F488597
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1030 | 423 | 2060 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0100371|Ga0453684_0100371_1867_2250 |
| Length | 127 |
| Sequence | MVQSLSRLKVADNSGAKEIMIIQVLGVKKGSGYRRYARVGDIVSASVKDAIPNGTVKKGEVLHAVVIRTTKEVRRADGSYLRFDDNAAVIIDKEKKEPKATRIFGPVARELKEKGFAKIISLASEVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300029276 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 172 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 173 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 174 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 206 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 208 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 242 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 248 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 249 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 250 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 255 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 256 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 257 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 258 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 259 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 260 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 261 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 262 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 263 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 264 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 265 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 268 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 329 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 369 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 373 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 385 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 387 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 389 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 390 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 391 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 394 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 396 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 414 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 415 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 416 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 417 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 418 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 419 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 420 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 421 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 422 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 423 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.51 |
| Metatranscriptomes | 9.42 |
| Isolates | 1.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.14 |
| Nodule | 0.1 |
| Rhizoplane | 1.07 |
| Rhizosphere | 93.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0100371 | 3300044712 | Bacteria | 3543 |
| 2 | Ga0006777J48905_1054038 | 3300003308 | Bacteria | 1116 |
| 3 | rootH2_10006221 | 3300003320 | Bacteria | 7866 |
| 4 | rootH1_10011452 | 3300003323 | Bacteria | 12825 |
| 5 | JGI25160J50197_1078321 | 3300003354 | Bacteria | 617 |
| 6 | Ga0007417J51691_1023280 | 3300003544 | Bacteria | 1861 |
| 7 | Ga0007410J51695_1028777 | 3300003574 | Bacteria | 1142 |
| 8 | Ga0007429J51699_1028655 | 3300003579 | Bacteria | 1309 |
| 9 | Ga0032354_1039933 | 3300003693 | Bacteria | 1244 |
| 10 | Ga0006780_1016914 | 3300003735 | Bacteria | 1313 |
| 11 | Ga0055542_1011755 | 3300003762 | Bacteria | 1541 |
| 12 | Ga0055529_1002705 | 3300003763 | Bacteria | 3261 |
| 13 | Ga0058863_10105546 | 3300004799 | Bacteria | 676 |
| 14 | Ga0058863_10168574 | 3300004799 | Bacteria | 566 |
| 15 | Ga0058861_10069211 | 3300004800 | Bacteria | 2465 |
| 16 | Ga0058862_12647723 | 3300004803 | Bacteria | 605 |
| 17 | Ga0065704_10078969 | 3300005289 | Bacteria | 4290 |
| 18 | Ga0070658_10083891 | 3300005327 | Bacteria | 2620 |
| 19 | Ga0070658_11091948 | 3300005327 | Bacteria | 694 |
| 20 | Ga0070658_11119305 | 3300005327 | Bacteria | 685 |
| 21 | Ga0070683_100036500 | 3300005329 | Bacteria | 4497 |
| 22 | Ga0070683_100067211 | 3300005329 | Bacteria | 3339 |
| 23 | Ga0070690_100066157 | 3300005330 | Bacteria | 2339 |
| 24 | Ga0068869_100000006 | 3300005334 | Bacteria | 87287 |
| 25 | Ga0068869_100843880 | 3300005334 | Bacteria | 790 |
| 26 | Ga0068869_101198253 | 3300005334 | Bacteria | 667 |
| 27 | Ga0068868_100042332 | 3300005338 | Bacteria | 3554 |
| 28 | Ga0070660_100222987 | 3300005339 | Bacteria | 1532 |
| 29 | Ga0070689_100142969 | 3300005340 | Bacteria | 1925 |
| 30 | Ga0070689_101141608 | 3300005340 | Bacteria | 698 |
| 31 | Ga0070661_100042151 | 3300005344 | Bacteria | 3331 |
| 32 | Ga0070674_101543769 | 3300005356 | Bacteria | 598 |
| 33 | Ga0070688_101488295 | 3300005365 | Bacteria | 551 |
| 34 | Ga0070659_100148080 | 3300005366 | Bacteria | 1913 |
| 35 | Ga0070667_100334472 | 3300005367 | Bacteria | 1369 |
| 36 | Ga0070667_101171600 | 3300005367 | Bacteria | 719 |
| 37 | Ga0070709_10131060 | 3300005434 | Bacteria | 1712 |
| 38 | Ga0070714_100172422 | 3300005435 | Bacteria | 1964 |
| 39 | Ga0070714_101045638 | 3300005435 | Bacteria | 795 |
| 40 | Ga0070713_100016910 | 3300005436 | Bacteria | 5497 |
| 41 | Ga0070713_100065811 | 3300005436 | Bacteria | 3046 |
| 42 | Ga0070713_100302103 | 3300005436 | Bacteria | 1473 |
| 43 | Ga0070711_100017546 | 3300005439 | Bacteria | 4560 |
| 44 | Ga0070711_100227918 | 3300005439 | Bacteria | 1452 |
| 45 | Ga0070708_101034260 | 3300005445 | Bacteria | 770 |
| 46 | Ga0070678_100194014 | 3300005456 | Bacteria | 1672 |
| 47 | Ga0070678_100824134 | 3300005456 | Bacteria | 844 |
| 48 | Ga0070678_101265432 | 3300005456 | Bacteria | 686 |
| 49 | Ga0070662_100453556 | 3300005457 | Bacteria | 1065 |
| 50 | Ga0070681_10379217 | 3300005458 | Bacteria | 1325 |
| 51 | Ga0070681_11135569 | 3300005458 | Bacteria | 703 |
| 52 | Ga0068867_100003491 | 3300005459 | Bacteria | 11055 |
| 53 | Ga0068867_100119426 | 3300005459 | Bacteria | 2035 |
| 54 | Ga0068867_100233586 | 3300005459 | Bacteria | 1488 |
| 55 | Ga0070706_100000179 | 3300005467 | Bacteria | 80520 |
| 56 | Ga0070698_100391326 | 3300005471 | Bacteria | 1323 |
| 57 | Ga0070679_100012053 | 3300005530 | Bacteria | 8254 |
| 58 | Ga0070679_100356782 | 3300005530 | Bacteria | 1409 |
| 59 | Ga0070679_100760746 | 3300005530 | Bacteria | 912 |
| 60 | Ga0070684_100056261 | 3300005535 | Bacteria | 3432 |
| 61 | Ga0070684_101218842 | 3300005535 | Bacteria | 708 |
| 62 | Ga0068853_101410620 | 3300005539 | Bacteria | 674 |
| 63 | Ga0070686_100113763 | 3300005544 | Bacteria | 1848 |
| 64 | Ga0070686_100637224 | 3300005544 | Bacteria | 844 |
| 65 | Ga0070696_100143017 | 3300005546 | Bacteria | 1750 |
| 66 | Ga0070693_100486756 | 3300005547 | Bacteria | 873 |
| 67 | Ga0070665_101421879 | 3300005548 | Bacteria | 702 |
| 68 | Ga0070704_100111312 | 3300005549 | Bacteria | 2084 |
| 69 | Ga0068855_100031040 | 3300005563 | Bacteria | 6386 |
| 70 | Ga0068855_100032846 | 3300005563 | Bacteria | 6196 |
| 71 | Ga0068855_100265352 | 3300005563 | Bacteria | 1911 |
| 72 | Ga0068855_100314312 | 3300005563 | Bacteria | 1732 |
| 73 | Ga0068855_101197100 | 3300005563 | Bacteria | 790 |
| 74 | Ga0068855_101268513 | 3300005563 | Bacteria | 764 |
| 75 | Ga0068855_101657858 | 3300005563 | Bacteria | 653 |
| 76 | Ga0070664_100172619 | 3300005564 | Bacteria | 1918 |
| 77 | Ga0070664_101057146 | 3300005564 | Bacteria | 764 |
| 78 | Ga0068857_100084743 | 3300005577 | Bacteria | 2832 |
| 79 | Ga0068857_100537741 | 3300005577 | Bacteria | 1100 |
| 80 | Ga0068857_101981486 | 3300005577 | Bacteria | 571 |
| 81 | Ga0068856_100000665 | 3300005614 | Bacteria | 37258 |
| 82 | Ga0068856_100009374 | 3300005614 | Bacteria | 9508 |
| 83 | Ga0068856_100022229 | 3300005614 | Bacteria | 6166 |
| 84 | Ga0068856_100123991 | 3300005614 | Bacteria | 2586 |
| 85 | Ga0068856_100661667 | 3300005614 | Bacteria | 1065 |
| 86 | Ga0068856_100740360 | 3300005614 | Bacteria | 1003 |
| 87 | Ga0068856_100890320 | 3300005614 | Bacteria | 909 |
| 88 | Ga0068856_101022393 | 3300005614 | Bacteria | 845 |
| 89 | Ga0068856_102659267 | 3300005614 | Bacteria | 506 |
| 90 | Ga0068859_100569330 | 3300005617 | Bacteria | 1227 |
| 91 | Ga0068859_101308813 | 3300005617 | Bacteria | 799 |
| 92 | Ga0068859_101365862 | 3300005617 | Bacteria | 781 |
| 93 | Ga0068864_101278271 | 3300005618 | Bacteria | 734 |
| 94 | Ga0068864_101454499 | 3300005618 | Bacteria | 688 |
| 95 | Ga0068866_10012814 | 3300005718 | Bacteria | 3662 |
| 96 | Ga0068866_10463997 | 3300005718 | Bacteria | 831 |
| 97 | Ga0068863_100331351 | 3300005841 | Bacteria | 1480 |
| 98 | Ga0068863_101909736 | 3300005841 | Bacteria | 604 |
| 99 | Ga0068858_101139743 | 3300005842 | Bacteria | 766 |
| 100 | Ga0068858_101968062 | 3300005842 | Bacteria | 578 |
| 101 | Ga0068860_100260330 | 3300005843 | Bacteria | 1691 |
| 102 | Ga0068860_100311844 | 3300005843 | Bacteria | 1543 |
| 103 | Ga0068860_101219106 | 3300005843 | Bacteria | 773 |
| 104 | Ga0068860_101945657 | 3300005843 | Bacteria | 609 |
| 105 | Ga0081455_10197589 | 3300005937 | Bacteria | 1509 |
| 106 | Ga0081455_10508216 | 3300005937 | Bacteria | 807 |
| 107 | Ga0081540_1017332 | 3300005983 | Bacteria | 4462 |
| 108 | Ga0070717_10000003 | 3300006028 | Bacteria | 370103 |
| 109 | Ga0070717_10916284 | 3300006028 | Bacteria | 798 |
| 110 | Ga0070712_100373144 | 3300006175 | Bacteria | 1173 |
| 111 | Ga0097621_100008884 | 3300006237 | Bacteria | 7265 |
| 112 | Ga0097621_100099626 | 3300006237 | Bacteria | 2443 |
| 113 | Ga0068871_100005514 | 3300006358 | Bacteria | 8875 |
| 114 | Ga0075428_100463924 | 3300006844 | Bacteria | 1356 |
| 115 | Ga0075433_10372726 | 3300006852 | Bacteria | 1261 |
| 116 | Ga0075434_100162986 | 3300006871 | Bacteria | 2249 |
| 117 | Ga0068865_100022521 | 3300006881 | Bacteria | 4112 |
| 118 | Ga0097620_100569307 | 3300006931 | Bacteria | 1227 |
| 119 | Ga0097620_101308821 | 3300006931 | Bacteria | 799 |
| 120 | Ga0097620_101366311 | 3300006931 | Bacteria | 781 |
| 121 | Ga0075435_100333284 | 3300007076 | Bacteria | 1300 |
| 122 | Ga0075435_100590720 | 3300007076 | Bacteria | 963 |
| 123 | Ga0099795_10069325 | 3300007788 | Bacteria | 1327 |
| 124 | Ga0105240_10022560 | 3300009093 | Bacteria | 8342 |
| 125 | Ga0105240_10083046 | 3300009093 | Bacteria | 3932 |
| 126 | Ga0105240_10392335 | 3300009093 | Bacteria | 1565 |
| 127 | Ga0105240_10805840 | 3300009093 | Bacteria | 1017 |
| 128 | Ga0105240_10951111 | 3300009093 | Bacteria | 921 |
| 129 | Ga0111539_10384047 | 3300009094 | Bacteria | 1635 |
| 130 | Ga0111539_10879529 | 3300009094 | Bacteria | 1042 |
| 131 | Ga0111539_11960999 | 3300009094 | Bacteria | 679 |
| 132 | Ga0105245_10282125 | 3300009098 | Bacteria | 1624 |
| 133 | Ga0105245_10774281 | 3300009098 | Bacteria | 996 |
| 134 | Ga0105247_10001485 | 3300009101 | Bacteria | 16868 |
| 135 | Ga0105247_10584722 | 3300009101 | Bacteria | 826 |
| 136 | Ga0114129_10017633 | 3300009147 | Bacteria | 10165 |
| 137 | Ga0105243_11684989 | 3300009148 | Bacteria | 663 |
| 138 | Ga0105243_12144913 | 3300009148 | Bacteria | 595 |
| 139 | Ga0105241_10170341 | 3300009174 | Bacteria | 1798 |
| 140 | Ga0105248_10859292 | 3300009177 | Bacteria | 1024 |
| 141 | Ga0105248_11305630 | 3300009177 | Bacteria | 821 |
| 142 | Ga0105237_10268560 | 3300009545 | Bacteria | 1709 |
| 143 | Ga0105237_10414975 | 3300009545 | Bacteria | 1351 |
| 144 | Ga0105238_10069674 | 3300009551 | Bacteria | 3517 |
| 145 | Ga0105238_10179460 | 3300009551 | Bacteria | 2094 |
| 146 | Ga0105249_11005021 | 3300009553 | Bacteria | 903 |
| 147 | Ga0105239_10282263 | 3300010375 | Bacteria | 1870 |
| 148 | Ga0105239_10691649 | 3300010375 | Bacteria | 1166 |
| 149 | Ga0157370_10039020 | 3300013104 | Bacteria | 4592 |
| 150 | Ga0157370_10102675 | 3300013104 | Bacteria | 2677 |
| 151 | Ga0157370_10800866 | 3300013104 | Bacteria | 857 |
| 152 | Ga0157369_10044058 | 3300013105 | Bacteria | 4859 |
| 153 | Ga0157369_10879848 | 3300013105 | Bacteria | 919 |
| 154 | Ga0157374_11509123 | 3300013296 | Bacteria | 695 |
| 155 | Ga0157374_11540241 | 3300013296 | Bacteria | 688 |
| 156 | Ga0157374_11849874 | 3300013296 | Bacteria | 629 |
| 157 | Ga0157374_12780126 | 3300013296 | Bacteria | 517 |
| 158 | Ga0157378_10985334 | 3300013297 | Bacteria | 877 |
| 159 | Ga0163162_11044659 | 3300013306 | Bacteria | 924 |
| 160 | Ga0163162_12505084 | 3300013306 | Bacteria | 593 |
| 161 | Ga0163162_12580083 | 3300013306 | Bacteria | 585 |
| 162 | Ga0157372_10387225 | 3300013307 | Bacteria | 1629 |
| 163 | Ga0157375_10275960 | 3300013308 | Bacteria | 1843 |
| 164 | Ga0157375_10516732 | 3300013308 | Unclassified | 1358 |
| 165 | Ga0157375_12419019 | 3300013308 | Bacteria | 627 |
| 166 | Ga0157375_12975574 | 3300013308 | Bacteria | 566 |
| 167 | Ga0163163_10050622 | 3300014325 | Bacteria | 4091 |
| 168 | Ga0163163_10254192 | 3300014325 | Bacteria | 1808 |
| 169 | Ga0163163_10254737 | 3300014325 | Bacteria | 1806 |
| 170 | Ga0163163_11901933 | 3300014325 | Bacteria | 655 |
| 171 | Ga0163163_12448308 | 3300014325 | Bacteria | 580 |
| 172 | Ga0182008_10161173 | 3300014497 | Bacteria | 1129 |
| 173 | Ga0182008_10348051 | 3300014497 | Bacteria | 785 |
| 174 | Ga0157377_11712881 | 3300014745 | Bacteria | 507 |
| 175 | Ga0157379_10000101 | 3300014968 | Bacteria | 58702 |
| 176 | Ga0157379_10235167 | 3300014968 | Bacteria | 1661 |
| 177 | Ga0157379_10986590 | 3300014968 | Bacteria | 803 |
| 178 | Ga0157379_12568732 | 3300014968 | Bacteria | 510 |
| 179 | Ga0157376_10024093 | 3300014969 | Bacteria | 4774 |
| 180 | Ga0157376_10998821 | 3300014969 | Bacteria | 859 |
| 181 | Ga0157376_12648203 | 3300014969 | Bacteria | 541 |
| 182 | Ga0206356_10662339 | 3300020070 | Bacteria | 2596 |
| 183 | Ga0206354_11287318 | 3300020081 | Bacteria | 1071 |
| 184 | Ga0213872_10297344 | 3300021361 | Bacteria | 671 |
| 185 | Ga0213876_10215195 | 3300021384 | Bacteria | 1022 |
| 186 | Ga0213875_10049479 | 3300021388 | Bacteria | 1970 |
| 187 | Ga0224712_10099636 | 3300022467 | Bacteria | 1230 |
| 188 | Ga0256744_143262 | 3300023309 | Bacteria | 1187 |
| 189 | Ga0209148_1001758 | 3300025254 | Bacteria | 9344 |
| 190 | Ga0209455_1000393 | 3300025272 | Bacteria | 37949 |
| 191 | Ga0209675_1026598 | 3300025291 | Bacteria | 1436 |
| 192 | Ga0209676_1004347 | 3300025292 | Bacteria | 7943 |
| 193 | Ga0209050_1094270 | 3300025298 | Bacteria | 606 |
| 194 | Ga0209256_1018456 | 3300025299 | Bacteria | 2265 |
| 195 | Ga0207426_1015852 | 3300025302 | Bacteria | 2724 |
| 196 | Ga0207697_10195762 | 3300025315 | Bacteria | 888 |
| 197 | Ga0207692_10111586 | 3300025898 | Bacteria | 1517 |
| 198 | Ga0207642_10225442 | 3300025899 | Bacteria | 1050 |
| 199 | Ga0207642_10399126 | 3300025899 | Bacteria | 822 |
| 200 | Ga0207710_10001280 | 3300025900 | Bacteria | 12698 |
| 201 | Ga0207710_10113684 | 3300025900 | Bacteria | 1287 |
| 202 | Ga0207710_10523213 | 3300025900 | Bacteria | 616 |
| 203 | Ga0207680_11337046 | 3300025903 | Bacteria | 509 |
| 204 | Ga0207647_10160685 | 3300025904 | Bacteria | 1311 |
| 205 | Ga0207685_10326854 | 3300025905 | Bacteria | 766 |
| 206 | Ga0207699_10061870 | 3300025906 | Bacteria | 2254 |
| 207 | Ga0207705_10326108 | 3300025909 | Bacteria | 1180 |
| 208 | Ga0207705_10396145 | 3300025909 | Bacteria | 1067 |
| 209 | Ga0207684_10000250 | 3300025910 | Bacteria | 80526 |
| 210 | Ga0207684_10304431 | 3300025910 | Bacteria | 1374 |
| 211 | Ga0207654_10101475 | 3300025911 | Bacteria | 1774 |
| 212 | Ga0207654_10147570 | 3300025911 | Bacteria | 1506 |
| 213 | Ga0207707_10340402 | 3300025912 | Bacteria | 1293 |
| 214 | Ga0207695_10404994 | 3300025913 | Bacteria | 1248 |
| 215 | Ga0207695_11315375 | 3300025913 | Bacteria | 603 |
| 216 | Ga0207671_10638908 | 3300025914 | Bacteria | 848 |
| 217 | Ga0207693_10130424 | 3300025915 | Bacteria | 1976 |
| 218 | Ga0207693_10272976 | 3300025915 | Bacteria | 1325 |
| 219 | Ga0207663_10014397 | 3300025916 | Bacteria | 4327 |
| 220 | Ga0207662_10644378 | 3300025918 | Bacteria | 740 |
| 221 | Ga0207657_10150376 | 3300025919 | Bacteria | 1897 |
| 222 | Ga0207649_10277517 | 3300025920 | Bacteria | 1217 |
| 223 | Ga0207652_10016079 | 3300025921 | Bacteria | 6102 |
| 224 | Ga0207652_10292192 | 3300025921 | Bacteria | 1470 |
| 225 | Ga0207646_11146572 | 3300025922 | Bacteria | 683 |
| 226 | Ga0207646_11166834 | 3300025922 | Bacteria | 676 |
| 227 | Ga0207646_11398831 | 3300025922 | Bacteria | 608 |
| 228 | Ga0207694_10103617 | 3300025924 | Bacteria | 2257 |
| 229 | Ga0207694_10338770 | 3300025924 | Bacteria | 1243 |
| 230 | Ga0207650_10645463 | 3300025925 | Bacteria | 892 |
| 231 | Ga0207687_10496531 | 3300025927 | Bacteria | 1018 |
| 232 | Ga0207700_10162473 | 3300025928 | Bacteria | 1856 |
| 233 | Ga0207700_10168190 | 3300025928 | Bacteria | 1827 |
| 234 | Ga0207700_10987022 | 3300025928 | Bacteria | 754 |
| 235 | Ga0207690_10362605 | 3300025932 | Bacteria | 1148 |
| 236 | Ga0207706_10339195 | 3300025933 | Bacteria | 1307 |
| 237 | Ga0207670_10141883 | 3300025936 | Bacteria | 1772 |
| 238 | Ga0207670_10143169 | 3300025936 | Bacteria | 1765 |
| 239 | Ga0207670_10156318 | 3300025936 | Bacteria | 1698 |
| 240 | Ga0207670_11597724 | 3300025936 | Bacteria | 555 |
| 241 | Ga0207704_10000857 | 3300025938 | Bacteria | 13471 |
| 242 | Ga0207704_10638293 | 3300025938 | Bacteria | 876 |
| 243 | Ga0207665_11133698 | 3300025939 | Bacteria | 624 |
| 244 | Ga0207711_10769089 | 3300025941 | Bacteria | 897 |
| 245 | Ga0207689_10000034 | 3300025942 | Bacteria | 95262 |
| 246 | Ga0207689_10951337 | 3300025942 | Bacteria | 725 |
| 247 | Ga0207689_11549763 | 3300025942 | Bacteria | 552 |
| 248 | Ga0207661_10120534 | 3300025944 | Bacteria | 2232 |
| 249 | Ga0207661_10174299 | 3300025944 | Bacteria | 1874 |
| 250 | Ga0207661_11687808 | 3300025944 | Bacteria | 579 |
| 251 | Ga0207679_10173720 | 3300025945 | Bacteria | 1776 |
| 252 | Ga0207667_10014133 | 3300025949 | Bacteria | 9112 |
| 253 | Ga0207667_10025777 | 3300025949 | Bacteria | 6432 |
| 254 | Ga0207667_10209989 | 3300025949 | Bacteria | 1995 |
| 255 | Ga0207667_10770860 | 3300025949 | Bacteria | 960 |
| 256 | Ga0207667_10838152 | 3300025949 | Bacteria | 914 |
| 257 | Ga0207667_11165627 | 3300025949 | Bacteria | 751 |
| 258 | Ga0207651_11257986 | 3300025960 | Bacteria | 665 |
| 259 | Ga0207658_10334026 | 3300025986 | Bacteria | 1315 |
| 260 | Ga0207677_10180438 | 3300026023 | Bacteria | 1660 |
| 261 | Ga0207677_10374526 | 3300026023 | Bacteria | 1200 |
| 262 | Ga0207677_11339966 | 3300026023 | Bacteria | 658 |
| 263 | Ga0207677_11520637 | 3300026023 | Bacteria | 618 |
| 264 | Ga0207703_11855863 | 3300026035 | Bacteria | 579 |
| 265 | Ga0207639_11032502 | 3300026041 | Bacteria | 770 |
| 266 | Ga0207708_11197640 | 3300026075 | Bacteria | 664 |
| 267 | Ga0207708_11328210 | 3300026075 | Bacteria | 630 |
| 268 | Ga0207702_10000449 | 3300026078 | Bacteria | 46527 |
| 269 | Ga0207702_10111875 | 3300026078 | Bacteria | 2429 |
| 270 | Ga0207702_10309454 | 3300026078 | Bacteria | 1502 |
| 271 | Ga0207702_10428424 | 3300026078 | Bacteria | 1280 |
| 272 | Ga0207702_10464052 | 3300026078 | Bacteria | 1230 |
| 273 | Ga0207702_10538832 | 3300026078 | Bacteria | 1141 |
| 274 | Ga0207702_10909629 | 3300026078 | Bacteria | 872 |
| 275 | Ga0207641_10134655 | 3300026088 | Bacteria | 2223 |
| 276 | Ga0207641_11593405 | 3300026088 | Bacteria | 655 |
| 277 | Ga0207648_10008188 | 3300026089 | Bacteria | 10161 |
| 278 | Ga0207676_10612113 | 3300026095 | Bacteria | 1047 |
| 279 | Ga0207676_10627767 | 3300026095 | Bacteria | 1035 |
| 280 | Ga0207676_10691852 | 3300026095 | Bacteria | 987 |
| 281 | Ga0207676_11191778 | 3300026095 | Bacteria | 755 |
| 282 | Ga0207676_11233631 | 3300026095 | Bacteria | 742 |
| 283 | Ga0207676_12110769 | 3300026095 | Bacteria | 562 |
| 284 | Ga0207674_10105129 | 3300026116 | Bacteria | 2802 |
| 285 | Ga0207674_10466710 | 3300026116 | Bacteria | 1220 |
| 286 | Ga0207674_11240440 | 3300026116 | Bacteria | 715 |
| 287 | Ga0207683_10005218 | 3300026121 | Bacteria | 11154 |
| 288 | Ga0207683_10040855 | 3300026121 | Bacteria | 4049 |
| 289 | Ga0207683_11945445 | 3300026121 | Bacteria | 537 |
| 290 | Ga0207698_10167535 | 3300026142 | Bacteria | 1930 |
| 291 | Ga0207698_10666695 | 3300026142 | Bacteria | 1032 |
| 292 | Ga0209981_1007139 | 3300027378 | Bacteria | 1504 |
| 293 | Ga0209588_1179380 | 3300027671 | Bacteria | 665 |
| 294 | Ga0268266_10005155 | 3300028379 | Bacteria | 12306 |
| 295 | Ga0268266_10814462 | 3300028379 | Bacteria | 902 |
| 296 | Ga0268264_10549947 | 3300028381 | Bacteria | 1132 |
| 297 | Ga0268264_10650291 | 3300028381 | Bacteria | 1043 |
| 298 | Ga0268264_10782326 | 3300028381 | Bacteria | 952 |
| 299 | Ga0265337_1000360 | 3300028556 | Bacteria | 24386 |
| 300 | Ga0265337_1001901 | 3300028556 | Bacteria | 9942 |
| 301 | Ga0265337_1002361 | 3300028556 | Bacteria | 8716 |
| 302 | Ga0265337_1005756 | 3300028556 | Bacteria | 4867 |
| 303 | Ga0265337_1086395 | 3300028556 | Bacteria | 856 |
| 304 | Ga0265337_1127813 | 3300028556 | Bacteria | 689 |
| 305 | Ga0265337_1128548 | 3300028556 | Bacteria | 687 |
| 306 | Ga0265337_1129041 | 3300028556 | Bacteria | 685 |
| 307 | Ga0265337_1135437 | 3300028556 | Bacteria | 667 |
| 308 | Ga0265337_1165955 | 3300028556 | Bacteria | 598 |
| 309 | Ga0265326_10010563 | 3300028558 | Bacteria | 2736 |
| 310 | Ga0265326_10013063 | 3300028558 | Bacteria | 2432 |
| 311 | Ga0265326_10033168 | 3300028558 | Bacteria | 1470 |
| 312 | Ga0265326_10045568 | 3300028558 | Bacteria | 1244 |
| 313 | Ga0265326_10126649 | 3300028558 | Bacteria | 727 |
| 314 | Ga0265326_10129973 | 3300028558 | Bacteria | 717 |
| 315 | Ga0265319_1000019 | 3300028563 | Bacteria | 154537 |
| 316 | Ga0265319_1000071 | 3300028563 | Bacteria | 81543 |
| 317 | Ga0265319_1000330 | 3300028563 | Bacteria | 34865 |
| 318 | Ga0265319_1001949 | 3300028563 | Bacteria | 11686 |
| 319 | Ga0265319_1003969 | 3300028563 | Bacteria | 7508 |
| 320 | Ga0265319_1005249 | 3300028563 | Bacteria | 6250 |
| 321 | Ga0265319_1011894 | 3300028563 | Bacteria | 3541 |
| 322 | Ga0265319_1017646 | 3300028563 | Bacteria | 2707 |
| 323 | Ga0265319_1038622 | 3300028563 | Bacteria | 1622 |
| 324 | Ga0265319_1038664 | 3300028563 | Bacteria | 1621 |
| 325 | Ga0265319_1061435 | 3300028563 | Bacteria | 1218 |
| 326 | Ga0265319_1119777 | 3300028563 | Bacteria | 820 |
| 327 | Ga0265334_10001615 | 3300028573 | Bacteria | 10823 |
| 328 | Ga0265334_10001971 | 3300028573 | Bacteria | 9750 |
| 329 | Ga0265334_10006043 | 3300028573 | Bacteria | 5256 |
| 330 | Ga0265334_10126506 | 3300028573 | Bacteria | 911 |
| 331 | Ga0265318_10000273 | 3300028577 | Bacteria | 43832 |
| 332 | Ga0265318_10001387 | 3300028577 | Bacteria | 14390 |
| 333 | Ga0265318_10001452 | 3300028577 | Bacteria | 13930 |
| 334 | Ga0265318_10002455 | 3300028577 | Bacteria | 9914 |
| 335 | Ga0265318_10004654 | 3300028577 | Bacteria | 6599 |
| 336 | Ga0265318_10005117 | 3300028577 | Bacteria | 6205 |
| 337 | Ga0265318_10011287 | 3300028577 | Bacteria | 3852 |
| 338 | Ga0265318_10063821 | 3300028577 | Bacteria | 1370 |
| 339 | Ga0265318_10090353 | 3300028577 | Bacteria | 1128 |
| 340 | Ga0265318_10341094 | 3300028577 | Bacteria | 547 |
| 341 | Ga0265323_10000005 | 3300028653 | Bacteria | 196003 |
| 342 | Ga0265323_10000705 | 3300028653 | Bacteria | 18171 |
| 343 | Ga0265323_10020264 | 3300028653 | Bacteria | 2563 |
| 344 | Ga0265323_10031922 | 3300028653 | Bacteria | 1956 |
| 345 | Ga0265323_10035085 | 3300028653 | Bacteria | 1850 |
| 346 | Ga0265323_10151865 | 3300028653 | Bacteria | 741 |
| 347 | Ga0265323_10161115 | 3300028653 | Bacteria | 715 |
| 348 | Ga0265323_10179160 | 3300028653 | Bacteria | 671 |
| 349 | Ga0265322_10000766 | 3300028654 | Bacteria | 11593 |
| 350 | Ga0265322_10018830 | 3300028654 | Bacteria | 1982 |
| 351 | Ga0265322_10152210 | 3300028654 | Bacteria | 661 |
| 352 | Ga0265322_10161554 | 3300028654 | Bacteria | 641 |
| 353 | Ga0265336_10005520 | 3300028666 | Bacteria | 4660 |
| 354 | Ga0265336_10007611 | 3300028666 | Bacteria | 3846 |
| 355 | Ga0265336_10010005 | 3300028666 | Bacteria | 3257 |
| 356 | Ga0265336_10017147 | 3300028666 | Bacteria | 2360 |
| 357 | Ga0307515_10072629 | 3300028794 | Bacteria | 4638 |
| 358 | Ga0307515_10226254 | 3300028794 | Bacteria | 1675 |
| 359 | Ga0265338_10000919 | 3300028800 | Bacteria | 49615 |
| 360 | Ga0265338_10001708 | 3300028800 | Bacteria | 34832 |
| 361 | Ga0265338_10004347 | 3300028800 | Bacteria | 19195 |
| 362 | Ga0265338_10006820 | 3300028800 | Bacteria | 14388 |
| 363 | Ga0265338_10008397 | 3300028800 | Bacteria | 12546 |
| 364 | Ga0265338_10008597 | 3300028800 | Bacteria | 12354 |
| 365 | Ga0265338_10009193 | 3300028800 | Bacteria | 11839 |
| 366 | Ga0265338_10019380 | 3300028800 | Bacteria | 7219 |
| 367 | Ga0265338_10021305 | 3300028800 | Bacteria | 6765 |
| 368 | Ga0265338_10027513 | 3300028800 | Bacteria | 5702 |
| 369 | Ga0265338_10027677 | 3300028800 | Bacteria | 5680 |
| 370 | Ga0265338_10044480 | 3300028800 | Bacteria | 4098 |
| 371 | Ga0265338_10094870 | 3300028800 | Bacteria | 2453 |
| 372 | Ga0265338_10127802 | 3300028800 | Bacteria | 2013 |
| 373 | Ga0265338_10128636 | 3300028800 | Bacteria | 2005 |
| 374 | Ga0265338_10131632 | 3300028800 | Bacteria | 1973 |
| 375 | Ga0265338_10166764 | 3300028800 | Bacteria | 1694 |
| 376 | Ga0265338_10180356 | 3300028800 | Bacteria | 1611 |
| 377 | Ga0265338_10342156 | 3300028800 | Bacteria | 1078 |
| 378 | Ga0265338_10403247 | 3300028800 | Bacteria | 974 |
| 379 | Ga0265338_10542829 | 3300028800 | Bacteria | 814 |
| 380 | Ga0265338_10926768 | 3300028800 | Bacteria | 592 |
| 381 | Ga0265338_11088933 | 3300028800 | Bacteria | 538 |
| 382 | Ga0311004_130229 | 3300029276 | Bacteria | 1017 |
| 383 | Ga0311001_1018422 | 3300029277 | Bacteria | 2218 |
| 384 | Ga0310981_1067369 | 3300029285 | Bacteria | 511 |
| 385 | Ga0265324_10000442 | 3300029957 | Bacteria | 29455 |
| 386 | Ga0265324_10004791 | 3300029957 | Bacteria | 5979 |
| 387 | Ga0265324_10008583 | 3300029957 | Bacteria | 4052 |
| 388 | Ga0265324_10041126 | 3300029957 | Bacteria | 1600 |
| 389 | Ga0265324_10043215 | 3300029957 | Bacteria | 1556 |
| 390 | Ga0265324_10063196 | 3300029957 | Bacteria | 1264 |
| 391 | Ga0265324_10077645 | 3300029957 | Bacteria | 1130 |
| 392 | Ga0265324_10144406 | 3300029957 | Bacteria | 808 |
| 393 | Ga0265762_1049584 | 3300030760 | Bacteria | 840 |
| 394 | Ga0265330_10000998 | 3300031235 | Bacteria | 17255 |
| 395 | Ga0265330_10011486 | 3300031235 | Bacteria | 4152 |
| 396 | Ga0265330_10102067 | 3300031235 | Bacteria | 1228 |
| 397 | Ga0265332_10000280 | 3300031238 | Bacteria | 40175 |
| 398 | Ga0265332_10022104 | 3300031238 | Bacteria | 2807 |
| 399 | Ga0265332_10121427 | 3300031238 | Bacteria | 1097 |
| 400 | Ga0265332_10122872 | 3300031238 | Bacteria | 1090 |
| 401 | Ga0265332_10198383 | 3300031238 | Bacteria | 834 |
| 402 | Ga0265332_10245132 | 3300031238 | Bacteria | 741 |
| 403 | Ga0265332_10277111 | 3300031238 | Bacteria | 693 |
| 404 | Ga0265332_10341298 | 3300031238 | Bacteria | 618 |
| 405 | Ga0265332_10396175 | 3300031238 | Bacteria | 570 |
| 406 | Ga0265328_10003166 | 3300031239 | Bacteria | 7314 |
| 407 | Ga0265328_10007527 | 3300031239 | Bacteria | 4535 |
| 408 | Ga0265328_10035187 | 3300031239 | Bacteria | 1852 |
| 409 | Ga0265328_10037312 | 3300031239 | Bacteria | 1795 |
| 410 | Ga0265328_10093673 | 3300031239 | Bacteria | 1110 |
| 411 | Ga0265328_10099522 | 3300031239 | Bacteria | 1076 |
| 412 | Ga0265328_10125682 | 3300031239 | Bacteria | 958 |
| 413 | Ga0265320_10000391 | 3300031240 | Bacteria | 35502 |
| 414 | Ga0265320_10000430 | 3300031240 | Bacteria | 33126 |
| 415 | Ga0265320_10000485 | 3300031240 | Bacteria | 31127 |
| 416 | Ga0265320_10001512 | 3300031240 | Bacteria | 16930 |
| 417 | Ga0265320_10001599 | 3300031240 | Bacteria | 16249 |
| 418 | Ga0265320_10009586 | 3300031240 | Bacteria | 5829 |
| 419 | Ga0265320_10010920 | 3300031240 | Bacteria | 5372 |
| 420 | Ga0265320_10020032 | 3300031240 | Bacteria | 3638 |
| 421 | Ga0265320_10032443 | 3300031240 | Bacteria | 2673 |
| 422 | Ga0265320_10039318 | 3300031240 | Bacteria | 2367 |
| 423 | Ga0265320_10041002 | 3300031240 | Bacteria | 2304 |
| 424 | Ga0265320_10050473 | 3300031240 | Bacteria | 2021 |
| 425 | Ga0265320_10072527 | 3300031240 | Bacteria | 1620 |
| 426 | Ga0265320_10073590 | 3300031240 | Bacteria | 1605 |
| 427 | Ga0265320_10147715 | 3300031240 | Bacteria | 1062 |
| 428 | Ga0265320_10171510 | 3300031240 | Bacteria | 974 |
| 429 | Ga0265320_10182576 | 3300031240 | Bacteria | 940 |
| 430 | Ga0265320_10254192 | 3300031240 | Bacteria | 779 |
| 431 | Ga0265325_10001575 | 3300031241 | Bacteria | 15904 |
| 432 | Ga0265325_10025908 | 3300031241 | Bacteria | 3181 |
| 433 | Ga0265325_10030183 | 3300031241 | Bacteria | 2909 |
| 434 | Ga0265325_10222283 | 3300031241 | Bacteria | 864 |
| 435 | Ga0265329_10000013 | 3300031242 | Bacteria | 70645 |
| 436 | Ga0265329_10062936 | 3300031242 | Bacteria | 1174 |
| 437 | Ga0265340_10000189 | 3300031247 | Bacteria | 31156 |
| 438 | Ga0265340_10006471 | 3300031247 | Bacteria | 6446 |
| 439 | Ga0265340_10010599 | 3300031247 | Bacteria | 4928 |
| 440 | Ga0265340_10033404 | 3300031247 | Bacteria | 2561 |
| 441 | Ga0265340_10037337 | 3300031247 | Bacteria | 2407 |
| 442 | Ga0265340_10056826 | 3300031247 | Bacteria | 1882 |
| 443 | Ga0265340_10120529 | 3300031247 | Bacteria | 1207 |
| 444 | Ga0265339_10001407 | 3300031249 | Bacteria | 17881 |
| 445 | Ga0265339_10022952 | 3300031249 | Bacteria | 3611 |
| 446 | Ga0265339_10031093 | 3300031249 | Bacteria | 3019 |
| 447 | Ga0265339_10039559 | 3300031249 | Bacteria | 2625 |
| 448 | Ga0265339_10054237 | 3300031249 | Bacteria | 2178 |
| 449 | Ga0265339_10122126 | 3300031249 | Bacteria | 1338 |
| 450 | Ga0265339_10343907 | 3300031249 | Bacteria | 704 |
| 451 | Ga0265339_10377502 | 3300031249 | Bacteria | 665 |
| 452 | Ga0265339_10595204 | 3300031249 | Bacteria | 507 |
| 453 | Ga0265331_10000543 | 3300031250 | Bacteria | 34421 |
| 454 | Ga0265331_10011176 | 3300031250 | Bacteria | 4925 |
| 455 | Ga0265331_10034609 | 3300031250 | Bacteria | 2490 |
| 456 | Ga0265331_10040673 | 3300031250 | Bacteria | 2261 |
| 457 | Ga0265331_10107681 | 3300031250 | Bacteria | 1279 |
| 458 | Ga0265331_10215007 | 3300031250 | Bacteria | 865 |
| 459 | Ga0265331_10349492 | 3300031250 | Bacteria | 662 |
| 460 | Ga0265327_10002314 | 3300031251 | Bacteria | 20368 |
| 461 | Ga0265327_10004150 | 3300031251 | Bacteria | 13074 |
| 462 | Ga0265327_10006465 | 3300031251 | Bacteria | 9359 |
| 463 | Ga0265327_10041880 | 3300031251 | Bacteria | 2463 |
| 464 | Ga0265327_10048769 | 3300031251 | Bacteria | 2225 |
| 465 | Ga0265327_10104862 | 3300031251 | Bacteria | 1359 |
| 466 | Ga0265327_10430362 | 3300031251 | Bacteria | 571 |
| 467 | Ga0265316_10001048 | 3300031344 | Bacteria | 29962 |
| 468 | Ga0265316_10001559 | 3300031344 | Bacteria | 24560 |
| 469 | Ga0265316_10002957 | 3300031344 | Bacteria | 17386 |
| 470 | Ga0265316_10006174 | 3300031344 | Bacteria | 11492 |
| 471 | Ga0265316_10013893 | 3300031344 | Bacteria | 7123 |
| 472 | Ga0265316_10017230 | 3300031344 | Bacteria | 6249 |
| 473 | Ga0265316_10021617 | 3300031344 | Bacteria | 5444 |
| 474 | Ga0265316_10023098 | 3300031344 | Bacteria | 5229 |
| 475 | Ga0265316_10028793 | 3300031344 | Bacteria | 4577 |
| 476 | Ga0265316_10054031 | 3300031344 | Bacteria | 3145 |
| 477 | Ga0265316_10112787 | 3300031344 | Bacteria | 2058 |
| 478 | Ga0265316_10154095 | 3300031344 | Bacteria | 1720 |
| 479 | Ga0265316_10175950 | 3300031344 | Bacteria | 1595 |
| 480 | Ga0265316_10185401 | 3300031344 | Bacteria | 1548 |
| 481 | Ga0265316_10252714 | 3300031344 | Bacteria | 1294 |
| 482 | Ga0265316_10346653 | 3300031344 | Bacteria | 1076 |
| 483 | Ga0265316_10359608 | 3300031344 | Bacteria | 1053 |
| 484 | Ga0265316_10668687 | 3300031344 | Bacteria | 733 |
| 485 | Ga0265316_10799617 | 3300031344 | Bacteria | 661 |
| 486 | Ga0265316_10828328 | 3300031344 | Bacteria | 648 |
| 487 | Ga0265316_11037340 | 3300031344 | Bacteria | 570 |
| 488 | Ga0265316_11146523 | 3300031344 | Bacteria | 538 |
| 489 | Ga0265316_11154711 | 3300031344 | Bacteria | 536 |
| 490 | Ga0307408_100000009 | 3300031548 | Bacteria | 426576 |
| 491 | Ga0307408_100076442 | 3300031548 | Bacteria | 2491 |
| 492 | Ga0307408_100766687 | 3300031548 | Bacteria | 873 |
| 493 | Ga0265313_10000016 | 3300031595 | Bacteria | 154004 |
| 494 | Ga0265313_10000458 | 3300031595 | Bacteria | 43153 |
| 495 | Ga0265313_10000463 | 3300031595 | Bacteria | 42820 |
| 496 | Ga0265313_10000484 | 3300031595 | Bacteria | 41826 |
| 497 | Ga0265313_10000667 | 3300031595 | Bacteria | 35343 |
| 498 | Ga0265313_10000967 | 3300031595 | Bacteria | 28455 |
| 499 | Ga0265313_10001355 | 3300031595 | Bacteria | 23078 |
| 500 | Ga0265313_10013304 | 3300031595 | Bacteria | 4948 |
| 501 | Ga0265313_10018854 | 3300031595 | Bacteria | 3861 |
| 502 | Ga0265313_10136205 | 3300031595 | Bacteria | 1060 |
| 503 | Ga0307508_10481615 | 3300031616 | Bacteria | 835 |
| 504 | Ga0316579_10244360 | 3300031691 | Bacteria | 868 |
| 505 | Ga0265314_10002804 | 3300031711 | Bacteria | 17395 |
| 506 | Ga0265314_10003246 | 3300031711 | Bacteria | 15899 |
| 507 | Ga0265314_10003296 | 3300031711 | Bacteria | 15770 |
| 508 | Ga0265314_10008489 | 3300031711 | Bacteria | 8789 |
| 509 | Ga0265314_10018694 | 3300031711 | Bacteria | 5394 |
| 510 | Ga0265314_10023749 | 3300031711 | Bacteria | 4666 |
| 511 | Ga0265314_10084279 | 3300031711 | Bacteria | 2087 |
| 512 | Ga0265314_10091350 | 3300031711 | Bacteria | 1982 |
| 513 | Ga0265314_10092900 | 3300031711 | Bacteria | 1960 |
| 514 | Ga0265314_10150911 | 3300031711 | Bacteria | 1425 |
| 515 | Ga0265314_10164950 | 3300031711 | Bacteria | 1344 |
| 516 | Ga0265314_10207188 | 3300031711 | Bacteria | 1154 |
| 517 | Ga0265314_10288030 | 3300031711 | Bacteria | 926 |
| 518 | Ga0265314_10499058 | 3300031711 | Bacteria | 641 |
| 519 | Ga0265342_10000471 | 3300031712 | Bacteria | 43707 |
| 520 | Ga0265342_10011450 | 3300031712 | Bacteria | 6070 |
| 521 | Ga0265342_10019586 | 3300031712 | Bacteria | 4359 |
| 522 | Ga0265342_10052539 | 3300031712 | Bacteria | 2428 |
| 523 | Ga0265342_10055789 | 3300031712 | Bacteria | 2344 |
| 524 | Ga0265342_10076611 | 3300031712 | Bacteria | 1939 |
| 525 | Ga0265342_10094282 | 3300031712 | Bacteria | 1713 |
| 526 | Ga0265342_10155620 | 3300031712 | Bacteria | 1267 |
| 527 | Ga0265342_10249931 | 3300031712 | Bacteria | 947 |
| 528 | Ga0265342_10256452 | 3300031712 | Bacteria | 932 |
| 529 | Ga0265342_10281360 | 3300031712 | Bacteria | 880 |
| 530 | Ga0265342_10296129 | 3300031712 | Bacteria | 853 |
| 531 | Ga0265342_10420711 | 3300031712 | Bacteria | 688 |
| 532 | Ga0265342_10441138 | 3300031712 | Bacteria | 669 |
| 533 | Ga0265342_10577983 | 3300031712 | Bacteria | 568 |
| 534 | Ga0316576_10003165 | 3300031727 | Bacteria | 9597 |
| 535 | Ga0316576_10126634 | 3300031727 | Bacteria | 1920 |
| 536 | Ga0316578_10021235 | 3300031728 | Bacteria | 3601 |
| 537 | Ga0316578_10095695 | 3300031728 | Bacteria | 1777 |
| 538 | Ga0316578_10129348 | 3300031728 | Bacteria | 1519 |
| 539 | Ga0316578_10445722 | 3300031728 | Bacteria | 765 |
| 540 | Ga0316578_10470234 | 3300031728 | Bacteria | 742 |
| 541 | Ga0307405_10098385 | 3300031731 | Bacteria | 1956 |
| 542 | Ga0307405_11086155 | 3300031731 | Bacteria | 687 |
| 543 | Ga0316577_10678550 | 3300031733 | Bacteria | 586 |
| 544 | Ga0307413_10259796 | 3300031824 | Bacteria | 1294 |
| 545 | Ga0307413_11332099 | 3300031824 | Bacteria | 629 |
| 546 | Ga0307413_11789323 | 3300031824 | Bacteria | 550 |
| 547 | Ga0307410_10000097 | 3300031852 | Bacteria | 30229 |
| 548 | Ga0307410_10315181 | 3300031852 | Bacteria | 1239 |
| 549 | Ga0307410_11851461 | 3300031852 | Bacteria | 537 |
| 550 | Ga0307410_11877839 | 3300031852 | Bacteria | 533 |
| 551 | Ga0307406_12019527 | 3300031901 | Bacteria | 516 |
| 552 | Ga0307407_10008349 | 3300031903 | Bacteria | 4746 |
| 553 | Ga0307407_10433402 | 3300031903 | Bacteria | 950 |
| 554 | Ga0307409_100000037 | 3300031995 | Bacteria | 47029 |
| 555 | Ga0307409_100814041 | 3300031995 | Bacteria | 942 |
| 556 | Ga0307409_100967887 | 3300031995 | Bacteria | 868 |
| 557 | Ga0307416_100000018 | 3300032002 | Bacteria | 200227 |
| 558 | Ga0307416_102892360 | 3300032002 | Bacteria | 574 |
| 559 | Ga0307414_10102967 | 3300032004 | Bacteria | 2153 |
| 560 | Ga0307414_11757641 | 3300032004 | Bacteria | 578 |
| 561 | Ga0307411_10984400 | 3300032005 | Bacteria | 754 |
| 562 | Ga0316583_10187372 | 3300032133 | Bacteria | 719 |
| 563 | Ga0316583_10204605 | 3300032133 | Bacteria | 685 |
| 564 | Ga0316593_10087338 | 3300032168 | Unclassified | 1095 |
| 565 | Ga0316593_10305000 | 3300032168 | Bacteria | 603 |
| 566 | Ga0307507_10068536 | 3300033179 | Bacteria | 3236 |
| 567 | Ga0316592_1176405 | 3300033524 | Bacteria | 510 |
| 568 | Ga0316587_1034770 | 3300033529 | Bacteria | 899 |
| 569 | Ga0316587_1072092 | 3300033529 | Bacteria | 647 |
| 570 | Ga0373959_0021034 | 3300034820 | Bacteria | 1250 |
| 571 | Ga0373959_0196683 | 3300034820 | Bacteria | 531 |
| 572 | Ga0373938_0002423 | 3300034957 | Bacteria | 3007 |
| 573 | Ga0373938_0025501 | 3300034957 | Bacteria | 1231 |
| 574 | Ga0373926_0037278 | 3300035083 | Bacteria | 1729 |
| 575 | Ga0373926_0168020 | 3300035083 | Bacteria | 839 |
| 576 | Ga0373929_0225821 | 3300035085 | Bacteria | 534 |
| 577 | Ga0373934_0110628 | 3300035086 | Bacteria | 1114 |
| 578 | Ga0373934_0152429 | 3300035086 | Bacteria | 947 |
| 579 | Ga0373951_0005223 | 3300035091 | Bacteria | 3028 |
| 580 | Ga0373952_0074303 | 3300035092 | Bacteria | 856 |
| 581 | Ga0373923_0102679 | 3300035111 | Bacteria | 1263 |
| 582 | Ga0373936_0629211 | 3300035113 | Bacteria | 505 |
| 583 | Ga0373945_0138113 | 3300035116 | Bacteria | 981 |
| 584 | Ga0373953_0032690 | 3300035117 | Bacteria | 2031 |
| 585 | Ga0373954_0004503 | 3300035118 | Bacteria | 5992 |
| 586 | Ga0373954_0062903 | 3300035118 | Bacteria | 1754 |
| 587 | Ga0373954_0102650 | 3300035118 | Bacteria | 1381 |
| 588 | Ga0373954_0276416 | 3300035118 | Bacteria | 828 |
| 589 | Ga0373954_0529218 | 3300035118 | Bacteria | 584 |
| 590 | Ga0373954_0706079 | 3300035118 | Bacteria | 500 |
| 591 | Ga0373956_0013877 | 3300035119 | Bacteria | 3356 |
| 592 | Ga0373960_0152723 | 3300035121 | Bacteria | 790 |
| 593 | Ga0373943_0440986 | 3300035170 | Bacteria | 756 |
| 594 | Ga0373943_0535570 | 3300035170 | Bacteria | 686 |
| 595 | Ga0373946_0141156 | 3300035171 | Bacteria | 1117 |
| 596 | Ga0373946_0208652 | 3300035171 | Bacteria | 938 |
| 597 | Ga0373942_0177862 | 3300035207 | Bacteria | 696 |
| 598 | Ga0373961_0136401 | 3300035241 | Bacteria | 826 |
| 599 | Ga0373931_0140469 | 3300035691 | Bacteria | 1398 |
| 600 | Ga0373931_0348474 | 3300035691 | Bacteria | 926 |
| 601 | Ga0373931_0521305 | 3300035691 | Bacteria | 769 |
| 602 | Ga0373935_0004181 | 3300035692 | Bacteria | 8454 |
| 603 | Ga0373935_0137172 | 3300035692 | Bacteria | 1649 |
| 604 | Ga0373935_0202219 | 3300035692 | Bacteria | 1373 |
| 605 | Ga0373935_0390479 | 3300035692 | Bacteria | 998 |
| 606 | Ga0373927_0020007 | 3300035695 | Bacteria | 4390 |
| 607 | Ga0373933_0072142 | 3300035724 | Bacteria | 2103 |
| 608 | Ga0373933_0137097 | 3300035724 | Bacteria | 1542 |
| 609 | Ga0373933_0343072 | 3300035724 | Bacteria | 970 |
| 610 | Ga0373933_0494782 | 3300035724 | Bacteria | 801 |
| 611 | Ga0373937_0002552 | 3300036401 | Bacteria | 15128 |
| 612 | Ga0373937_0018696 | 3300036401 | Bacteria | 6192 |
| 613 | Ga0373937_0046230 | 3300036401 | Bacteria | 3980 |
| 614 | Ga0373937_0188429 | 3300036401 | Bacteria | 1938 |
| 615 | Ga0373937_0408129 | 3300036401 | Bacteria | 1289 |
| 616 | Ga0373937_0464897 | 3300036401 | Bacteria | 1201 |
| 617 | Ga0373937_0710668 | 3300036401 | Bacteria | 952 |
| 618 | Ga0373937_0728155 | 3300036401 | Bacteria | 939 |
| 619 | Ga0373937_0812592 | 3300036401 | Bacteria | 883 |
| 620 | Ga0373937_0859409 | 3300036401 | Bacteria | 856 |
| 621 | Ga0373937_1508125 | 3300036401 | Bacteria | 620 |
| 622 | Ga0373937_2088550 | 3300036401 | Bacteria | 513 |
| 623 | Ga0316582_0245267 | 3300036647 | Bacteria | 1227 |
| 624 | Ga0373925_0099158 | 3300037068 | Bacteria | 2237 |
| 625 | Ga0373925_0107210 | 3300037068 | Bacteria | 2154 |
| 626 | Ga0395899_0007028 | 3300037312 | Bacteria | 8708 |
| 627 | Ga0395899_0215573 | 3300037312 | Bacteria | 1332 |
| 628 | Ga0395900_0014228 | 3300037418 | Bacteria | 8121 |
| 629 | Ga0395900_0233398 | 3300037418 | Bacteria | 1849 |
| 630 | Ga0395900_1077505 | 3300037418 | Bacteria | 721 |
| 631 | Ga0395898_0005690 | 3300037466 | Bacteria | 13432 |
| 632 | Ga0395898_0199091 | 3300037466 | Bacteria | 1913 |
| 633 | Ga0395905_0000064 | 3300037471 | Bacteria | 186494 |
| 634 | Ga0395905_0092421 | 3300037471 | Bacteria | 2837 |
| 635 | Ga0395905_0104459 | 3300037471 | Bacteria | 2660 |
| 636 | Ga0395905_0166007 | 3300037471 | Bacteria | 2075 |
| 637 | Ga0395905_0365392 | 3300037471 | Bacteria | 1336 |
| 638 | Ga0436364_0710949 | 3300037853 | Bacteria | 634 |
| 639 | Ga0395901_0007619 | 3300038443 | Bacteria | 10927 |
| 640 | Ga0395901_0067405 | 3300038443 | Bacteria | 3727 |
| 641 | Ga0395901_0171115 | 3300038443 | Bacteria | 2279 |
| 642 | Ga0242420_081185 | 3300038996 | Bacteria | 670 |
| 643 | Ga0400489_44614 | 3300039093 | Bacteria | 3589 |
| 644 | Ga0400489_74686 | 3300039093 | Bacteria | 1261 |
| 645 | Ga0436365_0174030 | 3300039437 | Bacteria | 2608 |
| 646 | Ga0436365_0582907 | 3300039437 | Bacteria | 2602 |
| 647 | Ga0436365_1092380 | 3300039437 | Bacteria | 1109 |
| 648 | Ga0436365_1511533 | 3300039437 | Bacteria | 506 |
| 649 | Ga0436360_0175680 | 3300039438 | Bacteria | 752 |
| 650 | Ga0436360_0438632 | 3300039438 | Bacteria | 694 |
| 651 | Ga0436360_1143196 | 3300039438 | Bacteria | 596 |
| 652 | Ga0436360_1269525 | 3300039438 | Bacteria | 850 |
| 653 | Ga0436361_0271121 | 3300039447 | Bacteria | 3084 |
| 654 | Ga0436363_0890189 | 3300039450 | Bacteria | 1665 |
| 655 | Ga0436363_0927249 | 3300039450 | Bacteria | 1053 |
| 656 | Ga0436363_0942557 | 3300039450 | Bacteria | 720 |
| 657 | Ga0436362_0062320 | 3300039453 | Bacteria | 690 |
| 658 | Ga0436362_0877265 | 3300039453 | Bacteria | 1735 |
| 659 | Ga0439461_0099089 | 3300041410 | Bacteria | 708 |
| 660 | Ga0439461_0196584 | 3300041410 | Bacteria | 540 |
| 661 | Ga0439465_0060703 | 3300041413 | Bacteria | 1252 |
| 662 | Ga0451789_1153559 | 3300041443 | Bacteria | 528 |
| 663 | Ga0451795_0900085 | 3300041456 | Bacteria | 633 |
| 664 | Ga0451800_0134159 | 3300041459 | Bacteria | 586 |
| 665 | Ga0451802_0891862 | 3300041460 | Bacteria | 602 |
| 666 | Ga0451841_0163031 | 3300041498 | Bacteria | 586 |
| 667 | Ga0451847_0366062 | 3300041503 | Bacteria | 577 |
| 668 | Ga0451853_3620705 | 3300041512 | Bacteria | 535 |
| 669 | Ga0439433_0075444 | 3300041999 | Bacteria | 815 |
| 670 | Ga0439441_005193 | 3300042001 | Bacteria | 2009 |
| 671 | Ga0439448_0011743 | 3300042005 | Bacteria | 2612 |
| 672 | Ga0439454_123214 | 3300042011 | Bacteria | 503 |
| 673 | Ga0439456_143619 | 3300042013 | Bacteria | 554 |
| 674 | Ga0450904_033175 | 3300042139 | Bacteria | 543 |
| 675 | Ga0439446_0121905 | 3300042156 | Bacteria | 840 |
| 676 | Ga0450908_014907 | 3300042184 | Bacteria | 1394 |
| 677 | Ga0439444_0055796 | 3300042437 | Bacteria | 813 |
| 678 | Ga0451577_0000008 | 3300042876 | Bacteria | 692992 |
| 679 | Ga0451577_0000155 | 3300042876 | Bacteria | 152745 |
| 680 | Ga0451577_0005406 | 3300042876 | Bacteria | 13101 |
| 681 | Ga0451577_0012523 | 3300042876 | Bacteria | 7965 |
| 682 | Ga0451577_0015131 | 3300042876 | Bacteria | 7178 |
| 683 | Ga0451577_0018419 | 3300042876 | Bacteria | 6433 |
| 684 | Ga0451577_0029976 | 3300042876 | Bacteria | 4915 |
| 685 | Ga0451577_0041006 | 3300042876 | Bacteria | 4157 |
| 686 | Ga0451577_0090080 | 3300042876 | Bacteria | 2737 |
| 687 | Ga0451577_0121976 | 3300042876 | Bacteria | 2335 |
| 688 | Ga0451577_0599523 | 3300042876 | Bacteria | 1000 |
| 689 | Ga0451577_0716331 | 3300042876 | Bacteria | 906 |
| 690 | Ga0451577_1063144 | 3300042876 | Bacteria | 725 |
| 691 | Ga0451577_1304253 | 3300042876 | Bacteria | 646 |
| 692 | Ga0466969_0215308 | 3300044656 | Bacteria | 874 |
| 693 | Ga0453683_0008323 | 3300044673 | Bacteria | 6969 |
| 694 | Ga0453683_0014110 | 3300044673 | Bacteria | 5194 |
| 695 | Ga0453683_0046011 | 3300044673 | Bacteria | 2736 |
| 696 | Ga0453683_0046241 | 3300044673 | Bacteria | 2729 |
| 697 | Ga0453683_0128187 | 3300044673 | Bacteria | 1598 |
| 698 | Ga0453683_0150644 | 3300044673 | Bacteria | 1470 |
| 699 | Ga0453683_0247322 | 3300044673 | Bacteria | 1136 |
| 700 | Ga0453683_0519281 | 3300044673 | Bacteria | 774 |
| 701 | Ga0453683_0554029 | 3300044673 | Bacteria | 748 |
| 702 | Ga0466963_0022826 | 3300044694 | Bacteria | 3967 |
| 703 | Ga0466963_1259992 | 3300044694 | Bacteria | 519 |
| 704 | Ga0466964_0353405 | 3300044706 | Bacteria | 756 |
| 705 | Ga0453684_0000032 | 3300044712 | Bacteria | 745626 |
| 706 | Ga0453684_0000295 | 3300044712 | Bacteria | 211570 |
| 707 | Ga0453684_0000652 | 3300044712 | Bacteria | 125090 |
| 708 | Ga0453684_0000735 | 3300044712 | Bacteria | 114790 |
| 709 | Ga0453684_0001648 | 3300044712 | Bacteria | 60626 |
| 710 | Ga0453684_0005247 | 3300044712 | Bacteria | 25923 |
| 711 | Ga0453684_0005256 | 3300044712 | Bacteria | 25882 |
| 712 | Ga0453684_0005884 | 3300044712 | Bacteria | 23812 |
| 713 | Ga0453684_0008030 | 3300044712 | Bacteria | 19098 |
| 714 | Ga0453684_0017321 | 3300044712 | Bacteria | 11171 |
| 715 | Ga0453684_0018447 | 3300044712 | Bacteria | 10709 |
| 716 | Ga0453684_0021178 | 3300044712 | Bacteria | 9735 |
| 717 | Ga0453684_0027964 | 3300044712 | Bacteria | 8066 |
| 718 | Ga0453684_0028873 | 3300044712 | Bacteria | 7895 |
| 719 | Ga0453684_0032832 | 3300044712 | Bacteria | 7252 |
| 720 | Ga0453684_0034674 | 3300044712 | Bacteria | 6996 |
| 721 | Ga0453684_0452146 | 3300044712 | Unclassified | 1430 |
| 722 | Ga0453684_0491366 | 3300044712 | Unclassified | 1360 |
| 723 | Ga0453684_0907100 | 3300044712 | Bacteria | 943 |
| 724 | Ga0453684_1220233 | 3300044712 | Bacteria | 788 |
| 725 | Ga0453684_2341387 | 3300044712 | Bacteria | 530 |
| 726 | Ga0466968_0298312 | 3300044735 | Bacteria | 774 |
| 727 | Ga0466957_0183869 | 3300044842 | Bacteria | 1366 |
| 728 | Ga0466957_0229546 | 3300044842 | Bacteria | 1228 |
| 729 | Ga0466960_0012057 | 3300044901 | Bacteria | 3638 |
| 730 | Ga0466959_0069974 | 3300045049 | Bacteria | 2542 |
| 731 | Ga0466959_0995691 | 3300045049 | Bacteria | 558 |
| 732 | Ga0451576_0000359 | 3300045051 | Bacteria | 109461 |
| 733 | Ga0451576_0001217 | 3300045051 | Bacteria | 45861 |
| 734 | Ga0451576_0001406 | 3300045051 | Bacteria | 41324 |
| 735 | Ga0451576_0024674 | 3300045051 | Bacteria | 6490 |
| 736 | Ga0451576_0041265 | 3300045051 | Bacteria | 4880 |
| 737 | Ga0451576_0063827 | 3300045051 | Bacteria | 3838 |
| 738 | Ga0451576_0071392 | 3300045051 | Bacteria | 3614 |
| 739 | Ga0451576_0183249 | 3300045051 | Bacteria | 2186 |
| 740 | Ga0451576_0220524 | 3300045051 | Bacteria | 1980 |
| 741 | Ga0451576_0239449 | 3300045051 | Bacteria | 1895 |
| 742 | Ga0451576_0246100 | 3300045051 | Bacteria | 1868 |
| 743 | Ga0451576_0972395 | 3300045051 | Bacteria | 890 |
| 744 | Ga0451576_1403756 | 3300045051 | Bacteria | 727 |
| 745 | Ga0451576_2202948 | 3300045051 | Bacteria | 566 |
| 746 | Ga0466967_0047822 | 3300045976 | Bacteria | 3731 |
| 747 | Ga0466967_0149825 | 3300045976 | Bacteria | 2179 |
| 748 | Ga0495629_0006700 | 3300046459 | Bacteria | 8518 |
| 749 | Ga0495638_0555916 | 3300046460 | Bacteria | 570 |
| 750 | Ga0495651_0320902 | 3300046462 | Bacteria | 1033 |
| 751 | Ga0495651_0415726 | 3300046462 | Bacteria | 875 |
| 752 | Ga0495653_0290394 | 3300046463 | Bacteria | 1070 |
| 753 | Ga0495653_0301149 | 3300046463 | Bacteria | 1046 |
| 754 | Ga0495650_0201763 | 3300046471 | Bacteria | 691 |
| 755 | Ga0495580_0002023 | 3300046472 | Bacteria | 17847 |
| 756 | Ga0495580_0755560 | 3300046472 | Bacteria | 633 |
| 757 | Ga0495662_0590705 | 3300046476 | Bacteria | 543 |
| 758 | Ga0495664_0133998 | 3300046477 | Bacteria | 1501 |
| 759 | Ga0495664_0450866 | 3300046477 | Bacteria | 770 |
| 760 | Ga0495594_0785771 | 3300046499 | Bacteria | 537 |
| 761 | Ga0495608_0153947 | 3300046511 | Bacteria | 1464 |
| 762 | Ga0495618_0001918 | 3300046514 | Bacteria | 13659 |
| 763 | Ga0495628_0433552 | 3300046516 | Bacteria | 956 |
| 764 | Ga0495628_0746891 | 3300046516 | Bacteria | 688 |
| 765 | Ga0495630_0042073 | 3300046517 | Bacteria | 3412 |
| 766 | Ga0495630_0315808 | 3300046517 | Bacteria | 1194 |
| 767 | Ga0495630_0337163 | 3300046517 | Bacteria | 1153 |
| 768 | Ga0495630_0409409 | 3300046517 | Bacteria | 1039 |
| 769 | Ga0495666_0314756 | 3300046526 | Bacteria | 707 |
| 770 | Ga0495640_0045519 | 3300046533 | Bacteria | 3044 |
| 771 | Ga0495640_0058160 | 3300046533 | Bacteria | 2637 |
| 772 | Ga0495586_0001064 | 3300046535 | Bacteria | 15493 |
| 773 | Ga0495586_0053812 | 3300046535 | Bacteria | 2181 |
| 774 | Ga0495586_0082158 | 3300046535 | Bacteria | 1771 |
| 775 | Ga0495586_0720612 | 3300046535 | Bacteria | 576 |
| 776 | Ga0495587_0091265 | 3300046536 | Bacteria | 1760 |
| 777 | Ga0495587_0095081 | 3300046536 | Bacteria | 1720 |
| 778 | Ga0495645_0051583 | 3300046543 | Bacteria | 2993 |
| 779 | Ga0495645_0245886 | 3300046543 | Bacteria | 1191 |
| 780 | Ga0495622_0007056 | 3300046557 | Bacteria | 5217 |
| 781 | Ga0495667_0009232 | 3300046559 | Bacteria | 6690 |
| 782 | Ga0495667_0026521 | 3300046559 | Bacteria | 3906 |
| 783 | Ga0495634_0003274 | 3300046642 | Bacteria | 13068 |
| 784 | Ga0495634_0354668 | 3300046642 | Bacteria | 878 |
| 785 | Ga0495635_0220001 | 3300046663 | Bacteria | 1284 |
| 786 | Ga0495635_0271209 | 3300046663 | Bacteria | 1141 |
| 787 | Ga0495657_0175934 | 3300046675 | Bacteria | 1316 |
| 788 | Ga0495599_0401489 | 3300046678 | Bacteria | 816 |
| 789 | Ga0495623_0297556 | 3300046679 | Bacteria | 893 |
| 790 | Ga0495647_0012537 | 3300046681 | Bacteria | 2921 |
| 791 | Ga0495658_0132955 | 3300046683 | Bacteria | 1516 |
| 792 | Ga0495658_0292522 | 3300046683 | Bacteria | 1029 |
| 793 | Ga0495613_0003460 | 3300046689 | Bacteria | 11805 |
| 794 | Ga0495613_0279663 | 3300046689 | Bacteria | 1159 |
| 795 | Ga0495589_0090822 | 3300046794 | Bacteria | 1483 |
| 796 | Ga0495581_0374774 | 3300047315 | Bacteria | 830 |
| 797 | Ga0495604_0098575 | 3300047317 | Bacteria | 2153 |
| 798 | Ga0495604_0204701 | 3300047317 | Bacteria | 1367 |
| 799 | Ga0495604_0445116 | 3300047317 | Bacteria | 847 |
| 800 | Ga0495674_0589133 | 3300047319 | Bacteria | 882 |
| 801 | Ga0495674_0972041 | 3300047319 | Bacteria | 652 |
| 802 | Ga0495680_0002262 | 3300047322 | Bacteria | 19840 |
| 803 | Ga0495680_0062109 | 3300047322 | Bacteria | 2873 |
| 804 | Ga0495680_0072824 | 3300047322 | Bacteria | 2613 |
| 805 | Ga0495680_0149335 | 3300047322 | Bacteria | 1705 |
| 806 | Ga0495680_0432662 | 3300047322 | Bacteria | 903 |
| 807 | Ga0495680_0998486 | 3300047322 | Bacteria | 535 |
| 808 | Ga0495675_0074423 | 3300047444 | Bacteria | 2140 |
| 809 | Ga0495675_0193052 | 3300047444 | Bacteria | 1242 |
| 810 | Ga0495684_0011576 | 3300047471 | Bacteria | 6810 |
| 811 | Ga0496102_0472002 | 3300048905 | Bacteria | 1176 |
| 812 | Ga0496104_0663294 | 3300048907 | Bacteria | 952 |
| 813 | Ga0496106_0548259 | 3300048909 | Bacteria | 928 |
| 814 | Ga0496108_1657028 | 3300048911 | Bacteria | 528 |
| 815 | Ga0496109_1708833 | 3300048912 | Bacteria | 563 |
| 816 | Ga0496113_1059593 | 3300048916 | Bacteria | 637 |
| 817 | Ga0496115_0002169 | 3300048918 | Bacteria | 14046 |
| 818 | Ga0496122_0082526 | 3300048925 | Bacteria | 2232 |
| 819 | Ga0496126_0261908 | 3300048929 | Bacteria | 1437 |
| 820 | Ga0501306_013124 | 3300049127 | Bacteria | 1076 |
| 821 | Ga0501308_000183 | 3300049128 | Bacteria | 3467 |
| 822 | Ga0501308_002435 | 3300049128 | Bacteria | 1633 |
| 823 | Ga0501308_002563 | 3300049128 | Bacteria | 1603 |
| 824 | Ga0501308_006720 | 3300049128 | Bacteria | 1187 |
| 825 | Ga0501308_038280 | 3300049128 | Bacteria | 668 |
| 826 | Ga0501309_001317 | 3300049129 | Bacteria | 2394 |
| 827 | Ga0501310_009303 | 3300049130 | Bacteria | 1081 |
| 828 | Ga0501304_001532 | 3300049160 | Bacteria | 1499 |
| 829 | Ga0501304_003315 | 3300049160 | Bacteria | 1173 |
| 830 | Ga0501304_039633 | 3300049160 | Bacteria | 523 |
| 831 | Ga0501305_000001 | 3300049161 | Bacteria | 19709 |
| 832 | Ga0501305_000061 | 3300049161 | Bacteria | 6159 |
| 833 | Ga0501305_000471 | 3300049161 | Bacteria | 3305 |
| 834 | Ga0501305_002606 | 3300049161 | Bacteria | 1963 |
| 835 | Ga0501305_004945 | 3300049161 | Bacteria | 1591 |
| 836 | Ga0501305_100090 | 3300049161 | Bacteria | 539 |
| 837 | Ga0501307_000001 | 3300049162 | Bacteria | 10981 |
| 838 | Ga0501307_000032 | 3300049162 | Bacteria | 5115 |
| 839 | Ga0501307_001064 | 3300049162 | Bacteria | 2181 |
| 840 | Ga0501307_023200 | 3300049162 | Bacteria | 821 |
| 841 | Ga0501307_039449 | 3300049162 | Bacteria | 682 |
| 842 | Ga0501290_013054 | 3300049513 | Bacteria | 1080 |
| 843 | Ga0501311_014812 | 3300049527 | Bacteria | 1000 |
| 844 | Ga0501311_029576 | 3300049527 | Bacteria | 787 |
| 845 | Ga0501311_067889 | 3300049527 | Bacteria | 587 |
| 846 | Ga0501312_000001 | 3300049528 | Bacteria | 18666 |
| 847 | Ga0501312_000189 | 3300049528 | Bacteria | 4164 |
| 848 | Ga0501312_014217 | 3300049528 | Bacteria | 1116 |
| 849 | Ga0501312_033006 | 3300049528 | Bacteria | 820 |
| 850 | Ga0501313_000478 | 3300049529 | Bacteria | 2757 |
| 851 | Ga0501314_002402 | 3300049530 | Bacteria | 1445 |
| 852 | Ga0501314_008769 | 3300049530 | Bacteria | 919 |
| 853 | Ga0501315_001006 | 3300049531 | Bacteria | 2240 |
| 854 | Ga0501315_008983 | 3300049531 | Bacteria | 1174 |
| 855 | Ga0501315_044361 | 3300049531 | Bacteria | 682 |
| 856 | Ga0501315_087658 | 3300049531 | Bacteria | 536 |
| 857 | Ga0501317_003139 | 3300049533 | Bacteria | 1620 |
| 858 | Ga0501318_032067 | 3300049534 | Bacteria | 719 |
| 859 | Ga0501319_021214 | 3300049535 | Bacteria | 583 |
| 860 | Ga0501320_000452 | 3300049536 | Bacteria | 2385 |
| 861 | Ga0501322_003879 | 3300049538 | Bacteria | 986 |
| 862 | Ga0501322_004168 | 3300049538 | Bacteria | 963 |
| 863 | Ga0501323_009259 | 3300049539 | Bacteria | 1158 |
| 864 | Ga0501323_026805 | 3300049539 | Bacteria | 791 |
| 865 | Ga0501324_013372 | 3300049540 | Bacteria | 777 |
| 866 | Ga0501325_001022 | 3300049541 | Bacteria | 1598 |
| 867 | Ga0501326_08908 | 3300049542 | Bacteria | 588 |
| 868 | Ga0501328_03494 | 3300049544 | Bacteria | 730 |
| 869 | Ga0501329_11162 | 3300049545 | Bacteria | 570 |
| 870 | Ga0501330_007402 | 3300049546 | Bacteria | 735 |
| 871 | Ga0501335_004292 | 3300049551 | Bacteria | 1240 |
| 872 | Ga0501340_004049 | 3300049556 | Bacteria | 911 |
| 873 | Ga0501031_0000292 | 3300049568 | Bacteria | 28530 |
| 874 | Ga0501031_0002762 | 3300049568 | Bacteria | 11183 |
| 875 | Ga0501031_0040058 | 3300049568 | Bacteria | 3059 |
| 876 | Ga0501032_0006919 | 3300049569 | Bacteria | 8314 |
| 877 | Ga0501032_0017049 | 3300049569 | Bacteria | 5103 |
| 878 | Ga0501032_0017943 | 3300049569 | Bacteria | 4964 |
| 879 | Ga0501032_0189366 | 3300049569 | Bacteria | 1345 |
| 880 | Ga0501032_0422583 | 3300049569 | Bacteria | 855 |
| 881 | Ga0501032_0729790 | 3300049569 | Bacteria | 627 |
| 882 | Ga0501033_0005284 | 3300049570 | Bacteria | 10246 |
| 883 | Ga0501033_0008437 | 3300049570 | Bacteria | 7980 |
| 884 | Ga0501033_0013322 | 3300049570 | Bacteria | 6266 |
| 885 | Ga0501033_0040145 | 3300049570 | Bacteria | 3494 |
| 886 | Ga0501033_0315314 | 3300049570 | Bacteria | 1099 |
| 887 | Ga0501034_0199162 | 3300049571 | Bacteria | 1961 |
| 888 | Ga0501034_0235529 | 3300049571 | Bacteria | 1778 |
| 889 | Ga0501034_0296379 | 3300049571 | Bacteria | 1554 |
| 890 | Ga0501034_0519636 | 3300049571 | Bacteria | 1102 |
| 891 | Ga0501034_0663193 | 3300049571 | Bacteria | 944 |
| 892 | Ga0501034_1104864 | 3300049571 | Bacteria | 674 |
| 893 | Ga0501034_1313952 | 3300049571 | Bacteria | 600 |
| 894 | Ga0501036_0004436 | 3300049572 | Bacteria | 11340 |
| 895 | Ga0501036_0895177 | 3300049572 | Bacteria | 729 |
| 896 | Ga0501037_0011831 | 3300049573 | Bacteria | 6427 |
| 897 | Ga0501037_0094984 | 3300049573 | Bacteria | 2155 |
| 898 | Ga0501037_0319656 | 3300049573 | Bacteria | 1075 |
| 899 | Ga0501037_0428287 | 3300049573 | Bacteria | 905 |
| 900 | Ga0501037_0491451 | 3300049573 | Bacteria | 833 |
| 901 | Ga0501037_1041238 | 3300049573 | Bacteria | 532 |
| 902 | Ga0501038_0004183 | 3300049574 | Bacteria | 13419 |
| 903 | Ga0501038_0186569 | 3300049574 | Bacteria | 1671 |
| 904 | Ga0501038_0291423 | 3300049574 | Bacteria | 1283 |
| 905 | Ga0501038_1000122 | 3300049574 | Bacteria | 614 |
| 906 | Ga0501039_0001456 | 3300049575 | Bacteria | 17399 |
| 907 | Ga0501039_0130275 | 3300049575 | Bacteria | 1974 |
| 908 | Ga0501039_0956610 | 3300049575 | Bacteria | 666 |
| 909 | Ga0501042_0203844 | 3300049578 | Bacteria | 1426 |
| 910 | Ga0501043_0059008 | 3300049579 | Bacteria | 3011 |
| 911 | Ga0501043_0205183 | 3300049579 | Bacteria | 1528 |
| 912 | Ga0501043_0212858 | 3300049579 | Bacteria | 1498 |
| 913 | Ga0501046_0005999 | 3300049580 | Bacteria | 10806 |
| 914 | Ga0501046_0051585 | 3300049580 | Bacteria | 3245 |
| 915 | Ga0501047_0017441 | 3300049581 | Bacteria | 6876 |
| 916 | Ga0501047_0024791 | 3300049581 | Bacteria | 5758 |
| 917 | Ga0501047_0079634 | 3300049581 | Bacteria | 3149 |
| 918 | Ga0501047_0175418 | 3300049581 | Bacteria | 2011 |
| 919 | Ga0501047_1020753 | 3300049581 | Bacteria | 640 |
| 920 | Ga0501047_1378381 | 3300049581 | Bacteria | 520 |
| 921 | Ga0501048_0004214 | 3300049582 | Bacteria | 10960 |
| 922 | Ga0501048_0015870 | 3300049582 | Bacteria | 5558 |
| 923 | Ga0501067_0240095 | 3300049583 | Bacteria | 1008 |
| 924 | Ga0501068_0023470 | 3300049584 | Bacteria | 3615 |
| 925 | Ga0501068_0035924 | 3300049584 | Bacteria | 2960 |
| 926 | Ga0501069_0577610 | 3300049585 | Bacteria | 674 |
| 927 | Ga0501070_0056055 | 3300049586 | Bacteria | 3267 |
| 928 | Ga0501070_0134563 | 3300049586 | Bacteria | 2041 |
| 929 | Ga0501070_0354300 | 3300049586 | Bacteria | 1191 |
| 930 | Ga0501070_0974744 | 3300049586 | Bacteria | 658 |
| 931 | Ga0501070_1217159 | 3300049586 | Bacteria | 577 |
| 932 | Ga0501072_0335612 | 3300049588 | Bacteria | 1201 |
| 933 | Ga0501072_1140106 | 3300049588 | Bacteria | 606 |
| 934 | Ga0501073_0196982 | 3300049589 | Bacteria | 1393 |
| 935 | Ga0501073_0561515 | 3300049589 | Bacteria | 788 |
| 936 | Ga0501077_0423070 | 3300049593 | Bacteria | 852 |
| 937 | Ga0501207_111022 | 3300049654 | Bacteria | 560 |
| 938 | Ga0501243_001912 | 3300049675 | Bacteria | 3034 |
| 939 | Ga0501080_0160800 | 3300049742 | Bacteria | 2074 |
| 940 | Ga0501080_0164222 | 3300049742 | Bacteria | 2050 |
| 941 | Ga0501080_0215135 | 3300049742 | Bacteria | 1760 |
| 942 | Ga0501080_0239349 | 3300049742 | Bacteria | 1657 |
| 943 | Ga0501080_0279589 | 3300049742 | Bacteria | 1518 |
| 944 | Ga0501080_0688706 | 3300049742 | Bacteria | 902 |
| 945 | Ga0501080_1194520 | 3300049742 | Bacteria | 654 |
| 946 | Ga0501080_1824672 | 3300049742 | Bacteria | 510 |
| 947 | Ga0501083_0001752 | 3300049744 | Bacteria | 14807 |
| 948 | Ga0501083_0081088 | 3300049744 | Bacteria | 2151 |
| 949 | Ga0501083_0158585 | 3300049744 | Bacteria | 1481 |
| 950 | Ga0501083_0235988 | 3300049744 | Bacteria | 1191 |
| 951 | Ga0501263_012115 | 3300049760 | Bacteria | 1078 |
| 952 | Ga0501264_027166 | 3300049761 | Bacteria | 640 |
| 953 | Ga0501035_0004187 | 3300049822 | Bacteria | 13710 |
| 954 | Ga0501035_0032346 | 3300049822 | Bacteria | 4759 |
| 955 | Ga0501035_0040870 | 3300049822 | Bacteria | 4189 |
| 956 | Ga0501035_0170044 | 3300049822 | Bacteria | 1883 |
| 957 | Ga0501044_0000427 | 3300049823 | Bacteria | 52004 |
| 958 | Ga0501044_0011226 | 3300049823 | Bacteria | 9713 |
| 959 | Ga0501044_0019577 | 3300049823 | Bacteria | 7236 |
| 960 | Ga0501044_0027412 | 3300049823 | Bacteria | 6021 |
| 961 | Ga0501044_0041072 | 3300049823 | Bacteria | 4815 |
| 962 | Ga0501044_0200112 | 3300049823 | Bacteria | 1956 |
| 963 | Ga0501044_0310874 | 3300049823 | Bacteria | 1502 |
| 964 | Ga0501044_0976879 | 3300049823 | Bacteria | 719 |
| 965 | Ga0501044_1170077 | 3300049823 | Bacteria | 637 |
| 966 | Ga0501045_0584478 | 3300049824 | Bacteria | 827 |
| 967 | nmdc:mga05p37_210959_c1 | 3300050507 | Bacteria | 2348 |
| 968 | nmdc:mga06r32_598805_c1 | 3300050510 | Bacteria | 1073 |
| 969 | nmdc:mga0n895_13026_c1 | 3300050512 | Bacteria | 7481 |
| 970 | nmdc:mga0rr50_1300481_c1 | 3300050513 | Bacteria | 617 |
| 971 | nmdc:mga0rr50_1845542_c1 | 3300050513 | Bacteria | 508 |
| 972 | nmdc:mga0a205_54866_c1 | 3300050515 | Bacteria | 3848 |
| 973 | Ga0495595_0228738 | 3300053084 | Bacteria | 929 |
| 974 | Ga0495619_0665693 | 3300053085 | Bacteria | 709 |
| 975 | Ga0495619_0876621 | 3300053085 | Bacteria | 605 |
| 976 | Ga0495619_1116779 | 3300053085 | Bacteria | 524 |
| 977 | Ga0500643_009589 | 3300053087 | Bacteria | 3687 |
| 978 | Ga0500644_0009620 | 3300053088 | Bacteria | 2592 |
| 979 | Ga0500644_0064003 | 3300053088 | Bacteria | 1305 |
| 980 | Ga0500647_0175632 | 3300053091 | Bacteria | 986 |
| 981 | Ga0500566_0076538 | 3300053094 | Bacteria | 1870 |
| 982 | Ga0500642_0091653 | 3300053130 | Bacteria | 1405 |
| 983 | Ga0500652_111558 | 3300053131 | Bacteria | 1143 |
| 984 | Ga0500588_0004535 | 3300053146 | Bacteria | 3018 |
| 985 | Ga0500616_0035635 | 3300053153 | Bacteria | 2705 |
| 986 | Ga0500616_0118534 | 3300053153 | Bacteria | 1268 |
| 987 | Ga0500636_0503809 | 3300053177 | Bacteria | 534 |
| 988 | Ga0500645_027583 | 3300053730 | Bacteria | 1721 |
| 989 | Ga0501084_0006405 | 3300054114 | Bacteria | 9676 |
| 990 | Ga0501084_0655366 | 3300054114 | Bacteria | 886 |
| 991 | Ga0590077_112427 | 3300059426 | Bacteria | 641 |
| 992 | Ga0587070_025179 | 3300059491 | Bacteria | 1036 |
| 993 | Ga0587073_0086591 | 3300059492 | Bacteria | 788 |
| 994 | Ga0587073_0198834 | 3300059492 | Bacteria | 600 |
| 995 | Ga0587077_000219 | 3300059493 | Bacteria | 4107 |
| 996 | Ga0587082_106977 | 3300059504 | Bacteria | 617 |
| 997 | Ga0587083_0009094 | 3300059505 | Bacteria | 1575 |
| 998 | Ga0587085_008578 | 3300059506 | Bacteria | 1308 |
| 999 | Ga0587085_032298 | 3300059506 | Bacteria | 868 |
| 1000 | Ga0587086_001313 | 3300059507 | Bacteria | 2110 |
| 1001 | Ga0587088_035195 | 3300059508 | Bacteria | 917 |
| 1002 | Ga0587090_000239 | 3300059510 | Bacteria | 4051 |
| 1003 | Ga0587125_070150 | 3300059607 | Bacteria | 528 |
| 1004 | Ga0587101_000303 | 3300059623 | Bacteria | 3204 |
| 1005 | Ga0587101_058593 | 3300059623 | Bacteria | 682 |
| 1006 | Ga0587128_113790 | 3300059630 | Bacteria | 581 |
| 1007 | Ga0587068_001246 | 3300059641 | Bacteria | 2782 |
| 1008 | Ga0587076_002597 | 3300059645 | Bacteria | 2045 |
| 1009 | Ga0587078_000387 | 3300059646 | Bacteria | 3211 |
| 1010 | Ga0587111_0000057 | 3300060346 | Bacteria | 6907 |
| 1011 | Ga0587111_0000079 | 3300060346 | Bacteria | 5946 |
| 1012 | Ga0587111_0041192 | 3300060346 | Bacteria | 985 |
| 1013 | Ga0587111_0121513 | 3300060346 | Bacteria | 673 |
| 1014 | Ga0501082_0069836 | 3300060353 | Bacteria | 3025 |
| 1015 | Ga0501082_0091200 | 3300060353 | Bacteria | 2631 |
| 1016 | Ga0501082_0237307 | 3300060353 | Bacteria | 1587 |
| 1017 | Ga0501082_0329537 | 3300060353 | Bacteria | 1330 |
| 1018 | Ga0501082_1257835 | 3300060353 | Bacteria | 647 |
| 1019 | Ga0501082_1910676 | 3300060353 | Bacteria | 518 |
| 1020 | 2512032383 | 2511231221 | Bacteria | 6846400 |
| 1021 | 2524609943 | 2524023250 | Bacteria | 5457705 |
| 1022 | 2599105617 | 2597490356 | Bacteria | 7030811 |
| 1023 | 2788433948 | 2786546940 | Bacteria | 6396474 |
| 1024 | 2842335157 | 2842333319 | Bacteria | 8899485 |
| 1025 | 2846954697 | 2846952575 | Bacteria | 6587527 |
| 1026 | 2848859036 | 2848858292 | Bacteria | 7391279 |
| 1027 | 2883294827 | 2883291878 | Bacteria | 5894118 |
| 1028 | 2883356687 | 2883354860 | Bacteria | 5865246 |
| 1029 | 2897804176 | 2897803580 | Bacteria | 7000062 |
| 1030 | 8054005931 | 8054002106 | Bacteria | 7987183 |
| 1031 | Ga0453684_0100371 | |||
| 1032 | Ga0006777J48905_1054038 | |||
| 1033 | rootH2_10006221 | |||
| 1034 | rootH1_10011452 | |||
| 1035 | JGI25160J50197_1078321 | |||
| 1036 | Ga0007417J51691_1023280 | |||
| 1037 | Ga0007410J51695_1028777 | |||
| 1038 | Ga0007429J51699_1028655 | |||
| 1039 | Ga0032354_1039933 | |||
| 1040 | Ga0006780_1016914 | |||
| 1041 | Ga0055542_1011755 | |||
| 1042 | Ga0055529_1002705 | |||
| 1043 | Ga0058863_10105546 | |||
| 1044 | Ga0058863_10168574 | |||
| 1045 | Ga0058861_10069211 | |||
| 1046 | Ga0058862_12647723 | |||
| 1047 | Ga0065704_10078969 | |||
| 1048 | Ga0070658_10083891 | |||
| 1049 | Ga0070658_11091948 | |||
| 1050 | Ga0070658_11119305 | |||
| 1051 | Ga0070683_100036500 | |||
| 1052 | Ga0070683_100067211 | |||
| 1053 | Ga0070690_100066157 | |||
| 1054 | Ga0068869_100000006 | |||
| 1055 | Ga0068869_100843880 | |||
| 1056 | Ga0068869_101198253 | |||
| 1057 | Ga0068868_100042332 | |||
| 1058 | Ga0070660_100222987 | |||
| 1059 | Ga0070689_100142969 | |||
| 1060 | Ga0070689_101141608 | |||
| 1061 | Ga0070661_100042151 | |||
| 1062 | Ga0070674_101543769 | |||
| 1063 | Ga0070688_101488295 | |||
| 1064 | Ga0070659_100148080 | |||
| 1065 | Ga0070667_100334472 | |||
| 1066 | Ga0070667_101171600 | |||
| 1067 | Ga0070709_10131060 | |||
| 1068 | Ga0070714_100172422 | |||
| 1069 | Ga0070714_101045638 | |||
| 1070 | Ga0070713_100016910 | |||
| 1071 | Ga0070713_100065811 | |||
| 1072 | Ga0070713_100302103 | |||
| 1073 | Ga0070711_100017546 | |||
| 1074 | Ga0070711_100227918 | |||
| 1075 | Ga0070708_101034260 | |||
| 1076 | Ga0070678_100194014 | |||
| 1077 | Ga0070678_100824134 | |||
| 1078 | Ga0070678_101265432 | |||
| 1079 | Ga0070662_100453556 | |||
| 1080 | Ga0070681_10379217 | |||
| 1081 | Ga0070681_11135569 | |||
| 1082 | Ga0068867_100003491 | |||
| 1083 | Ga0068867_100119426 | |||
| 1084 | Ga0068867_100233586 | |||
| 1085 | Ga0070706_100000179 | |||
| 1086 | Ga0070698_100391326 | |||
| 1087 | Ga0070679_100012053 | |||
| 1088 | Ga0070679_100356782 | |||
| 1089 | Ga0070679_100760746 | |||
| 1090 | Ga0070684_100056261 | |||
| 1091 | Ga0070684_101218842 | |||
| 1092 | Ga0068853_101410620 | |||
| 1093 | Ga0070686_100113763 | |||
| 1094 | Ga0070686_100637224 | |||
| 1095 | Ga0070696_100143017 | |||
| 1096 | Ga0070693_100486756 | |||
| 1097 | Ga0070665_101421879 | |||
| 1098 | Ga0070704_100111312 | |||
| 1099 | Ga0068855_100031040 | |||
| 1100 | Ga0068855_100032846 | |||
| 1101 | Ga0068855_100265352 | |||
| 1102 | Ga0068855_100314312 | |||
| 1103 | Ga0068855_101197100 | |||
| 1104 | Ga0068855_101268513 | |||
| 1105 | Ga0068855_101657858 | |||
| 1106 | Ga0070664_100172619 | |||
| 1107 | Ga0070664_101057146 | |||
| 1108 | Ga0068857_100084743 | |||
| 1109 | Ga0068857_100537741 | |||
| 1110 | Ga0068857_101981486 | |||
| 1111 | Ga0068856_100000665 | |||
| 1112 | Ga0068856_100009374 | |||
| 1113 | Ga0068856_100022229 | |||
| 1114 | Ga0068856_100123991 | |||
| 1115 | Ga0068856_100661667 | |||
| 1116 | Ga0068856_100740360 | |||
| 1117 | Ga0068856_100890320 | |||
| 1118 | Ga0068856_101022393 | |||
| 1119 | Ga0068856_102659267 | |||
| 1120 | Ga0068859_100569330 | |||
| 1121 | Ga0068859_101308813 | |||
| 1122 | Ga0068859_101365862 | |||
| 1123 | Ga0068864_101278271 | |||
| 1124 | Ga0068864_101454499 | |||
| 1125 | Ga0068866_10012814 | |||
| 1126 | Ga0068866_10463997 | |||
| 1127 | Ga0068863_100331351 | |||
| 1128 | Ga0068863_101909736 | |||
| 1129 | Ga0068858_101139743 | |||
| 1130 | Ga0068858_101968062 | |||
| 1131 | Ga0068860_100260330 | |||
| 1132 | Ga0068860_100311844 | |||
| 1133 | Ga0068860_101219106 | |||
| 1134 | Ga0068860_101945657 | |||
| 1135 | Ga0081455_10197589 | |||
| 1136 | Ga0081455_10508216 | |||
| 1137 | Ga0081540_1017332 | |||
| 1138 | Ga0070717_10000003 | |||
| 1139 | Ga0070717_10916284 | |||
| 1140 | Ga0070712_100373144 | |||
| 1141 | Ga0097621_100008884 | |||
| 1142 | Ga0097621_100099626 | |||
| 1143 | Ga0068871_100005514 | |||
| 1144 | Ga0075428_100463924 | |||
| 1145 | Ga0075433_10372726 | |||
| 1146 | Ga0075434_100162986 | |||
| 1147 | Ga0068865_100022521 | |||
| 1148 | Ga0097620_100569307 | |||
| 1149 | Ga0097620_101308821 | |||
| 1150 | Ga0097620_101366311 | |||
| 1151 | Ga0075435_100333284 | |||
| 1152 | Ga0075435_100590720 | |||
| 1153 | Ga0099795_10069325 | |||
| 1154 | Ga0105240_10022560 | |||
| 1155 | Ga0105240_10083046 | |||
| 1156 | Ga0105240_10392335 | |||
| 1157 | Ga0105240_10805840 | |||
| 1158 | Ga0105240_10951111 | |||
| 1159 | Ga0111539_10384047 | |||
| 1160 | Ga0111539_10879529 | |||
| 1161 | Ga0111539_11960999 | |||
| 1162 | Ga0105245_10282125 | |||
| 1163 | Ga0105245_10774281 | |||
| 1164 | Ga0105247_10001485 | |||
| 1165 | Ga0105247_10584722 | |||
| 1166 | Ga0114129_10017633 | |||
| 1167 | Ga0105243_11684989 | |||
| 1168 | Ga0105243_12144913 | |||
| 1169 | Ga0105241_10170341 | |||
| 1170 | Ga0105248_10859292 | |||
| 1171 | Ga0105248_11305630 | |||
| 1172 | Ga0105237_10268560 | |||
| 1173 | Ga0105237_10414975 | |||
| 1174 | Ga0105238_10069674 | |||
| 1175 | Ga0105238_10179460 | |||
| 1176 | Ga0105249_11005021 | |||
| 1177 | Ga0105239_10282263 | |||
| 1178 | Ga0105239_10691649 | |||
| 1179 | Ga0157370_10039020 | |||
| 1180 | Ga0157370_10102675 | |||
| 1181 | Ga0157370_10800866 | |||
| 1182 | Ga0157369_10044058 | |||
| 1183 | Ga0157369_10879848 | |||
| 1184 | Ga0157374_11509123 | |||
| 1185 | Ga0157374_11540241 | |||
| 1186 | Ga0157374_11849874 | |||
| 1187 | Ga0157374_12780126 | |||
| 1188 | Ga0157378_10985334 | |||
| 1189 | Ga0163162_11044659 | |||
| 1190 | Ga0163162_12505084 | |||
| 1191 | Ga0163162_12580083 | |||
| 1192 | Ga0157372_10387225 | |||
| 1193 | Ga0157375_10275960 | |||
| 1194 | Ga0157375_10516732 | |||
| 1195 | Ga0157375_12419019 | |||
| 1196 | Ga0157375_12975574 | |||
| 1197 | Ga0163163_10050622 | |||
| 1198 | Ga0163163_10254192 | |||
| 1199 | Ga0163163_10254737 | |||
| 1200 | Ga0163163_11901933 | |||
| 1201 | Ga0163163_12448308 | |||
| 1202 | Ga0182008_10161173 | |||
| 1203 | Ga0182008_10348051 | |||
| 1204 | Ga0157377_11712881 | |||
| 1205 | Ga0157379_10000101 | |||
| 1206 | Ga0157379_10235167 | |||
| 1207 | Ga0157379_10986590 | |||
| 1208 | Ga0157379_12568732 | |||
| 1209 | Ga0157376_10024093 | |||
| 1210 | Ga0157376_10998821 | |||
| 1211 | Ga0157376_12648203 | |||
| 1212 | Ga0206356_10662339 | |||
| 1213 | Ga0206354_11287318 | |||
| 1214 | Ga0213872_10297344 | |||
| 1215 | Ga0213876_10215195 | |||
| 1216 | Ga0213875_10049479 | |||
| 1217 | Ga0224712_10099636 | |||
| 1218 | Ga0256744_143262 | |||
| 1219 | Ga0209148_1001758 | |||
| 1220 | Ga0209455_1000393 | |||
| 1221 | Ga0209675_1026598 | |||
| 1222 | Ga0209676_1004347 | |||
| 1223 | Ga0209050_1094270 | |||
| 1224 | Ga0209256_1018456 | |||
| 1225 | Ga0207426_1015852 | |||
| 1226 | Ga0207697_10195762 | |||
| 1227 | Ga0207692_10111586 | |||
| 1228 | Ga0207642_10225442 | |||
| 1229 | Ga0207642_10399126 | |||
| 1230 | Ga0207710_10001280 | |||
| 1231 | Ga0207710_10113684 | |||
| 1232 | Ga0207710_10523213 | |||
| 1233 | Ga0207680_11337046 | |||
| 1234 | Ga0207647_10160685 | |||
| 1235 | Ga0207685_10326854 | |||
| 1236 | Ga0207699_10061870 | |||
| 1237 | Ga0207705_10326108 | |||
| 1238 | Ga0207705_10396145 | |||
| 1239 | Ga0207684_10000250 | |||
| 1240 | Ga0207684_10304431 | |||
| 1241 | Ga0207654_10101475 | |||
| 1242 | Ga0207654_10147570 | |||
| 1243 | Ga0207707_10340402 | |||
| 1244 | Ga0207695_10404994 | |||
| 1245 | Ga0207695_11315375 | |||
| 1246 | Ga0207671_10638908 | |||
| 1247 | Ga0207693_10130424 | |||
| 1248 | Ga0207693_10272976 | |||
| 1249 | Ga0207663_10014397 | |||
| 1250 | Ga0207662_10644378 | |||
| 1251 | Ga0207657_10150376 | |||
| 1252 | Ga0207649_10277517 | |||
| 1253 | Ga0207652_10016079 | |||
| 1254 | Ga0207652_10292192 | |||
| 1255 | Ga0207646_11146572 | |||
| 1256 | Ga0207646_11166834 | |||
| 1257 | Ga0207646_11398831 | |||
| 1258 | Ga0207694_10103617 | |||
| 1259 | Ga0207694_10338770 | |||
| 1260 | Ga0207650_10645463 | |||
| 1261 | Ga0207687_10496531 | |||
| 1262 | Ga0207700_10162473 | |||
| 1263 | Ga0207700_10168190 | |||
| 1264 | Ga0207700_10987022 | |||
| 1265 | Ga0207690_10362605 | |||
| 1266 | Ga0207706_10339195 | |||
| 1267 | Ga0207670_10141883 | |||
| 1268 | Ga0207670_10143169 | |||
| 1269 | Ga0207670_10156318 | |||
| 1270 | Ga0207670_11597724 | |||
| 1271 | Ga0207704_10000857 | |||
| 1272 | Ga0207704_10638293 | |||
| 1273 | Ga0207665_11133698 | |||
| 1274 | Ga0207711_10769089 | |||
| 1275 | Ga0207689_10000034 | |||
| 1276 | Ga0207689_10951337 | |||
| 1277 | Ga0207689_11549763 | |||
| 1278 | Ga0207661_10120534 | |||
| 1279 | Ga0207661_10174299 | |||
| 1280 | Ga0207661_11687808 | |||
| 1281 | Ga0207679_10173720 | |||
| 1282 | Ga0207667_10014133 | |||
| 1283 | Ga0207667_10025777 | |||
| 1284 | Ga0207667_10209989 | |||
| 1285 | Ga0207667_10770860 | |||
| 1286 | Ga0207667_10838152 | |||
| 1287 | Ga0207667_11165627 | |||
| 1288 | Ga0207651_11257986 | |||
| 1289 | Ga0207658_10334026 | |||
| 1290 | Ga0207677_10180438 | |||
| 1291 | Ga0207677_10374526 | |||
| 1292 | Ga0207677_11339966 | |||
| 1293 | Ga0207677_11520637 | |||
| 1294 | Ga0207703_11855863 | |||
| 1295 | Ga0207639_11032502 | |||
| 1296 | Ga0207708_11197640 | |||
| 1297 | Ga0207708_11328210 | |||
| 1298 | Ga0207702_10000449 | |||
| 1299 | Ga0207702_10111875 | |||
| 1300 | Ga0207702_10309454 | |||
| 1301 | Ga0207702_10428424 | |||
| 1302 | Ga0207702_10464052 | |||
| 1303 | Ga0207702_10538832 | |||
| 1304 | Ga0207702_10909629 | |||
| 1305 | Ga0207641_10134655 | |||
| 1306 | Ga0207641_11593405 | |||
| 1307 | Ga0207648_10008188 | |||
| 1308 | Ga0207676_10612113 | |||
| 1309 | Ga0207676_10627767 | |||
| 1310 | Ga0207676_10691852 | |||
| 1311 | Ga0207676_11191778 | |||
| 1312 | Ga0207676_11233631 | |||
| 1313 | Ga0207676_12110769 | |||
| 1314 | Ga0207674_10105129 | |||
| 1315 | Ga0207674_10466710 | |||
| 1316 | Ga0207674_11240440 | |||
| 1317 | Ga0207683_10005218 | |||
| 1318 | Ga0207683_10040855 | |||
| 1319 | Ga0207683_11945445 | |||
| 1320 | Ga0207698_10167535 | |||
| 1321 | Ga0207698_10666695 | |||
| 1322 | Ga0209981_1007139 | |||
| 1323 | Ga0209588_1179380 | |||
| 1324 | Ga0268266_10005155 | |||
| 1325 | Ga0268266_10814462 | |||
| 1326 | Ga0268264_10549947 | |||
| 1327 | Ga0268264_10650291 | |||
| 1328 | Ga0268264_10782326 | |||
| 1329 | Ga0265337_1000360 | |||
| 1330 | Ga0265337_1001901 | |||
| 1331 | Ga0265337_1002361 | |||
| 1332 | Ga0265337_1005756 | |||
| 1333 | Ga0265337_1086395 | |||
| 1334 | Ga0265337_1127813 | |||
| 1335 | Ga0265337_1128548 | |||
| 1336 | Ga0265337_1129041 | |||
| 1337 | Ga0265337_1135437 | |||
| 1338 | Ga0265337_1165955 | |||
| 1339 | Ga0265326_10010563 | |||
| 1340 | Ga0265326_10013063 | |||
| 1341 | Ga0265326_10033168 | |||
| 1342 | Ga0265326_10045568 | |||
| 1343 | Ga0265326_10126649 | |||
| 1344 | Ga0265326_10129973 | |||
| 1345 | Ga0265319_1000019 | |||
| 1346 | Ga0265319_1000071 | |||
| 1347 | Ga0265319_1000330 | |||
| 1348 | Ga0265319_1001949 | |||
| 1349 | Ga0265319_1003969 | |||
| 1350 | Ga0265319_1005249 | |||
| 1351 | Ga0265319_1011894 | |||
| 1352 | Ga0265319_1017646 | |||
| 1353 | Ga0265319_1038622 | |||
| 1354 | Ga0265319_1038664 | |||
| 1355 | Ga0265319_1061435 | |||
| 1356 | Ga0265319_1119777 | |||
| 1357 | Ga0265334_10001615 | |||
| 1358 | Ga0265334_10001971 | |||
| 1359 | Ga0265334_10006043 | |||
| 1360 | Ga0265334_10126506 | |||
| 1361 | Ga0265318_10000273 | |||
| 1362 | Ga0265318_10001387 | |||
| 1363 | Ga0265318_10001452 | |||
| 1364 | Ga0265318_10002455 | |||
| 1365 | Ga0265318_10004654 | |||
| 1366 | Ga0265318_10005117 | |||
| 1367 | Ga0265318_10011287 | |||
| 1368 | Ga0265318_10063821 | |||
| 1369 | Ga0265318_10090353 | |||
| 1370 | Ga0265318_10341094 | |||
| 1371 | Ga0265323_10000005 | |||
| 1372 | Ga0265323_10000705 | |||
| 1373 | Ga0265323_10020264 | |||
| 1374 | Ga0265323_10031922 | |||
| 1375 | Ga0265323_10035085 | |||
| 1376 | Ga0265323_10151865 | |||
| 1377 | Ga0265323_10161115 | |||
| 1378 | Ga0265323_10179160 | |||
| 1379 | Ga0265322_10000766 | |||
| 1380 | Ga0265322_10018830 | |||
| 1381 | Ga0265322_10152210 | |||
| 1382 | Ga0265322_10161554 | |||
| 1383 | Ga0265336_10005520 | |||
| 1384 | Ga0265336_10007611 | |||
| 1385 | Ga0265336_10010005 | |||
| 1386 | Ga0265336_10017147 | |||
| 1387 | Ga0307515_10072629 | |||
| 1388 | Ga0307515_10226254 | |||
| 1389 | Ga0265338_10000919 | |||
| 1390 | Ga0265338_10001708 | |||
| 1391 | Ga0265338_10004347 | |||
| 1392 | Ga0265338_10006820 | |||
| 1393 | Ga0265338_10008397 | |||
| 1394 | Ga0265338_10008597 | |||
| 1395 | Ga0265338_10009193 | |||
| 1396 | Ga0265338_10019380 | |||
| 1397 | Ga0265338_10021305 | |||
| 1398 | Ga0265338_10027513 | |||
| 1399 | Ga0265338_10027677 | |||
| 1400 | Ga0265338_10044480 | |||
| 1401 | Ga0265338_10094870 | |||
| 1402 | Ga0265338_10127802 | |||
| 1403 | Ga0265338_10128636 | |||
| 1404 | Ga0265338_10131632 | |||
| 1405 | Ga0265338_10166764 | |||
| 1406 | Ga0265338_10180356 | |||
| 1407 | Ga0265338_10342156 | |||
| 1408 | Ga0265338_10403247 | |||
| 1409 | Ga0265338_10542829 | |||
| 1410 | Ga0265338_10926768 | |||
| 1411 | Ga0265338_11088933 | |||
| 1412 | Ga0311004_130229 | |||
| 1413 | Ga0311001_1018422 | |||
| 1414 | Ga0310981_1067369 | |||
| 1415 | Ga0265324_10000442 | |||
| 1416 | Ga0265324_10004791 | |||
| 1417 | Ga0265324_10008583 | |||
| 1418 | Ga0265324_10041126 | |||
| 1419 | Ga0265324_10043215 | |||
| 1420 | Ga0265324_10063196 | |||
| 1421 | Ga0265324_10077645 | |||
| 1422 | Ga0265324_10144406 | |||
| 1423 | Ga0265762_1049584 | |||
| 1424 | Ga0265330_10000998 | |||
| 1425 | Ga0265330_10011486 | |||
| 1426 | Ga0265330_10102067 | |||
| 1427 | Ga0265332_10000280 | |||
| 1428 | Ga0265332_10022104 | |||
| 1429 | Ga0265332_10121427 | |||
| 1430 | Ga0265332_10122872 | |||
| 1431 | Ga0265332_10198383 | |||
| 1432 | Ga0265332_10245132 | |||
| 1433 | Ga0265332_10277111 | |||
| 1434 | Ga0265332_10341298 | |||
| 1435 | Ga0265332_10396175 | |||
| 1436 | Ga0265328_10003166 | |||
| 1437 | Ga0265328_10007527 | |||
| 1438 | Ga0265328_10035187 | |||
| 1439 | Ga0265328_10037312 | |||
| 1440 | Ga0265328_10093673 | |||
| 1441 | Ga0265328_10099522 | |||
| 1442 | Ga0265328_10125682 | |||
| 1443 | Ga0265320_10000391 | |||
| 1444 | Ga0265320_10000430 | |||
| 1445 | Ga0265320_10000485 | |||
| 1446 | Ga0265320_10001512 | |||
| 1447 | Ga0265320_10001599 | |||
| 1448 | Ga0265320_10009586 | |||
| 1449 | Ga0265320_10010920 | |||
| 1450 | Ga0265320_10020032 | |||
| 1451 | Ga0265320_10032443 | |||
| 1452 | Ga0265320_10039318 | |||
| 1453 | Ga0265320_10041002 | |||
| 1454 | Ga0265320_10050473 | |||
| 1455 | Ga0265320_10072527 | |||
| 1456 | Ga0265320_10073590 | |||
| 1457 | Ga0265320_10147715 | |||
| 1458 | Ga0265320_10171510 | |||
| 1459 | Ga0265320_10182576 | |||
| 1460 | Ga0265320_10254192 | |||
| 1461 | Ga0265325_10001575 | |||
| 1462 | Ga0265325_10025908 | |||
| 1463 | Ga0265325_10030183 | |||
| 1464 | Ga0265325_10222283 | |||
| 1465 | Ga0265329_10000013 | |||
| 1466 | Ga0265329_10062936 | |||
| 1467 | Ga0265340_10000189 | |||
| 1468 | Ga0265340_10006471 | |||
| 1469 | Ga0265340_10010599 | |||
| 1470 | Ga0265340_10033404 | |||
| 1471 | Ga0265340_10037337 | |||
| 1472 | Ga0265340_10056826 | |||
| 1473 | Ga0265340_10120529 | |||
| 1474 | Ga0265339_10001407 | |||
| 1475 | Ga0265339_10022952 | |||
| 1476 | Ga0265339_10031093 | |||
| 1477 | Ga0265339_10039559 | |||
| 1478 | Ga0265339_10054237 | |||
| 1479 | Ga0265339_10122126 | |||
| 1480 | Ga0265339_10343907 | |||
| 1481 | Ga0265339_10377502 | |||
| 1482 | Ga0265339_10595204 | |||
| 1483 | Ga0265331_10000543 | |||
| 1484 | Ga0265331_10011176 | |||
| 1485 | Ga0265331_10034609 | |||
| 1486 | Ga0265331_10040673 | |||
| 1487 | Ga0265331_10107681 | |||
| 1488 | Ga0265331_10215007 | |||
| 1489 | Ga0265331_10349492 | |||
| 1490 | Ga0265327_10002314 | |||
| 1491 | Ga0265327_10004150 | |||
| 1492 | Ga0265327_10006465 | |||
| 1493 | Ga0265327_10041880 | |||
| 1494 | Ga0265327_10048769 | |||
| 1495 | Ga0265327_10104862 | |||
| 1496 | Ga0265327_10430362 | |||
| 1497 | Ga0265316_10001048 | |||
| 1498 | Ga0265316_10001559 | |||
| 1499 | Ga0265316_10002957 | |||
| 1500 | Ga0265316_10006174 | |||
| 1501 | Ga0265316_10013893 | |||
| 1502 | Ga0265316_10017230 | |||
| 1503 | Ga0265316_10021617 | |||
| 1504 | Ga0265316_10023098 | |||
| 1505 | Ga0265316_10028793 | |||
| 1506 | Ga0265316_10054031 | |||
| 1507 | Ga0265316_10112787 | |||
| 1508 | Ga0265316_10154095 | |||
| 1509 | Ga0265316_10175950 | |||
| 1510 | Ga0265316_10185401 | |||
| 1511 | Ga0265316_10252714 | |||
| 1512 | Ga0265316_10346653 | |||
| 1513 | Ga0265316_10359608 | |||
| 1514 | Ga0265316_10668687 | |||
| 1515 | Ga0265316_10799617 | |||
| 1516 | Ga0265316_10828328 | |||
| 1517 | Ga0265316_11037340 | |||
| 1518 | Ga0265316_11146523 | |||
| 1519 | Ga0265316_11154711 | |||
| 1520 | Ga0307408_100000009 | |||
| 1521 | Ga0307408_100076442 | |||
| 1522 | Ga0307408_100766687 | |||
| 1523 | Ga0265313_10000016 | |||
| 1524 | Ga0265313_10000458 | |||
| 1525 | Ga0265313_10000463 | |||
| 1526 | Ga0265313_10000484 | |||
| 1527 | Ga0265313_10000667 | |||
| 1528 | Ga0265313_10000967 | |||
| 1529 | Ga0265313_10001355 | |||
| 1530 | Ga0265313_10013304 | |||
| 1531 | Ga0265313_10018854 | |||
| 1532 | Ga0265313_10136205 | |||
| 1533 | Ga0307508_10481615 | |||
| 1534 | Ga0316579_10244360 | |||
| 1535 | Ga0265314_10002804 | |||
| 1536 | Ga0265314_10003246 | |||
| 1537 | Ga0265314_10003296 | |||
| 1538 | Ga0265314_10008489 | |||
| 1539 | Ga0265314_10018694 | |||
| 1540 | Ga0265314_10023749 | |||
| 1541 | Ga0265314_10084279 | |||
| 1542 | Ga0265314_10091350 | |||
| 1543 | Ga0265314_10092900 | |||
| 1544 | Ga0265314_10150911 | |||
| 1545 | Ga0265314_10164950 | |||
| 1546 | Ga0265314_10207188 | |||
| 1547 | Ga0265314_10288030 | |||
| 1548 | Ga0265314_10499058 | |||
| 1549 | Ga0265342_10000471 | |||
| 1550 | Ga0265342_10011450 | |||
| 1551 | Ga0265342_10019586 | |||
| 1552 | Ga0265342_10052539 | |||
| 1553 | Ga0265342_10055789 | |||
| 1554 | Ga0265342_10076611 | |||
| 1555 | Ga0265342_10094282 | |||
| 1556 | Ga0265342_10155620 | |||
| 1557 | Ga0265342_10249931 | |||
| 1558 | Ga0265342_10256452 | |||
| 1559 | Ga0265342_10281360 | |||
| 1560 | Ga0265342_10296129 | |||
| 1561 | Ga0265342_10420711 | |||
| 1562 | Ga0265342_10441138 | |||
| 1563 | Ga0265342_10577983 | |||
| 1564 | Ga0316576_10003165 | |||
| 1565 | Ga0316576_10126634 | |||
| 1566 | Ga0316578_10021235 | |||
| 1567 | Ga0316578_10095695 | |||
| 1568 | Ga0316578_10129348 | |||
| 1569 | Ga0316578_10445722 | |||
| 1570 | Ga0316578_10470234 | |||
| 1571 | Ga0307405_10098385 | |||
| 1572 | Ga0307405_11086155 | |||
| 1573 | Ga0316577_10678550 | |||
| 1574 | Ga0307413_10259796 | |||
| 1575 | Ga0307413_11332099 | |||
| 1576 | Ga0307413_11789323 | |||
| 1577 | Ga0307410_10000097 | |||
| 1578 | Ga0307410_10315181 | |||
| 1579 | Ga0307410_11851461 | |||
| 1580 | Ga0307410_11877839 | |||
| 1581 | Ga0307406_12019527 | |||
| 1582 | Ga0307407_10008349 | |||
| 1583 | Ga0307407_10433402 | |||
| 1584 | Ga0307409_100000037 | |||
| 1585 | Ga0307409_100814041 | |||
| 1586 | Ga0307409_100967887 | |||
| 1587 | Ga0307416_100000018 | |||
| 1588 | Ga0307416_102892360 | |||
| 1589 | Ga0307414_10102967 | |||
| 1590 | Ga0307414_11757641 | |||
| 1591 | Ga0307411_10984400 | |||
| 1592 | Ga0316583_10187372 | |||
| 1593 | Ga0316583_10204605 | |||
| 1594 | Ga0316593_10087338 | |||
| 1595 | Ga0316593_10305000 | |||
| 1596 | Ga0307507_10068536 | |||
| 1597 | Ga0316592_1176405 | |||
| 1598 | Ga0316587_1034770 | |||
| 1599 | Ga0316587_1072092 | |||
| 1600 | Ga0373959_0021034 | |||
| 1601 | Ga0373959_0196683 | |||
| 1602 | Ga0373938_0002423 | |||
| 1603 | Ga0373938_0025501 | |||
| 1604 | Ga0373926_0037278 | |||
| 1605 | Ga0373926_0168020 | |||
| 1606 | Ga0373929_0225821 | |||
| 1607 | Ga0373934_0110628 | |||
| 1608 | Ga0373934_0152429 | |||
| 1609 | Ga0373951_0005223 | |||
| 1610 | Ga0373952_0074303 | |||
| 1611 | Ga0373923_0102679 | |||
| 1612 | Ga0373936_0629211 | |||
| 1613 | Ga0373945_0138113 | |||
| 1614 | Ga0373953_0032690 | |||
| 1615 | Ga0373954_0004503 | |||
| 1616 | Ga0373954_0062903 | |||
| 1617 | Ga0373954_0102650 | |||
| 1618 | Ga0373954_0276416 | |||
| 1619 | Ga0373954_0529218 | |||
| 1620 | Ga0373954_0706079 | |||
| 1621 | Ga0373956_0013877 | |||
| 1622 | Ga0373960_0152723 | |||
| 1623 | Ga0373943_0440986 | |||
| 1624 | Ga0373943_0535570 | |||
| 1625 | Ga0373946_0141156 | |||
| 1626 | Ga0373946_0208652 | |||
| 1627 | Ga0373942_0177862 | |||
| 1628 | Ga0373961_0136401 | |||
| 1629 | Ga0373931_0140469 | |||
| 1630 | Ga0373931_0348474 | |||
| 1631 | Ga0373931_0521305 | |||
| 1632 | Ga0373935_0004181 | |||
| 1633 | Ga0373935_0137172 | |||
| 1634 | Ga0373935_0202219 | |||
| 1635 | Ga0373935_0390479 | |||
| 1636 | Ga0373927_0020007 | |||
| 1637 | Ga0373933_0072142 | |||
| 1638 | Ga0373933_0137097 | |||
| 1639 | Ga0373933_0343072 | |||
| 1640 | Ga0373933_0494782 | |||
| 1641 | Ga0373937_0002552 | |||
| 1642 | Ga0373937_0018696 | |||
| 1643 | Ga0373937_0046230 | |||
| 1644 | Ga0373937_0188429 | |||
| 1645 | Ga0373937_0408129 | |||
| 1646 | Ga0373937_0464897 | |||
| 1647 | Ga0373937_0710668 | |||
| 1648 | Ga0373937_0728155 | |||
| 1649 | Ga0373937_0812592 | |||
| 1650 | Ga0373937_0859409 | |||
| 1651 | Ga0373937_1508125 | |||
| 1652 | Ga0373937_2088550 | |||
| 1653 | Ga0316582_0245267 | |||
| 1654 | Ga0373925_0099158 | |||
| 1655 | Ga0373925_0107210 | |||
| 1656 | Ga0395899_0007028 | |||
| 1657 | Ga0395899_0215573 | |||
| 1658 | Ga0395900_0014228 | |||
| 1659 | Ga0395900_0233398 | |||
| 1660 | Ga0395900_1077505 | |||
| 1661 | Ga0395898_0005690 | |||
| 1662 | Ga0395898_0199091 | |||
| 1663 | Ga0395905_0000064 | |||
| 1664 | Ga0395905_0092421 | |||
| 1665 | Ga0395905_0104459 | |||
| 1666 | Ga0395905_0166007 | |||
| 1667 | Ga0395905_0365392 | |||
| 1668 | Ga0436364_0710949 | |||
| 1669 | Ga0395901_0007619 | |||
| 1670 | Ga0395901_0067405 | |||
| 1671 | Ga0395901_0171115 | |||
| 1672 | Ga0242420_081185 | |||
| 1673 | Ga0400489_44614 | |||
| 1674 | Ga0400489_74686 | |||
| 1675 | Ga0436365_0174030 | |||
| 1676 | Ga0436365_0582907 | |||
| 1677 | Ga0436365_1092380 | |||
| 1678 | Ga0436365_1511533 | |||
| 1679 | Ga0436360_0175680 | |||
| 1680 | Ga0436360_0438632 | |||
| 1681 | Ga0436360_1143196 | |||
| 1682 | Ga0436360_1269525 | |||
| 1683 | Ga0436361_0271121 | |||
| 1684 | Ga0436363_0890189 | |||
| 1685 | Ga0436363_0927249 | |||
| 1686 | Ga0436363_0942557 | |||
| 1687 | Ga0436362_0062320 | |||
| 1688 | Ga0436362_0877265 | |||
| 1689 | Ga0439461_0099089 | |||
| 1690 | Ga0439461_0196584 | |||
| 1691 | Ga0439465_0060703 | |||
| 1692 | Ga0451789_1153559 | |||
| 1693 | Ga0451795_0900085 | |||
| 1694 | Ga0451800_0134159 | |||
| 1695 | Ga0451802_0891862 | |||
| 1696 | Ga0451841_0163031 | |||
| 1697 | Ga0451847_0366062 | |||
| 1698 | Ga0451853_3620705 | |||
| 1699 | Ga0439433_0075444 | |||
| 1700 | Ga0439441_005193 | |||
| 1701 | Ga0439448_0011743 | |||
| 1702 | Ga0439454_123214 | |||
| 1703 | Ga0439456_143619 | |||
| 1704 | Ga0450904_033175 | |||
| 1705 | Ga0439446_0121905 | |||
| 1706 | Ga0450908_014907 | |||
| 1707 | Ga0439444_0055796 | |||
| 1708 | Ga0451577_0000008 | |||
| 1709 | Ga0451577_0000155 | |||
| 1710 | Ga0451577_0005406 | |||
| 1711 | Ga0451577_0012523 | |||
| 1712 | Ga0451577_0015131 | |||
| 1713 | Ga0451577_0018419 | |||
| 1714 | Ga0451577_0029976 | |||
| 1715 | Ga0451577_0041006 | |||
| 1716 | Ga0451577_0090080 | |||
| 1717 | Ga0451577_0121976 | |||
| 1718 | Ga0451577_0599523 | |||
| 1719 | Ga0451577_0716331 | |||
| 1720 | Ga0451577_1063144 | |||
| 1721 | Ga0451577_1304253 | |||
| 1722 | Ga0466969_0215308 | |||
| 1723 | Ga0453683_0008323 | |||
| 1724 | Ga0453683_0014110 | |||
| 1725 | Ga0453683_0046011 | |||
| 1726 | Ga0453683_0046241 | |||
| 1727 | Ga0453683_0128187 | |||
| 1728 | Ga0453683_0150644 | |||
| 1729 | Ga0453683_0247322 | |||
| 1730 | Ga0453683_0519281 | |||
| 1731 | Ga0453683_0554029 | |||
| 1732 | Ga0466963_0022826 | |||
| 1733 | Ga0466963_1259992 | |||
| 1734 | Ga0466964_0353405 | |||
| 1735 | Ga0453684_0000032 | |||
| 1736 | Ga0453684_0000295 | |||
| 1737 | Ga0453684_0000652 | |||
| 1738 | Ga0453684_0000735 | |||
| 1739 | Ga0453684_0001648 | |||
| 1740 | Ga0453684_0005247 | |||
| 1741 | Ga0453684_0005256 | |||
| 1742 | Ga0453684_0005884 | |||
| 1743 | Ga0453684_0008030 | |||
| 1744 | Ga0453684_0017321 | |||
| 1745 | Ga0453684_0018447 | |||
| 1746 | Ga0453684_0021178 | |||
| 1747 | Ga0453684_0027964 | |||
| 1748 | Ga0453684_0028873 | |||
| 1749 | Ga0453684_0032832 | |||
| 1750 | Ga0453684_0034674 | |||
| 1751 | Ga0453684_0452146 | |||
| 1752 | Ga0453684_0491366 | |||
| 1753 | Ga0453684_0907100 | |||
| 1754 | Ga0453684_1220233 | |||
| 1755 | Ga0453684_2341387 | |||
| 1756 | Ga0466968_0298312 | |||
| 1757 | Ga0466957_0183869 | |||
| 1758 | Ga0466957_0229546 | |||
| 1759 | Ga0466960_0012057 | |||
| 1760 | Ga0466959_0069974 | |||
| 1761 | Ga0466959_0995691 | |||
| 1762 | Ga0451576_0000359 | |||
| 1763 | Ga0451576_0001217 | |||
| 1764 | Ga0451576_0001406 | |||
| 1765 | Ga0451576_0024674 | |||
| 1766 | Ga0451576_0041265 | |||
| 1767 | Ga0451576_0063827 | |||
| 1768 | Ga0451576_0071392 | |||
| 1769 | Ga0451576_0183249 | |||
| 1770 | Ga0451576_0220524 | |||
| 1771 | Ga0451576_0239449 | |||
| 1772 | Ga0451576_0246100 | |||
| 1773 | Ga0451576_0972395 | |||
| 1774 | Ga0451576_1403756 | |||
| 1775 | Ga0451576_2202948 | |||
| 1776 | Ga0466967_0047822 | |||
| 1777 | Ga0466967_0149825 | |||
| 1778 | Ga0495629_0006700 | |||
| 1779 | Ga0495638_0555916 | |||
| 1780 | Ga0495651_0320902 | |||
| 1781 | Ga0495651_0415726 | |||
| 1782 | Ga0495653_0290394 | |||
| 1783 | Ga0495653_0301149 | |||
| 1784 | Ga0495650_0201763 | |||
| 1785 | Ga0495580_0002023 | |||
| 1786 | Ga0495580_0755560 | |||
| 1787 | Ga0495662_0590705 | |||
| 1788 | Ga0495664_0133998 | |||
| 1789 | Ga0495664_0450866 | |||
| 1790 | Ga0495594_0785771 | |||
| 1791 | Ga0495608_0153947 | |||
| 1792 | Ga0495618_0001918 | |||
| 1793 | Ga0495628_0433552 | |||
| 1794 | Ga0495628_0746891 | |||
| 1795 | Ga0495630_0042073 | |||
| 1796 | Ga0495630_0315808 | |||
| 1797 | Ga0495630_0337163 | |||
| 1798 | Ga0495630_0409409 | |||
| 1799 | Ga0495666_0314756 | |||
| 1800 | Ga0495640_0045519 | |||
| 1801 | Ga0495640_0058160 | |||
| 1802 | Ga0495586_0001064 | |||
| 1803 | Ga0495586_0053812 | |||
| 1804 | Ga0495586_0082158 | |||
| 1805 | Ga0495586_0720612 | |||
| 1806 | Ga0495587_0091265 | |||
| 1807 | Ga0495587_0095081 | |||
| 1808 | Ga0495645_0051583 | |||
| 1809 | Ga0495645_0245886 | |||
| 1810 | Ga0495622_0007056 | |||
| 1811 | Ga0495667_0009232 | |||
| 1812 | Ga0495667_0026521 | |||
| 1813 | Ga0495634_0003274 | |||
| 1814 | Ga0495634_0354668 | |||
| 1815 | Ga0495635_0220001 | |||
| 1816 | Ga0495635_0271209 | |||
| 1817 | Ga0495657_0175934 | |||
| 1818 | Ga0495599_0401489 | |||
| 1819 | Ga0495623_0297556 | |||
| 1820 | Ga0495647_0012537 | |||
| 1821 | Ga0495658_0132955 | |||
| 1822 | Ga0495658_0292522 | |||
| 1823 | Ga0495613_0003460 | |||
| 1824 | Ga0495613_0279663 | |||
| 1825 | Ga0495589_0090822 | |||
| 1826 | Ga0495581_0374774 | |||
| 1827 | Ga0495604_0098575 | |||
| 1828 | Ga0495604_0204701 | |||
| 1829 | Ga0495604_0445116 | |||
| 1830 | Ga0495674_0589133 | |||
| 1831 | Ga0495674_0972041 | |||
| 1832 | Ga0495680_0002262 | |||
| 1833 | Ga0495680_0062109 | |||
| 1834 | Ga0495680_0072824 | |||
| 1835 | Ga0495680_0149335 | |||
| 1836 | Ga0495680_0432662 | |||
| 1837 | Ga0495680_0998486 | |||
| 1838 | Ga0495675_0074423 | |||
| 1839 | Ga0495675_0193052 | |||
| 1840 | Ga0495684_0011576 | |||
| 1841 | Ga0496102_0472002 | |||
| 1842 | Ga0496104_0663294 | |||
| 1843 | Ga0496106_0548259 | |||
| 1844 | Ga0496108_1657028 | |||
| 1845 | Ga0496109_1708833 | |||
| 1846 | Ga0496113_1059593 | |||
| 1847 | Ga0496115_0002169 | |||
| 1848 | Ga0496122_0082526 | |||
| 1849 | Ga0496126_0261908 | |||
| 1850 | Ga0501306_013124 | |||
| 1851 | Ga0501308_000183 | |||
| 1852 | Ga0501308_002435 | |||
| 1853 | Ga0501308_002563 | |||
| 1854 | Ga0501308_006720 | |||
| 1855 | Ga0501308_038280 | |||
| 1856 | Ga0501309_001317 | |||
| 1857 | Ga0501310_009303 | |||
| 1858 | Ga0501304_001532 | |||
| 1859 | Ga0501304_003315 | |||
| 1860 | Ga0501304_039633 | |||
| 1861 | Ga0501305_000001 | |||
| 1862 | Ga0501305_000061 | |||
| 1863 | Ga0501305_000471 | |||
| 1864 | Ga0501305_002606 | |||
| 1865 | Ga0501305_004945 | |||
| 1866 | Ga0501305_100090 | |||
| 1867 | Ga0501307_000001 | |||
| 1868 | Ga0501307_000032 | |||
| 1869 | Ga0501307_001064 | |||
| 1870 | Ga0501307_023200 | |||
| 1871 | Ga0501307_039449 | |||
| 1872 | Ga0501290_013054 | |||
| 1873 | Ga0501311_014812 | |||
| 1874 | Ga0501311_029576 | |||
| 1875 | Ga0501311_067889 | |||
| 1876 | Ga0501312_000001 | |||
| 1877 | Ga0501312_000189 | |||
| 1878 | Ga0501312_014217 | |||
| 1879 | Ga0501312_033006 | |||
| 1880 | Ga0501313_000478 | |||
| 1881 | Ga0501314_002402 | |||
| 1882 | Ga0501314_008769 | |||
| 1883 | Ga0501315_001006 | |||
| 1884 | Ga0501315_008983 | |||
| 1885 | Ga0501315_044361 | |||
| 1886 | Ga0501315_087658 | |||
| 1887 | Ga0501317_003139 | |||
| 1888 | Ga0501318_032067 | |||
| 1889 | Ga0501319_021214 | |||
| 1890 | Ga0501320_000452 | |||
| 1891 | Ga0501322_003879 | |||
| 1892 | Ga0501322_004168 | |||
| 1893 | Ga0501323_009259 | |||
| 1894 | Ga0501323_026805 | |||
| 1895 | Ga0501324_013372 | |||
| 1896 | Ga0501325_001022 | |||
| 1897 | Ga0501326_08908 | |||
| 1898 | Ga0501328_03494 | |||
| 1899 | Ga0501329_11162 | |||
| 1900 | Ga0501330_007402 | |||
| 1901 | Ga0501335_004292 | |||
| 1902 | Ga0501340_004049 | |||
| 1903 | Ga0501031_0000292 | |||
| 1904 | Ga0501031_0002762 | |||
| 1905 | Ga0501031_0040058 | |||
| 1906 | Ga0501032_0006919 | |||
| 1907 | Ga0501032_0017049 | |||
| 1908 | Ga0501032_0017943 | |||
| 1909 | Ga0501032_0189366 | |||
| 1910 | Ga0501032_0422583 | |||
| 1911 | Ga0501032_0729790 | |||
| 1912 | Ga0501033_0005284 | |||
| 1913 | Ga0501033_0008437 | |||
| 1914 | Ga0501033_0013322 | |||
| 1915 | Ga0501033_0040145 | |||
| 1916 | Ga0501033_0315314 | |||
| 1917 | Ga0501034_0199162 | |||
| 1918 | Ga0501034_0235529 | |||
| 1919 | Ga0501034_0296379 | |||
| 1920 | Ga0501034_0519636 | |||
| 1921 | Ga0501034_0663193 | |||
| 1922 | Ga0501034_1104864 | |||
| 1923 | Ga0501034_1313952 | |||
| 1924 | Ga0501036_0004436 | |||
| 1925 | Ga0501036_0895177 | |||
| 1926 | Ga0501037_0011831 | |||
| 1927 | Ga0501037_0094984 | |||
| 1928 | Ga0501037_0319656 | |||
| 1929 | Ga0501037_0428287 | |||
| 1930 | Ga0501037_0491451 | |||
| 1931 | Ga0501037_1041238 | |||
| 1932 | Ga0501038_0004183 | |||
| 1933 | Ga0501038_0186569 | |||
| 1934 | Ga0501038_0291423 | |||
| 1935 | Ga0501038_1000122 | |||
| 1936 | Ga0501039_0001456 | |||
| 1937 | Ga0501039_0130275 | |||
| 1938 | Ga0501039_0956610 | |||
| 1939 | Ga0501042_0203844 | |||
| 1940 | Ga0501043_0059008 | |||
| 1941 | Ga0501043_0205183 | |||
| 1942 | Ga0501043_0212858 | |||
| 1943 | Ga0501046_0005999 | |||
| 1944 | Ga0501046_0051585 | |||
| 1945 | Ga0501047_0017441 | |||
| 1946 | Ga0501047_0024791 | |||
| 1947 | Ga0501047_0079634 | |||
| 1948 | Ga0501047_0175418 | |||
| 1949 | Ga0501047_1020753 | |||
| 1950 | Ga0501047_1378381 | |||
| 1951 | Ga0501048_0004214 | |||
| 1952 | Ga0501048_0015870 | |||
| 1953 | Ga0501067_0240095 | |||
| 1954 | Ga0501068_0023470 | |||
| 1955 | Ga0501068_0035924 | |||
| 1956 | Ga0501069_0577610 | |||
| 1957 | Ga0501070_0056055 | |||
| 1958 | Ga0501070_0134563 | |||
| 1959 | Ga0501070_0354300 | |||
| 1960 | Ga0501070_0974744 | |||
| 1961 | Ga0501070_1217159 | |||
| 1962 | Ga0501072_0335612 | |||
| 1963 | Ga0501072_1140106 | |||
| 1964 | Ga0501073_0196982 | |||
| 1965 | Ga0501073_0561515 | |||
| 1966 | Ga0501077_0423070 | |||
| 1967 | Ga0501207_111022 | |||
| 1968 | Ga0501243_001912 | |||
| 1969 | Ga0501080_0160800 | |||
| 1970 | Ga0501080_0164222 | |||
| 1971 | Ga0501080_0215135 | |||
| 1972 | Ga0501080_0239349 | |||
| 1973 | Ga0501080_0279589 | |||
| 1974 | Ga0501080_0688706 | |||
| 1975 | Ga0501080_1194520 | |||
| 1976 | Ga0501080_1824672 | |||
| 1977 | Ga0501083_0001752 | |||
| 1978 | Ga0501083_0081088 | |||
| 1979 | Ga0501083_0158585 | |||
| 1980 | Ga0501083_0235988 | |||
| 1981 | Ga0501263_012115 | |||
| 1982 | Ga0501264_027166 | |||
| 1983 | Ga0501035_0004187 | |||
| 1984 | Ga0501035_0032346 | |||
| 1985 | Ga0501035_0040870 | |||
| 1986 | Ga0501035_0170044 | |||
| 1987 | Ga0501044_0000427 | |||
| 1988 | Ga0501044_0011226 | |||
| 1989 | Ga0501044_0019577 | |||
| 1990 | Ga0501044_0027412 | |||
| 1991 | Ga0501044_0041072 | |||
| 1992 | Ga0501044_0200112 | |||
| 1993 | Ga0501044_0310874 | |||
| 1994 | Ga0501044_0976879 | |||
| 1995 | Ga0501044_1170077 | |||
| 1996 | Ga0501045_0584478 | |||
| 1997 | nmdc:mga05p37_210959_c1 | |||
| 1998 | nmdc:mga06r32_598805_c1 | |||
| 1999 | nmdc:mga0n895_13026_c1 | |||
| 2000 | nmdc:mga0rr50_1300481_c1 | |||
| 2001 | nmdc:mga0rr50_1845542_c1 | |||
| 2002 | nmdc:mga0a205_54866_c1 | |||
| 2003 | Ga0495595_0228738 | |||
| 2004 | Ga0495619_0665693 | |||
| 2005 | Ga0495619_0876621 | |||
| 2006 | Ga0495619_1116779 | |||
| 2007 | Ga0500643_009589 | |||
| 2008 | Ga0500644_0009620 | |||
| 2009 | Ga0500644_0064003 | |||
| 2010 | Ga0500647_0175632 | |||
| 2011 | Ga0500566_0076538 | |||
| 2012 | Ga0500642_0091653 | |||
| 2013 | Ga0500652_111558 | |||
| 2014 | Ga0500588_0004535 | |||
| 2015 | Ga0500616_0035635 | |||
| 2016 | Ga0500616_0118534 | |||
| 2017 | Ga0500636_0503809 | |||
| 2018 | Ga0500645_027583 | |||
| 2019 | Ga0501084_0006405 | |||
| 2020 | Ga0501084_0655366 | |||
| 2021 | Ga0590077_112427 | |||
| 2022 | Ga0587070_025179 | |||
| 2023 | Ga0587073_0086591 | |||
| 2024 | Ga0587073_0198834 | |||
| 2025 | Ga0587077_000219 | |||
| 2026 | Ga0587082_106977 | |||
| 2027 | Ga0587083_0009094 | |||
| 2028 | Ga0587085_008578 | |||
| 2029 | Ga0587085_032298 | |||
| 2030 | Ga0587086_001313 | |||
| 2031 | Ga0587088_035195 | |||
| 2032 | Ga0587090_000239 | |||
| 2033 | Ga0587125_070150 | |||
| 2034 | Ga0587101_000303 | |||
| 2035 | Ga0587101_058593 | |||
| 2036 | Ga0587128_113790 | |||
| 2037 | Ga0587068_001246 | |||
| 2038 | Ga0587076_002597 | |||
| 2039 | Ga0587078_000387 | |||
| 2040 | Ga0587111_0000057 | |||
| 2041 | Ga0587111_0000079 | |||
| 2042 | Ga0587111_0041192 | |||
| 2043 | Ga0587111_0121513 | |||
| 2044 | Ga0501082_0069836 | |||
| 2045 | Ga0501082_0091200 | |||
| 2046 | Ga0501082_0237307 | |||
| 2047 | Ga0501082_0329537 | |||
| 2048 | Ga0501082_1257835 | |||
| 2049 | Ga0501082_1910676 | |||
| 2050 | 2512032383 | |||
| 2051 | 2524609943 | |||
| 2052 | 2599105617 | |||
| 2053 | 2788433948 | |||
| 2054 | 2842335157 | |||
| 2055 | 2846954697 | |||
| 2056 | 2848859036 | |||
| 2057 | 2883294827 | |||
| 2058 | 2883356687 | |||
| 2059 | 2897804176 | |||
| 2060 | 8054005931 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a57-assembly1.cif.gz_N | cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. | 0.988 | 1 | 122 |
| 4v9a-assembly1.cif.gz_BN | crystal structure of the 70s ribosome with tetracycline. | 0.9867 | 1 | 122 |
| 4wf9-assembly1.cif.gz_H | the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin | 0.9859 | 1 | 122 |
| 5jvh-assembly1.cif.gz_H | the crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin | 0.985 | 1 | 122 |
| 7y41-assembly1.cif.gz_L | mycobacterium smegmatis 50s ribosomal subunit from log phase of growth | 0.9845 | 1 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ddgW00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9777 | 2 | 121 | 2.40.150.20 |
| 6ddgW00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9698 | 2 | 121 | 2.40.150.20 |
| 3i1nK00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9515 | 1 | 121 | 2.40.150.20 |
| 1vw4I00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9411 | 1 | 122 | 2.40.150.20 |
| 1vw4I00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9336 | 1 | 122 | 2.40.150.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434CQN6-F1-model_v4 | 50S ribosomal protein L14 | 1.005 | 1 | 65 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-W4SMQ2-F1-model_v4 | 50S ribosomal protein L14 | 1.002 | 1 | 61 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A3B8K637-F1-model_v4 | deleted | 1.002 | 1 | 57 |
|
| AF-A0A371BCY3-F1-model_v4 | Large ribosomal subunit protein uL14 | 1.001 | 1 | 122 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A833NL55-F1-model_v4 | deleted | 0.9996 | 1 | 61 |
|