
106 Ga0081455_10508216 3300005937 Bacteria 807
107 Ga0081540_1017332 3300005983 Bacteria 4462
108 Ga0070717_10000003 3300006028 Bacteria 370103
109 Ga0070717_10916284 3300006028 Bacteria 798
110 Ga0070712_100373144 3300006175 Bacteria 1173
111 Ga0097621_100008884 3300006237 Bacteria 7265
112 Ga0097621_100099626 3300006237 Bacteria 2443
113 Ga0068871_100005514 3300006358 Bacteria 8875
114 Ga0075428_100463924 3300006844 Bacteria 1356
115 Ga0075433_10372726 3300006852 Bacteria 1261
116 Ga0075434_100162986 3300006871 Bacteria 2249
117 Ga0068865_100022521 3300006881 Bacteria 4112
118 Ga0097620_100569307 3300006931 Bacteria 1227
119 Ga0097620_101308821 3300006931 Bacteria 799
120 Ga0097620_101366311 3300006931 Bacteria 781
121 Ga0075435_100333284 3300007076 Bacteria 1300
122 Ga0075435_100590720 3300007076 Bacteria 963
123 Ga0099795_10069325 3300007788 Bacteria 1327
124 Ga0105240_10022560 3300009093 Bacteria 8342
125 Ga0105240_10083046 3300009093 Bacteria 3932
126 Ga0105240_10392335 3300009093 Bacteria 1565
127 Ga0105240_10805840 3300009093 Bacteria 1017
128 Ga0105240_10951111 3300009093 Bacteria 921
129 Ga0111539_10384047 3300009094 Bacteria 1635
130 Ga0111539_10879529 3300009094 Bacteria 1042
131 Ga0111539_11960999 3300009094 Bacteria 679
132 Ga0105245_10282125 3300009098 Bacteria 1624
133 Ga0105245_10774281 3300009098 Bacteria 996
134 Ga0105247_10001485 3300009101 Bacteria 16868
135 Ga0105247_10584722 3300009101 Bacteria 826
136 Ga0114129_10017633 3300009147 Bacteria 10165
137 Ga0105243_11684989 3300009148 Bacteria 663
138 Ga0105243_12144913 3300009148 Bacteria 595
139 Ga0105241_10170341 3300009174 Bacteria 1798
140 Ga0105248_10859292 3300009177 Bacteria 1024
141 Ga0105248_11305630 3300009177 Bacteria 821
142 Ga0105237_10268560 3300009545 Bacteria 1709
143 Ga0105237_10414975 3300009545 Bacteria 1351
144 Ga0105238_10069674 3300009551 Bacteria 3517
145 Ga0105238_10179460 3300009551 Bacteria 2094
146 Ga0105249_11005021 3300009553 Bacteria 903
147 Ga0105239_10282263 3300010375 Bacteria 1870
148 Ga0105239_10691649 3300010375 Bacteria 1166
149 Ga0157370_10039020 3300013104 Bacteria 4592
150 Ga0157370_10102675 3300013104 Bacteria 2677
151 Ga0157370_10800866 3300013104 Bacteria 857
152 Ga0157369_10044058 3300013105 Bacteria 4859
153 Ga0157369_10879848 3300013105 Bacteria 919
154 Ga0157374_11509123 3300013296 Bacteria 695
155 Ga0157374_11540241 3300013296 Bacteria 688
156 Ga0157374_11849874 3300013296 Bacteria 629
157 Ga0157374_12780126 3300013296 Bacteria 517
158 Ga0157378_10985334 3300013297 Bacteria 877
159 Ga0163162_11044659 3300013306 Bacteria 924
160 Ga0163162_12505084 3300013306 Bacteria 593
161 Ga0163162_12580083 3300013306 Bacteria 585
162 Ga0157372_10387225 3300013307 Bacteria 1629
163 Ga0157375_10275960 3300013308 Bacteria 1843
164 Ga0157375_10516732 3300013308 Unclassified 1358
165 Ga0157375_12419019 3300013308 Bacteria 627
166 Ga0157375_12975574 3300013308 Bacteria 566
167 Ga0163163_10050622 3300014325 Bacteria 4091
168 Ga0163163_10254192 3300014325 Bacteria 1808
169 Ga0163163_10254737 3300014325 Bacteria 1806
170 Ga0163163_11901933 3300014325 Bacteria 655
171 Ga0163163_12448308 3300014325 Bacteria 580
172 Ga0182008_10161173 3300014497 Bacteria 1129
173 Ga0182008_10348051 3300014497 Bacteria 785
174 Ga0157377_11712881 3300014745 Bacteria 507
175 Ga0157379_10000101 3300014968 Bacteria 58702
176 Ga0157379_10235167 3300014968 Bacteria 1661
177 Ga0157379_10986590 3300014968 Bacteria 803
178 Ga0157379_12568732 3300014968 Bacteria 510
179 Ga0157376_10024093 3300014969 Bacteria 4774
180 Ga0157376_10998821 3300014969 Bacteria 859
181 Ga0157376_12648203 3300014969 Bacteria 541
182 Ga0206356_10662339 3300020070 Bacteria 2596
183 Ga0206354_11287318 3300020081 Bacteria 1071
184 Ga0213872_10297344 3300021361 Bacteria 671
185 Ga0213876_10215195 3300021384 Bacteria 1022
186 Ga0213875_10049479 3300021388 Bacteria 1970
187 Ga0224712_10099636 3300022467 Bacteria 1230
188 Ga0256744_143262 3300023309 Bacteria 1187
189 Ga0209148_1001758 3300025254 Bacteria 9344
190 Ga0209455_1000393 3300025272 Bacteria 37949
191 Ga0209675_1026598 3300025291 Bacteria 1436
192 Ga0209676_1004347 3300025292 Bacteria 7943
193 Ga0209050_1094270 3300025298 Bacteria 606
194 Ga0209256_1018456 3300025299 Bacteria 2265
195 Ga0207426_1015852 3300025302 Bacteria 2724
196 Ga0207697_10195762 3300025315 Bacteria 888
197 Ga0207692_10111586 3300025898 Bacteria 1517
198 Ga0207642_10225442 3300025899 Bacteria 1050
199 Ga0207642_10399126 3300025899 Bacteria 822
200 Ga0207710_10001280 3300025900 Bacteria 12698
201 Ga0207710_10113684 3300025900 Bacteria 1287
202 Ga0207710_10523213 3300025900 Bacteria 616
203 Ga0207680_11337046 3300025903 Bacteria 509
204 Ga0207647_10160685 3300025904 Bacteria 1311
205 Ga0207685_10326854 3300025905 Bacteria 766
206 Ga0207699_10061870 3300025906 Bacteria 2254
207 Ga0207705_10326108 3300025909 Bacteria 1180
208 Ga0207705_10396145 3300025909 Bacteria 1067
209 Ga0207684_10000250 3300025910 Bacteria 80526
210 Ga0207684_10304431 3300025910 Bacteria 1374
211 Ga0207654_10101475 3300025911 Bacteria 1774
212 Ga0207654_10147570 3300025911 Bacteria 1506
213 Ga0207707_10340402 3300025912 Bacteria 1293
214 Ga0207695_10404994 3300025913 Bacteria 1248
215 Ga0207695_11315375 3300025913 Bacteria 603
216 Ga0207671_10638908 3300025914 Bacteria 848
217 Ga0207693_10130424 3300025915 Bacteria 1976
218 Ga0207693_10272976 3300025915 Bacteria 1325
219 Ga0207663_10014397 3300025916 Bacteria 4327
220 Ga0207662_10644378 3300025918 Bacteria 740
221 Ga0207657_10150376 3300025919 Bacteria 1897
222 Ga0207649_10277517 3300025920 Bacteria 1217
223 Ga0207652_10016079 3300025921 Bacteria 6102
224 Ga0207652_10292192 3300025921 Bacteria 1470
225 Ga0207646_11146572 3300025922 Bacteria 683
226 Ga0207646_11166834 3300025922 Bacteria 676
227 Ga0207646_11398831 3300025922 Bacteria 608
228 Ga0207694_10103617 3300025924 Bacteria 2257
229 Ga0207694_10338770 3300025924 Bacteria 1243
230 Ga0207650_10645463 3300025925 Bacteria 892
231 Ga0207687_10496531 3300025927 Bacteria 1018
232 Ga0207700_10162473 3300025928 Bacteria 1856
233 Ga0207700_10168190 3300025928 Bacteria 1827
234 Ga0207700_10987022 3300025928 Bacteria 754
235 Ga0207690_10362605 3300025932 Bacteria 1148
236 Ga0207706_10339195 3300025933 Bacteria 1307
237 Ga0207670_10141883 3300025936 Bacteria 1772
238 Ga0207670_10143169 3300025936 Bacteria 1765
239 Ga0207670_10156318 3300025936 Bacteria 1698
240 Ga0207670_11597724 3300025936 Bacteria 555
241 Ga0207704_10000857 3300025938 Bacteria 13471
242 Ga0207704_10638293 3300025938 Bacteria 876
243 Ga0207665_11133698 3300025939 Bacteria 624
244 Ga0207711_10769089 3300025941 Bacteria 897
245 Ga0207689_10000034 3300025942 Bacteria 95262
246 Ga0207689_10951337 3300025942 Bacteria 725
247 Ga0207689_11549763 3300025942 Bacteria 552
248 Ga0207661_10120534 3300025944 Bacteria 2232
249 Ga0207661_10174299 3300025944 Bacteria 1874
250 Ga0207661_11687808 3300025944 Bacteria 579
251 Ga0207679_10173720 3300025945 Bacteria 1776
252 Ga0207667_10014133 3300025949 Bacteria 9112
253 Ga0207667_10025777 3300025949 Bacteria 6432
254 Ga0207667_10209989 3300025949 Bacteria 1995
255 Ga0207667_10770860 3300025949 Bacteria 960
256 Ga0207667_10838152 3300025949 Bacteria 914
257 Ga0207667_11165627 3300025949 Bacteria 751
258 Ga0207651_11257986 3300025960 Bacteria 665
259 Ga0207658_10334026 3300025986 Bacteria 1315
260 Ga0207677_10180438 3300026023 Bacteria 1660
261 Ga0207677_10374526 3300026023 Bacteria 1200
262 Ga0207677_11339966 3300026023 Bacteria 658
263 Ga0207677_11520637 3300026023 Bacteria 618
264 Ga0207703_11855863 3300026035 Bacteria 579
265 Ga0207639_11032502 3300026041 Bacteria 770
266 Ga0207708_11197640 3300026075 Bacteria 664
267 Ga0207708_11328210 3300026075 Bacteria 630
268 Ga0207702_10000449 3300026078 Bacteria 46527
269 Ga0207702_10111875 3300026078 Bacteria 2429
270 Ga0207702_10309454 3300026078 Bacteria 1502
271 Ga0207702_10428424 3300026078 Bacteria 1280
272 Ga0207702_10464052 3300026078 Bacteria 1230
273 Ga0207702_10538832 3300026078 Bacteria 1141
274 Ga0207702_10909629 3300026078 Bacteria 872
275 Ga0207641_10134655 3300026088 Bacteria 2223
276 Ga0207641_11593405 3300026088 Bacteria 655
277 Ga0207648_10008188 3300026089 Bacteria 10161
278 Ga0207676_10612113 3300026095 Bacteria 1047
279 Ga0207676_10627767 3300026095 Bacteria 1035
280 Ga0207676_10691852 3300026095 Bacteria 987
281 Ga0207676_11191778 3300026095 Bacteria 755
282 Ga0207676_11233631 3300026095 Bacteria 742
283 Ga0207676_12110769 3300026095 Bacteria 562
284 Ga0207674_10105129 3300026116 Bacteria 2802
285 Ga0207674_10466710 3300026116 Bacteria 1220
286 Ga0207674_11240440 3300026116 Bacteria 715
287 Ga0207683_10005218 3300026121 Bacteria 11154
288 Ga0207683_10040855 3300026121 Bacteria 4049
289 Ga0207683_11945445 3300026121 Bacteria 537
290 Ga0207698_10167535 3300026142 Bacteria 1930
291 Ga0207698_10666695 3300026142 Bacteria 1032
292 Ga0209981_1007139 3300027378 Bacteria 1504
293 Ga0209588_1179380 3300027671 Bacteria 665
294 Ga0268266_10005155 3300028379 Bacteria 12306
295 Ga0268266_10814462 3300028379 Bacteria 902
296 Ga0268264_10549947 3300028381 Bacteria 1132
297 Ga0268264_10650291 3300028381 Bacteria 1043
298 Ga0268264_10782326 3300028381 Bacteria 952
299 Ga0265337_1000360 3300028556 Bacteria 24386
300 Ga0265337_1001901 3300028556 Bacteria 9942
301 Ga0265337_1002361 3300028556 Bacteria 8716
302 Ga0265337_1005756 3300028556 Bacteria 4867
303 Ga0265337_1086395 3300028556 Bacteria 856
304 Ga0265337_1127813 3300028556 Bacteria 689
305 Ga0265337_1128548 3300028556 Bacteria 687
306 Ga0265337_1129041 3300028556 Bacteria 685
307 Ga0265337_1135437 3300028556 Bacteria 667
308 Ga0265337_1165955 3300028556 Bacteria 598
309 Ga0265326_10010563 3300028558 Bacteria 2736
310 Ga0265326_10013063 3300028558 Bacteria 2432
311 Ga0265326_10033168 3300028558 Bacteria 1470
312 Ga0265326_10045568 3300028558 Bacteria 1244
313 Ga0265326_10126649 3300028558 Bacteria 727
314 Ga0265326_10129973 3300028558 Bacteria 717
315 Ga0265319_1000019 3300028563 Bacteria 154537
316 Ga0265319_1000071 3300028563 Bacteria 81543
317 Ga0265319_1000330 3300028563 Bacteria 34865
318 Ga0265319_1001949 3300028563 Bacteria 11686
319 Ga0265319_1003969 3300028563 Bacteria 7508
320 Ga0265319_1005249 3300028563 Bacteria 6250
321 Ga0265319_1011894 3300028563 Bacteria 3541
322 Ga0265319_1017646 3300028563 Bacteria 2707
323 Ga0265319_1038622 3300028563 Bacteria 1622
324 Ga0265319_1038664 3300028563 Bacteria 1621
325 Ga0265319_1061435 3300028563 Bacteria 1218
326 Ga0265319_1119777 3300028563 Bacteria 820
327 Ga0265334_10001615 3300028573 Bacteria 10823
328 Ga0265334_10001971 3300028573 Bacteria 9750
329 Ga0265334_10006043 3300028573 Bacteria 5256
330 Ga0265334_10126506 3300028573 Bacteria 911
331 Ga0265318_10000273 3300028577 Bacteria 43832
332 Ga0265318_10001387 3300028577 Bacteria 14390
333 Ga0265318_10001452 3300028577 Bacteria 13930
334 Ga0265318_10002455 3300028577 Bacteria 9914
335 Ga0265318_10004654 3300028577 Bacteria 6599
336 Ga0265318_10005117 3300028577 Bacteria 6205
337 Ga0265318_10011287 3300028577 Bacteria 3852
338 Ga0265318_10063821 3300028577 Bacteria 1370
339 Ga0265318_10090353 3300028577 Bacteria 1128
340 Ga0265318_10341094 3300028577 Bacteria 547
341 Ga0265323_10000005 3300028653 Bacteria 196003
342 Ga0265323_10000705 3300028653 Bacteria 18171
343 Ga0265323_10020264 3300028653 Bacteria 2563
344 Ga0265323_10031922 3300028653 Bacteria 1956
345 Ga0265323_10035085 3300028653 Bacteria 1850
346 Ga0265323_10151865 3300028653 Bacteria 741
347 Ga0265323_10161115 3300028653 Bacteria 715
348 Ga0265323_10179160 3300028653 Bacteria 671
349 Ga0265322_10000766 3300028654 Bacteria 11593
350 Ga0265322_10018830 3300028654 Bacteria 1982
351 Ga0265322_10152210 3300028654 Bacteria 661
352 Ga0265322_10161554 3300028654 Bacteria 641
353 Ga0265336_10005520 3300028666 Bacteria 4660
354 Ga0265336_10007611 3300028666 Bacteria 3846
355 Ga0265336_10010005 3300028666 Bacteria 3257
356 Ga0265336_10017147 3300028666 Bacteria 2360
357 Ga0307515_10072629 3300028794 Bacteria 4638
358 Ga0307515_10226254 3300028794 Bacteria 1675
359 Ga0265338_10000919 3300028800 Bacteria 49615
360 Ga0265338_10001708 3300028800 Bacteria 34832
361 Ga0265338_10004347 3300028800 Bacteria 19195
362 Ga0265338_10006820 3300028800 Bacteria 14388
363 Ga0265338_10008397 3300028800 Bacteria 12546
364 Ga0265338_10008597 3300028800 Bacteria 12354
365 Ga0265338_10009193 3300028800 Bacteria 11839
366 Ga0265338_10019380 3300028800 Bacteria 7219
367 Ga0265338_10021305 3300028800 Bacteria 6765
368 Ga0265338_10027513 3300028800 Bacteria 5702
369 Ga0265338_10027677 3300028800 Bacteria 5680
370 Ga0265338_10044480 3300028800 Bacteria 4098
371 Ga0265338_10094870 3300028800 Bacteria 2453
372 Ga0265338_10127802 3300028800 Bacteria 2013
373 Ga0265338_10128636 3300028800 Bacteria 2005
374 Ga0265338_10131632 3300028800 Bacteria 1973
375 Ga0265338_10166764 3300028800 Bacteria 1694
376 Ga0265338_10180356 3300028800 Bacteria 1611
377 Ga0265338_10342156 3300028800 Bacteria 1078
378 Ga0265338_10403247 3300028800 Bacteria 974
379 Ga0265338_10542829 3300028800 Bacteria 814
380 Ga0265338_10926768 3300028800 Bacteria 592
381 Ga0265338_11088933 3300028800 Bacteria 538
382 Ga0311004_130229 3300029276 Bacteria 1017
383 Ga0311001_1018422 3300029277 Bacteria 2218
384 Ga0310981_1067369 3300029285 Bacteria 511
385 Ga0265324_10000442 3300029957 Bacteria 29455
386 Ga0265324_10004791 3300029957 Bacteria 5979
387 Ga0265324_10008583 3300029957 Bacteria 4052
388 Ga0265324_10041126 3300029957 Bacteria 1600
389 Ga0265324_10043215 3300029957 Bacteria 1556
390 Ga0265324_10063196 3300029957 Bacteria 1264
391 Ga0265324_10077645 3300029957 Bacteria 1130
392 Ga0265324_10144406 3300029957 Bacteria 808
393 Ga0265762_1049584 3300030760 Bacteria 840
394 Ga0265330_10000998 3300031235 Bacteria 17255
395 Ga0265330_10011486 3300031235 Bacteria 4152
396 Ga0265330_10102067 3300031235 Bacteria 1228
397 Ga0265332_10000280 3300031238 Bacteria 40175
398 Ga0265332_10022104 3300031238 Bacteria 2807
399 Ga0265332_10121427 3300031238 Bacteria 1097
400 Ga0265332_10122872 3300031238 Bacteria 1090
401 Ga0265332_10198383 3300031238 Bacteria 834
402 Ga0265332_10245132 3300031238 Bacteria 741
403 Ga0265332_10277111 3300031238 Bacteria 693
404 Ga0265332_10341298 3300031238 Bacteria 618
405 Ga0265332_10396175 3300031238 Bacteria 570
406 Ga0265328_10003166 3300031239 Bacteria 7314
407 Ga0265328_10007527 3300031239 Bacteria 4535
408 Ga0265328_10035187 3300031239 Bacteria 1852
409 Ga0265328_10037312 3300031239 Bacteria 1795
410 Ga0265328_10093673 3300031239 Bacteria 1110
411 Ga0265328_10099522 3300031239 Bacteria 1076
412 Ga0265328_10125682 3300031239 Bacteria 958
413 Ga0265320_10000391 3300031240 Bacteria 35502
414 Ga0265320_10000430 3300031240 Bacteria 33126
415 Ga0265320_10000485 3300031240 Bacteria 31127
416 Ga0265320_10001512 3300031240 Bacteria 16930
417 Ga0265320_10001599 3300031240 Bacteria 16249
418 Ga0265320_10009586 3300031240 Bacteria 5829
419 Ga0265320_10010920 3300031240 Bacteria 5372
420 Ga0265320_10020032 3300031240 Bacteria 3638
421 Ga0265320_10032443 3300031240 Bacteria 2673
422 Ga0265320_10039318 3300031240 Bacteria 2367
423 Ga0265320_10041002 3300031240 Bacteria 2304
424 Ga0265320_10050473 3300031240 Bacteria 2021
425 Ga0265320_10072527 3300031240 Bacteria 1620
426 Ga0265320_10073590 3300031240 Bacteria 1605
427 Ga0265320_10147715 3300031240 Bacteria 1062
428 Ga0265320_10171510 3300031240 Bacteria 974
429 Ga0265320_10182576 3300031240 Bacteria 940
430 Ga0265320_10254192 3300031240 Bacteria 779
431 Ga0265325_10001575 3300031241 Bacteria 15904
432 Ga0265325_10025908 3300031241 Bacteria 3181
433 Ga0265325_10030183 3300031241 Bacteria 2909
434 Ga0265325_10222283 3300031241 Bacteria 864
435 Ga0265329_10000013 3300031242 Bacteria 70645
436 Ga0265329_10062936 3300031242 Bacteria 1174
437 Ga0265340_10000189 3300031247 Bacteria 31156
438 Ga0265340_10006471 3300031247 Bacteria 6446
439 Ga0265340_10010599 3300031247 Bacteria 4928
440 Ga0265340_10033404 3300031247 Bacteria 2561
441 Ga0265340_10037337 3300031247 Bacteria 2407
442 Ga0265340_10056826 3300031247 Bacteria 1882
443 Ga0265340_10120529 3300031247 Bacteria 1207
444 Ga0265339_10001407 3300031249 Bacteria 17881
445 Ga0265339_10022952 3300031249 Bacteria 3611
446 Ga0265339_10031093 3300031249 Bacteria 3019
447 Ga0265339_10039559 3300031249 Bacteria 2625
448 Ga0265339_10054237 3300031249 Bacteria 2178
449 Ga0265339_10122126 3300031249 Bacteria 1338
450 Ga0265339_10343907 3300031249 Bacteria 704
451 Ga0265339_10377502 3300031249 Bacteria 665
452 Ga0265339_10595204 3300031249 Bacteria 507
453 Ga0265331_10000543 3300031250 Bacteria 34421
454 Ga0265331_10011176 3300031250 Bacteria 4925
455 Ga0265331_10034609 3300031250 Bacteria 2490
456 Ga0265331_10040673 3300031250 Bacteria 2261
457 Ga0265331_10107681 3300031250 Bacteria 1279
458 Ga0265331_10215007 3300031250 Bacteria 865
459 Ga0265331_10349492 3300031250 Bacteria 662
460 Ga0265327_10002314 3300031251 Bacteria 20368
461 Ga0265327_10004150 3300031251 Bacteria 13074
462 Ga0265327_10006465 3300031251 Bacteria 9359
463 Ga0265327_10041880 3300031251 Bacteria 2463
464 Ga0265327_10048769 3300031251 Bacteria 2225
465 Ga0265327_10104862 3300031251 Bacteria 1359
466 Ga0265327_10430362 3300031251 Bacteria 571
467 Ga0265316_10001048 3300031344 Bacteria 29962
468 Ga0265316_10001559 3300031344 Bacteria 24560
469 Ga0265316_10002957 3300031344 Bacteria 17386
470 Ga0265316_10006174 3300031344 Bacteria 11492
471 Ga0265316_10013893 3300031344 Bacteria 7123
472 Ga0265316_10017230 3300031344 Bacteria 6249
473 Ga0265316_10021617 3300031344 Bacteria 5444
474 Ga0265316_10023098 3300031344 Bacteria 5229
475 Ga0265316_10028793 3300031344 Bacteria 4577
476 Ga0265316_10054031 3300031344 Bacteria 3145
477 Ga0265316_10112787 3300031344 Bacteria 2058
478 Ga0265316_10154095 3300031344 Bacteria 1720
479 Ga0265316_10175950 3300031344 Bacteria 1595
480 Ga0265316_10185401 3300031344 Bacteria 1548
481 Ga0265316_10252714 3300031344 Bacteria 1294
482 Ga0265316_10346653 3300031344 Bacteria 1076
483 Ga0265316_10359608 3300031344 Bacteria 1053
484 Ga0265316_10668687 3300031344 Bacteria 733
485 Ga0265316_10799617 3300031344 Bacteria 661
486 Ga0265316_10828328 3300031344 Bacteria 648
487 Ga0265316_11037340 3300031344 Bacteria 570
488 Ga0265316_11146523 3300031344 Bacteria 538
489 Ga0265316_11154711 3300031344 Bacteria 536
490 Ga0307408_100000009 3300031548 Bacteria 426576
491 Ga0307408_100076442 3300031548 Bacteria 2491
492 Ga0307408_100766687 3300031548 Bacteria 873
493 Ga0265313_10000016 3300031595 Bacteria 154004
494 Ga0265313_10000458 3300031595 Bacteria 43153
495 Ga0265313_10000463 3300031595 Bacteria 42820
496 Ga0265313_10000484 3300031595 Bacteria 41826
497 Ga0265313_10000667 3300031595 Bacteria 35343
498 Ga0265313_10000967 3300031595 Bacteria 28455
499 Ga0265313_10001355 3300031595 Bacteria 23078
500 Ga0265313_10013304 3300031595 Bacteria 4948
501 Ga0265313_10018854 3300031595 Bacteria 3861
502 Ga0265313_10136205 3300031595 Bacteria 1060
503 Ga0307508_10481615 3300031616 Bacteria 835
504 Ga0316579_10244360 3300031691 Bacteria 868
505 Ga0265314_10002804 3300031711 Bacteria 17395
506 Ga0265314_10003246 3300031711 Bacteria 15899
507 Ga0265314_10003296 3300031711 Bacteria 15770
508 Ga0265314_10008489 3300031711 Bacteria 8789
509 Ga0265314_10018694 3300031711 Bacteria 5394
510 Ga0265314_10023749 3300031711 Bacteria 4666
511 Ga0265314_10084279 3300031711 Bacteria 2087
512 Ga0265314_10091350 3300031711 Bacteria 1982
513 Ga0265314_10092900 3300031711 Bacteria 1960
514 Ga0265314_10150911 3300031711 Bacteria 1425
515 Ga0265314_10164950 3300031711 Bacteria 1344
516 Ga0265314_10207188 3300031711 Bacteria 1154
517 Ga0265314_10288030 3300031711 Bacteria 926
518 Ga0265314_10499058 3300031711 Bacteria 641
519 Ga0265342_10000471 3300031712 Bacteria 43707
520 Ga0265342_10011450 3300031712 Bacteria 6070
521 Ga0265342_10019586 3300031712 Bacteria 4359
522 Ga0265342_10052539 3300031712 Bacteria 2428
523 Ga0265342_10055789 3300031712 Bacteria 2344
524 Ga0265342_10076611 3300031712 Bacteria 1939
525 Ga0265342_10094282 3300031712 Bacteria 1713
526 Ga0265342_10155620 3300031712 Bacteria 1267
527 Ga0265342_10249931 3300031712 Bacteria 947
528 Ga0265342_10256452 3300031712 Bacteria 932
529 Ga0265342_10281360 3300031712 Bacteria 880
530 Ga0265342_10296129 3300031712 Bacteria 853
531 Ga0265342_10420711 3300031712 Bacteria 688
532 Ga0265342_10441138 3300031712 Bacteria 669
533 Ga0265342_10577983 3300031712 Bacteria 568
534 Ga0316576_10003165 3300031727 Bacteria 9597
535 Ga0316576_10126634 3300031727 Bacteria 1920
536 Ga0316578_10021235 3300031728 Bacteria 3601
537 Ga0316578_10095695 3300031728 Bacteria 1777
538 Ga0316578_10129348 3300031728 Bacteria 1519
539 Ga0316578_10445722 3300031728 Bacteria 765
540 Ga0316578_10470234 3300031728 Bacteria 742
541 Ga0307405_10098385 3300031731 Bacteria 1956
542 Ga0307405_11086155 3300031731 Bacteria 687
543 Ga0316577_10678550 3300031733 Bacteria 586
544 Ga0307413_10259796 3300031824 Bacteria 1294
545 Ga0307413_11332099 3300031824 Bacteria 629
546 Ga0307413_11789323 3300031824 Bacteria 550
547 Ga0307410_10000097 3300031852 Bacteria 30229
548 Ga0307410_10315181 3300031852 Bacteria 1239
549 Ga0307410_11851461 3300031852 Bacteria 537
550 Ga0307410_11877839 3300031852 Bacteria 533
551 Ga0307406_12019527 3300031901 Bacteria 516
552 Ga0307407_10008349 3300031903 Bacteria 4746
553 Ga0307407_10433402 3300031903 Bacteria 950
554 Ga0307409_100000037 3300031995 Bacteria 47029
555 Ga0307409_100814041 3300031995 Bacteria 942
556 Ga0307409_100967887 3300031995 Bacteria 868
557 Ga0307416_100000018 3300032002 Bacteria 200227
558 Ga0307416_102892360 3300032002 Bacteria 574
559 Ga0307414_10102967 3300032004 Bacteria 2153
560 Ga0307414_11757641 3300032004 Bacteria 578
561 Ga0307411_10984400 3300032005 Bacteria 754
562 Ga0316583_10187372 3300032133 Bacteria 719
563 Ga0316583_10204605 3300032133 Bacteria 685
564 Ga0316593_10087338 3300032168 Unclassified 1095
565 Ga0316593_10305000 3300032168 Bacteria 603
566 Ga0307507_10068536 3300033179 Bacteria 3236
567 Ga0316592_1176405 3300033524 Bacteria 510
568 Ga0316587_1034770 3300033529 Bacteria 899
569 Ga0316587_1072092 3300033529 Bacteria 647
570 Ga0373959_0021034 3300034820 Bacteria 1250
571 Ga0373959_0196683 3300034820 Bacteria 531
572 Ga0373938_0002423 3300034957 Bacteria 3007
573 Ga0373938_0025501 3300034957 Bacteria 1231
574 Ga0373926_0037278 3300035083 Bacteria 1729
575 Ga0373926_0168020 3300035083 Bacteria 839
576 Ga0373929_0225821 3300035085 Bacteria 534
577 Ga0373934_0110628 3300035086 Bacteria 1114
578 Ga0373934_0152429 3300035086 Bacteria 947
579 Ga0373951_0005223 3300035091 Bacteria 3028
580 Ga0373952_0074303 3300035092 Bacteria 856
581 Ga0373923_0102679 3300035111 Bacteria 1263
582 Ga0373936_0629211 3300035113 Bacteria 505
583 Ga0373945_0138113 3300035116 Bacteria 981
584 Ga0373953_0032690 3300035117 Bacteria 2031
585 Ga0373954_0004503 3300035118 Bacteria 5992
586 Ga0373954_0062903 3300035118 Bacteria 1754
587 Ga0373954_0102650 3300035118 Bacteria 1381
588 Ga0373954_0276416 3300035118 Bacteria 828
589 Ga0373954_0529218 3300035118 Bacteria 584
590 Ga0373954_0706079 3300035118 Bacteria 500
591 Ga0373956_0013877 3300035119 Bacteria 3356
592 Ga0373960_0152723 3300035121 Bacteria 790
593 Ga0373943_0440986 3300035170 Bacteria 756
594 Ga0373943_0535570 3300035170 Bacteria 686
595 Ga0373946_0141156 3300035171 Bacteria 1117
596 Ga0373946_0208652 3300035171 Bacteria 938
597 Ga0373942_0177862 3300035207 Bacteria 696
598 Ga0373961_0136401 3300035241 Bacteria 826
599 Ga0373931_0140469 3300035691 Bacteria 1398
600 Ga0373931_0348474 3300035691 Bacteria 926
601 Ga0373931_0521305 3300035691 Bacteria 769
602 Ga0373935_0004181 3300035692 Bacteria 8454
603 Ga0373935_0137172 3300035692 Bacteria 1649
604 Ga0373935_0202219 3300035692 Bacteria 1373
605 Ga0373935_0390479 3300035692 Bacteria 998
606 Ga0373927_0020007 3300035695 Bacteria 4390
607 Ga0373933_0072142 3300035724 Bacteria 2103
608 Ga0373933_0137097 3300035724 Bacteria 1542
609 Ga0373933_0343072 3300035724 Bacteria 970
610 Ga0373933_0494782 3300035724 Bacteria 801
611 Ga0373937_0002552 3300036401 Bacteria 15128
612 Ga0373937_0018696 3300036401 Bacteria 6192
613 Ga0373937_0046230 3300036401 Bacteria 3980
614 Ga0373937_0188429 3300036401 Bacteria 1938
615 Ga0373937_0408129 3300036401 Bacteria 1289
616 Ga0373937_0464897 3300036401 Bacteria 1201
617 Ga0373937_0710668 3300036401 Bacteria 952
618 Ga0373937_0728155 3300036401 Bacteria 939
619 Ga0373937_0812592 3300036401 Bacteria 883
620 Ga0373937_0859409 3300036401 Bacteria 856
621 Ga0373937_1508125 3300036401 Bacteria 620
622 Ga0373937_2088550 3300036401 Bacteria 513
623 Ga0316582_0245267 3300036647 Bacteria 1227
624 Ga0373925_0099158 3300037068 Bacteria 2237
625 Ga0373925_0107210 3300037068 Bacteria 2154
626 Ga0395899_0007028 3300037312 Bacteria 8708
627 Ga0395899_0215573 3300037312 Bacteria 1332
628 Ga0395900_0014228 3300037418 Bacteria 8121
629 Ga0395900_0233398 3300037418 Bacteria 1849
630 Ga0395900_1077505 3300037418 Bacteria 721
631 Ga0395898_0005690 3300037466 Bacteria 13432
632 Ga0395898_0199091 3300037466 Bacteria 1913
633 Ga0395905_0000064 3300037471 Bacteria 186494
634 Ga0395905_0092421 3300037471 Bacteria 2837
635 Ga0395905_0104459 3300037471 Bacteria 2660
636 Ga0395905_0166007 3300037471 Bacteria 2075
637 Ga0395905_0365392 3300037471 Bacteria 1336
638 Ga0436364_0710949 3300037853 Bacteria 634
639 Ga0395901_0007619 3300038443 Bacteria 10927
640 Ga0395901_0067405 3300038443 Bacteria 3727
641 Ga0395901_0171115 3300038443 Bacteria 2279
642 Ga0242420_081185 3300038996 Bacteria 670
643 Ga0400489_44614 3300039093 Bacteria 3589
644 Ga0400489_74686 3300039093 Bacteria 1261
645 Ga0436365_0174030 3300039437 Bacteria 2608
646 Ga0436365_0582907 3300039437 Bacteria 2602
647 Ga0436365_1092380 3300039437 Bacteria 1109
648 Ga0436365_1511533 3300039437 Bacteria 506
649 Ga0436360_0175680 3300039438 Bacteria 752
650 Ga0436360_0438632 3300039438 Bacteria 694
651 Ga0436360_1143196 3300039438 Bacteria 596
652 Ga0436360_1269525 3300039438 Bacteria 850
653 Ga0436361_0271121 3300039447 Bacteria 3084
654 Ga0436363_0890189 3300039450 Bacteria 1665
655 Ga0436363_0927249 3300039450 Bacteria 1053
656 Ga0436363_0942557 3300039450 Bacteria 720
657 Ga0436362_0062320 3300039453 Bacteria 690
658 Ga0436362_0877265 3300039453 Bacteria 1735
659 Ga0439461_0099089 3300041410 Bacteria 708
660 Ga0439461_0196584 3300041410 Bacteria 540
661 Ga0439465_0060703 3300041413 Bacteria 1252
662 Ga0451789_1153559 3300041443 Bacteria 528
663 Ga0451795_0900085 3300041456 Bacteria 633
664 Ga0451800_0134159 3300041459 Bacteria 586
665 Ga0451802_0891862 3300041460 Bacteria 602
666 Ga0451841_0163031 3300041498 Bacteria 586
667 Ga0451847_0366062 3300041503 Bacteria 577
668 Ga0451853_3620705 3300041512 Bacteria 535
669 Ga0439433_0075444 3300041999 Bacteria 815
670 Ga0439441_005193 3300042001 Bacteria 2009
671 Ga0439448_0011743 3300042005 Bacteria 2612
672 Ga0439454_123214 3300042011 Bacteria 503
673 Ga0439456_143619 3300042013 Bacteria 554
674 Ga0450904_033175 3300042139 Bacteria 543
675 Ga0439446_0121905 3300042156 Bacteria 840
676 Ga0450908_014907 3300042184 Bacteria 1394
677 Ga0439444_0055796 3300042437 Bacteria 813
678 Ga0451577_0000008 3300042876 Bacteria 692992
679 Ga0451577_0000155 3300042876 Bacteria 152745
680 Ga0451577_0005406 3300042876 Bacteria 13101
681 Ga0451577_0012523 3300042876 Bacteria 7965
682 Ga0451577_0015131 3300042876 Bacteria 7178
683 Ga0451577_0018419 3300042876 Bacteria 6433
684 Ga0451577_0029976 3300042876 Bacteria 4915
685 Ga0451577_0041006 3300042876 Bacteria 4157
686 Ga0451577_0090080 3300042876 Bacteria 2737
687 Ga0451577_0121976 3300042876 Bacteria 2335
688 Ga0451577_0599523 3300042876 Bacteria 1000
689 Ga0451577_0716331 3300042876 Bacteria 906
690 Ga0451577_1063144 3300042876 Bacteria 725
691 Ga0451577_1304253 3300042876 Bacteria 646
692 Ga0466969_0215308 3300044656 Bacteria 874
693 Ga0453683_0008323 3300044673 Bacteria 6969
694 Ga0453683_0014110 3300044673 Bacteria 5194
695 Ga0453683_0046011 3300044673 Bacteria 2736
696 Ga0453683_0046241 3300044673 Bacteria 2729
697 Ga0453683_0128187 3300044673 Bacteria 1598
698 Ga0453683_0150644 3300044673 Bacteria 1470
699 Ga0453683_0247322 3300044673 Bacteria 1136
700 Ga0453683_0519281 3300044673 Bacteria 774
701 Ga0453683_0554029 3300044673 Bacteria 748
702 Ga0466963_0022826 3300044694 Bacteria 3967
703 Ga0466963_1259992 3300044694 Bacteria 519
704 Ga0466964_0353405 3300044706 Bacteria 756
705 Ga0453684_0000032 3300044712 Bacteria 745626
706 Ga0453684_0000295 3300044712 Bacteria 211570
707 Ga0453684_0000652 3300044712 Bacteria 125090
708 Ga0453684_0000735 3300044712 Bacteria 114790
709 Ga0453684_0001648 3300044712 Bacteria 60626
710 Ga0453684_0005247 3300044712 Bacteria 25923
711 Ga0453684_0005256 3300044712 Bacteria 25882
712 Ga0453684_0005884 3300044712 Bacteria 23812
713 Ga0453684_0008030 3300044712 Bacteria 19098
714 Ga0453684_0017321 3300044712 Bacteria 11171
715 Ga0453684_0018447 3300044712 Bacteria 10709
716 Ga0453684_0021178 3300044712 Bacteria 9735
717 Ga0453684_0027964 3300044712 Bacteria 8066
718 Ga0453684_0028873 3300044712 Bacteria 7895
719 Ga0453684_0032832 3300044712 Bacteria 7252
720 Ga0453684_0034674 3300044712 Bacteria 6996
721 Ga0453684_0452146 3300044712 Unclassified 1430
722 Ga0453684_0491366 3300044712 Unclassified 1360
723 Ga0453684_0907100 3300044712 Bacteria 943
724 Ga0453684_1220233 3300044712 Bacteria 788
725 Ga0453684_2341387 3300044712 Bacteria 530
726 Ga0466968_0298312 3300044735 Bacteria 774
727 Ga0466957_0183869 3300044842 Bacteria 1366
728 Ga0466957_0229546 3300044842 Bacteria 1228
729 Ga0466960_0012057 3300044901 Bacteria 3638
730 Ga0466959_0069974 3300045049 Bacteria 2542
731 Ga0466959_0995691 3300045049 Bacteria 558
732 Ga0451576_0000359 3300045051 Bacteria 109461
733 Ga0451576_0001217 3300045051 Bacteria 45861
734 Ga0451576_0001406 3300045051 Bacteria 41324
735 Ga0451576_0024674 3300045051 Bacteria 6490
736 Ga0451576_0041265 3300045051 Bacteria 4880
737 Ga0451576_0063827 3300045051 Bacteria 3838
738 Ga0451576_0071392 3300045051 Bacteria 3614
739 Ga0451576_0183249 3300045051 Bacteria 2186
740 Ga0451576_0220524 3300045051 Bacteria 1980
741 Ga0451576_0239449 3300045051 Bacteria 1895
742 Ga0451576_0246100 3300045051 Bacteria 1868
743 Ga0451576_0972395 3300045051 Bacteria 890
744 Ga0451576_1403756 3300045051 Bacteria 727
745 Ga0451576_2202948 3300045051 Bacteria 566
746 Ga0466967_0047822 3300045976 Bacteria 3731
747 Ga0466967_0149825 3300045976 Bacteria 2179
748 Ga0495629_0006700 3300046459 Bacteria 8518
749 Ga0495638_0555916 3300046460 Bacteria 570
750 Ga0495651_0320902 3300046462 Bacteria 1033
751 Ga0495651_0415726 3300046462 Bacteria 875
752 Ga0495653_0290394 3300046463 Bacteria 1070
753 Ga0495653_0301149 3300046463 Bacteria 1046
754 Ga0495650_0201763 3300046471 Bacteria 691
755 Ga0495580_0002023 3300046472 Bacteria 17847
756 Ga0495580_0755560 3300046472 Bacteria 633
757 Ga0495662_0590705 3300046476 Bacteria 543
758 Ga0495664_0133998 3300046477 Bacteria 1501
759 Ga0495664_0450866 3300046477 Bacteria 770
760 Ga0495594_0785771 3300046499 Bacteria 537
761 Ga0495608_0153947 3300046511 Bacteria 1464
762 Ga0495618_0001918 3300046514 Bacteria 13659
763 Ga0495628_0433552 3300046516 Bacteria 956
764 Ga0495628_0746891 3300046516 Bacteria 688
765 Ga0495630_0042073 3300046517 Bacteria 3412
766 Ga0495630_0315808 3300046517 Bacteria 1194
767 Ga0495630_0337163 3300046517 Bacteria 1153
768 Ga0495630_0409409 3300046517 Bacteria 1039
769 Ga0495666_0314756 3300046526 Bacteria 707
770 Ga0495640_0045519 3300046533 Bacteria 3044
771 Ga0495640_0058160 3300046533 Bacteria 2637
772 Ga0495586_0001064 3300046535 Bacteria 15493
773 Ga0495586_0053812 3300046535 Bacteria 2181
774 Ga0495586_0082158 3300046535 Bacteria 1771
775 Ga0495586_0720612 3300046535 Bacteria 576
776 Ga0495587_0091265 3300046536 Bacteria 1760
777 Ga0495587_0095081 3300046536 Bacteria 1720
778 Ga0495645_0051583 3300046543 Bacteria 2993
779 Ga0495645_0245886 3300046543 Bacteria 1191
780 Ga0495622_0007056 3300046557 Bacteria 5217
781 Ga0495667_0009232 3300046559 Bacteria 6690
782 Ga0495667_0026521 3300046559 Bacteria 3906
783 Ga0495634_0003274 3300046642 Bacteria 13068
784 Ga0495634_0354668 3300046642 Bacteria 878
785 Ga0495635_0220001 3300046663 Bacteria 1284
786 Ga0495635_0271209 3300046663 Bacteria 1141
787 Ga0495657_0175934 3300046675 Bacteria 1316
788 Ga0495599_0401489 3300046678 Bacteria 816
789 Ga0495623_0297556 3300046679 Bacteria 893
790 Ga0495647_0012537 3300046681 Bacteria 2921
791 Ga0495658_0132955 3300046683 Bacteria 1516
792 Ga0495658_0292522 3300046683 Bacteria 1029
793 Ga0495613_0003460 3300046689 Bacteria 11805
794 Ga0495613_0279663 3300046689 Bacteria 1159
795 Ga0495589_0090822 3300046794 Bacteria 1483
796 Ga0495581_0374774 3300047315 Bacteria 830
797 Ga0495604_0098575 3300047317 Bacteria 2153
798 Ga0495604_0204701 3300047317 Bacteria 1367
799 Ga0495604_0445116 3300047317 Bacteria 847
800 Ga0495674_0589133 3300047319 Bacteria 882
801 Ga0495674_0972041 3300047319 Bacteria 652
802 Ga0495680_0002262 3300047322 Bacteria 19840
803 Ga0495680_0062109 3300047322 Bacteria 2873
804 Ga0495680_0072824 3300047322 Bacteria 2613
805 Ga0495680_0149335 3300047322 Bacteria 1705
806 Ga0495680_0432662 3300047322 Bacteria 903
807 Ga0495680_0998486 3300047322 Bacteria 535
808 Ga0495675_0074423 3300047444 Bacteria 2140
809 Ga0495675_0193052 3300047444 Bacteria 1242
810 Ga0495684_0011576 3300047471 Bacteria 6810
811 Ga0496102_0472002 3300048905 Bacteria 1176
812 Ga0496104_0663294 3300048907 Bacteria 952
813 Ga0496106_0548259 3300048909 Bacteria 928
814 Ga0496108_1657028 3300048911 Bacteria 528
815 Ga0496109_1708833 3300048912 Bacteria 563
816 Ga0496113_1059593 3300048916 Bacteria 637
817 Ga0496115_0002169 3300048918 Bacteria 14046
818 Ga0496122_0082526 3300048925 Bacteria 2232
819 Ga0496126_0261908 3300048929 Bacteria 1437
820 Ga0501306_013124 3300049127 Bacteria 1076
821 Ga0501308_000183 3300049128 Bacteria 3467
822 Ga0501308_002435 3300049128 Bacteria 1633
823 Ga0501308_002563 3300049128 Bacteria 1603
824 Ga0501308_006720 3300049128 Bacteria 1187
825 Ga0501308_038280 3300049128 Bacteria 668
826 Ga0501309_001317 3300049129 Bacteria 2394
827 Ga0501310_009303 3300049130 Bacteria 1081
828 Ga0501304_001532 3300049160 Bacteria 1499
829 Ga0501304_003315 3300049160 Bacteria 1173
830 Ga0501304_039633 3300049160 Bacteria 523
831 Ga0501305_000001 3300049161 Bacteria 19709
832 Ga0501305_000061 3300049161 Bacteria 6159
833 Ga0501305_000471 3300049161 Bacteria 3305
834 Ga0501305_002606 3300049161 Bacteria 1963
835 Ga0501305_004945 3300049161 Bacteria 1591
836 Ga0501305_100090 3300049161 Bacteria 539
837 Ga0501307_000001 3300049162 Bacteria 10981
838 Ga0501307_000032 3300049162 Bacteria 5115
839 Ga0501307_001064 3300049162 Bacteria 2181
840 Ga0501307_023200 3300049162 Bacteria 821
841 Ga0501307_039449 3300049162 Bacteria 682
842 Ga0501290_013054 3300049513 Bacteria 1080
843 Ga0501311_014812 3300049527 Bacteria 1000
844 Ga0501311_029576 3300049527 Bacteria 787
845 Ga0501311_067889 3300049527 Bacteria 587
846 Ga0501312_000001 3300049528 Bacteria 18666
847 Ga0501312_000189 3300049528 Bacteria 4164
848 Ga0501312_014217 3300049528 Bacteria 1116
849 Ga0501312_033006 3300049528 Bacteria 820
850 Ga0501313_000478 3300049529 Bacteria 2757
851 Ga0501314_002402 3300049530 Bacteria 1445
852 Ga0501314_008769 3300049530 Bacteria 919
853 Ga0501315_001006 3300049531 Bacteria 2240
854 Ga0501315_008983 3300049531 Bacteria 1174
855 Ga0501315_044361 3300049531 Bacteria 682
856 Ga0501315_087658 3300049531 Bacteria 536
857 Ga0501317_003139 3300049533 Bacteria 1620
858 Ga0501318_032067 3300049534 Bacteria 719
859 Ga0501319_021214 3300049535 Bacteria 583
860 Ga0501320_000452 3300049536 Bacteria 2385
861 Ga0501322_003879 3300049538 Bacteria 986
862 Ga0501322_004168 3300049538 Bacteria 963
863 Ga0501323_009259 3300049539 Bacteria 1158
864 Ga0501323_026805 3300049539 Bacteria 791
865 Ga0501324_013372 3300049540 Bacteria 777
866 Ga0501325_001022 3300049541 Bacteria 1598
867 Ga0501326_08908 3300049542 Bacteria 588
868 Ga0501328_03494 3300049544 Bacteria 730
869 Ga0501329_11162 3300049545 Bacteria 570
870 Ga0501330_007402 3300049546 Bacteria 735
871 Ga0501335_004292 3300049551 Bacteria 1240
872 Ga0501340_004049 3300049556 Bacteria 911
873 Ga0501031_0000292 3300049568 Bacteria 28530
874 Ga0501031_0002762 3300049568 Bacteria 11183
875 Ga0501031_0040058 3300049568 Bacteria 3059
876 Ga0501032_0006919 3300049569 Bacteria 8314
877 Ga0501032_0017049 3300049569 Bacteria 5103
878 Ga0501032_0017943 3300049569 Bacteria 4964
879 Ga0501032_0189366 3300049569 Bacteria 1345
880 Ga0501032_0422583 3300049569 Bacteria 855
881 Ga0501032_0729790 3300049569 Bacteria 627
882 Ga0501033_0005284 3300049570 Bacteria 10246
883 Ga0501033_0008437 3300049570 Bacteria 7980
884 Ga0501033_0013322 3300049570 Bacteria 6266
885 Ga0501033_0040145 3300049570 Bacteria 3494
886 Ga0501033_0315314 3300049570 Bacteria 1099
887 Ga0501034_0199162 3300049571 Bacteria 1961
888 Ga0501034_0235529 3300049571 Bacteria 1778
889 Ga0501034_0296379 3300049571 Bacteria 1554
890 Ga0501034_0519636 3300049571 Bacteria 1102
891 Ga0501034_0663193 3300049571 Bacteria 944
892 Ga0501034_1104864 3300049571 Bacteria 674
893 Ga0501034_1313952 3300049571 Bacteria 600
894 Ga0501036_0004436 3300049572 Bacteria 11340
895 Ga0501036_0895177 3300049572 Bacteria 729
896 Ga0501037_0011831 3300049573 Bacteria 6427
897 Ga0501037_0094984 3300049573 Bacteria 2155
898 Ga0501037_0319656 3300049573 Bacteria 1075
899 Ga0501037_0428287 3300049573 Bacteria 905
900 Ga0501037_0491451 3300049573 Bacteria 833
901 Ga0501037_1041238 3300049573 Bacteria 532
902 Ga0501038_0004183 3300049574 Bacteria 13419
903 Ga0501038_0186569 3300049574 Bacteria 1671
904 Ga0501038_0291423 3300049574 Bacteria 1283
905 Ga0501038_1000122 3300049574 Bacteria 614
906 Ga0501039_0001456 3300049575 Bacteria 17399
907 Ga0501039_0130275 3300049575 Bacteria 1974
908 Ga0501039_0956610 3300049575 Bacteria 666
909 Ga0501042_0203844 3300049578 Bacteria 1426
910 Ga0501043_0059008 3300049579 Bacteria 3011
911 Ga0501043_0205183 3300049579 Bacteria 1528
912 Ga0501043_0212858 3300049579 Bacteria 1498
913 Ga0501046_0005999 3300049580 Bacteria 10806
914 Ga0501046_0051585 3300049580 Bacteria 3245
915 Ga0501047_0017441 3300049581 Bacteria 6876
916 Ga0501047_0024791 3300049581 Bacteria 5758
917 Ga0501047_0079634 3300049581 Bacteria 3149
918 Ga0501047_0175418 3300049581 Bacteria 2011
919 Ga0501047_1020753 3300049581 Bacteria 640
920 Ga0501047_1378381 3300049581 Bacteria 520
921 Ga0501048_0004214 3300049582 Bacteria 10960
922 Ga0501048_0015870 3300049582 Bacteria 5558
923 Ga0501067_0240095 3300049583 Bacteria 1008
924 Ga0501068_0023470 3300049584 Bacteria 3615
925 Ga0501068_0035924 3300049584 Bacteria 2960
926 Ga0501069_0577610 3300049585 Bacteria 674
927 Ga0501070_0056055 3300049586 Bacteria 3267
928 Ga0501070_0134563 3300049586 Bacteria 2041
929 Ga0501070_0354300 3300049586 Bacteria 1191
930 Ga0501070_0974744 3300049586 Bacteria 658
931 Ga0501070_1217159 3300049586 Bacteria 577
932 Ga0501072_0335612 3300049588 Bacteria 1201
933 Ga0501072_1140106 3300049588 Bacteria 606
934 Ga0501073_0196982 3300049589 Bacteria 1393
935 Ga0501073_0561515 3300049589 Bacteria 788
936 Ga0501077_0423070 3300049593 Bacteria 852
937 Ga0501207_111022 3300049654 Bacteria 560
938 Ga0501243_001912 3300049675 Bacteria 3034
939 Ga0501080_0160800 3300049742 Bacteria 2074
940 Ga0501080_0164222 3300049742 Bacteria 2050
941 Ga0501080_0215135 3300049742 Bacteria 1760
942 Ga0501080_0239349 3300049742 Bacteria 1657
943 Ga0501080_0279589 3300049742 Bacteria 1518
944 Ga0501080_0688706 3300049742 Bacteria 902
945 Ga0501080_1194520 3300049742 Bacteria 654
946 Ga0501080_1824672 3300049742 Bacteria 510
947 Ga0501083_0001752 3300049744 Bacteria 14807
948 Ga0501083_0081088 3300049744 Bacteria 2151
949 Ga0501083_0158585 3300049744 Bacteria 1481
950 Ga0501083_0235988 3300049744 Bacteria 1191
951 Ga0501263_012115 3300049760 Bacteria 1078
952 Ga0501264_027166 3300049761 Bacteria 640
953 Ga0501035_0004187 3300049822 Bacteria 13710
954 Ga0501035_0032346 3300049822 Bacteria 4759
955 Ga0501035_0040870 3300049822 Bacteria 4189
956 Ga0501035_0170044 3300049822 Bacteria 1883
957 Ga0501044_0000427 3300049823 Bacteria 52004
958 Ga0501044_0011226 3300049823 Bacteria 9713
959 Ga0501044_0019577 3300049823 Bacteria 7236
960 Ga0501044_0027412 3300049823 Bacteria 6021
961 Ga0501044_0041072 3300049823 Bacteria 4815
962 Ga0501044_0200112 3300049823 Bacteria 1956
963 Ga0501044_0310874 3300049823 Bacteria 1502
964 Ga0501044_0976879 3300049823 Bacteria 719
965 Ga0501044_1170077 3300049823 Bacteria 637
966 Ga0501045_0584478 3300049824 Bacteria 827
967 nmdc:mga05p37_210959_c1 3300050507 Bacteria 2348
968 nmdc:mga06r32_598805_c1 3300050510 Bacteria 1073
969 nmdc:mga0n895_13026_c1 3300050512 Bacteria 7481
970 nmdc:mga0rr50_1300481_c1 3300050513 Bacteria 617
971 nmdc:mga0rr50_1845542_c1 3300050513 Bacteria 508
972 nmdc:mga0a205_54866_c1 3300050515 Bacteria 3848
973 Ga0495595_0228738 3300053084 Bacteria 929
974 Ga0495619_0665693 3300053085 Bacteria 709
975 Ga0495619_0876621 3300053085 Bacteria 605
976 Ga0495619_1116779 3300053085 Bacteria 524
977 Ga0500643_009589 3300053087 Bacteria 3687
978 Ga0500644_0009620 3300053088 Bacteria 2592
979 Ga0500644_0064003 3300053088 Bacteria 1305
980 Ga0500647_0175632 3300053091 Bacteria 986
981 Ga0500566_0076538 3300053094 Bacteria 1870
982 Ga0500642_0091653 3300053130 Bacteria 1405
983 Ga0500652_111558 3300053131 Bacteria 1143
984 Ga0500588_0004535 3300053146 Bacteria 3018
985 Ga0500616_0035635 3300053153 Bacteria 2705
986 Ga0500616_0118534 3300053153 Bacteria 1268
987 Ga0500636_0503809 3300053177 Bacteria 534
988 Ga0500645_027583 3300053730 Bacteria 1721
989 Ga0501084_0006405 3300054114 Bacteria 9676
990 Ga0501084_0655366 3300054114 Bacteria 886
991 Ga0590077_112427 3300059426 Bacteria 641
992 Ga0587070_025179 3300059491 Bacteria 1036
993 Ga0587073_0086591 3300059492 Bacteria 788
994 Ga0587073_0198834 3300059492 Bacteria 600
995 Ga0587077_000219 3300059493 Bacteria 4107
996 Ga0587082_106977 3300059504 Bacteria 617
997 Ga0587083_0009094 3300059505 Bacteria 1575
998 Ga0587085_008578 3300059506 Bacteria 1308
999 Ga0587085_032298 3300059506 Bacteria 868
1000 Ga0587086_001313 3300059507 Bacteria 2110
1001 Ga0587088_035195 3300059508 Bacteria 917
1002 Ga0587090_000239 3300059510 Bacteria 4051
1003 Ga0587125_070150 3300059607 Bacteria 528
1004 Ga0587101_000303 3300059623 Bacteria 3204
1005 Ga0587101_058593 3300059623 Bacteria 682
1006 Ga0587128_113790 3300059630 Bacteria 581
1007 Ga0587068_001246 3300059641 Bacteria 2782
1008 Ga0587076_002597 3300059645 Bacteria 2045
1009 Ga0587078_000387 3300059646 Bacteria 3211
1010 Ga0587111_0000057 3300060346 Bacteria 6907
1011 Ga0587111_0000079 3300060346 Bacteria 5946
1012 Ga0587111_0041192 3300060346 Bacteria 985
1013 Ga0587111_0121513 3300060346 Bacteria 673
1014 Ga0501082_0069836 3300060353 Bacteria 3025
1015 Ga0501082_0091200 3300060353 Bacteria 2631
1016 Ga0501082_0237307 3300060353 Bacteria 1587
1017 Ga0501082_0329537 3300060353 Bacteria 1330
1018 Ga0501082_1257835 3300060353 Bacteria 647
1019 Ga0501082_1910676 3300060353 Bacteria 518
1020 2512032383 2511231221 Bacteria 6846400
1021 2524609943 2524023250 Bacteria 5457705
1022 2599105617 2597490356 Bacteria 7030811
1023 2788433948 2786546940 Bacteria 6396474
1024 2842335157 2842333319 Bacteria 8899485
1025 2846954697 2846952575 Bacteria 6587527
1026 2848859036 2848858292 Bacteria 7391279
1027 2883294827 2883291878 Bacteria 5894118
1028 2883356687 2883354860 Bacteria 5865246
1029 2897804176 2897803580 Bacteria 7000062
1030 8054005931 8054002106 Bacteria 7987183
1031 Ga0453684_0100371
1032 Ga0006777J48905_1054038
1033 rootH2_10006221
1034 rootH1_10011452
1035 JGI25160J50197_1078321
1036 Ga0007417J51691_1023280
1037 Ga0007410J51695_1028777
1038 Ga0007429J51699_1028655
1039 Ga0032354_1039933
1040 Ga0006780_1016914
1041 Ga0055542_1011755
1042 Ga0055529_1002705
1043 Ga0058863_10105546
1044 Ga0058863_10168574
1045 Ga0058861_10069211
1046 Ga0058862_12647723
1047 Ga0065704_10078969
1048 Ga0070658_10083891
1049 Ga0070658_11091948
1050 Ga0070658_11119305
1051 Ga0070683_100036500
1052 Ga0070683_100067211
1053 Ga0070690_100066157
1054 Ga0068869_100000006
1055 Ga0068869_100843880
1056 Ga0068869_101198253
1057 Ga0068868_100042332
1058 Ga0070660_100222987
1059 Ga0070689_100142969
1060 Ga0070689_101141608
1061 Ga0070661_100042151
1062 Ga0070674_101543769
1063 Ga0070688_101488295
1064 Ga0070659_100148080
1065 Ga0070667_100334472
1066 Ga0070667_101171600
1067 Ga0070709_10131060
1068 Ga0070714_100172422
1069 Ga0070714_101045638
1070 Ga0070713_100016910
1071 Ga0070713_100065811
1072 Ga0070713_100302103
1073 Ga0070711_100017546
1074 Ga0070711_100227918
1075 Ga0070708_101034260
1076 Ga0070678_100194014
1077 Ga0070678_100824134
1078 Ga0070678_101265432
1079 Ga0070662_100453556
1080 Ga0070681_10379217
1081 Ga0070681_11135569
1082 Ga0068867_100003491
1083 Ga0068867_100119426
1084 Ga0068867_100233586
1085 Ga0070706_100000179
1086 Ga0070698_100391326
1087 Ga0070679_100012053
1088 Ga0070679_100356782
1089 Ga0070679_100760746
1090 Ga0070684_100056261
1091 Ga0070684_101218842
1092 Ga0068853_101410620
1093 Ga0070686_100113763
1094 Ga0070686_100637224
1095 Ga0070696_100143017
1096 Ga0070693_100486756
1097 Ga0070665_101421879
1098 Ga0070704_100111312
1099 Ga0068855_100031040
1100 Ga0068855_100032846
1101 Ga0068855_100265352
1102 Ga0068855_100314312
1103 Ga0068855_101197100
1104 Ga0068855_101268513
1105 Ga0068855_101657858
1106 Ga0070664_100172619
1107 Ga0070664_101057146
1108 Ga0068857_100084743
1109 Ga0068857_100537741
1110 Ga0068857_101981486
1111 Ga0068856_100000665
1112 Ga0068856_100009374
1113 Ga0068856_100022229
1114 Ga0068856_100123991
1115 Ga0068856_100661667
1116 Ga0068856_100740360
1117 Ga0068856_100890320
1118 Ga0068856_101022393
1119 Ga0068856_102659267
1120 Ga0068859_100569330
1121 Ga0068859_101308813
1122 Ga0068859_101365862
1123 Ga0068864_101278271
1124 Ga0068864_101454499
1125 Ga0068866_10012814
1126 Ga0068866_10463997
1127 Ga0068863_100331351
1128 Ga0068863_101909736
1129 Ga0068858_101139743
1130 Ga0068858_101968062
1131 Ga0068860_100260330
1132 Ga0068860_100311844
1133 Ga0068860_101219106
1134 Ga0068860_101945657
1135 Ga0081455_10197589
1136 Ga0081455_10508216
1137 Ga0081540_1017332
1138 Ga0070717_10000003
1139 Ga0070717_10916284
1140 Ga0070712_100373144
1141 Ga0097621_100008884
1142 Ga0097621_100099626
1143 Ga0068871_100005514
1144 Ga0075428_100463924
1145 Ga0075433_10372726
1146 Ga0075434_100162986
1147 Ga0068865_100022521
1148 Ga0097620_100569307
1149 Ga0097620_101308821
1150 Ga0097620_101366311
1151 Ga0075435_100333284
1152 Ga0075435_100590720
1153 Ga0099795_10069325
1154 Ga0105240_10022560
1155 Ga0105240_10083046
1156 Ga0105240_10392335
1157 Ga0105240_10805840
1158 Ga0105240_10951111
1159 Ga0111539_10384047
1160 Ga0111539_10879529
1161 Ga0111539_11960999
1162 Ga0105245_10282125
1163 Ga0105245_10774281
1164 Ga0105247_10001485
1165 Ga0105247_10584722
1166 Ga0114129_10017633
1167 Ga0105243_11684989
1168 Ga0105243_12144913
1169 Ga0105241_10170341
1170 Ga0105248_10859292
1171 Ga0105248_11305630
1172 Ga0105237_10268560
1173 Ga0105237_10414975
1174 Ga0105238_10069674
1175 Ga0105238_10179460
1176 Ga0105249_11005021
1177 Ga0105239_10282263
1178 Ga0105239_10691649
1179 Ga0157370_10039020
1180 Ga0157370_10102675
1181 Ga0157370_10800866
1182 Ga0157369_10044058
1183 Ga0157369_10879848
1184 Ga0157374_11509123
1185 Ga0157374_11540241
1186 Ga0157374_11849874
1187 Ga0157374_12780126
1188 Ga0157378_10985334
1189 Ga0163162_11044659
1190 Ga0163162_12505084
1191 Ga0163162_12580083
1192 Ga0157372_10387225
1193 Ga0157375_10275960
1194 Ga0157375_10516732
1195 Ga0157375_12419019
1196 Ga0157375_12975574
1197 Ga0163163_10050622
1198 Ga0163163_10254192
1199 Ga0163163_10254737
1200 Ga0163163_11901933
1201 Ga0163163_12448308
1202 Ga0182008_10161173
1203 Ga0182008_10348051
1204 Ga0157377_11712881
1205 Ga0157379_10000101
1206 Ga0157379_10235167
1207 Ga0157379_10986590
1208 Ga0157379_12568732
1209 Ga0157376_10024093
1210 Ga0157376_10998821
1211 Ga0157376_12648203
1212 Ga0206356_10662339
1213 Ga0206354_11287318
1214 Ga0213872_10297344
1215 Ga0213876_10215195
1216 Ga0213875_10049479
1217 Ga0224712_10099636
1218 Ga0256744_143262
1219 Ga0209148_1001758
1220 Ga0209455_1000393
1221 Ga0209675_1026598
1222 Ga0209676_1004347
1223 Ga0209050_1094270
1224 Ga0209256_1018456
1225 Ga0207426_1015852
1226 Ga0207697_10195762
1227 Ga0207692_10111586
1228 Ga0207642_10225442
1229 Ga0207642_10399126
1230 Ga0207710_10001280
1231 Ga0207710_10113684
1232 Ga0207710_10523213
1233 Ga0207680_11337046
1234 Ga0207647_10160685
1235 Ga0207685_10326854
1236 Ga0207699_10061870
1237 Ga0207705_10326108
1238 Ga0207705_10396145
1239 Ga0207684_10000250
1240 Ga0207684_10304431
1241 Ga0207654_10101475
1242 Ga0207654_10147570
1243 Ga0207707_10340402
1244 Ga0207695_10404994
1245 Ga0207695_11315375
1246 Ga0207671_10638908
1247 Ga0207693_10130424
1248 Ga0207693_10272976
1249 Ga0207663_10014397
1250 Ga0207662_10644378
1251 Ga0207657_10150376
1252 Ga0207649_10277517
1253 Ga0207652_10016079
1254 Ga0207652_10292192
1255 Ga0207646_11146572
1256 Ga0207646_11166834
1257 Ga0207646_11398831
1258 Ga0207694_10103617
1259 Ga0207694_10338770
1260 Ga0207650_10645463
1261 Ga0207687_10496531
1262 Ga0207700_10162473
1263 Ga0207700_10168190
1264 Ga0207700_10987022
1265 Ga0207690_10362605
1266 Ga0207706_10339195
1267 Ga0207670_10141883
1268 Ga0207670_10143169
1269 Ga0207670_10156318
1270 Ga0207670_11597724
1271 Ga0207704_10000857
1272 Ga0207704_10638293
1273 Ga0207665_11133698
1274 Ga0207711_10769089
1275 Ga0207689_10000034
1276 Ga0207689_10951337
1277 Ga0207689_11549763
1278 Ga0207661_10120534
1279 Ga0207661_10174299
1280 Ga0207661_11687808
1281 Ga0207679_10173720
1282 Ga0207667_10014133
1283 Ga0207667_10025777
1284 Ga0207667_10209989
1285 Ga0207667_10770860
1286 Ga0207667_10838152
1287 Ga0207667_11165627
1288 Ga0207651_11257986
1289 Ga0207658_10334026
1290 Ga0207677_10180438
1291 Ga0207677_10374526
1292 Ga0207677_11339966
1293 Ga0207677_11520637
1294 Ga0207703_11855863
1295 Ga0207639_11032502
1296 Ga0207708_11197640
1297 Ga0207708_11328210
1298 Ga0207702_10000449
1299 Ga0207702_10111875
1300 Ga0207702_10309454
1301 Ga0207702_10428424
1302 Ga0207702_10464052
1303 Ga0207702_10538832
1304 Ga0207702_10909629
1305 Ga0207641_10134655
1306 Ga0207641_11593405
1307 Ga0207648_10008188
1308 Ga0207676_10612113
1309 Ga0207676_10627767
1310 Ga0207676_10691852
1311 Ga0207676_11191778
1312 Ga0207676_11233631
1313 Ga0207676_12110769
1314 Ga0207674_10105129
1315 Ga0207674_10466710
1316 Ga0207674_11240440
1317 Ga0207683_10005218
1318 Ga0207683_10040855
1319 Ga0207683_11945445
1320 Ga0207698_10167535
1321 Ga0207698_10666695
1322 Ga0209981_1007139
1323 Ga0209588_1179380
1324 Ga0268266_10005155
1325 Ga0268266_10814462
1326 Ga0268264_10549947
1327 Ga0268264_10650291
1328 Ga0268264_10782326
1329 Ga0265337_1000360
1330 Ga0265337_1001901
1331 Ga0265337_1002361
1332 Ga0265337_1005756
1333 Ga0265337_1086395
1334 Ga0265337_1127813
1335 Ga0265337_1128548
1336 Ga0265337_1129041
1337 Ga0265337_1135437
1338 Ga0265337_1165955
1339 Ga0265326_10010563
1340 Ga0265326_10013063
1341 Ga0265326_10033168
1342 Ga0265326_10045568
1343 Ga0265326_10126649
1344 Ga0265326_10129973
1345 Ga0265319_1000019
1346 Ga0265319_1000071
1347 Ga0265319_1000330
1348 Ga0265319_1001949
1349 Ga0265319_1003969
1350 Ga0265319_1005249
1351 Ga0265319_1011894
1352 Ga0265319_1017646
1353 Ga0265319_1038622
1354 Ga0265319_1038664
1355 Ga0265319_1061435
1356 Ga0265319_1119777
1357 Ga0265334_10001615
1358 Ga0265334_10001971
1359 Ga0265334_10006043
1360 Ga0265334_10126506
1361 Ga0265318_10000273
1362 Ga0265318_10001387
1363 Ga0265318_10001452
1364 Ga0265318_10002455
1365 Ga0265318_10004654
1366 Ga0265318_10005117
1367 Ga0265318_10011287
1368 Ga0265318_10063821
1369 Ga0265318_10090353
1370 Ga0265318_10341094
1371 Ga0265323_10000005
1372 Ga0265323_10000705
1373 Ga0265323_10020264
1374 Ga0265323_10031922
1375 Ga0265323_10035085
1376 Ga0265323_10151865
1377 Ga0265323_10161115
1378 Ga0265323_10179160
1379 Ga0265322_10000766
1380 Ga0265322_10018830
1381 Ga0265322_10152210
1382 Ga0265322_10161554
1383 Ga0265336_10005520
1384 Ga0265336_10007611
1385 Ga0265336_10010005
1386 Ga0265336_10017147
1387 Ga0307515_10072629
1388 Ga0307515_10226254
1389 Ga0265338_10000919
1390 Ga0265338_10001708
1391 Ga0265338_10004347
1392 Ga0265338_10006820
1393 Ga0265338_10008397
1394 Ga0265338_10008597
1395 Ga0265338_10009193
1396 Ga0265338_10019380
1397 Ga0265338_10021305
1398 Ga0265338_10027513
1399 Ga0265338_10027677
1400 Ga0265338_10044480
1401 Ga0265338_10094870
1402 Ga0265338_10127802
1403 Ga0265338_10128636
1404 Ga0265338_10131632
1405 Ga0265338_10166764
1406 Ga0265338_10180356
1407 Ga0265338_10342156
1408 Ga0265338_10403247
1409 Ga0265338_10542829
1410 Ga0265338_10926768
1411 Ga0265338_11088933
1412 Ga0311004_130229
1413 Ga0311001_1018422
1414 Ga0310981_1067369
1415 Ga0265324_10000442
1416 Ga0265324_10004791
1417 Ga0265324_10008583
1418 Ga0265324_10041126
1419 Ga0265324_10043215
1420 Ga0265324_10063196
1421 Ga0265324_10077645
1422 Ga0265324_10144406
1423 Ga0265762_1049584
1424 Ga0265330_10000998
1425 Ga0265330_10011486
1426 Ga0265330_10102067
1427 Ga0265332_10000280
1428 Ga0265332_10022104
1429 Ga0265332_10121427
1430 Ga0265332_10122872
1431 Ga0265332_10198383
1432 Ga0265332_10245132
1433 Ga0265332_10277111
1434 Ga0265332_10341298
1435 Ga0265332_10396175
1436 Ga0265328_10003166
1437 Ga0265328_10007527
1438 Ga0265328_10035187
1439 Ga0265328_10037312
1440 Ga0265328_10093673
1441 Ga0265328_10099522
1442 Ga0265328_10125682
1443 Ga0265320_10000391
1444 Ga0265320_10000430
1445 Ga0265320_10000485
1446 Ga0265320_10001512
1447 Ga0265320_10001599
1448 Ga0265320_10009586
1449 Ga0265320_10010920
1450 Ga0265320_10020032
1451 Ga0265320_10032443
1452 Ga0265320_10039318
1453 Ga0265320_10041002
1454 Ga0265320_10050473
1455 Ga0265320_10072527
1456 Ga0265320_10073590
1457 Ga0265320_10147715
1458 Ga0265320_10171510
1459 Ga0265320_10182576
1460 Ga0265320_10254192
1461 Ga0265325_10001575
1462 Ga0265325_10025908
1463 Ga0265325_10030183
1464 Ga0265325_10222283
1465 Ga0265329_10000013
1466 Ga0265329_10062936
1467 Ga0265340_10000189
1468 Ga0265340_10006471
1469 Ga0265340_10010599
1470 Ga0265340_10033404
1471 Ga0265340_10037337
1472 Ga0265340_10056826
1473 Ga0265340_10120529
1474 Ga0265339_10001407
1475 Ga0265339_10022952
1476 Ga0265339_10031093
1477 Ga0265339_10039559
1478 Ga0265339_10054237
1479 Ga0265339_10122126
1480 Ga0265339_10343907
1481 Ga0265339_10377502
1482 Ga0265339_10595204
1483 Ga0265331_10000543
1484 Ga0265331_10011176
1485 Ga0265331_10034609
1486 Ga0265331_10040673
1487 Ga0265331_10107681
1488 Ga0265331_10215007
1489 Ga0265331_10349492
1490 Ga0265327_10002314
1491 Ga0265327_10004150
1492 Ga0265327_10006465
1493 Ga0265327_10041880
1494 Ga0265327_10048769
1495 Ga0265327_10104862
1496 Ga0265327_10430362
1497 Ga0265316_10001048
1498 Ga0265316_10001559
1499 Ga0265316_10002957
1500 Ga0265316_10006174
1501 Ga0265316_10013893
1502 Ga0265316_10017230
1503 Ga0265316_10021617
1504 Ga0265316_10023098
1505 Ga0265316_10028793
1506 Ga0265316_10054031
1507 Ga0265316_10112787
1508 Ga0265316_10154095
1509 Ga0265316_10175950
1510 Ga0265316_10185401
1511 Ga0265316_10252714
1512 Ga0265316_10346653
1513 Ga0265316_10359608
1514 Ga0265316_10668687
1515 Ga0265316_10799617
1516 Ga0265316_10828328
1517 Ga0265316_11037340
1518 Ga0265316_11146523
1519 Ga0265316_11154711
1520 Ga0307408_100000009
1521 Ga0307408_100076442
1522 Ga0307408_100766687
1523 Ga0265313_10000016
1524 Ga0265313_10000458
1525 Ga0265313_10000463
1526 Ga0265313_10000484
1527 Ga0265313_10000667
1528 Ga0265313_10000967
1529 Ga0265313_10001355
1530 Ga0265313_10013304
1531 Ga0265313_10018854
1532 Ga0265313_10136205
1533 Ga0307508_10481615
1534 Ga0316579_10244360
1535 Ga0265314_10002804
1536 Ga0265314_10003246
1537 Ga0265314_10003296
1538 Ga0265314_10008489
1539 Ga0265314_10018694
1540 Ga0265314_10023749
1541 Ga0265314_10084279
1542 Ga0265314_10091350
1543 Ga0265314_10092900
1544 Ga0265314_10150911
1545 Ga0265314_10164950
1546 Ga0265314_10207188
1547 Ga0265314_10288030
1548 Ga0265314_10499058
1549 Ga0265342_10000471
1550 Ga0265342_10011450
1551 Ga0265342_10019586
1552 Ga0265342_10052539
1553 Ga0265342_10055789
1554 Ga0265342_10076611
1555 Ga0265342_10094282
1556 Ga0265342_10155620
1557 Ga0265342_10249931
1558 Ga0265342_10256452
1559 Ga0265342_10281360
1560 Ga0265342_10296129
1561 Ga0265342_10420711
1562 Ga0265342_10441138
1563 Ga0265342_10577983
1564 Ga0316576_10003165
1565 Ga0316576_10126634
1566 Ga0316578_10021235
1567 Ga0316578_10095695
1568 Ga0316578_10129348
1569 Ga0316578_10445722
1570 Ga0316578_10470234
1571 Ga0307405_10098385
1572 Ga0307405_11086155
1573 Ga0316577_10678550
1574 Ga0307413_10259796
1575 Ga0307413_11332099
1576 Ga0307413_11789323
1577 Ga0307410_10000097
1578 Ga0307410_10315181
1579 Ga0307410_11851461
1580 Ga0307410_11877839
1581 Ga0307406_12019527
1582 Ga0307407_10008349
1583 Ga0307407_10433402
1584 Ga0307409_100000037
1585 Ga0307409_100814041
1586 Ga0307409_100967887
1587 Ga0307416_100000018
1588 Ga0307416_102892360
1589 Ga0307414_10102967
1590 Ga0307414_11757641
1591 Ga0307411_10984400
1592 Ga0316583_10187372
1593 Ga0316583_10204605
1594 Ga0316593_10087338
1595 Ga0316593_10305000
1596 Ga0307507_10068536
1597 Ga0316592_1176405
1598 Ga0316587_1034770
1599 Ga0316587_1072092
1600 Ga0373959_0021034
1601 Ga0373959_0196683
1602 Ga0373938_0002423
1603 Ga0373938_0025501
1604 Ga0373926_0037278
1605 Ga0373926_0168020
1606 Ga0373929_0225821
1607 Ga0373934_0110628
1608 Ga0373934_0152429
1609 Ga0373951_0005223
1610 Ga0373952_0074303
1611 Ga0373923_0102679
1612 Ga0373936_0629211
1613 Ga0373945_0138113
1614 Ga0373953_0032690
1615 Ga0373954_0004503
1616 Ga0373954_0062903
1617 Ga0373954_0102650
1618 Ga0373954_0276416
1619 Ga0373954_0529218
1620 Ga0373954_0706079
1621 Ga0373956_0013877
1622 Ga0373960_0152723
1623 Ga0373943_0440986
1624 Ga0373943_0535570
1625 Ga0373946_0141156
1626 Ga0373946_0208652
1627 Ga0373942_0177862
1628 Ga0373961_0136401
1629 Ga0373931_0140469
1630 Ga0373931_0348474
1631 Ga0373931_0521305
1632 Ga0373935_0004181
1633 Ga0373935_0137172
1634 Ga0373935_0202219
1635 Ga0373935_0390479
1636 Ga0373927_0020007
1637 Ga0373933_0072142
1638 Ga0373933_0137097
1639 Ga0373933_0343072
1640 Ga0373933_0494782
1641 Ga0373937_0002552
1642 Ga0373937_0018696
1643 Ga0373937_0046230
1644 Ga0373937_0188429
1645 Ga0373937_0408129
1646 Ga0373937_0464897
1647 Ga0373937_0710668
1648 Ga0373937_0728155
1649 Ga0373937_0812592
1650 Ga0373937_0859409
1651 Ga0373937_1508125
1652 Ga0373937_2088550
1653 Ga0316582_0245267
1654 Ga0373925_0099158
1655 Ga0373925_0107210
1656 Ga0395899_0007028
1657 Ga0395899_0215573
1658 Ga0395900_0014228
1659 Ga0395900_0233398
1660 Ga0395900_1077505
1661 Ga0395898_0005690
1662 Ga0395898_0199091
1663 Ga0395905_0000064
1664 Ga0395905_0092421
1665 Ga0395905_0104459
1666 Ga0395905_0166007
1667 Ga0395905_0365392
1668 Ga0436364_0710949
1669 Ga0395901_0007619
1670 Ga0395901_0067405
1671 Ga0395901_0171115
1672 Ga0242420_081185
1673 Ga0400489_44614
1674 Ga0400489_74686
1675 Ga0436365_0174030
1676 Ga0436365_0582907
1677 Ga0436365_1092380
1678 Ga0436365_1511533
1679 Ga0436360_0175680
1680 Ga0436360_0438632
1681 Ga0436360_1143196
1682 Ga0436360_1269525
1683 Ga0436361_0271121
1684 Ga0436363_0890189
1685 Ga0436363_0927249
1686 Ga0436363_0942557
1687 Ga0436362_0062320
1688 Ga0436362_0877265
1689 Ga0439461_0099089
1690 Ga0439461_0196584
1691 Ga0439465_0060703
1692 Ga0451789_1153559
1693 Ga0451795_0900085
1694 Ga0451800_0134159
1695 Ga0451802_0891862
1696 Ga0451841_0163031
1697 Ga0451847_0366062
1698 Ga0451853_3620705
1699 Ga0439433_0075444
1700 Ga0439441_005193
1701 Ga0439448_0011743
1702 Ga0439454_123214
1703 Ga0439456_143619
1704 Ga0450904_033175
1705 Ga0439446_0121905
1706 Ga0450908_014907
1707 Ga0439444_0055796
1708 Ga0451577_0000008
1709 Ga0451577_0000155
1710 Ga0451577_0005406
1711 Ga0451577_0012523
1712 Ga0451577_0015131
1713 Ga0451577_0018419
1714 Ga0451577_0029976
1715 Ga0451577_0041006
1716 Ga0451577_0090080
1717 Ga0451577_0121976
1718 Ga0451577_0599523
1719 Ga0451577_0716331
1720 Ga0451577_1063144
1721 Ga0451577_1304253
1722 Ga0466969_0215308
1723 Ga0453683_0008323
1724 Ga0453683_0014110
1725 Ga0453683_0046011
1726 Ga0453683_0046241
1727 Ga0453683_0128187
1728 Ga0453683_0150644
1729 Ga0453683_0247322
1730 Ga0453683_0519281
1731 Ga0453683_0554029
1732 Ga0466963_0022826
1733 Ga0466963_1259992
1734 Ga0466964_0353405
1735 Ga0453684_0000032
1736 Ga0453684_0000295
1737 Ga0453684_0000652
1738 Ga0453684_0000735
1739 Ga0453684_0001648
1740 Ga0453684_0005247
1741 Ga0453684_0005256
1742 Ga0453684_0005884
1743 Ga0453684_0008030
1744 Ga0453684_0017321
1745 Ga0453684_0018447
1746 Ga0453684_0021178
1747 Ga0453684_0027964
1748 Ga0453684_0028873
1749 Ga0453684_0032832
1750 Ga0453684_0034674
1751 Ga0453684_0452146
1752 Ga0453684_0491366
1753 Ga0453684_0907100
1754 Ga0453684_1220233
1755 Ga0453684_2341387
1756 Ga0466968_0298312
1757 Ga0466957_0183869
1758 Ga0466957_0229546
1759 Ga0466960_0012057
1760 Ga0466959_0069974
1761 Ga0466959_0995691
1762 Ga0451576_0000359
1763 Ga0451576_0001217
1764 Ga0451576_0001406
1765 Ga0451576_0024674
1766 Ga0451576_0041265
1767 Ga0451576_0063827
1768 Ga0451576_0071392
1769 Ga0451576_0183249
1770 Ga0451576_0220524
1771 Ga0451576_0239449
1772 Ga0451576_0246100
1773 Ga0451576_0972395
1774 Ga0451576_1403756
1775 Ga0451576_2202948
1776 Ga0466967_0047822
1777 Ga0466967_0149825
1778 Ga0495629_0006700
1779 Ga0495638_0555916
1780 Ga0495651_0320902
1781 Ga0495651_0415726
1782 Ga0495653_0290394
1783 Ga0495653_0301149
1784 Ga0495650_0201763
1785 Ga0495580_0002023
1786 Ga0495580_0755560
1787 Ga0495662_0590705
1788 Ga0495664_0133998
1789 Ga0495664_0450866
1790 Ga0495594_0785771
1791 Ga0495608_0153947
1792 Ga0495618_0001918
1793 Ga0495628_0433552
1794 Ga0495628_0746891
1795 Ga0495630_0042073
1796 Ga0495630_0315808
1797 Ga0495630_0337163
1798 Ga0495630_0409409
1799 Ga0495666_0314756
1800 Ga0495640_0045519
1801 Ga0495640_0058160
1802 Ga0495586_0001064
1803 Ga0495586_0053812
1804 Ga0495586_0082158
1805 Ga0495586_0720612
1806 Ga0495587_0091265
1807 Ga0495587_0095081
1808 Ga0495645_0051583
1809 Ga0495645_0245886
1810 Ga0495622_0007056
1811 Ga0495667_0009232
1812 Ga0495667_0026521
1813 Ga0495634_0003274
1814 Ga0495634_0354668
1815 Ga0495635_0220001
1816 Ga0495635_0271209
1817 Ga0495657_0175934
1818 Ga0495599_0401489
1819 Ga0495623_0297556
1820 Ga0495647_0012537
1821 Ga0495658_0132955
1822 Ga0495658_0292522
1823 Ga0495613_0003460
1824 Ga0495613_0279663
1825 Ga0495589_0090822
1826 Ga0495581_0374774
1827 Ga0495604_0098575
1828 Ga0495604_0204701
1829 Ga0495604_0445116
1830 Ga0495674_0589133
1831 Ga0495674_0972041
1832 Ga0495680_0002262
1833 Ga0495680_0062109
1834 Ga0495680_0072824
1835 Ga0495680_0149335
1836 Ga0495680_0432662
1837 Ga0495680_0998486
1838 Ga0495675_0074423
1839 Ga0495675_0193052
1840 Ga0495684_0011576
1841 Ga0496102_0472002
1842 Ga0496104_0663294
1843 Ga0496106_0548259
1844 Ga0496108_1657028
1845 Ga0496109_1708833
1846 Ga0496113_1059593
1847 Ga0496115_0002169
1848 Ga0496122_0082526
1849 Ga0496126_0261908
1850 Ga0501306_013124
1851 Ga0501308_000183
1852 Ga0501308_002435
1853 Ga0501308_002563
1854 Ga0501308_006720
1855 Ga0501308_038280
1856 Ga0501309_001317
1857 Ga0501310_009303
1858 Ga0501304_001532
1859 Ga0501304_003315
1860 Ga0501304_039633
1861 Ga0501305_000001
1862 Ga0501305_000061
1863 Ga0501305_000471
1864 Ga0501305_002606
1865 Ga0501305_004945
1866 Ga0501305_100090
1867 Ga0501307_000001
1868 Ga0501307_000032
1869 Ga0501307_001064
1870 Ga0501307_023200
1871 Ga0501307_039449
1872 Ga0501290_013054
1873 Ga0501311_014812
1874 Ga0501311_029576
1875 Ga0501311_067889
1876 Ga0501312_000001
1877 Ga0501312_000189
1878 Ga0501312_014217
1879 Ga0501312_033006
1880 Ga0501313_000478
1881 Ga0501314_002402
1882 Ga0501314_008769
1883 Ga0501315_001006
1884 Ga0501315_008983
1885 Ga0501315_044361
1886 Ga0501315_087658
1887 Ga0501317_003139
1888 Ga0501318_032067
1889 Ga0501319_021214
1890 Ga0501320_000452
1891 Ga0501322_003879
1892 Ga0501322_004168
1893 Ga0501323_009259
1894 Ga0501323_026805
1895 Ga0501324_013372
1896 Ga0501325_001022
1897 Ga0501326_08908
1898 Ga0501328_03494
1899 Ga0501329_11162
1900 Ga0501330_007402
1901 Ga0501335_004292
1902 Ga0501340_004049
1903 Ga0501031_0000292
1904 Ga0501031_0002762
1905 Ga0501031_0040058
1906 Ga0501032_0006919
1907 Ga0501032_0017049
1908 Ga0501032_0017943
1909 Ga0501032_0189366
1910 Ga0501032_0422583
1911 Ga0501032_0729790
1912 Ga0501033_0005284
1913 Ga0501033_0008437
1914 Ga0501033_0013322
1915 Ga0501033_0040145
1916 Ga0501033_0315314
1917 Ga0501034_0199162
1918 Ga0501034_0235529
1919 Ga0501034_0296379
1920 Ga0501034_0519636
1921 Ga0501034_0663193
1922 Ga0501034_1104864
1923 Ga0501034_1313952
1924 Ga0501036_0004436
1925 Ga0501036_0895177
1926 Ga0501037_0011831
1927 Ga0501037_0094984
1928 Ga0501037_0319656
1929 Ga0501037_0428287
1930 Ga0501037_0491451
1931 Ga0501037_1041238
1932 Ga0501038_0004183
1933 Ga0501038_0186569
1934 Ga0501038_0291423
1935 Ga0501038_1000122
1936 Ga0501039_0001456
1937 Ga0501039_0130275
1938 Ga0501039_0956610
1939 Ga0501042_0203844
1940 Ga0501043_0059008
1941 Ga0501043_0205183
1942 Ga0501043_0212858
1943 Ga0501046_0005999
1944 Ga0501046_0051585
1945 Ga0501047_0017441
1946 Ga0501047_0024791
1947 Ga0501047_0079634
1948 Ga0501047_0175418
1949 Ga0501047_1020753
1950 Ga0501047_1378381
1951 Ga0501048_0004214
1952 Ga0501048_0015870
1953 Ga0501067_0240095
1954 Ga0501068_0023470
1955 Ga0501068_0035924
1956 Ga0501069_0577610
1957 Ga0501070_0056055
1958 Ga0501070_0134563
1959 Ga0501070_0354300
1960 Ga0501070_0974744
1961 Ga0501070_1217159
1962 Ga0501072_0335612
1963 Ga0501072_1140106
1964 Ga0501073_0196982
1965 Ga0501073_0561515
1966 Ga0501077_0423070
1967 Ga0501207_111022
1968 Ga0501243_001912
1969 Ga0501080_0160800
1970 Ga0501080_0164222
1971 Ga0501080_0215135
1972 Ga0501080_0239349
1973 Ga0501080_0279589
1974 Ga0501080_0688706
1975 Ga0501080_1194520
1976 Ga0501080_1824672
1977 Ga0501083_0001752
1978 Ga0501083_0081088
1979 Ga0501083_0158585
1980 Ga0501083_0235988
1981 Ga0501263_012115
1982 Ga0501264_027166
1983 Ga0501035_0004187
1984 Ga0501035_0032346
1985 Ga0501035_0040870
1986 Ga0501035_0170044
1987 Ga0501044_0000427
1988 Ga0501044_0011226
1989 Ga0501044_0019577
1990 Ga0501044_0027412
1991 Ga0501044_0041072
1992 Ga0501044_0200112
1993 Ga0501044_0310874
1994 Ga0501044_0976879
1995 Ga0501044_1170077
1996 Ga0501045_0584478
1997 nmdc:mga05p37_210959_c1
1998 nmdc:mga06r32_598805_c1
1999 nmdc:mga0n895_13026_c1
2000 nmdc:mga0rr50_1300481_c1
2001 nmdc:mga0rr50_1845542_c1
2002 nmdc:mga0a205_54866_c1
2003 Ga0495595_0228738
2004 Ga0495619_0665693
2005 Ga0495619_0876621
2006 Ga0495619_1116779
2007 Ga0500643_009589
2008 Ga0500644_0009620
2009 Ga0500644_0064003
2010 Ga0500647_0175632
2011 Ga0500566_0076538
2012 Ga0500642_0091653
2013 Ga0500652_111558
2014 Ga0500588_0004535
2015 Ga0500616_0035635
2016 Ga0500616_0118534
2017 Ga0500636_0503809
2018 Ga0500645_027583
2019 Ga0501084_0006405
2020 Ga0501084_0655366
2021 Ga0590077_112427
2022 Ga0587070_025179
2023 Ga0587073_0086591
2024 Ga0587073_0198834
2025 Ga0587077_000219
2026 Ga0587082_106977
2027 Ga0587083_0009094
2028 Ga0587085_008578
2029 Ga0587085_032298
2030 Ga0587086_001313
2031 Ga0587088_035195
2032 Ga0587090_000239
2033 Ga0587125_070150
2034 Ga0587101_000303
2035 Ga0587101_058593
2036 Ga0587128_113790
2037 Ga0587068_001246
2038 Ga0587076_002597
2039 Ga0587078_000387
2040 Ga0587111_0000057
2041 Ga0587111_0000079
2042 Ga0587111_0041192
2043 Ga0587111_0121513
2044 Ga0501082_0069836
2045 Ga0501082_0091200
2046 Ga0501082_0237307
2047 Ga0501082_0329537
2048 Ga0501082_1257835
2049 Ga0501082_1910676
2050 2512032383
2051 2524609943
2052 2599105617
2053 2788433948
2054 2842335157
2055 2846954697
2056 2848859036
2057 2883294827
2058 2883356687
2059 2897804176
2060 8054005931

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00238

Ribosomal_L14

Ribosomal protein L14p/L23e

1

127

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a57-assembly1.cif.gz_N cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. 0.988 1 122
4v9a-assembly1.cif.gz_BN crystal structure of the 70s ribosome with tetracycline. 0.9867 1 122
4wf9-assembly1.cif.gz_H the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin 0.9859 1 122
5jvh-assembly1.cif.gz_H the crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin 0.985 1 122
7y41-assembly1.cif.gz_L mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.9845 1 122
ID Description Score Start End Superfamily
6ddgW00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9777 2 121 2.40.150.20
6ddgW00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9698 2 121 2.40.150.20
3i1nK00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9515 1 121 2.40.150.20
1vw4I00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9411 1 122 2.40.150.20
1vw4I00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9336 1 122 2.40.150.20
ID Description Score Start End GO Terms
AF-A0A434CQN6-F1-model_v4 50S ribosomal protein L14 1.005 1 65 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-W4SMQ2-F1-model_v4 50S ribosomal protein L14 1.002 1 61 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A3B8K637-F1-model_v4 deleted 1.002 1 57
AF-A0A371BCY3-F1-model_v4 Large ribosomal subunit protein uL14 1.001 1 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A833NL55-F1-model_v4 deleted 0.9996 1 61

Map