F488587
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1029 | 462 | 1029 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300049575|Ga0501039_0740727|Ga0501039_0740727_330_722 |
| Length | 130 |
| Sequence | MKDDAIFITGLLIHAHHGVMEHESKVGQRFILDLVLSVDLDDAARSDKLADTASYAAIVECATRAFTARNHKLVESAAGMVADAILSEFTKVTAVRVTVHKPHAPIAATFADVGVTIVRYRNAFDEPSHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 19 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 20 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 21 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 22 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 23 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 24 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 25 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 26 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 27 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 28 | 3300003383 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM | Metagenome | Rhizosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 32 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 119 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 148 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 149 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 150 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 151 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 152 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 153 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 154 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 155 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 156 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 259 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 261 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 262 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 263 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 264 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 265 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 266 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 267 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 269 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 270 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 274 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 275 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 276 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 278 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 279 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 280 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 281 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 282 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 284 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 292 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 299 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 300 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 301 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 303 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 306 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 307 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 308 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 310 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 311 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 312 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 313 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 315 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 316 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 318 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 319 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 320 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 321 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 322 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 323 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 324 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 325 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 326 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 327 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 328 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 329 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 330 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 331 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 332 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 333 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 334 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 335 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 336 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 337 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 338 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 339 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 340 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 341 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 385 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 386 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 387 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 388 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 389 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 390 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 393 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 394 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 395 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 396 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 397 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 398 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 399 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 400 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 401 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 402 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 403 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 404 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 437 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 438 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 439 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 440 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 451 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 456 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 457 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 458 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 462 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.43 |
| Nodule | 0 |
| Rhizoplane | 5.54 |
| Rhizosphere | 91.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214745210 | 2209111006 | Bacteria | 15141 |
| 2 | ARcpr5oldR_c000144 | 3300000041 | Bacteria | 12262 |
| 3 | ARSoilYngRDRAFT_c00009 | 3300000042 | Bacteria | 30468 |
| 4 | ARcpr5yngRDRAFT_c000006 | 3300000043 | Bacteria | 44193 |
| 5 | ARSoilOldRDRAFT_c000102 | 3300000044 | Bacteria | 16000 |
| 6 | ARCol0oldRDRAFT_c01043 | 3300000045 | Bacteria | 2085 |
| 7 | ARCol0yngRDRAFT_1000092 | 3300000652 | Bacteria | 16856 |
| 8 | JGI24032J14994_100041 | 3300001430 | Bacteria | 4933 |
| 9 | JGI24736J21556_1064614 | 3300001904 | Bacteria | 567 |
| 10 | JGI24752J21851_1042901 | 3300001976 | Bacteria | 608 |
| 11 | JGI24746J21847_1001712 | 3300001977 | Bacteria | 3514 |
| 12 | JGI24740J21852_10011798 | 3300001979 | Bacteria | 3316 |
| 13 | JGI24739J22299_10000092 | 3300001989 | Bacteria | 26283 |
| 14 | JGI24737J22298_10003955 | 3300001990 | Bacteria | 5189 |
| 15 | JGI24737J22298_10008311 | 3300001990 | Bacteria | 3481 |
| 16 | JGI24743J22301_10030239 | 3300001991 | Bacteria | 1064 |
| 17 | JGI24750J21931_1000128 | 3300002070 | Bacteria | 12041 |
| 18 | JGI24745J21846_1000110 | 3300002073 | Bacteria | 6290 |
| 19 | JGI24748J21848_1000158 | 3300002074 | Bacteria | 9876 |
| 20 | JGI24738J21930_10000010 | 3300002075 | Bacteria | 37976 |
| 21 | JGI24749J21850_1001926 | 3300002076 | Bacteria | 2933 |
| 22 | JGI24749J21850_1018182 | 3300002076 | Bacteria | 992 |
| 23 | JGI24744J21845_10000683 | 3300002077 | Bacteria | 6233 |
| 24 | JGI24744J21845_10110869 | 3300002077 | Bacteria | 509 |
| 25 | JGI24035J26624_1000002 | 3300002126 | Bacteria | 16706 |
| 26 | JGI24033J26618_1002588 | 3300002155 | Bacteria | 1858 |
| 27 | JGI24034J26672_10000201 | 3300002239 | Bacteria | 8012 |
| 28 | JGI24742J22300_10000765 | 3300002244 | Bacteria | 4898 |
| 29 | JGI24751J29686_10021731 | 3300002459 | Bacteria | 1330 |
| 30 | JGI26129J50193_1007527 | 3300003349 | Bacteria | 787 |
| 31 | JGI26129J50193_1015647 | 3300003349 | Bacteria | 558 |
| 32 | JGI26140J50224_101872 | 3300003383 | Bacteria | 756 |
| 33 | Ga0055526_1030168 | 3300003771 | Bacteria | 1588 |
| 34 | JGI25405J52794_10006144 | 3300003911 | Bacteria | 2190 |
| 35 | Ga0065717_1003867 | 3300005276 | Bacteria | 1160 |
| 36 | Ga0065716_1002550 | 3300005277 | Bacteria | 1687 |
| 37 | Ga0065704_10094385 | 3300005289 | Bacteria | 2543 |
| 38 | Ga0065712_10000899 | 3300005290 | Bacteria | 8202 |
| 39 | Ga0065712_10068648 | 3300005290 | Bacteria | 9527 |
| 40 | Ga0065715_10000752 | 3300005293 | Bacteria | 15084 |
| 41 | Ga0065715_10089173 | 3300005293 | Bacteria | 13131 |
| 42 | Ga0065715_10165183 | 3300005293 | Bacteria | 1572 |
| 43 | Ga0070658_10504520 | 3300005327 | Bacteria | 1045 |
| 44 | Ga0070676_10000978 | 3300005328 | Bacteria | 14208 |
| 45 | Ga0070676_10241875 | 3300005328 | Bacteria | 1201 |
| 46 | Ga0070683_100001029 | 3300005329 | Bacteria | 20930 |
| 47 | Ga0070683_100114195 | 3300005329 | Bacteria | 2549 |
| 48 | Ga0070683_101456400 | 3300005329 | Bacteria | 658 |
| 49 | Ga0070690_100001038 | 3300005330 | Bacteria | 14220 |
| 50 | Ga0070690_100615176 | 3300005330 | Bacteria | 826 |
| 51 | Ga0070670_100026956 | 3300005331 | Bacteria | 4943 |
| 52 | Ga0070670_100398935 | 3300005331 | Bacteria | 1214 |
| 53 | Ga0070677_10000126 | 3300005333 | Bacteria | 25482 |
| 54 | Ga0070677_10285506 | 3300005333 | Bacteria | 833 |
| 55 | Ga0068869_100000079 | 3300005334 | Bacteria | 44000 |
| 56 | Ga0068869_100035044 | 3300005334 | Bacteria | 3555 |
| 57 | Ga0068869_102041152 | 3300005334 | Bacteria | 515 |
| 58 | Ga0070666_10019358 | 3300005335 | Bacteria | 4394 |
| 59 | Ga0070666_10250122 | 3300005335 | Bacteria | 1255 |
| 60 | Ga0070680_100002329 | 3300005336 | Bacteria | 14022 |
| 61 | Ga0070680_100007030 | 3300005336 | Bacteria | 8579 |
| 62 | Ga0070680_100129426 | 3300005336 | Bacteria | 2111 |
| 63 | Ga0070682_100000641 | 3300005337 | Bacteria | 21233 |
| 64 | Ga0070682_100663111 | 3300005337 | Unclassified | 832 |
| 65 | Ga0068868_100002114 | 3300005338 | Bacteria | 13683 |
| 66 | Ga0070660_100002411 | 3300005339 | Bacteria | 12843 |
| 67 | Ga0070660_100019320 | 3300005339 | Bacteria | 4990 |
| 68 | Ga0070660_101957305 | 3300005339 | Bacteria | 500 |
| 69 | Ga0070689_100003727 | 3300005340 | Bacteria | 10202 |
| 70 | Ga0070689_100021372 | 3300005340 | Bacteria | 4817 |
| 71 | Ga0070691_10000161 | 3300005341 | Bacteria | 21699 |
| 72 | Ga0070691_10033380 | 3300005341 | Bacteria | 2422 |
| 73 | Ga0070687_100000085 | 3300005343 | Bacteria | 30647 |
| 74 | Ga0070687_100013028 | 3300005343 | Bacteria | 3693 |
| 75 | Ga0070687_100760099 | 3300005343 | Bacteria | 683 |
| 76 | Ga0070687_100917709 | 3300005343 | Bacteria | 629 |
| 77 | Ga0070661_100000307 | 3300005344 | Bacteria | 39479 |
| 78 | Ga0070661_100454154 | 3300005344 | Bacteria | 1020 |
| 79 | Ga0070661_100551561 | 3300005344 | Bacteria | 927 |
| 80 | Ga0070661_100855173 | 3300005344 | Bacteria | 749 |
| 81 | Ga0070692_10001915 | 3300005345 | Bacteria | 7857 |
| 82 | Ga0070692_10048702 | 3300005345 | Bacteria | 2196 |
| 83 | Ga0070668_100009110 | 3300005347 | Bacteria | 7371 |
| 84 | Ga0070668_100039131 | 3300005347 | Bacteria | 3627 |
| 85 | Ga0070668_102210166 | 3300005347 | Unclassified | 508 |
| 86 | Ga0070669_100000571 | 3300005353 | Bacteria | 27367 |
| 87 | Ga0070669_100037439 | 3300005353 | Bacteria | 3519 |
| 88 | Ga0070675_100014189 | 3300005354 | Bacteria | 6280 |
| 89 | Ga0070675_100075720 | 3300005354 | Bacteria | 2798 |
| 90 | Ga0070675_101151216 | 3300005354 | Unclassified | 714 |
| 91 | Ga0070671_100000104 | 3300005355 | Bacteria | 53922 |
| 92 | Ga0070674_100000238 | 3300005356 | Bacteria | 27260 |
| 93 | Ga0070674_100057646 | 3300005356 | Bacteria | 2697 |
| 94 | Ga0070673_100000152 | 3300005364 | Bacteria | 33183 |
| 95 | Ga0070673_101435931 | 3300005364 | Bacteria | 650 |
| 96 | Ga0070688_100001552 | 3300005365 | Bacteria | 11464 |
| 97 | Ga0070688_100010437 | 3300005365 | Bacteria | 5120 |
| 98 | Ga0070688_100185664 | 3300005365 | Bacteria | 1445 |
| 99 | Ga0070659_100000551 | 3300005366 | Bacteria | 27372 |
| 100 | Ga0070659_100014072 | 3300005366 | Bacteria | 5970 |
| 101 | Ga0070667_100002365 | 3300005367 | Bacteria | 16513 |
| 102 | Ga0070667_100082240 | 3300005367 | Bacteria | 2757 |
| 103 | Ga0070667_100126878 | 3300005367 | Bacteria | 2224 |
| 104 | Ga0070703_10002446 | 3300005406 | Bacteria | 5352 |
| 105 | Ga0070703_10008783 | 3300005406 | Bacteria | 2845 |
| 106 | Ga0070703_10277971 | 3300005406 | Bacteria | 690 |
| 107 | Ga0070714_100382247 | 3300005435 | Bacteria | 1328 |
| 108 | Ga0070714_100521871 | 3300005435 | Bacteria | 1135 |
| 109 | Ga0070710_10903011 | 3300005437 | Bacteria | 638 |
| 110 | Ga0070701_10000674 | 3300005438 | Bacteria | 12016 |
| 111 | Ga0070701_10024327 | 3300005438 | Bacteria | 2929 |
| 112 | Ga0070701_10027601 | 3300005438 | Bacteria | 2783 |
| 113 | Ga0070711_100898965 | 3300005439 | Bacteria | 756 |
| 114 | Ga0070711_102008838 | 3300005439 | Bacteria | 509 |
| 115 | Ga0070705_100000096 | 3300005440 | Bacteria | 49240 |
| 116 | Ga0070705_100000148 | 3300005440 | Bacteria | 41687 |
| 117 | Ga0070705_100039756 | 3300005440 | Bacteria | 2671 |
| 118 | Ga0070700_100000277 | 3300005441 | Bacteria | 27391 |
| 119 | Ga0070700_100004184 | 3300005441 | Bacteria | 7525 |
| 120 | Ga0070700_100071695 | 3300005441 | Bacteria | 2212 |
| 121 | Ga0070700_101978793 | 3300005441 | Bacteria | 505 |
| 122 | Ga0070694_100009315 | 3300005444 | Bacteria | 6029 |
| 123 | Ga0070694_100025210 | 3300005444 | Bacteria | 3846 |
| 124 | Ga0070694_100028101 | 3300005444 | Bacteria | 3657 |
| 125 | Ga0070708_100013438 | 3300005445 | Bacteria | 6704 |
| 126 | Ga0070708_100080131 | 3300005445 | Bacteria | 2955 |
| 127 | Ga0070663_100000522 | 3300005455 | Bacteria | 20244 |
| 128 | Ga0070663_100030853 | 3300005455 | Bacteria | 3677 |
| 129 | Ga0070663_100107269 | 3300005455 | Bacteria | 2093 |
| 130 | Ga0070663_101465575 | 3300005455 | Unclassified | 606 |
| 131 | Ga0070678_100000718 | 3300005456 | Bacteria | 16435 |
| 132 | Ga0070678_102109210 | 3300005456 | Unclassified | 534 |
| 133 | Ga0070662_100019850 | 3300005457 | Bacteria | 4570 |
| 134 | Ga0070662_100078008 | 3300005457 | Bacteria | 2459 |
| 135 | Ga0070662_100479210 | 3300005457 | Unclassified | 1036 |
| 136 | Ga0070662_100815239 | 3300005457 | Bacteria | 794 |
| 137 | Ga0070681_10003456 | 3300005458 | Bacteria | 14797 |
| 138 | Ga0070681_10022561 | 3300005458 | Bacteria | 6322 |
| 139 | Ga0070681_10064843 | 3300005458 | Bacteria | 3623 |
| 140 | Ga0070681_10141932 | 3300005458 | Bacteria | 2331 |
| 141 | Ga0070681_11854580 | 3300005458 | Bacteria | 530 |
| 142 | Ga0068867_100004407 | 3300005459 | Bacteria | 9902 |
| 143 | Ga0068867_100017974 | 3300005459 | Bacteria | 5024 |
| 144 | Ga0068867_100775500 | 3300005459 | Unclassified | 853 |
| 145 | Ga0070685_10012102 | 3300005466 | Bacteria | 4525 |
| 146 | Ga0070706_100069484 | 3300005467 | Bacteria | 3257 |
| 147 | Ga0070698_100076049 | 3300005471 | Bacteria | 3361 |
| 148 | Ga0074259_11111610 | 3300005507 | Bacteria | 1435 |
| 149 | Ga0070699_100000255 | 3300005518 | Bacteria | 52092 |
| 150 | Ga0070699_101296327 | 3300005518 | Bacteria | 668 |
| 151 | Ga0070679_100031781 | 3300005530 | Bacteria | 5219 |
| 152 | Ga0070679_100031892 | 3300005530 | Bacteria | 5210 |
| 153 | Ga0070679_100033806 | 3300005530 | Bacteria | 5063 |
| 154 | Ga0070679_100133048 | 3300005530 | Bacteria | 2468 |
| 155 | Ga0070679_101519029 | 3300005530 | Bacteria | 617 |
| 156 | Ga0070684_100000894 | 3300005535 | Bacteria | 21105 |
| 157 | Ga0070684_100310980 | 3300005535 | Bacteria | 1447 |
| 158 | Ga0070684_100925204 | 3300005535 | Unclassified | 817 |
| 159 | Ga0070697_100015667 | 3300005536 | Bacteria | 5954 |
| 160 | Ga0070697_100390178 | 3300005536 | Bacteria | 1207 |
| 161 | Ga0070697_100659297 | 3300005536 | Bacteria | 922 |
| 162 | Ga0068853_100002891 | 3300005539 | Bacteria | 13032 |
| 163 | Ga0068853_100259619 | 3300005539 | Bacteria | 1597 |
| 164 | Ga0070672_100000088 | 3300005543 | Bacteria | 44394 |
| 165 | Ga0070672_100091389 | 3300005543 | Bacteria | 2456 |
| 166 | Ga0070672_100573416 | 3300005543 | Bacteria | 981 |
| 167 | Ga0070686_100000719 | 3300005544 | Bacteria | 19252 |
| 168 | Ga0070686_100032503 | 3300005544 | Bacteria | 3199 |
| 169 | Ga0070695_100000248 | 3300005545 | Bacteria | 26990 |
| 170 | Ga0070695_100001789 | 3300005545 | Bacteria | 12107 |
| 171 | Ga0070695_100027104 | 3300005545 | Bacteria | 3547 |
| 172 | Ga0070696_100000552 | 3300005546 | Bacteria | 23812 |
| 173 | Ga0070696_100013552 | 3300005546 | Bacteria | 5471 |
| 174 | Ga0070696_100020079 | 3300005546 | Bacteria | 4530 |
| 175 | Ga0070696_100421267 | 3300005546 | Bacteria | 1048 |
| 176 | Ga0070693_100000134 | 3300005547 | Bacteria | 33408 |
| 177 | Ga0070693_100009572 | 3300005547 | Bacteria | 4822 |
| 178 | Ga0070665_100050659 | 3300005548 | Bacteria | 4166 |
| 179 | Ga0070704_100000026 | 3300005549 | Bacteria | 48700 |
| 180 | Ga0070704_100011965 | 3300005549 | Bacteria | 5345 |
| 181 | Ga0070704_100044802 | 3300005549 | Bacteria | 3076 |
| 182 | Ga0070704_100309229 | 3300005549 | Bacteria | 1320 |
| 183 | Ga0070704_100607338 | 3300005549 | Unclassified | 962 |
| 184 | Ga0068855_100006834 | 3300005563 | Bacteria | 13840 |
| 185 | Ga0068855_102295069 | 3300005563 | Bacteria | 540 |
| 186 | Ga0068855_102355802 | 3300005563 | Bacteria | 532 |
| 187 | Ga0070664_100002234 | 3300005564 | Bacteria | 15585 |
| 188 | Ga0070664_100011614 | 3300005564 | Bacteria | 7146 |
| 189 | Ga0070664_100179423 | 3300005564 | Bacteria | 1882 |
| 190 | Ga0070664_100397929 | 3300005564 | Unclassified | 1259 |
| 191 | Ga0068857_100002935 | 3300005577 | Bacteria | 14058 |
| 192 | Ga0068857_100010529 | 3300005577 | Bacteria | 8039 |
| 193 | Ga0068854_100000546 | 3300005578 | Bacteria | 22673 |
| 194 | Ga0068854_100932240 | 3300005578 | Unclassified | 765 |
| 195 | Ga0068856_100002000 | 3300005614 | Bacteria | 21261 |
| 196 | Ga0068856_100541781 | 3300005614 | Bacteria | 1185 |
| 197 | Ga0070702_100000245 | 3300005615 | Bacteria | 18498 |
| 198 | Ga0070702_100127545 | 3300005615 | Bacteria | 1602 |
| 199 | Ga0068852_100008609 | 3300005616 | Bacteria | 7533 |
| 200 | Ga0068852_100091269 | 3300005616 | Bacteria | 2725 |
| 201 | Ga0068852_101149115 | 3300005616 | Unclassified | 797 |
| 202 | Ga0068852_101348714 | 3300005616 | Bacteria | 735 |
| 203 | Ga0068852_101580847 | 3300005616 | Unclassified | 678 |
| 204 | Ga0068859_100006734 | 3300005617 | Bacteria | 11674 |
| 205 | Ga0068859_100026101 | 3300005617 | Bacteria | 5860 |
| 206 | Ga0068859_100041857 | 3300005617 | Bacteria | 4602 |
| 207 | Ga0068864_100000890 | 3300005618 | Bacteria | 25145 |
| 208 | Ga0068864_100277961 | 3300005618 | Bacteria | 1562 |
| 209 | Ga0068866_10000221 | 3300005718 | Bacteria | 27070 |
| 210 | Ga0068861_100011785 | 3300005719 | Bacteria | 6084 |
| 211 | Ga0068861_100018274 | 3300005719 | Bacteria | 4993 |
| 212 | Ga0068861_100118272 | 3300005719 | Bacteria | 2134 |
| 213 | Ga0068870_10003727 | 3300005840 | Bacteria | 6480 |
| 214 | Ga0068870_10844419 | 3300005840 | Bacteria | 643 |
| 215 | Ga0068863_100000340 | 3300005841 | Bacteria | 47641 |
| 216 | Ga0068863_100056996 | 3300005841 | Bacteria | 3698 |
| 217 | Ga0068863_100431802 | 3300005841 | Bacteria | 1291 |
| 218 | Ga0068858_100000295 | 3300005842 | Bacteria | 53892 |
| 219 | Ga0068858_100102941 | 3300005842 | Bacteria | 2663 |
| 220 | Ga0068858_100150676 | 3300005842 | Bacteria | 2187 |
| 221 | Ga0068860_100001285 | 3300005843 | Bacteria | 27247 |
| 222 | Ga0068860_100004629 | 3300005843 | Bacteria | 14046 |
| 223 | Ga0068860_100158254 | 3300005843 | Bacteria | 2183 |
| 224 | Ga0068860_102061263 | 3300005843 | Bacteria | 592 |
| 225 | Ga0068862_100003236 | 3300005844 | Bacteria | 14093 |
| 226 | Ga0068862_100003354 | 3300005844 | Bacteria | 13821 |
| 227 | Ga0068862_100063398 | 3300005844 | Bacteria | 3180 |
| 228 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 229 | Ga0070717_10037964 | 3300006028 | Bacteria | 3913 |
| 230 | Ga0070717_10127591 | 3300006028 | Bacteria | 2185 |
| 231 | Ga0075365_10358614 | 3300006038 | Bacteria | 1028 |
| 232 | Ga0075363_100115462 | 3300006048 | Bacteria | 1495 |
| 233 | Ga0075363_100519829 | 3300006048 | Bacteria | 708 |
| 234 | Ga0075432_10027241 | 3300006058 | Bacteria | 1967 |
| 235 | Ga0070715_10325721 | 3300006163 | Bacteria | 831 |
| 236 | Ga0070716_100357488 | 3300006173 | Bacteria | 1036 |
| 237 | Ga0070712_100000052 | 3300006175 | Bacteria | 62524 |
| 238 | Ga0070712_100377819 | 3300006175 | Bacteria | 1166 |
| 239 | Ga0070712_100908656 | 3300006175 | Bacteria | 759 |
| 240 | Ga0075362_10188980 | 3300006177 | Bacteria | 1000 |
| 241 | Ga0075362_10436132 | 3300006177 | Bacteria | 664 |
| 242 | Ga0075367_10011053 | 3300006178 | Bacteria | 4761 |
| 243 | Ga0075367_10394533 | 3300006178 | Bacteria | 875 |
| 244 | Ga0075369_10139621 | 3300006186 | Bacteria | 1104 |
| 245 | Ga0097621_100000040 | 3300006237 | Bacteria | 66339 |
| 246 | Ga0075370_10374773 | 3300006353 | Bacteria | 852 |
| 247 | Ga0068871_100000301 | 3300006358 | Bacteria | 34368 |
| 248 | Ga0075431_100199738 | 3300006847 | Bacteria | 2046 |
| 249 | Ga0075431_100269493 | 3300006847 | Bacteria | 1726 |
| 250 | Ga0075431_101914954 | 3300006847 | Unclassified | 548 |
| 251 | Ga0075433_10016057 | 3300006852 | Bacteria | 6160 |
| 252 | Ga0075433_10067742 | 3300006852 | Bacteria | 3133 |
| 253 | Ga0075434_100002477 | 3300006871 | Bacteria | 16252 |
| 254 | Ga0075434_100249805 | 3300006871 | Bacteria | 1793 |
| 255 | Ga0075434_100441171 | 3300006871 | Bacteria | 1323 |
| 256 | Ga0068865_100000275 | 3300006881 | Bacteria | 28270 |
| 257 | Ga0075436_100005032 | 3300006914 | Bacteria | 9089 |
| 258 | Ga0075436_100042636 | 3300006914 | Unclassified | 3130 |
| 259 | Ga0097620_100006734 | 3300006931 | Bacteria | 11674 |
| 260 | Ga0097620_100026102 | 3300006931 | Bacteria | 5860 |
| 261 | Ga0097620_100041858 | 3300006931 | Bacteria | 4602 |
| 262 | Ga0075435_100096492 | 3300007076 | Bacteria | 2446 |
| 263 | Ga0075435_100250148 | 3300007076 | Bacteria | 1509 |
| 264 | Ga0075435_101291276 | 3300007076 | Bacteria | 639 |
| 265 | Ga0099795_10012252 | 3300007788 | Bacteria | 2594 |
| 266 | Ga0105251_10052992 | 3300009011 | Bacteria | 1930 |
| 267 | Ga0105250_10011042 | 3300009092 | Bacteria | 3754 |
| 268 | Ga0105250_10192936 | 3300009092 | Unclassified | 858 |
| 269 | Ga0105240_10212812 | 3300009093 | Bacteria | 2257 |
| 270 | Ga0105240_10367463 | 3300009093 | Bacteria | 1628 |
| 271 | Ga0111539_10000394 | 3300009094 | Bacteria | 54170 |
| 272 | Ga0111539_10003483 | 3300009094 | Bacteria | 20741 |
| 273 | Ga0111539_10043754 | 3300009094 | Bacteria | 5367 |
| 274 | Ga0105245_10000462 | 3300009098 | Bacteria | 37242 |
| 275 | Ga0105245_11078352 | 3300009098 | Bacteria | 849 |
| 276 | Ga0105245_11279654 | 3300009098 | Bacteria | 782 |
| 277 | Ga0105247_10000442 | 3300009101 | Bacteria | 35071 |
| 278 | Ga0105247_10171228 | 3300009101 | Bacteria | 1444 |
| 279 | Ga0114129_10178784 | 3300009147 | Bacteria | 2889 |
| 280 | Ga0114129_10905858 | 3300009147 | Bacteria | 1117 |
| 281 | Ga0105243_10000282 | 3300009148 | Bacteria | 56666 |
| 282 | Ga0105243_10031294 | 3300009148 | Bacteria | 4102 |
| 283 | Ga0105243_10398541 | 3300009148 | Bacteria | 1278 |
| 284 | Ga0105243_11105948 | 3300009148 | Bacteria | 801 |
| 285 | Ga0105241_10000652 | 3300009174 | Bacteria | 26004 |
| 286 | Ga0105241_10151582 | 3300009174 | Bacteria | 1897 |
| 287 | Ga0105241_10642950 | 3300009174 | Bacteria | 963 |
| 288 | Ga0105242_10001726 | 3300009176 | Bacteria | 17253 |
| 289 | Ga0105248_10010575 | 3300009177 | Bacteria | 10168 |
| 290 | Ga0105248_10023284 | 3300009177 | Bacteria | 6879 |
| 291 | Ga0105248_10388826 | 3300009177 | Bacteria | 1570 |
| 292 | Ga0105237_10008154 | 3300009545 | Bacteria | 11375 |
| 293 | Ga0105237_10875312 | 3300009545 | Bacteria | 905 |
| 294 | Ga0105238_10106046 | 3300009551 | Bacteria | 2792 |
| 295 | Ga0105238_12073122 | 3300009551 | Bacteria | 603 |
| 296 | Ga0105249_10001210 | 3300009553 | Bacteria | 22796 |
| 297 | Ga0105249_10003736 | 3300009553 | Bacteria | 13134 |
| 298 | Ga0105249_10010878 | 3300009553 | Bacteria | 7996 |
| 299 | Ga0105249_10399550 | 3300009553 | Bacteria | 1404 |
| 300 | Ga0099796_10006469 | 3300010159 | Bacteria | 3000 |
| 301 | Ga0105239_10006303 | 3300010375 | Bacteria | 13795 |
| 302 | Ga0105239_10163008 | 3300010375 | Bacteria | 2491 |
| 303 | Ga0105239_10258581 | 3300010375 | Bacteria | 1956 |
| 304 | Ga0105239_10282303 | 3300010375 | Bacteria | 1869 |
| 305 | Ga0105239_12355476 | 3300010375 | Bacteria | 620 |
| 306 | Ga0105246_10000312 | 3300011119 | Bacteria | 25800 |
| 307 | Ga0105246_10078510 | 3300011119 | Bacteria | 2345 |
| 308 | Ga0105246_10114945 | 3300011119 | Bacteria | 1984 |
| 309 | Ga0105246_10309787 | 3300011119 | Bacteria | 1278 |
| 310 | Ga0157344_1002004 | 3300012476 | Bacteria | 1038 |
| 311 | Ga0157328_1013142 | 3300012478 | Bacteria | 611 |
| 312 | Ga0157325_1002945 | 3300012485 | Bacteria | 907 |
| 313 | Ga0157343_1003240 | 3300012488 | Bacteria | 942 |
| 314 | Ga0157329_1010294 | 3300012491 | Bacteria | 731 |
| 315 | Ga0157341_1004268 | 3300012494 | Bacteria | 1028 |
| 316 | Ga0157313_1000657 | 3300012503 | Bacteria | 1665 |
| 317 | Ga0157315_1014475 | 3300012508 | Bacteria | 756 |
| 318 | Ga0157327_1031858 | 3300012512 | Bacteria | 662 |
| 319 | Ga0157373_10035915 | 3300013100 | Bacteria | 3557 |
| 320 | Ga0157371_10029433 | 3300013102 | Bacteria | 3972 |
| 321 | Ga0157371_10457690 | 3300013102 | Bacteria | 939 |
| 322 | Ga0157370_11531953 | 3300013104 | Bacteria | 599 |
| 323 | Ga0157369_11568099 | 3300013105 | Bacteria | 670 |
| 324 | Ga0157369_12043287 | 3300013105 | Bacteria | 581 |
| 325 | Ga0157374_10001123 | 3300013296 | Bacteria | 23027 |
| 326 | Ga0157374_10708914 | 3300013296 | Bacteria | 1020 |
| 327 | Ga0157378_10000270 | 3300013297 | Bacteria | 50517 |
| 328 | Ga0163162_10000145 | 3300013306 | Bacteria | 65191 |
| 329 | Ga0163162_10021406 | 3300013306 | Bacteria | 6368 |
| 330 | Ga0157372_10004025 | 3300013307 | Bacteria | 15762 |
| 331 | Ga0157372_10224278 | 3300013307 | Bacteria | 2179 |
| 332 | Ga0157372_11770094 | 3300013307 | Bacteria | 711 |
| 333 | Ga0157372_13276400 | 3300013307 | Unclassified | 516 |
| 334 | Ga0157375_10000332 | 3300013308 | Bacteria | 42513 |
| 335 | Ga0157375_10106184 | 3300013308 | Bacteria | 2900 |
| 336 | Ga0163163_10000865 | 3300014325 | Bacteria | 25811 |
| 337 | Ga0163163_10019523 | 3300014325 | Bacteria | 6367 |
| 338 | Ga0157380_10003074 | 3300014326 | Bacteria | 11374 |
| 339 | Ga0157380_10090270 | 3300014326 | Bacteria | 2527 |
| 340 | Ga0157377_10000137 | 3300014745 | Bacteria | 46698 |
| 341 | Ga0157379_10001761 | 3300014968 | Bacteria | 17895 |
| 342 | Ga0157379_10034305 | 3300014968 | Bacteria | 4524 |
| 343 | Ga0157376_10000088 | 3300014969 | Bacteria | 70084 |
| 344 | Ga0182006_1105742 | 3300015261 | Bacteria | 993 |
| 345 | Ga0163161_10000144 | 3300017792 | Bacteria | 64771 |
| 346 | Ga0197907_10831634 | 3300020069 | Bacteria | 525 |
| 347 | Ga0207666_1000048 | 3300025271 | Bacteria | 23535 |
| 348 | Ga0207666_1000232 | 3300025271 | Bacteria | 8175 |
| 349 | Ga0207673_1000013 | 3300025290 | Bacteria | 13878 |
| 350 | Ga0209564_1002100 | 3300025295 | Bacteria | 17043 |
| 351 | Ga0207697_10000136 | 3300025315 | Bacteria | 35274 |
| 352 | Ga0207697_10006414 | 3300025315 | Bacteria | 5326 |
| 353 | Ga0207713_1063062 | 3300025735 | Bacteria | 1401 |
| 354 | Ga0207653_10001370 | 3300025885 | Bacteria | 7928 |
| 355 | Ga0207653_10002887 | 3300025885 | Bacteria | 5457 |
| 356 | Ga0207682_10000006 | 3300025893 | Bacteria | 94953 |
| 357 | Ga0207682_10243760 | 3300025893 | Bacteria | 836 |
| 358 | Ga0207692_10226829 | 3300025898 | Bacteria | 1110 |
| 359 | Ga0207642_10003385 | 3300025899 | Bacteria | 5030 |
| 360 | Ga0207710_10001915 | 3300025900 | Bacteria | 9975 |
| 361 | Ga0207710_10018748 | 3300025900 | Bacteria | 2946 |
| 362 | Ga0207688_10000027 | 3300025901 | Bacteria | 48448 |
| 363 | Ga0207688_10013378 | 3300025901 | Bacteria | 4458 |
| 364 | Ga0207647_10005467 | 3300025904 | Bacteria | 9310 |
| 365 | Ga0207647_10014058 | 3300025904 | Bacteria | 5533 |
| 366 | Ga0207685_10255435 | 3300025905 | Bacteria | 849 |
| 367 | Ga0207699_10089456 | 3300025906 | Bacteria | 1930 |
| 368 | Ga0207645_10000100 | 3300025907 | Bacteria | 64057 |
| 369 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 370 | Ga0207643_10566913 | 3300025908 | Bacteria | 729 |
| 371 | Ga0207684_11610847 | 3300025910 | Bacteria | 525 |
| 372 | Ga0207654_10000314 | 3300025911 | Bacteria | 29106 |
| 373 | Ga0207654_10654077 | 3300025911 | Bacteria | 753 |
| 374 | Ga0207707_10003030 | 3300025912 | Bacteria | 14935 |
| 375 | Ga0207707_10003553 | 3300025912 | Bacteria | 13808 |
| 376 | Ga0207707_10334681 | 3300025912 | Bacteria | 1306 |
| 377 | Ga0207707_10649541 | 3300025912 | Bacteria | 889 |
| 378 | Ga0207707_10961805 | 3300025912 | Bacteria | 703 |
| 379 | Ga0207695_10031101 | 3300025913 | Bacteria | 5862 |
| 380 | Ga0207671_10029994 | 3300025914 | Bacteria | 4058 |
| 381 | Ga0207671_10040362 | 3300025914 | Bacteria | 3455 |
| 382 | Ga0207671_11033306 | 3300025914 | Bacteria | 647 |
| 383 | Ga0207693_10000835 | 3300025915 | Bacteria | 27434 |
| 384 | Ga0207693_10451262 | 3300025915 | Bacteria | 1005 |
| 385 | Ga0207693_10766771 | 3300025915 | Bacteria | 745 |
| 386 | Ga0207663_10263165 | 3300025916 | Bacteria | 1274 |
| 387 | Ga0207663_10310252 | 3300025916 | Bacteria | 1182 |
| 388 | Ga0207660_10000041 | 3300025917 | Bacteria | 63485 |
| 389 | Ga0207660_10030841 | 3300025917 | Bacteria | 3687 |
| 390 | Ga0207660_10063155 | 3300025917 | Bacteria | 2669 |
| 391 | Ga0207660_10468332 | 3300025917 | Bacteria | 1020 |
| 392 | Ga0207660_10956360 | 3300025917 | Bacteria | 699 |
| 393 | Ga0207660_11187095 | 3300025917 | Bacteria | 621 |
| 394 | Ga0207662_10000282 | 3300025918 | Bacteria | 23540 |
| 395 | Ga0207662_10012555 | 3300025918 | Bacteria | 4720 |
| 396 | Ga0207662_10554950 | 3300025918 | Bacteria | 796 |
| 397 | Ga0207657_10003933 | 3300025919 | Bacteria | 15773 |
| 398 | Ga0207657_10024595 | 3300025919 | Bacteria | 5572 |
| 399 | Ga0207649_10002204 | 3300025920 | Bacteria | 11011 |
| 400 | Ga0207649_10629545 | 3300025920 | Bacteria | 827 |
| 401 | Ga0207652_10006361 | 3300025921 | Bacteria | 9537 |
| 402 | Ga0207652_10041684 | 3300025921 | Bacteria | 3904 |
| 403 | Ga0207652_10052780 | 3300025921 | Bacteria | 3491 |
| 404 | Ga0207646_10925371 | 3300025922 | Bacteria | 773 |
| 405 | Ga0207681_10000100 | 3300025923 | Bacteria | 72913 |
| 406 | Ga0207681_10035203 | 3300025923 | Bacteria | 3298 |
| 407 | Ga0207694_10058343 | 3300025924 | Bacteria | 3002 |
| 408 | Ga0207694_11157445 | 3300025924 | Bacteria | 655 |
| 409 | Ga0207650_10031197 | 3300025925 | Bacteria | 3846 |
| 410 | Ga0207659_10000044 | 3300025926 | Bacteria | 88759 |
| 411 | Ga0207659_10356560 | 3300025926 | Bacteria | 1214 |
| 412 | Ga0207687_10000072 | 3300025927 | Bacteria | 76222 |
| 413 | Ga0207664_10474955 | 3300025929 | Bacteria | 1118 |
| 414 | Ga0207644_10007313 | 3300025931 | Bacteria | 7187 |
| 415 | Ga0207690_10000140 | 3300025932 | Bacteria | 58923 |
| 416 | Ga0207690_10045487 | 3300025932 | Bacteria | 2900 |
| 417 | Ga0207690_10416557 | 3300025932 | Bacteria | 1074 |
| 418 | Ga0207706_10003180 | 3300025933 | Bacteria | 15778 |
| 419 | Ga0207706_10023633 | 3300025933 | Bacteria | 5519 |
| 420 | Ga0207706_10088083 | 3300025933 | Bacteria | 2730 |
| 421 | Ga0207706_10107818 | 3300025933 | Bacteria | 2451 |
| 422 | Ga0207706_10606124 | 3300025933 | Bacteria | 940 |
| 423 | Ga0207686_10018123 | 3300025934 | Bacteria | 3980 |
| 424 | Ga0207686_11120960 | 3300025934 | Bacteria | 642 |
| 425 | Ga0207709_10000154 | 3300025935 | Bacteria | 93456 |
| 426 | Ga0207709_10007823 | 3300025935 | Bacteria | 5925 |
| 427 | Ga0207709_10682084 | 3300025935 | Bacteria | 821 |
| 428 | Ga0207670_10000444 | 3300025936 | Bacteria | 23206 |
| 429 | Ga0207670_10468651 | 3300025936 | Bacteria | 1018 |
| 430 | Ga0207670_10818838 | 3300025936 | Bacteria | 776 |
| 431 | Ga0207670_10857592 | 3300025936 | Unclassified | 759 |
| 432 | Ga0207669_10000176 | 3300025937 | Bacteria | 29979 |
| 433 | Ga0207669_10026689 | 3300025937 | Bacteria | 3147 |
| 434 | Ga0207704_10000086 | 3300025938 | Bacteria | 54866 |
| 435 | Ga0207704_10033653 | 3300025938 | Bacteria | 2917 |
| 436 | Ga0207704_10220588 | 3300025938 | Unclassified | 1403 |
| 437 | Ga0207665_10132210 | 3300025939 | Bacteria | 1773 |
| 438 | Ga0207665_10242924 | 3300025939 | Bacteria | 1327 |
| 439 | Ga0207691_10000214 | 3300025940 | Bacteria | 56205 |
| 440 | Ga0207691_10059545 | 3300025940 | Bacteria | 3472 |
| 441 | Ga0207711_10001773 | 3300025941 | Bacteria | 19760 |
| 442 | Ga0207711_10014174 | 3300025941 | Bacteria | 6621 |
| 443 | Ga0207689_10000366 | 3300025942 | Bacteria | 42711 |
| 444 | Ga0207689_10062365 | 3300025942 | Bacteria | 3065 |
| 445 | Ga0207689_11612069 | 3300025942 | Bacteria | 540 |
| 446 | Ga0207661_10000087 | 3300025944 | Bacteria | 63263 |
| 447 | Ga0207661_10604003 | 3300025944 | Bacteria | 1007 |
| 448 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 449 | Ga0207679_10008732 | 3300025945 | Bacteria | 6463 |
| 450 | Ga0207679_10269457 | 3300025945 | Bacteria | 1456 |
| 451 | Ga0207667_10022798 | 3300025949 | Bacteria | 6906 |
| 452 | Ga0207667_10834510 | 3300025949 | Bacteria | 916 |
| 453 | Ga0207651_10000264 | 3300025960 | Bacteria | 22299 |
| 454 | Ga0207651_10735947 | 3300025960 | Bacteria | 871 |
| 455 | Ga0207712_10000129 | 3300025961 | Bacteria | 79246 |
| 456 | Ga0207712_10002495 | 3300025961 | Bacteria | 11837 |
| 457 | Ga0207712_10008947 | 3300025961 | Bacteria | 6333 |
| 458 | Ga0207668_10000100 | 3300025972 | Bacteria | 60574 |
| 459 | Ga0207668_10248086 | 3300025972 | Bacteria | 1444 |
| 460 | Ga0207668_10707679 | 3300025972 | Bacteria | 886 |
| 461 | Ga0207668_11724260 | 3300025972 | Unclassified | 565 |
| 462 | Ga0207640_10001860 | 3300025981 | Bacteria | 11310 |
| 463 | Ga0207640_10683863 | 3300025981 | Unclassified | 878 |
| 464 | Ga0207658_10011163 | 3300025986 | Bacteria | 6117 |
| 465 | Ga0207658_10110125 | 3300025986 | Bacteria | 2175 |
| 466 | Ga0207658_10425745 | 3300025986 | Bacteria | 1171 |
| 467 | Ga0207677_10006287 | 3300026023 | Bacteria | 6500 |
| 468 | Ga0207703_10006917 | 3300026035 | Bacteria | 9029 |
| 469 | Ga0207703_10042113 | 3300026035 | Bacteria | 3661 |
| 470 | Ga0207703_10899707 | 3300026035 | Bacteria | 847 |
| 471 | Ga0207639_10002204 | 3300026041 | Bacteria | 13124 |
| 472 | Ga0207639_10025420 | 3300026041 | Bacteria | 4294 |
| 473 | Ga0207639_10661600 | 3300026041 | Bacteria | 967 |
| 474 | Ga0207678_10002814 | 3300026067 | Bacteria | 15778 |
| 475 | Ga0207678_10004143 | 3300026067 | Bacteria | 13031 |
| 476 | Ga0207678_10139405 | 3300026067 | Bacteria | 2069 |
| 477 | Ga0207708_10001802 | 3300026075 | Bacteria | 15778 |
| 478 | Ga0207708_10002366 | 3300026075 | Bacteria | 13852 |
| 479 | Ga0207708_10004097 | 3300026075 | Bacteria | 10724 |
| 480 | Ga0207702_10001819 | 3300026078 | Bacteria | 20980 |
| 481 | Ga0207702_10309599 | 3300026078 | Bacteria | 1501 |
| 482 | Ga0207641_10000476 | 3300026088 | Bacteria | 45413 |
| 483 | Ga0207641_10039915 | 3300026088 | Bacteria | 3927 |
| 484 | Ga0207641_10182723 | 3300026088 | Bacteria | 1922 |
| 485 | Ga0207648_10000072 | 3300026089 | Bacteria | 94957 |
| 486 | Ga0207648_10074884 | 3300026089 | Bacteria | 2951 |
| 487 | Ga0207676_10000512 | 3300026095 | Bacteria | 32630 |
| 488 | Ga0207676_10145923 | 3300026095 | Bacteria | 2032 |
| 489 | Ga0207676_10153966 | 3300026095 | Bacteria | 1983 |
| 490 | Ga0207674_10000697 | 3300026116 | Bacteria | 43729 |
| 491 | Ga0207674_10003652 | 3300026116 | Bacteria | 18763 |
| 492 | Ga0207675_100002384 | 3300026118 | Bacteria | 18614 |
| 493 | Ga0207675_100026129 | 3300026118 | Bacteria | 5435 |
| 494 | Ga0207675_100082231 | 3300026118 | Bacteria | 3020 |
| 495 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 496 | Ga0207698_10000523 | 3300026142 | Bacteria | 22323 |
| 497 | Ga0207698_10066725 | 3300026142 | Bacteria | 2834 |
| 498 | Ga0209973_1007912 | 3300027252 | Bacteria | 1199 |
| 499 | Ga0209967_1008658 | 3300027364 | Bacteria | 1403 |
| 500 | Ga0209967_1020422 | 3300027364 | Bacteria | 965 |
| 501 | Ga0209984_1008235 | 3300027424 | Bacteria | 1309 |
| 502 | Ga0209968_1019510 | 3300027526 | Bacteria | 1092 |
| 503 | Ga0209999_1006967 | 3300027543 | Bacteria | 2033 |
| 504 | Ga0209982_1015508 | 3300027552 | Bacteria | 1157 |
| 505 | Ga0210002_1000381 | 3300027617 | Bacteria | 6055 |
| 506 | Ga0209983_1009047 | 3300027665 | Bacteria | 2035 |
| 507 | Ga0209966_1001626 | 3300027695 | Bacteria | 3839 |
| 508 | Ga0209966_1010167 | 3300027695 | Bacteria | 1692 |
| 509 | Ga0209966_1094199 | 3300027695 | Bacteria | 673 |
| 510 | Ga0209998_10003967 | 3300027717 | Bacteria | 3182 |
| 511 | Ga0209998_10006957 | 3300027717 | Bacteria | 2346 |
| 512 | Ga0209998_10112281 | 3300027717 | Bacteria | 681 |
| 513 | Ga0209813_10001957 | 3300027866 | Bacteria | 4658 |
| 514 | Ga0209974_10028078 | 3300027876 | Bacteria | 1863 |
| 515 | Ga0209974_10047690 | 3300027876 | Bacteria | 1435 |
| 516 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 517 | Ga0207428_10000228 | 3300027907 | Bacteria | 77812 |
| 518 | Ga0207428_10250934 | 3300027907 | Unclassified | 1319 |
| 519 | Ga0268266_10026692 | 3300028379 | Bacteria | 4914 |
| 520 | Ga0268265_10001240 | 3300028380 | Bacteria | 22083 |
| 521 | Ga0268265_10002707 | 3300028380 | Bacteria | 13120 |
| 522 | Ga0268265_10635181 | 3300028380 | Bacteria | 1024 |
| 523 | Ga0268264_10006796 | 3300028381 | Bacteria | 9610 |
| 524 | Ga0268264_10023946 | 3300028381 | Bacteria | 4981 |
| 525 | Ga0268264_10086087 | 3300028381 | Bacteria | 2699 |
| 526 | Ga0268264_11821256 | 3300028381 | Bacteria | 619 |
| 527 | Ga0265332_10001262 | 3300031238 | Bacteria | 14505 |
| 528 | Ga0265325_10035258 | 3300031241 | Bacteria | 2658 |
| 529 | Ga0265329_10007990 | 3300031242 | Bacteria | 4049 |
| 530 | Ga0265340_10010191 | 3300031247 | Bacteria | 5033 |
| 531 | Ga0265340_10050420 | 3300031247 | Bacteria | 2019 |
| 532 | Ga0265340_10187919 | 3300031247 | Bacteria | 932 |
| 533 | Ga0265316_10737023 | 3300031344 | Bacteria | 693 |
| 534 | Ga0307408_100226002 | 3300031548 | Bacteria | 1530 |
| 535 | Ga0316579_10196012 | 3300031691 | Bacteria | 976 |
| 536 | Ga0265342_10000069 | 3300031712 | Bacteria | 110550 |
| 537 | Ga0316576_10108378 | 3300031727 | Bacteria | 2081 |
| 538 | Ga0316578_10010476 | 3300031728 | Bacteria | 4813 |
| 539 | Ga0307405_10373372 | 3300031731 | Bacteria | 1108 |
| 540 | Ga0307413_10368925 | 3300031824 | Bacteria | 1114 |
| 541 | Ga0307410_10149906 | 3300031852 | Bacteria | 1735 |
| 542 | Ga0307406_10883851 | 3300031901 | Bacteria | 760 |
| 543 | Ga0307412_10542996 | 3300031911 | Bacteria | 975 |
| 544 | Ga0307412_11539426 | 3300031911 | Bacteria | 606 |
| 545 | Ga0307409_100175231 | 3300031995 | Bacteria | 1892 |
| 546 | Ga0307409_100461723 | 3300031995 | Bacteria | 1228 |
| 547 | Ga0307411_10032708 | 3300032005 | Bacteria | 3217 |
| 548 | Ga0307411_10947454 | 3300032005 | Bacteria | 768 |
| 549 | Ga0307415_100620440 | 3300032126 | Bacteria | 965 |
| 550 | Ga0316583_10018501 | 3300032133 | Bacteria | 2501 |
| 551 | Ga0373930_0000036 | 3300034816 | Bacteria | 11808 |
| 552 | Ga0373948_0001276 | 3300034817 | Bacteria | 3442 |
| 553 | Ga0373950_0000274 | 3300034818 | Bacteria | 6492 |
| 554 | Ga0373950_0006173 | 3300034818 | Bacteria | 1818 |
| 555 | Ga0373958_0000036 | 3300034819 | Bacteria | 13507 |
| 556 | Ga0373958_0000512 | 3300034819 | Bacteria | 4815 |
| 557 | Ga0373959_0001045 | 3300034820 | Bacteria | 4542 |
| 558 | Ga0373959_0074521 | 3300034820 | Bacteria | 772 |
| 559 | Ga0373938_0000752 | 3300034957 | Bacteria | 5239 |
| 560 | Ga0373938_0001980 | 3300034957 | Bacteria | 3283 |
| 561 | Ga0373928_0000727 | 3300035084 | Bacteria | 6461 |
| 562 | Ga0373928_0002885 | 3300035084 | Bacteria | 3313 |
| 563 | Ga0373929_0000805 | 3300035085 | Bacteria | 6102 |
| 564 | Ga0373934_0088515 | 3300035086 | Bacteria | 1247 |
| 565 | Ga0373940_0000107 | 3300035088 | Bacteria | 10202 |
| 566 | Ga0373940_0005262 | 3300035088 | Bacteria | 2791 |
| 567 | Ga0373949_0000284 | 3300035090 | Bacteria | 18664 |
| 568 | Ga0373949_0001237 | 3300035090 | Bacteria | 7538 |
| 569 | Ga0373951_0000560 | 3300035091 | Bacteria | 10396 |
| 570 | Ga0373951_0004835 | 3300035091 | Bacteria | 3170 |
| 571 | Ga0373952_0000135 | 3300035092 | Bacteria | 10680 |
| 572 | Ga0373952_0000152 | 3300035092 | Bacteria | 10287 |
| 573 | Ga0373952_0203300 | 3300035092 | Unclassified | 581 |
| 574 | Ga0373923_0005530 | 3300035111 | Bacteria | 4296 |
| 575 | Ga0373932_0000172 | 3300035112 | Bacteria | 18943 |
| 576 | Ga0373932_0002592 | 3300035112 | Bacteria | 4511 |
| 577 | Ga0373936_0012581 | 3300035113 | Bacteria | 3221 |
| 578 | Ga0373936_0012931 | 3300035113 | Bacteria | 3183 |
| 579 | Ga0373939_0007160 | 3300035114 | Bacteria | 2704 |
| 580 | Ga0373939_0011782 | 3300035114 | Bacteria | 2215 |
| 581 | Ga0373941_0000081 | 3300035115 | Bacteria | 15592 |
| 582 | Ga0373941_0000225 | 3300035115 | Bacteria | 10871 |
| 583 | Ga0373941_0002269 | 3300035115 | Bacteria | 4208 |
| 584 | Ga0373941_0121660 | 3300035115 | Bacteria | 931 |
| 585 | Ga0373945_0040392 | 3300035116 | Bacteria | 1684 |
| 586 | Ga0373945_0083557 | 3300035116 | Bacteria | 1227 |
| 587 | Ga0373953_0002122 | 3300035117 | Bacteria | 5929 |
| 588 | Ga0373953_0075559 | 3300035117 | Bacteria | 1395 |
| 589 | Ga0373954_0002543 | 3300035118 | Bacteria | 7653 |
| 590 | Ga0373954_0014017 | 3300035118 | Bacteria | 3573 |
| 591 | Ga0373956_0060477 | 3300035119 | Bacteria | 1715 |
| 592 | Ga0373957_0012970 | 3300035120 | Bacteria | 2818 |
| 593 | Ga0373957_0014625 | 3300035120 | Bacteria | 2686 |
| 594 | Ga0373960_0001550 | 3300035121 | Bacteria | 5123 |
| 595 | Ga0373960_0003760 | 3300035121 | Bacteria | 3450 |
| 596 | Ga0373943_0005071 | 3300035170 | Bacteria | 5939 |
| 597 | Ga0373946_0000195 | 3300035171 | Bacteria | 18740 |
| 598 | Ga0373955_0000728 | 3300035172 | Bacteria | 14088 |
| 599 | Ga0373955_0003373 | 3300035172 | Bacteria | 7021 |
| 600 | Ga0373942_0000173 | 3300035207 | Bacteria | 16049 |
| 601 | Ga0373942_0065726 | 3300035207 | Bacteria | 1048 |
| 602 | Ga0373961_0000196 | 3300035241 | Bacteria | 28662 |
| 603 | Ga0373961_0003123 | 3300035241 | Bacteria | 4151 |
| 604 | Ga0373962_0000151 | 3300035242 | Bacteria | 14355 |
| 605 | Ga0373962_0000452 | 3300035242 | Bacteria | 9022 |
| 606 | Ga0316574_0025731 | 3300035398 | Bacteria | 3534 |
| 607 | Ga0373924_0000908 | 3300035410 | Bacteria | 9373 |
| 608 | Ga0373924_0014025 | 3300035410 | Bacteria | 3022 |
| 609 | Ga0373931_0001253 | 3300035691 | Bacteria | 10836 |
| 610 | Ga0373931_0002490 | 3300035691 | Bacteria | 8167 |
| 611 | Ga0373931_0324267 | 3300035691 | Bacteria | 957 |
| 612 | Ga0373931_1030836 | 3300035691 | Bacteria | 558 |
| 613 | Ga0373935_0000192 | 3300035692 | Bacteria | 29081 |
| 614 | Ga0373927_0324268 | 3300035695 | Bacteria | 1014 |
| 615 | Ga0373927_0351808 | 3300035695 | Bacteria | 971 |
| 616 | Ga0373927_0822081 | 3300035695 | Bacteria | 613 |
| 617 | Ga0373933_0004316 | 3300035724 | Bacteria | 7806 |
| 618 | Ga0373933_0006946 | 3300035724 | Bacteria | 6170 |
| 619 | Ga0373933_0388058 | 3300035724 | Bacteria | 910 |
| 620 | Ga0373947_0002278 | 3300035725 | Bacteria | 11598 |
| 621 | Ga0373947_0021129 | 3300035725 | Bacteria | 3766 |
| 622 | Ga0373947_0026478 | 3300035725 | Bacteria | 3390 |
| 623 | Ga0373937_0000018 | 3300036401 | Bacteria | 144056 |
| 624 | Ga0373937_0738293 | 3300036401 | Bacteria | 932 |
| 625 | Ga0316582_0076318 | 3300036647 | Bacteria | 2179 |
| 626 | Ga0316584_0073155 | 3300036712 | Bacteria | 2568 |
| 627 | Ga0373925_0000055 | 3300037068 | Bacteria | 123638 |
| 628 | Ga0373925_0056277 | 3300037068 | Bacteria | 2946 |
| 629 | Ga0373925_0345257 | 3300037068 | Bacteria | 1208 |
| 630 | Ga0395898_0119462 | 3300037466 | Bacteria | 2525 |
| 631 | Ga0242420_003017 | 3300038996 | Bacteria | 2460 |
| 632 | Ga0436361_0155875 | 3300039447 | Bacteria | 855 |
| 633 | Ga0439441_172451 | 3300042001 | Bacteria | 517 |
| 634 | Ga0439450_090220 | 3300042008 | Bacteria | 769 |
| 635 | Ga0439455_0040110 | 3300042012 | Bacteria | 1196 |
| 636 | Ga0439463_200409 | 3300042016 | Bacteria | 518 |
| 637 | Ga0439458_0070207 | 3300042157 | Bacteria | 884 |
| 638 | Ga0439444_0123655 | 3300042437 | Bacteria | 606 |
| 639 | Ga0439464_0042609 | 3300042439 | Bacteria | 1296 |
| 640 | Ga0439464_0142683 | 3300042439 | Bacteria | 746 |
| 641 | Ga0439460_0095645 | 3300042461 | Bacteria | 949 |
| 642 | Ga0451577_0327081 | 3300042876 | Bacteria | 1390 |
| 643 | Ga0466972_0019709 | 3300044658 | Bacteria | 3373 |
| 644 | Ga0466972_0033799 | 3300044658 | Bacteria | 2508 |
| 645 | Ga0466965_0020059 | 3300044683 | Bacteria | 3211 |
| 646 | Ga0466965_0024731 | 3300044683 | Bacteria | 2906 |
| 647 | Ga0466961_0016205 | 3300044693 | Bacteria | 4786 |
| 648 | Ga0466964_0017573 | 3300044706 | Bacteria | 2737 |
| 649 | Ga0453684_0171995 | 3300044712 | Bacteria | 2552 |
| 650 | Ga0466971_0020441 | 3300044719 | Bacteria | 2943 |
| 651 | Ga0466970_0009267 | 3300044765 | Bacteria | 4969 |
| 652 | Ga0466970_0121027 | 3300044765 | Bacteria | 1434 |
| 653 | Ga0466957_0011379 | 3300044842 | Bacteria | 5131 |
| 654 | Ga0466957_0064591 | 3300044842 | Bacteria | 2252 |
| 655 | Ga0466960_0077820 | 3300044901 | Bacteria | 1664 |
| 656 | Ga0466960_0831607 | 3300044901 | Bacteria | 560 |
| 657 | Ga0451576_0041638 | 3300045051 | Bacteria | 4855 |
| 658 | Ga0466958_0036691 | 3300045836 | Bacteria | 2935 |
| 659 | Ga0466967_0025379 | 3300045976 | Bacteria | 4886 |
| 660 | Ga0466967_0119885 | 3300045976 | Bacteria | 2429 |
| 661 | Ga0466967_0524362 | 3300045976 | Bacteria | 1164 |
| 662 | Ga0466967_0627373 | 3300045976 | Bacteria | 1062 |
| 663 | Ga0495592_0000235 | 3300046454 | Bacteria | 47623 |
| 664 | Ga0495592_0093466 | 3300046454 | Bacteria | 2154 |
| 665 | Ga0495590_0052060 | 3300046457 | Bacteria | 1430 |
| 666 | Ga0495629_0002430 | 3300046459 | Bacteria | 14300 |
| 667 | Ga0495638_0271792 | 3300046460 | Bacteria | 925 |
| 668 | Ga0495651_0000516 | 3300046462 | Bacteria | 30037 |
| 669 | Ga0495651_0390249 | 3300046462 | Bacteria | 911 |
| 670 | Ga0495653_0000003 | 3300046463 | Bacteria | 377892 |
| 671 | Ga0495653_0418520 | 3300046463 | Bacteria | 848 |
| 672 | Ga0495582_0034749 | 3300046473 | Bacteria | 2771 |
| 673 | Ga0495662_0011854 | 3300046476 | Bacteria | 4261 |
| 674 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 675 | Ga0495608_0000033 | 3300046511 | Bacteria | 141349 |
| 676 | Ga0495608_0045528 | 3300046511 | Bacteria | 2923 |
| 677 | Ga0495608_0154901 | 3300046511 | Bacteria | 1459 |
| 678 | Ga0495618_0000012 | 3300046514 | Bacteria | 170881 |
| 679 | Ga0495628_0000003 | 3300046516 | Bacteria | 470339 |
| 680 | Ga0495630_0004336 | 3300046517 | Bacteria | 9954 |
| 681 | Ga0495630_0325694 | 3300046517 | Bacteria | 1175 |
| 682 | Ga0495637_0290906 | 3300046520 | Bacteria | 581 |
| 683 | Ga0495642_0289634 | 3300046528 | Bacteria | 717 |
| 684 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 685 | Ga0495652_0082958 | 3300046529 | Bacteria | 2640 |
| 686 | Ga0495652_0592264 | 3300046529 | Bacteria | 757 |
| 687 | Ga0495640_0000012 | 3300046533 | Bacteria | 194692 |
| 688 | Ga0495640_0698415 | 3300046533 | Bacteria | 609 |
| 689 | Ga0495587_0000003 | 3300046536 | Bacteria | 424188 |
| 690 | Ga0495587_0031814 | 3300046536 | Bacteria | 3192 |
| 691 | Ga0495587_0271814 | 3300046536 | Bacteria | 951 |
| 692 | Ga0495609_0124607 | 3300046538 | Bacteria | 1106 |
| 693 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 694 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 695 | Ga0495667_0032697 | 3300046559 | Bacteria | 3484 |
| 696 | Ga0495634_0000163 | 3300046642 | Bacteria | 60720 |
| 697 | Ga0495635_0000015 | 3300046663 | Bacteria | 215468 |
| 698 | Ga0495635_0229038 | 3300046663 | Bacteria | 1256 |
| 699 | Ga0495635_0845041 | 3300046663 | Bacteria | 588 |
| 700 | Ga0495657_0000061 | 3300046675 | Bacteria | 96199 |
| 701 | Ga0495657_0028219 | 3300046675 | Bacteria | 3951 |
| 702 | Ga0495599_0000004 | 3300046678 | Bacteria | 316231 |
| 703 | Ga0495623_0000020 | 3300046679 | Bacteria | 100523 |
| 704 | Ga0495623_0041069 | 3300046679 | Bacteria | 2952 |
| 705 | Ga0495623_0387829 | 3300046679 | Bacteria | 754 |
| 706 | Ga0495646_0000006 | 3300046680 | Bacteria | 258496 |
| 707 | Ga0495646_0355101 | 3300046680 | Bacteria | 767 |
| 708 | Ga0495647_0478379 | 3300046681 | Bacteria | 578 |
| 709 | Ga0495658_0030078 | 3300046683 | Bacteria | 2946 |
| 710 | Ga0495613_0002383 | 3300046689 | Bacteria | 14238 |
| 711 | Ga0495613_0147438 | 3300046689 | Bacteria | 1679 |
| 712 | Ga0495624_0012717 | 3300046690 | Bacteria | 5747 |
| 713 | Ga0495624_0340139 | 3300046690 | Bacteria | 903 |
| 714 | Ga0495600_0000029 | 3300046809 | Bacteria | 89914 |
| 715 | Ga0495581_0001267 | 3300047315 | Bacteria | 13913 |
| 716 | Ga0495604_0000018 | 3300047317 | Bacteria | 181417 |
| 717 | Ga0495604_0199106 | 3300047317 | Bacteria | 1391 |
| 718 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 719 | Ga0495674_0053333 | 3300047319 | Bacteria | 3555 |
| 720 | Ga0495674_0178558 | 3300047319 | Bacteria | 1769 |
| 721 | Ga0495672_0124293 | 3300047320 | Bacteria | 1367 |
| 722 | Ga0495672_0279408 | 3300047320 | Bacteria | 799 |
| 723 | Ga0495680_0000147 | 3300047322 | Bacteria | 70915 |
| 724 | Ga0495680_0005610 | 3300047322 | Bacteria | 11761 |
| 725 | Ga0495675_0000034 | 3300047444 | Bacteria | 97963 |
| 726 | Ga0495684_0000005 | 3300047471 | Bacteria | 291932 |
| 727 | Ga0495684_0502670 | 3300047471 | Bacteria | 833 |
| 728 | Ga0495593_0002540 | 3300047673 | Bacteria | 10956 |
| 729 | Ga0495602_0000002 | 3300048088 | Bacteria | 422216 |
| 730 | Ga0495602_0260578 | 3300048088 | Bacteria | 1286 |
| 731 | Ga0495602_0383473 | 3300048088 | Bacteria | 1006 |
| 732 | Ga0496100_0000530 | 3300048903 | Bacteria | 18154 |
| 733 | Ga0496100_0129276 | 3300048903 | Bacteria | 1777 |
| 734 | Ga0496100_0459229 | 3300048903 | Bacteria | 977 |
| 735 | Ga0496101_0000189 | 3300048904 | Bacteria | 48416 |
| 736 | Ga0496101_0067265 | 3300048904 | Bacteria | 2616 |
| 737 | Ga0496101_0181949 | 3300048904 | Bacteria | 1619 |
| 738 | Ga0496101_0255871 | 3300048904 | Bacteria | 1365 |
| 739 | Ga0496102_0001085 | 3300048905 | Bacteria | 25158 |
| 740 | Ga0496102_0026992 | 3300048905 | Bacteria | 5127 |
| 741 | Ga0496102_0053152 | 3300048905 | Bacteria | 3693 |
| 742 | Ga0496102_1405045 | 3300048905 | Bacteria | 617 |
| 743 | Ga0496103_0020763 | 3300048906 | Bacteria | 3948 |
| 744 | Ga0496103_0399992 | 3300048906 | Bacteria | 882 |
| 745 | Ga0496104_0004877 | 3300048907 | Bacteria | 11694 |
| 746 | Ga0496104_0076771 | 3300048907 | Bacteria | 3182 |
| 747 | Ga0496104_0102063 | 3300048907 | Bacteria | 2747 |
| 748 | Ga0496104_0590549 | 3300048907 | Unclassified | 1021 |
| 749 | Ga0496104_0937430 | 3300048907 | Bacteria | 770 |
| 750 | Ga0496105_0007511 | 3300048908 | Bacteria | 8445 |
| 751 | Ga0496105_0329944 | 3300048908 | Bacteria | 1221 |
| 752 | Ga0496105_0642762 | 3300048908 | Bacteria | 819 |
| 753 | Ga0496106_0002185 | 3300048909 | Bacteria | 14611 |
| 754 | Ga0496106_0004993 | 3300048909 | Bacteria | 9819 |
| 755 | Ga0496106_0040009 | 3300048909 | Bacteria | 3510 |
| 756 | Ga0496106_0110134 | 3300048909 | Bacteria | 2143 |
| 757 | Ga0496106_0195661 | 3300048909 | Bacteria | 1608 |
| 758 | Ga0496106_0465257 | 3300048909 | Bacteria | 1016 |
| 759 | Ga0496106_0537812 | 3300048909 | Bacteria | 938 |
| 760 | Ga0496107_0003085 | 3300048910 | Bacteria | 11063 |
| 761 | Ga0496107_0006647 | 3300048910 | Bacteria | 7961 |
| 762 | Ga0496107_0121975 | 3300048910 | Bacteria | 1920 |
| 763 | Ga0496107_0295133 | 3300048910 | Bacteria | 1206 |
| 764 | Ga0496108_0002465 | 3300048911 | Bacteria | 14815 |
| 765 | Ga0496108_0011168 | 3300048911 | Bacteria | 7296 |
| 766 | Ga0496108_0502321 | 3300048911 | Unclassified | 1059 |
| 767 | Ga0496109_0000488 | 3300048912 | Bacteria | 33914 |
| 768 | Ga0496109_0006884 | 3300048912 | Bacteria | 9588 |
| 769 | Ga0496109_0084382 | 3300048912 | Bacteria | 2931 |
| 770 | Ga0496109_0173976 | 3300048912 | Bacteria | 2021 |
| 771 | Ga0496109_0784305 | 3300048912 | Unclassified | 891 |
| 772 | Ga0496110_0069646 | 3300048913 | Bacteria | 3116 |
| 773 | Ga0496110_0111002 | 3300048913 | Bacteria | 2464 |
| 774 | Ga0496110_0526456 | 3300048913 | Bacteria | 1075 |
| 775 | Ga0496111_0098927 | 3300048914 | Bacteria | 2142 |
| 776 | Ga0496111_0140843 | 3300048914 | Bacteria | 1787 |
| 777 | Ga0496111_0436514 | 3300048914 | Bacteria | 967 |
| 778 | Ga0496112_0030833 | 3300048915 | Bacteria | 5194 |
| 779 | Ga0496112_0184312 | 3300048915 | Bacteria | 2051 |
| 780 | Ga0496113_0021686 | 3300048916 | Bacteria | 4534 |
| 781 | Ga0496113_0037283 | 3300048916 | Bacteria | 3566 |
| 782 | Ga0496113_0055553 | 3300048916 | Bacteria | 2968 |
| 783 | Ga0496113_0500650 | 3300048916 | Unclassified | 975 |
| 784 | Ga0496114_0001960 | 3300048917 | Bacteria | 15650 |
| 785 | Ga0496114_0318888 | 3300048917 | Bacteria | 1373 |
| 786 | Ga0496115_0002442 | 3300048918 | Bacteria | 13349 |
| 787 | Ga0496115_0095823 | 3300048918 | Bacteria | 2429 |
| 788 | Ga0496115_0293453 | 3300048918 | Bacteria | 1333 |
| 789 | Ga0496121_0656819 | 3300048924 | Bacteria | 638 |
| 790 | Ga0496122_0179782 | 3300048925 | Bacteria | 1263 |
| 791 | Ga0496123_0028949 | 3300048926 | Bacteria | 4089 |
| 792 | Ga0496124_0594816 | 3300048927 | Bacteria | 721 |
| 793 | Ga0496125_0289770 | 3300048928 | Bacteria | 1009 |
| 794 | Ga0496126_0652286 | 3300048929 | Bacteria | 823 |
| 795 | Ga0501031_0008966 | 3300049568 | Bacteria | 6506 |
| 796 | Ga0501031_0048550 | 3300049568 | Bacteria | 2766 |
| 797 | Ga0501031_0075381 | 3300049568 | Bacteria | 2196 |
| 798 | Ga0501032_0032190 | 3300049569 | Bacteria | 3593 |
| 799 | Ga0501032_0053337 | 3300049569 | Bacteria | 2723 |
| 800 | Ga0501032_0122015 | 3300049569 | Bacteria | 1722 |
| 801 | Ga0501032_0251647 | 3300049569 | Bacteria | 1147 |
| 802 | Ga0501032_0339287 | 3300049569 | Bacteria | 968 |
| 803 | Ga0501032_0633903 | 3300049569 | Bacteria | 679 |
| 804 | Ga0501033_0127784 | 3300049570 | Bacteria | 1842 |
| 805 | Ga0501033_0153285 | 3300049570 | Bacteria | 1661 |
| 806 | Ga0501033_0158723 | 3300049570 | Bacteria | 1628 |
| 807 | Ga0501033_0278704 | 3300049570 | Bacteria | 1180 |
| 808 | Ga0501033_0804144 | 3300049570 | Bacteria | 635 |
| 809 | Ga0501034_0000616 | 3300049571 | Bacteria | 55864 |
| 810 | Ga0501034_0000850 | 3300049571 | Bacteria | 45243 |
| 811 | Ga0501034_0016718 | 3300049571 | Bacteria | 7522 |
| 812 | Ga0501034_0023602 | 3300049571 | Bacteria | 6266 |
| 813 | Ga0501034_0071171 | 3300049571 | Bacteria | 3488 |
| 814 | Ga0501034_0076450 | 3300049571 | Bacteria | 3354 |
| 815 | Ga0501034_0118117 | 3300049571 | Bacteria | 2639 |
| 816 | Ga0501034_0420067 | 3300049571 | Bacteria | 1258 |
| 817 | Ga0501034_0427856 | 3300049571 | Bacteria | 1244 |
| 818 | Ga0501034_0963848 | 3300049571 | Bacteria | 738 |
| 819 | Ga0501034_1042437 | 3300049571 | Bacteria | 700 |
| 820 | Ga0501034_1064263 | 3300049571 | Unclassified | 691 |
| 821 | Ga0501036_0000547 | 3300049572 | Bacteria | 26976 |
| 822 | Ga0501036_0034721 | 3300049572 | Bacteria | 4266 |
| 823 | Ga0501036_0038602 | 3300049572 | Bacteria | 4041 |
| 824 | Ga0501036_0065268 | 3300049572 | Bacteria | 3081 |
| 825 | Ga0501036_0073228 | 3300049572 | Bacteria | 2896 |
| 826 | Ga0501036_0352825 | 3300049572 | Bacteria | 1228 |
| 827 | Ga0501036_0796033 | 3300049572 | Bacteria | 778 |
| 828 | Ga0501037_0001864 | 3300049573 | Bacteria | 15310 |
| 829 | Ga0501037_0055103 | 3300049573 | Bacteria | 2907 |
| 830 | Ga0501037_0079089 | 3300049573 | Bacteria | 2386 |
| 831 | Ga0501037_0131522 | 3300049573 | Bacteria | 1794 |
| 832 | Ga0501037_0199016 | 3300049573 | Bacteria | 1416 |
| 833 | Ga0501037_0656609 | 3300049573 | Bacteria | 700 |
| 834 | Ga0501038_0011775 | 3300049574 | Bacteria | 7979 |
| 835 | Ga0501038_0093671 | 3300049574 | Bacteria | 2512 |
| 836 | Ga0501038_0167015 | 3300049574 | Bacteria | 1784 |
| 837 | Ga0501038_0172863 | 3300049574 | Bacteria | 1747 |
| 838 | Ga0501038_0352777 | 3300049574 | Bacteria | 1145 |
| 839 | Ga0501038_0544194 | 3300049574 | Bacteria | 883 |
| 840 | Ga0501039_0009820 | 3300049575 | Bacteria | 7293 |
| 841 | Ga0501039_0054526 | 3300049575 | Bacteria | 3094 |
| 842 | Ga0501039_0129166 | 3300049575 | Bacteria | 1983 |
| 843 | Ga0501039_0740727 | 3300049575 | Bacteria | 768 |
| 844 | Ga0501040_0082795 | 3300049576 | Bacteria | 2225 |
| 845 | Ga0501040_0820205 | 3300049576 | Unclassified | 673 |
| 846 | Ga0501042_1029229 | 3300049578 | Unclassified | 600 |
| 847 | Ga0501043_0001850 | 3300049579 | Bacteria | 18123 |
| 848 | Ga0501043_0012323 | 3300049579 | Bacteria | 6685 |
| 849 | Ga0501043_0065891 | 3300049579 | Bacteria | 2844 |
| 850 | Ga0501043_0117371 | 3300049579 | Bacteria | 2088 |
| 851 | Ga0501043_0117907 | 3300049579 | Unclassified | 2082 |
| 852 | Ga0501043_0118826 | 3300049579 | Bacteria | 2073 |
| 853 | Ga0501043_0169344 | 3300049579 | Bacteria | 1704 |
| 854 | Ga0501043_0389891 | 3300049579 | Bacteria | 1053 |
| 855 | Ga0501046_0011532 | 3300049580 | Bacteria | 7558 |
| 856 | Ga0501046_0049782 | 3300049580 | Bacteria | 3313 |
| 857 | Ga0501046_0076847 | 3300049580 | Bacteria | 2586 |
| 858 | Ga0501046_0084305 | 3300049580 | Bacteria | 2451 |
| 859 | Ga0501046_0485179 | 3300049580 | Bacteria | 886 |
| 860 | Ga0501047_0000455 | 3300049581 | Bacteria | 45200 |
| 861 | Ga0501047_0004194 | 3300049581 | Bacteria | 13570 |
| 862 | Ga0501047_0189989 | 3300049581 | Bacteria | 1917 |
| 863 | Ga0501047_0253119 | 3300049581 | Bacteria | 1609 |
| 864 | Ga0501047_0316763 | 3300049581 | Bacteria | 1400 |
| 865 | Ga0501047_0343734 | 3300049581 | Bacteria | 1329 |
| 866 | Ga0501047_0429194 | 3300049581 | Bacteria | 1152 |
| 867 | Ga0501047_0504463 | 3300049581 | Bacteria | 1036 |
| 868 | Ga0501047_0807331 | 3300049581 | Bacteria | 753 |
| 869 | Ga0501047_0954825 | 3300049581 | Bacteria | 670 |
| 870 | Ga0501048_0001113 | 3300049582 | Bacteria | 20168 |
| 871 | Ga0501048_0074084 | 3300049582 | Bacteria | 2402 |
| 872 | Ga0501048_0078673 | 3300049582 | Bacteria | 2327 |
| 873 | Ga0501048_0328389 | 3300049582 | Bacteria | 1090 |
| 874 | Ga0501048_1046248 | 3300049582 | Bacteria | 587 |
| 875 | Ga0501067_0017220 | 3300049583 | Bacteria | 3994 |
| 876 | Ga0501068_0014384 | 3300049584 | Bacteria | 4522 |
| 877 | Ga0501068_0060046 | 3300049584 | Bacteria | 2308 |
| 878 | Ga0501068_0111176 | 3300049584 | Bacteria | 1703 |
| 879 | Ga0501068_0561863 | 3300049584 | Bacteria | 742 |
| 880 | Ga0501068_0890866 | 3300049584 | Bacteria | 585 |
| 881 | Ga0501069_0037404 | 3300049585 | Bacteria | 2678 |
| 882 | Ga0501069_0061150 | 3300049585 | Bacteria | 2102 |
| 883 | Ga0501069_0156637 | 3300049585 | Bacteria | 1310 |
| 884 | Ga0501069_0166813 | 3300049585 | Bacteria | 1269 |
| 885 | Ga0501069_0194151 | 3300049585 | Bacteria | 1175 |
| 886 | Ga0501069_0421308 | 3300049585 | Bacteria | 791 |
| 887 | Ga0501070_0003292 | 3300049586 | Bacteria | 14019 |
| 888 | Ga0501070_0005448 | 3300049586 | Bacteria | 10863 |
| 889 | Ga0501070_0017466 | 3300049586 | Bacteria | 6024 |
| 890 | Ga0501070_0048170 | 3300049586 | Bacteria | 3540 |
| 891 | Ga0501070_0052248 | 3300049586 | Bacteria | 3392 |
| 892 | Ga0501070_0077534 | 3300049586 | Bacteria | 2750 |
| 893 | Ga0501070_0085866 | 3300049586 | Bacteria | 2605 |
| 894 | Ga0501070_0086430 | 3300049586 | Bacteria | 2596 |
| 895 | Ga0501070_0167163 | 3300049586 | Bacteria | 1812 |
| 896 | Ga0501070_0233512 | 3300049586 | Bacteria | 1507 |
| 897 | Ga0501070_0305835 | 3300049586 | Bacteria | 1294 |
| 898 | Ga0501070_0334427 | 3300049586 | Bacteria | 1230 |
| 899 | Ga0501070_0335000 | 3300049586 | Bacteria | 1229 |
| 900 | Ga0501070_0378459 | 3300049586 | Bacteria | 1147 |
| 901 | Ga0501070_0488873 | 3300049586 | Bacteria | 989 |
| 902 | Ga0501070_1199378 | 3300049586 | Bacteria | 582 |
| 903 | Ga0501071_0026287 | 3300049587 | Bacteria | 4084 |
| 904 | Ga0501071_0032614 | 3300049587 | Bacteria | 3700 |
| 905 | Ga0501072_0042458 | 3300049588 | Bacteria | 3572 |
| 906 | Ga0501072_0150085 | 3300049588 | Bacteria | 1858 |
| 907 | Ga0501072_0163577 | 3300049588 | Bacteria | 1775 |
| 908 | Ga0501072_0605319 | 3300049588 | Unclassified | 864 |
| 909 | Ga0501072_1078776 | 3300049588 | Unclassified | 625 |
| 910 | Ga0501073_0023747 | 3300049589 | Bacteria | 4402 |
| 911 | Ga0501073_0142005 | 3300049589 | Bacteria | 1664 |
| 912 | Ga0501073_0317161 | 3300049589 | Bacteria | 1075 |
| 913 | Ga0501074_0006027 | 3300049590 | Bacteria | 8750 |
| 914 | Ga0501074_0010081 | 3300049590 | Bacteria | 6860 |
| 915 | Ga0501074_0090880 | 3300049590 | Bacteria | 2186 |
| 916 | Ga0501074_0266623 | 3300049590 | Bacteria | 1217 |
| 917 | Ga0501074_0501960 | 3300049590 | Unclassified | 859 |
| 918 | Ga0501075_0090438 | 3300049591 | Bacteria | 2322 |
| 919 | Ga0501075_0252633 | 3300049591 | Bacteria | 1344 |
| 920 | Ga0501075_0312204 | 3300049591 | Bacteria | 1198 |
| 921 | Ga0501076_0156240 | 3300049592 | Bacteria | 1857 |
| 922 | Ga0501077_0131914 | 3300049593 | Bacteria | 1584 |
| 923 | Ga0501077_0542348 | 3300049593 | Bacteria | 746 |
| 924 | Ga0501079_0014949 | 3300049741 | Bacteria | 5916 |
| 925 | Ga0501079_0039132 | 3300049741 | Bacteria | 3657 |
| 926 | Ga0501079_0056857 | 3300049741 | Bacteria | 3019 |
| 927 | Ga0501079_0728916 | 3300049741 | Bacteria | 780 |
| 928 | Ga0501079_1676934 | 3300049741 | Unclassified | 500 |
| 929 | Ga0501080_0005235 | 3300049742 | Bacteria | 11555 |
| 930 | Ga0501080_0006633 | 3300049742 | Bacteria | 10411 |
| 931 | Ga0501080_0023839 | 3300049742 | Bacteria | 5672 |
| 932 | Ga0501080_0272356 | 3300049742 | Bacteria | 1541 |
| 933 | Ga0501080_0577445 | 3300049742 | Bacteria | 999 |
| 934 | Ga0501080_0684720 | 3300049742 | Bacteria | 905 |
| 935 | Ga0501080_0765243 | 3300049742 | Bacteria | 848 |
| 936 | Ga0501081_0204727 | 3300049743 | Bacteria | 1432 |
| 937 | Ga0501081_0799210 | 3300049743 | Bacteria | 710 |
| 938 | Ga0501083_0000437 | 3300049744 | Bacteria | 26753 |
| 939 | Ga0501083_0056364 | 3300049744 | Bacteria | 2633 |
| 940 | Ga0501083_0076461 | 3300049744 | Bacteria | 2222 |
| 941 | Ga0501083_0120344 | 3300049744 | Bacteria | 1722 |
| 942 | Ga0501083_0218872 | 3300049744 | Bacteria | 1241 |
| 943 | Ga0501083_0231490 | 3300049744 | Bacteria | 1203 |
| 944 | Ga0501083_0441481 | 3300049744 | Bacteria | 847 |
| 945 | Ga0501035_0000837 | 3300049822 | Bacteria | 32871 |
| 946 | Ga0501035_0046997 | 3300049822 | Bacteria | 3878 |
| 947 | Ga0501035_0052690 | 3300049822 | Bacteria | 3640 |
| 948 | Ga0501035_0063205 | 3300049822 | Bacteria | 3293 |
| 949 | Ga0501035_0077206 | 3300049822 | Bacteria | 2943 |
| 950 | Ga0501035_0177704 | 3300049822 | Bacteria | 1835 |
| 951 | Ga0501035_0200239 | 3300049822 | Bacteria | 1713 |
| 952 | Ga0501035_0230125 | 3300049822 | Bacteria | 1580 |
| 953 | Ga0501035_0591901 | 3300049822 | Bacteria | 905 |
| 954 | Ga0501035_1271270 | 3300049822 | Unclassified | 568 |
| 955 | Ga0501044_0015432 | 3300049823 | Bacteria | 8227 |
| 956 | Ga0501044_0015853 | 3300049823 | Bacteria | 8108 |
| 957 | Ga0501044_0035180 | 3300049823 | Bacteria | 5246 |
| 958 | Ga0501044_0058058 | 3300049823 | Bacteria | 3969 |
| 959 | Ga0501044_0065969 | 3300049823 | Bacteria | 3691 |
| 960 | Ga0501044_0085528 | 3300049823 | Bacteria | 3186 |
| 961 | Ga0501044_0112301 | 3300049823 | Bacteria | 2732 |
| 962 | Ga0501044_0281194 | 3300049823 | Bacteria | 1597 |
| 963 | Ga0501044_0372002 | 3300049823 | Bacteria | 1345 |
| 964 | Ga0501044_0475287 | 3300049823 | Bacteria | 1153 |
| 965 | Ga0501044_0482396 | 3300049823 | Bacteria | 1143 |
| 966 | Ga0501044_0899510 | 3300049823 | Bacteria | 760 |
| 967 | Ga0501044_0958332 | 3300049823 | Bacteria | 728 |
| 968 | Ga0501045_0130953 | 3300049824 | Bacteria | 1865 |
| 969 | Ga0501045_0276003 | 3300049824 | Bacteria | 1251 |
| 970 | nmdc:mga03683_306883_c1 | 3300050489 | Bacteria | 745 |
| 971 | nmdc:mga03n38_364009_c1 | 3300050490 | Bacteria | 789 |
| 972 | nmdc:mga00v17_326156_c1 | 3300050491 | Bacteria | 998 |
| 973 | nmdc:mga06z11_11012_c1 | 3300050494 | Bacteria | 3880 |
| 974 | nmdc:mga06z11_310787_c1 | 3300050494 | Bacteria | 939 |
| 975 | nmdc:mga04h51_1452_c1 | 3300050495 | Bacteria | 5485 |
| 976 | nmdc:mga07m45_342931_c1 | 3300050496 | Bacteria | 868 |
| 977 | nmdc:mga07m45_452579_c1 | 3300050496 | Bacteria | 744 |
| 978 | nmdc:mga05p37_306787_c1 | 3300050507 | Bacteria | 1883 |
| 979 | nmdc:mga09592_1462109_c1 | 3300050508 | Unclassified | 557 |
| 980 | nmdc:mga06r32_106007_c1 | 3300050510 | Bacteria | 2761 |
| 981 | nmdc:mga06r32_1123471_c1 | 3300050510 | Bacteria | 734 |
| 982 | nmdc:mga06r32_2052604_c1 | 3300050510 | Unclassified | 505 |
| 983 | nmdc:mga06r32_545779_c1 | 3300050510 | Bacteria | 1133 |
| 984 | nmdc:mga08y16_1045_c1 | 3300050511 | Bacteria | 27157 |
| 985 | nmdc:mga08y16_11105_c1 | 3300050511 | Bacteria | 9458 |
| 986 | nmdc:mga08y16_84627_c1 | 3300050511 | Bacteria | 3306 |
| 987 | nmdc:mga0n895_1396109_c1 | 3300050512 | Bacteria | 669 |
| 988 | nmdc:mga0n895_206826_c1 | 3300050512 | Bacteria | 1993 |
| 989 | nmdc:mga0n895_239240_c1 | 3300050512 | Unclassified | 1842 |
| 990 | nmdc:mga0n895_242719_c1 | 3300050512 | Bacteria | 1828 |
| 991 | nmdc:mga0n895_6556_c1 | 3300050512 | Bacteria | 9906 |
| 992 | nmdc:mga0n895_749056_c1 | 3300050512 | Bacteria | 970 |
| 993 | nmdc:mga0n895_82905_c1 | 3300050512 | Bacteria | 3197 |
| 994 | nmdc:mga0rr50_1209514_c1 | 3300050513 | Bacteria | 642 |
| 995 | nmdc:mga0rr50_174817_c1 | 3300050513 | Bacteria | 1752 |
| 996 | nmdc:mga0rr50_179658_c1 | 3300050513 | Bacteria | 1729 |
| 997 | nmdc:mga08x19_3619_c1 | 3300050514 | Bacteria | 9202 |
| 998 | nmdc:mga08x19_45947_c1 | 3300050514 | Unclassified | 2791 |
| 999 | nmdc:mga0a205_1492_c1 | 3300050515 | Bacteria | 19963 |
| 1000 | nmdc:mga0a205_30267_c1 | 3300050515 | Bacteria | 5182 |
| 1001 | nmdc:mga0sz30_235576_c1 | 3300050516 | Bacteria | 815 |
| 1002 | Ga0495601_0000003 | 3300053077 | Bacteria | 493642 |
| 1003 | Ga0495601_0004661 | 3300053077 | Bacteria | 7935 |
| 1004 | Ga0495601_0060828 | 3300053077 | Bacteria | 2397 |
| 1005 | Ga0495612_0000007 | 3300053078 | Bacteria | 253300 |
| 1006 | Ga0495612_0081412 | 3300053078 | Bacteria | 1361 |
| 1007 | Ga0495595_0000018 | 3300053084 | Bacteria | 126874 |
| 1008 | Ga0495595_0044171 | 3300053084 | Bacteria | 2046 |
| 1009 | Ga0495595_0246404 | 3300053084 | Bacteria | 894 |
| 1010 | Ga0495619_0000009 | 3300053085 | Bacteria | 305595 |
| 1011 | Ga0495619_0141403 | 3300053085 | Bacteria | 1657 |
| 1012 | Ga0495619_0184650 | 3300053085 | Bacteria | 1443 |
| 1013 | Ga0500641_0007998 | 3300053096 | Bacteria | 3768 |
| 1014 | Ga0500641_0057847 | 3300053096 | Bacteria | 1609 |
| 1015 | Ga0500652_000080 | 3300053131 | Bacteria | 42009 |
| 1016 | Ga0500636_0040041 | 3300053177 | Bacteria | 2772 |
| 1017 | Ga0501084_0068797 | 3300054114 | Bacteria | 2964 |
| 1018 | Ga0501084_0239755 | 3300054114 | Bacteria | 1531 |
| 1019 | Ga0501084_0266357 | 3300054114 | Bacteria | 1447 |
| 1020 | Ga0501084_1731539 | 3300054114 | Bacteria | 522 |
| 1021 | Ga0587092_149011 | 3300059512 | Bacteria | 521 |
| 1022 | Ga0501082_0105643 | 3300060353 | Bacteria | 2436 |
| 1023 | Ga0501082_0146392 | 3300060353 | Bacteria | 2051 |
| 1024 | Ga0501082_0334620 | 3300060353 | Bacteria | 1319 |
| 1025 | Ga0501082_0351801 | 3300060353 | Bacteria | 1284 |
| 1026 | Ga0501082_0428464 | 3300060353 | Bacteria | 1155 |
| 1027 | Ga0466962_0031835 | 3300061719 | Bacteria | 2525 |
| 1028 | Ga0530510_0147766 | 3300061734 | Bacteria | 1734 |
| 1029 | Ga0530510_0806643 | 3300061734 | Bacteria | 716 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_11078352 | Ga0105245_110783521 | 94 |
| 2 | 3300034820 | Ga0373959_0074521 | Ga0373959_0074521_448_762 | 96 |
| 3 | 3300042001 | Ga0439441_172451 | Ga0439441_172451_51_365 | 96 |
| 4 | 3300046528 | Ga0495642_0289634 | Ga0495642_0289634_389_703 | 96 |
| 5 | 3300046533 | Ga0495640_0698415 | Ga0495640_0698415_275_595 | 96 |
| 6 | 3300048927 | Ga0496124_0594816 | Ga0496124_0594816_289_645 | 97 |
| 7 | 3300048924 | Ga0496121_0656819 | Ga0496121_0656819_239_604 | 100 |
| 8 | 3300003771 | Ga0055526_1030168 | Ga0055526_10301682 | 103 |
| 9 | 3300006177 | Ga0075362_10436132 | Ga0075362_104361322 | 103 |
| 10 | 3300025295 | Ga0209564_1002100 | Ga0209564_10021006 | 103 |
| 11 | 3300005439 | Ga0070711_102008838 | Ga0070711_1020088381 | 104 |
| 12 | 3300005530 | Ga0070679_101519029 | Ga0070679_1015190292 | 104 |
| 13 | 3300025916 | Ga0207663_10263165 | Ga0207663_102631653 | 104 |
| 14 | 3300025917 | Ga0207660_11187095 | Ga0207660_111870952 | 104 |
| 15 | 3300031247 | Ga0265340_10050420 | Ga0265340_100504203 | 104 |
| 16 | 3300037466 | Ga0395898_0119462 | Ga0395898_0119462_882_1259 | 104 |
| 17 | 3300049571 | Ga0501034_0071171 | Ga0501034_0071171_2034_2411 | 104 |
| 18 | 3300049581 | Ga0501047_0316763 | Ga0501047_0316763_131_508 | 104 |
| 19 | 3300049744 | Ga0501083_0218872 | Ga0501083_0218872_695_1069 | 104 |
| 20 | 3300049822 | Ga0501035_0230125 | Ga0501035_0230125_1193_1570 | 104 |
| 21 | 3300053096 | Ga0500641_0007998 | Ga0500641_0007998_2121_2498 | 104 |
| 22 | 3300049741 | Ga0501079_1676934 | Ga0501079_1676934_86_454 | 106 |
| 23 | 3300048925 | Ga0496122_0179782 | Ga0496122_0179782_166_531 | 108 |
| 24 | 3300048926 | Ga0496123_0028949 | Ga0496123_0028949_3187_3552 | 108 |
| 25 | 3300048928 | Ga0496125_0289770 | Ga0496125_0289770_580_945 | 108 |
| 26 | 3300048929 | Ga0496126_0652286 | Ga0496126_0652286_287_652 | 108 |
| 27 | 3300005330 | Ga0070690_100615176 | Ga0070690_1006151762 | 109 |
| 28 | 3300005334 | Ga0068869_100035044 | Ga0068869_1000350442 | 109 |
| 29 | 3300005336 | Ga0070680_100002329 | Ga0070680_1000023292 | 109 |
| 30 | 3300005337 | Ga0070682_100663111 | Ga0070682_1006631111 | 109 |
| 31 | 3300005406 | Ga0070703_10002446 | Ga0070703_100024462 | 109 |
| 32 | 3300005438 | Ga0070701_10024327 | Ga0070701_100243272 | 109 |
| 33 | 3300005440 | Ga0070705_100000096 | Ga0070705_10000009647 | 109 |
| 34 | 3300005441 | Ga0070700_100004184 | Ga0070700_1000041842 | 109 |
| 35 | 3300005444 | Ga0070694_100009315 | Ga0070694_1000093152 | 109 |
| 36 | 3300005445 | Ga0070708_100013438 | Ga0070708_1000134382 | 109 |
| 37 | 3300005455 | Ga0070663_100030853 | Ga0070663_1000308532 | 109 |
| 38 | 3300005457 | Ga0070662_100479210 | Ga0070662_1004792102 | 109 |
| 39 | 3300005458 | Ga0070681_10022561 | Ga0070681_100225611 | 109 |
| 40 | 3300005459 | Ga0068867_100775500 | Ga0068867_1007755001 | 109 |
| 41 | 3300005467 | Ga0070706_100069484 | Ga0070706_1000694842 | 109 |
| 42 | 3300005471 | Ga0070698_100076049 | Ga0070698_1000760492 | 109 |
| 43 | 3300005518 | Ga0070699_100000255 | Ga0070699_10000025531 | 109 |
| 44 | 3300005530 | Ga0070679_100031892 | Ga0070679_1000318922 | 109 |
| 45 | 3300005536 | Ga0070697_100015667 | Ga0070697_1000156672 | 109 |
| 46 | 3300005545 | Ga0070695_100000248 | Ga0070695_10000024814 | 109 |
| 47 | 3300005546 | Ga0070696_100000552 | Ga0070696_1000005524 | 109 |
| 48 | 3300005547 | Ga0070693_100009572 | Ga0070693_1000095722 | 109 |
| 49 | 3300005549 | Ga0070704_100044802 | Ga0070704_1000448022 | 109 |
| 50 | 3300005564 | Ga0070664_100397929 | Ga0070664_1003979292 | 109 |
| 51 | 3300005577 | Ga0068857_100010529 | Ga0068857_1000105294 | 109 |
| 52 | 3300005578 | Ga0068854_100932240 | Ga0068854_1009322402 | 109 |
| 53 | 3300005615 | Ga0070702_100127545 | Ga0070702_1001275452 | 109 |
| 54 | 3300005617 | Ga0068859_100026101 | Ga0068859_1000261017 | 109 |
| 55 | 3300005719 | Ga0068861_100118272 | Ga0068861_1001182722 | 109 |
| 56 | 3300005841 | Ga0068863_100056996 | Ga0068863_1000569963 | 109 |
| 57 | 3300005843 | Ga0068860_100004629 | Ga0068860_10000462914 | 109 |
| 58 | 3300005844 | Ga0068862_100003354 | Ga0068862_1000033542 | 109 |
| 59 | 3300006931 | Ga0097620_100026102 | Ga0097620_1000261021 | 109 |
| 60 | 3300009553 | Ga0105249_10003736 | Ga0105249_100037369 | 109 |
| 61 | 3300011119 | Ga0105246_10114945 | Ga0105246_101149452 | 109 |
| 62 | 3300025885 | Ga0207653_10002887 | Ga0207653_100028871 | 109 |
| 63 | 3300025912 | Ga0207707_10003030 | Ga0207707_100030306 | 109 |
| 64 | 3300025917 | Ga0207660_10030841 | Ga0207660_100308412 | 109 |
| 65 | 3300025921 | Ga0207652_10052780 | Ga0207652_100527803 | 109 |
| 66 | 3300025933 | Ga0207706_10107818 | Ga0207706_101078182 | 109 |
| 67 | 3300025936 | Ga0207670_10857592 | Ga0207670_108575921 | 109 |
| 68 | 3300025938 | Ga0207704_10220588 | Ga0207704_102205882 | 109 |
| 69 | 3300025942 | Ga0207689_10062365 | Ga0207689_100623652 | 109 |
| 70 | 3300025961 | Ga0207712_10002495 | Ga0207712_100024952 | 109 |
| 71 | 3300025981 | Ga0207640_10683863 | Ga0207640_106838632 | 109 |
| 72 | 3300026041 | Ga0207639_10661600 | Ga0207639_106616002 | 109 |
| 73 | 3300026067 | Ga0207678_10004143 | Ga0207678_100041434 | 109 |
| 74 | 3300026075 | Ga0207708_10004097 | Ga0207708_100040977 | 109 |
| 75 | 3300026088 | Ga0207641_10039915 | Ga0207641_100399153 | 109 |
| 76 | 3300026095 | Ga0207676_10145923 | Ga0207676_101459232 | 109 |
| 77 | 3300026116 | Ga0207674_10003652 | Ga0207674_1000365212 | 109 |
| 78 | 3300026118 | Ga0207675_100082231 | Ga0207675_1000822312 | 109 |
| 79 | 3300028380 | Ga0268265_10002707 | Ga0268265_100027072 | 109 |
| 80 | 3300028381 | Ga0268264_10086087 | Ga0268264_100860872 | 109 |
| 81 | 3300035092 | Ga0373952_0203300 | Ga0373952_0203300_147_527 | 109 |
| 82 | 3300048904 | Ga0496101_0181949 | Ga0496101_0181949_438_818 | 109 |
| 83 | 3300048905 | Ga0496102_0001085 | Ga0496102_0001085_23520_23900 | 109 |
| 84 | 3300048909 | Ga0496106_0004993 | Ga0496106_0004993_7031_7411 | 109 |
| 85 | 3300048910 | Ga0496107_0006647 | Ga0496107_0006647_993_1373 | 109 |
| 86 | 3300048911 | Ga0496108_0502321 | Ga0496108_0502321_347_727 | 109 |
| 87 | 3300048912 | Ga0496109_0784305 | Ga0496109_0784305_66_446 | 109 |
| 88 | 3300005327 | Ga0070658_10504520 | Ga0070658_105045201 | 112 |
| 89 | 3300005334 | Ga0068869_102041152 | Ga0068869_1020411522 | 112 |
| 90 | 3300005339 | Ga0070660_101957305 | Ga0070660_1019573052 | 112 |
| 91 | 3300005344 | Ga0070661_100454154 | Ga0070661_1004541542 | 112 |
| 92 | 3300005344 | Ga0070661_100551561 | Ga0070661_1005515612 | 112 |
| 93 | 3300005354 | Ga0070675_101151216 | Ga0070675_1011512162 | 112 |
| 94 | 3300005455 | Ga0070663_100107269 | Ga0070663_1001072691 | 112 |
| 95 | 3300005457 | Ga0070662_100815239 | Ga0070662_1008152392 | 112 |
| 96 | 3300005564 | Ga0070664_100011614 | Ga0070664_1000116148 | 112 |
| 97 | 3300009098 | Ga0105245_11279654 | Ga0105245_112796542 | 112 |
| 98 | 3300009148 | Ga0105243_11105948 | Ga0105243_111059482 | 112 |
| 99 | 3300009174 | Ga0105241_10642950 | Ga0105241_106429502 | 112 |
| 100 | 3300009545 | Ga0105237_10875312 | Ga0105237_108753122 | 112 |
| 101 | 3300010375 | Ga0105239_10163008 | Ga0105239_101630082 | 112 |
| 102 | 3300010375 | Ga0105239_10282303 | Ga0105239_102823033 | 112 |
| 103 | 3300011119 | Ga0105246_10309787 | Ga0105246_103097872 | 112 |
| 104 | 3300013307 | Ga0157372_11770094 | Ga0157372_117700942 | 112 |
| 105 | 3300015261 | Ga0182006_1105742 | Ga0182006_11057422 | 112 |
| 106 | 3300020069 | Ga0197907_10831634 | Ga0197907_108316342 | 112 |
| 107 | 3300025911 | Ga0207654_10654077 | Ga0207654_106540772 | 112 |
| 108 | 3300025914 | Ga0207671_11033306 | Ga0207671_110333062 | 112 |
| 109 | 3300025920 | Ga0207649_10629545 | Ga0207649_106295451 | 112 |
| 110 | 3300025933 | Ga0207706_10088083 | Ga0207706_100880832 | 112 |
| 111 | 3300025933 | Ga0207706_10606124 | Ga0207706_106061242 | 112 |
| 112 | 3300025935 | Ga0207709_10682084 | Ga0207709_106820841 | 112 |
| 113 | 3300025942 | Ga0207689_11612069 | Ga0207689_116120692 | 112 |
| 114 | 3300025945 | Ga0207679_10008732 | Ga0207679_100087328 | 112 |
| 115 | 3300026067 | Ga0207678_10139405 | Ga0207678_101394052 | 112 |
| 116 | 3300031548 | Ga0307408_100226002 | Ga0307408_1002260022 | 112 |
| 117 | 3300031911 | Ga0307412_10542996 | Ga0307412_105429962 | 112 |
| 118 | 3300031911 | Ga0307412_11539426 | Ga0307412_115394262 | 112 |
| 119 | 3300031995 | Ga0307409_100175231 | Ga0307409_1001752312 | 112 |
| 120 | 3300032005 | Ga0307411_10947454 | Ga0307411_109474541 | 112 |
| 121 | 3300035115 | Ga0373941_0000225 | Ga0373941_0000225_3898_4260 | 112 |
| 122 | 3300035695 | Ga0373927_0351808 | Ga0373927_0351808_278_646 | 112 |
| 123 | 3300042157 | Ga0439458_0070207 | Ga0439458_0070207_500_862 | 112 |
| 124 | 3300042439 | Ga0439464_0042609 | Ga0439464_0042609_662_1024 | 112 |
| 125 | 3300044658 | Ga0466972_0019709 | Ga0466972_0019709_502_864 | 112 |
| 126 | 3300044658 | Ga0466972_0033799 | Ga0466972_0033799_1918_2280 | 112 |
| 127 | 3300044683 | Ga0466965_0020059 | Ga0466965_0020059_1142_1504 | 112 |
| 128 | 3300044683 | Ga0466965_0024731 | Ga0466965_0024731_2033_2395 | 112 |
| 129 | 3300044693 | Ga0466961_0016205 | Ga0466961_0016205_2901_3263 | 112 |
| 130 | 3300044706 | Ga0466964_0017573 | Ga0466964_0017573_1271_1633 | 112 |
| 131 | 3300044719 | Ga0466971_0020441 | Ga0466971_0020441_602_964 | 112 |
| 132 | 3300044765 | Ga0466970_0009267 | Ga0466970_0009267_2900_3262 | 112 |
| 133 | 3300044765 | Ga0466970_0121027 | Ga0466970_0121027_481_843 | 112 |
| 134 | 3300044842 | Ga0466957_0011379 | Ga0466957_0011379_2767_3129 | 112 |
| 135 | 3300044901 | Ga0466960_0077820 | Ga0466960_0077820_151_513 | 112 |
| 136 | 3300044901 | Ga0466960_0831607 | Ga0466960_0831607_111_473 | 112 |
| 137 | 3300045836 | Ga0466958_0036691 | Ga0466958_0036691_1291_1653 | 112 |
| 138 | 3300045976 | Ga0466967_0025379 | Ga0466967_0025379_2277_2639 | 112 |
| 139 | 3300045976 | Ga0466967_0119885 | Ga0466967_0119885_2043_2405 | 112 |
| 140 | 3300045976 | Ga0466967_0627373 | Ga0466967_0627373_454_816 | 112 |
| 141 | 3300049568 | Ga0501031_0008966 | Ga0501031_0008966_5007_5369 | 112 |
| 142 | 3300049568 | Ga0501031_0048550 | Ga0501031_0048550_2371_2733 | 112 |
| 143 | 3300049569 | Ga0501032_0032190 | Ga0501032_0032190_2748_3110 | 112 |
| 144 | 3300049569 | Ga0501032_0053337 | Ga0501032_0053337_562_924 | 112 |
| 145 | 3300049569 | Ga0501032_0122015 | Ga0501032_0122015_930_1292 | 112 |
| 146 | 3300049569 | Ga0501032_0339287 | Ga0501032_0339287_406_768 | 112 |
| 147 | 3300049570 | Ga0501033_0153285 | Ga0501033_0153285_692_1054 | 112 |
| 148 | 3300049570 | Ga0501033_0158723 | Ga0501033_0158723_1062_1424 | 112 |
| 149 | 3300049570 | Ga0501033_0804144 | Ga0501033_0804144_20_382 | 112 |
| 150 | 3300049571 | Ga0501034_0000616 | Ga0501034_0000616_43305_43667 | 112 |
| 151 | 3300049571 | Ga0501034_0000850 | Ga0501034_0000850_15842_16204 | 112 |
| 152 | 3300049571 | Ga0501034_0016718 | Ga0501034_0016718_2077_2439 | 112 |
| 153 | 3300049571 | Ga0501034_0023602 | Ga0501034_0023602_5801_6163 | 112 |
| 154 | 3300049571 | Ga0501034_0076450 | Ga0501034_0076450_2142_2504 | 112 |
| 155 | 3300049571 | Ga0501034_0118117 | Ga0501034_0118117_1349_1711 | 112 |
| 156 | 3300049571 | Ga0501034_0420067 | Ga0501034_0420067_542_904 | 112 |
| 157 | 3300049571 | Ga0501034_1042437 | Ga0501034_1042437_134_496 | 112 |
| 158 | 3300049571 | Ga0501034_1064263 | Ga0501034_1064263_53_415 | 112 |
| 159 | 3300049572 | Ga0501036_0000547 | Ga0501036_0000547_25764_26126 | 112 |
| 160 | 3300049572 | Ga0501036_0065268 | Ga0501036_0065268_1078_1440 | 112 |
| 161 | 3300049572 | Ga0501036_0073228 | Ga0501036_0073228_452_814 | 112 |
| 162 | 3300049572 | Ga0501036_0352825 | Ga0501036_0352825_232_594 | 112 |
| 163 | 3300049572 | Ga0501036_0796033 | Ga0501036_0796033_216_578 | 112 |
| 164 | 3300049573 | Ga0501037_0001864 | Ga0501037_0001864_14545_14907 | 112 |
| 165 | 3300049573 | Ga0501037_0055103 | Ga0501037_0055103_832_1194 | 112 |
| 166 | 3300049573 | Ga0501037_0079089 | Ga0501037_0079089_636_998 | 112 |
| 167 | 3300049573 | Ga0501037_0131522 | Ga0501037_0131522_488_850 | 112 |
| 168 | 3300049573 | Ga0501037_0656609 | Ga0501037_0656609_205_567 | 112 |
| 169 | 3300049574 | Ga0501038_0011775 | Ga0501038_0011775_4981_5343 | 112 |
| 170 | 3300049574 | Ga0501038_0093671 | Ga0501038_0093671_439_801 | 112 |
| 171 | 3300049574 | Ga0501038_0352777 | Ga0501038_0352777_439_801 | 112 |
| 172 | 3300049574 | Ga0501038_0544194 | Ga0501038_0544194_66_428 | 112 |
| 173 | 3300049575 | Ga0501039_0009820 | Ga0501039_0009820_2790_3152 | 112 |
| 174 | 3300049575 | Ga0501039_0054526 | Ga0501039_0054526_964_1326 | 112 |
| 175 | 3300049576 | Ga0501040_0082795 | Ga0501040_0082795_1051_1413 | 112 |
| 176 | 3300049579 | Ga0501043_0001850 | Ga0501043_0001850_6556_6918 | 112 |
| 177 | 3300049579 | Ga0501043_0012323 | Ga0501043_0012323_2891_3253 | 112 |
| 178 | 3300049579 | Ga0501043_0065891 | Ga0501043_0065891_2053_2415 | 112 |
| 179 | 3300049579 | Ga0501043_0117907 | Ga0501043_0117907_1707_2069 | 112 |
| 180 | 3300049579 | Ga0501043_0169344 | Ga0501043_0169344_1208_1570 | 112 |
| 181 | 3300049580 | Ga0501046_0011532 | Ga0501046_0011532_586_948 | 112 |
| 182 | 3300049580 | Ga0501046_0049782 | Ga0501046_0049782_1155_1517 | 112 |
| 183 | 3300049580 | Ga0501046_0084305 | Ga0501046_0084305_1097_1459 | 112 |
| 184 | 3300049580 | Ga0501046_0485179 | Ga0501046_0485179_414_776 | 112 |
| 185 | 3300049581 | Ga0501047_0000455 | Ga0501047_0000455_29020_29382 | 112 |
| 186 | 3300049581 | Ga0501047_0189989 | Ga0501047_0189989_437_799 | 112 |
| 187 | 3300049581 | Ga0501047_0253119 | Ga0501047_0253119_790_1152 | 112 |
| 188 | 3300049581 | Ga0501047_0429194 | Ga0501047_0429194_658_1020 | 112 |
| 189 | 3300049581 | Ga0501047_0807331 | Ga0501047_0807331_221_583 | 112 |
| 190 | 3300049581 | Ga0501047_0954825 | Ga0501047_0954825_182_544 | 112 |
| 191 | 3300049582 | Ga0501048_0001113 | Ga0501048_0001113_15792_16154 | 112 |
| 192 | 3300049582 | Ga0501048_0074084 | Ga0501048_0074084_886_1248 | 112 |
| 193 | 3300049582 | Ga0501048_0078673 | Ga0501048_0078673_1092_1454 | 112 |
| 194 | 3300049583 | Ga0501067_0017220 | Ga0501067_0017220_1261_1623 | 112 |
| 195 | 3300049584 | Ga0501068_0014384 | Ga0501068_0014384_684_1046 | 112 |
| 196 | 3300049584 | Ga0501068_0060046 | Ga0501068_0060046_1207_1569 | 112 |
| 197 | 3300049584 | Ga0501068_0111176 | Ga0501068_0111176_201_563 | 112 |
| 198 | 3300049585 | Ga0501069_0037404 | Ga0501069_0037404_722_1084 | 112 |
| 199 | 3300049585 | Ga0501069_0061150 | Ga0501069_0061150_929_1291 | 112 |
| 200 | 3300049585 | Ga0501069_0156637 | Ga0501069_0156637_114_476 | 112 |
| 201 | 3300049585 | Ga0501069_0166813 | Ga0501069_0166813_730_1092 | 112 |
| 202 | 3300049585 | Ga0501069_0421308 | Ga0501069_0421308_345_707 | 112 |
| 203 | 3300049586 | Ga0501070_0003292 | Ga0501070_0003292_839_1201 | 112 |
| 204 | 3300049586 | Ga0501070_0005448 | Ga0501070_0005448_6796_7158 | 112 |
| 205 | 3300049586 | Ga0501070_0017466 | Ga0501070_0017466_1923_2285 | 112 |
| 206 | 3300049586 | Ga0501070_0048170 | Ga0501070_0048170_2089_2451 | 112 |
| 207 | 3300049586 | Ga0501070_0052248 | Ga0501070_0052248_1376_1738 | 112 |
| 208 | 3300049586 | Ga0501070_0077534 | Ga0501070_0077534_2078_2440 | 112 |
| 209 | 3300049586 | Ga0501070_0085866 | Ga0501070_0085866_2080_2442 | 112 |
| 210 | 3300049586 | Ga0501070_0233512 | Ga0501070_0233512_1102_1464 | 112 |
| 211 | 3300049586 | Ga0501070_0305835 | Ga0501070_0305835_765_1127 | 112 |
| 212 | 3300049586 | Ga0501070_0334427 | Ga0501070_0334427_608_970 | 112 |
| 213 | 3300049586 | Ga0501070_0378459 | Ga0501070_0378459_47_409 | 112 |
| 214 | 3300049586 | Ga0501070_0488873 | Ga0501070_0488873_608_970 | 112 |
| 215 | 3300049586 | Ga0501070_1199378 | Ga0501070_1199378_193_555 | 112 |
| 216 | 3300049587 | Ga0501071_0026287 | Ga0501071_0026287_915_1277 | 112 |
| 217 | 3300049588 | Ga0501072_0042458 | Ga0501072_0042458_563_925 | 112 |
| 218 | 3300049588 | Ga0501072_1078776 | Ga0501072_1078776_13_375 | 112 |
| 219 | 3300049589 | Ga0501073_0023747 | Ga0501073_0023747_2960_3322 | 112 |
| 220 | 3300049589 | Ga0501073_0142005 | Ga0501073_0142005_966_1328 | 112 |
| 221 | 3300049589 | Ga0501073_0317161 | Ga0501073_0317161_106_468 | 112 |
| 222 | 3300049590 | Ga0501074_0006027 | Ga0501074_0006027_7292_7654 | 112 |
| 223 | 3300049590 | Ga0501074_0010081 | Ga0501074_0010081_205_567 | 112 |
| 224 | 3300049590 | Ga0501074_0090880 | Ga0501074_0090880_493_855 | 112 |
| 225 | 3300049590 | Ga0501074_0501960 | Ga0501074_0501960_356_718 | 112 |
| 226 | 3300049593 | Ga0501077_0542348 | Ga0501077_0542348_290_652 | 112 |
| 227 | 3300049741 | Ga0501079_0014949 | Ga0501079_0014949_4094_4456 | 112 |
| 228 | 3300049742 | Ga0501080_0005235 | Ga0501080_0005235_2302_2664 | 112 |
| 229 | 3300049742 | Ga0501080_0006633 | Ga0501080_0006633_6190_6552 | 112 |
| 230 | 3300049742 | Ga0501080_0023839 | Ga0501080_0023839_2897_3259 | 112 |
| 231 | 3300049742 | Ga0501080_0272356 | Ga0501080_0272356_285_647 | 112 |
| 232 | 3300049742 | Ga0501080_0577445 | Ga0501080_0577445_201_563 | 112 |
| 233 | 3300049742 | Ga0501080_0684720 | Ga0501080_0684720_297_659 | 112 |
| 234 | 3300049742 | Ga0501080_0765243 | Ga0501080_0765243_282_644 | 112 |
| 235 | 3300049743 | Ga0501081_0799210 | Ga0501081_0799210_321_683 | 112 |
| 236 | 3300049744 | Ga0501083_0000437 | Ga0501083_0000437_10523_10885 | 112 |
| 237 | 3300049744 | Ga0501083_0056364 | Ga0501083_0056364_580_942 | 112 |
| 238 | 3300049744 | Ga0501083_0231490 | Ga0501083_0231490_569_931 | 112 |
| 239 | 3300049744 | Ga0501083_0441481 | Ga0501083_0441481_60_422 | 112 |
| 240 | 3300049822 | Ga0501035_0000837 | Ga0501035_0000837_31708_32070 | 112 |
| 241 | 3300049822 | Ga0501035_0046997 | Ga0501035_0046997_1075_1437 | 112 |
| 242 | 3300049822 | Ga0501035_0052690 | Ga0501035_0052690_1808_2170 | 112 |
| 243 | 3300049822 | Ga0501035_0077206 | Ga0501035_0077206_969_1331 | 112 |
| 244 | 3300049822 | Ga0501035_0177704 | Ga0501035_0177704_656_1018 | 112 |
| 245 | 3300049822 | Ga0501035_0200239 | Ga0501035_0200239_410_772 | 112 |
| 246 | 3300049822 | Ga0501035_0591901 | Ga0501035_0591901_233_595 | 112 |
| 247 | 3300049823 | Ga0501044_0015853 | Ga0501044_0015853_5462_5824 | 112 |
| 248 | 3300049823 | Ga0501044_0035180 | Ga0501044_0035180_3795_4157 | 112 |
| 249 | 3300049823 | Ga0501044_0065969 | Ga0501044_0065969_1785_2147 | 112 |
| 250 | 3300049823 | Ga0501044_0085528 | Ga0501044_0085528_962_1324 | 112 |
| 251 | 3300049823 | Ga0501044_0281194 | Ga0501044_0281194_89_451 | 112 |
| 252 | 3300049823 | Ga0501044_0372002 | Ga0501044_0372002_304_666 | 112 |
| 253 | 3300049823 | Ga0501044_0475287 | Ga0501044_0475287_608_970 | 112 |
| 254 | 3300049823 | Ga0501044_0482396 | Ga0501044_0482396_565_927 | 112 |
| 255 | 3300049823 | Ga0501044_0899510 | Ga0501044_0899510_282_644 | 112 |
| 256 | 3300049824 | Ga0501045_0130953 | Ga0501045_0130953_1405_1767 | 112 |
| 257 | 3300049824 | Ga0501045_0276003 | Ga0501045_0276003_450_812 | 112 |
| 258 | 3300050496 | nmdc:mga07m45_452579_c1 | nmdc:mga07m45_452579_c1_85_447 | 112 |
| 259 | 3300053096 | Ga0500641_0057847 | Ga0500641_0057847_1017_1379 | 112 |
| 260 | 3300054114 | Ga0501084_0266357 | Ga0501084_0266357_798_1160 | 112 |
| 261 | 3300054114 | Ga0501084_1731539 | Ga0501084_1731539_14_376 | 112 |
| 262 | 3300059512 | Ga0587092_149011 | Ga0587092_149011_36_398 | 112 |
| 263 | 3300060353 | Ga0501082_0105643 | Ga0501082_0105643_1762_2124 | 112 |
| 264 | 3300060353 | Ga0501082_0334620 | Ga0501082_0334620_391_753 | 112 |
| 265 | 3300060353 | Ga0501082_0351801 | Ga0501082_0351801_102_464 | 112 |
| 266 | 3300061719 | Ga0466962_0031835 | Ga0466962_0031835_672_1034 | 112 |
| 267 | 3300005563 | Ga0068855_102295069 | Ga0068855_1022950691 | 113 |
| 268 | 3300006048 | Ga0075363_100115462 | Ga0075363_1001154622 | 113 |
| 269 | 3300006048 | Ga0075363_100519829 | Ga0075363_1005198292 | 113 |
| 270 | 3300006177 | Ga0075362_10188980 | Ga0075362_101889802 | 113 |
| 271 | 3300006186 | Ga0075369_10139621 | Ga0075369_101396213 | 113 |
| 272 | 3300009147 | Ga0114129_10905858 | Ga0114129_109058582 | 113 |
| 273 | 3300027866 | Ga0209813_10001957 | Ga0209813_100019571 | 113 |
| 274 | 3300049569 | Ga0501032_0633903 | Ga0501032_0633903_96_503 | 113 |
| 275 | 3300049570 | Ga0501033_0127784 | Ga0501033_0127784_1082_1450 | 113 |
| 276 | 3300049571 | Ga0501034_0427856 | Ga0501034_0427856_703_1071 | 113 |
| 277 | 3300049573 | Ga0501037_0199016 | Ga0501037_0199016_605_973 | 113 |
| 278 | 3300049574 | Ga0501038_0167015 | Ga0501038_0167015_702_1070 | 113 |
| 279 | 3300049579 | Ga0501043_0118826 | Ga0501043_0118826_43_411 | 113 |
| 280 | 3300049580 | Ga0501046_0076847 | Ga0501046_0076847_358_726 | 113 |
| 281 | 3300049581 | Ga0501047_0004194 | Ga0501047_0004194_4067_4435 | 113 |
| 282 | 3300049582 | Ga0501048_0328389 | Ga0501048_0328389_422_790 | 113 |
| 283 | 3300049586 | Ga0501070_0167163 | Ga0501070_0167163_862_1230 | 113 |
| 284 | 3300049587 | Ga0501071_0032614 | Ga0501071_0032614_2061_2426 | 113 |
| 285 | 3300049588 | Ga0501072_0150085 | Ga0501072_0150085_1179_1544 | 113 |
| 286 | 3300049590 | Ga0501074_0266623 | Ga0501074_0266623_366_731 | 113 |
| 287 | 3300049591 | Ga0501075_0090438 | Ga0501075_0090438_1010_1375 | 113 |
| 288 | 3300049741 | Ga0501079_0056857 | Ga0501079_0056857_1179_1544 | 113 |
| 289 | 3300049823 | Ga0501044_0015432 | Ga0501044_0015432_6334_6702 | 113 |
| 290 | 3300049823 | Ga0501044_0112301 | Ga0501044_0112301_1042_1410 | 113 |
| 291 | 3300050489 | nmdc:mga03683_306883_c1 | nmdc:mga03683_306883_c1_76_441 | 113 |
| 292 | 3300050490 | nmdc:mga03n38_364009_c1 | nmdc:mga03n38_364009_c1_174_539 | 113 |
| 293 | 3300050491 | nmdc:mga00v17_326156_c1 | nmdc:mga00v17_326156_c1_211_576 | 113 |
| 294 | 3300050494 | nmdc:mga06z11_310787_c1 | nmdc:mga06z11_310787_c1_227_592 | 113 |
| 295 | 3300050495 | nmdc:mga04h51_1452_c1 | nmdc:mga04h51_1452_c1_55_420 | 113 |
| 296 | 3300050516 | nmdc:mga0sz30_235576_c1 | nmdc:mga0sz30_235576_c1_83_448 | 113 |
| 297 | 3300060353 | Ga0501082_0146392 | Ga0501082_0146392_925_1290 | 113 |
| 298 | 2209111006 | 2214745210 | 2213754785 | 114 |
| 299 | 3300000041 | ARcpr5oldR_c000144 | ARcpr5oldR_0001444 | 114 |
| 300 | 3300000042 | ARSoilYngRDRAFT_c00009 | ARSoilYngRDRAFT_0000914 | 114 |
| 301 | 3300000043 | ARcpr5yngRDRAFT_c000006 | ARcpr5yngRDRAFT_00000614 | 114 |
| 302 | 3300000044 | ARSoilOldRDRAFT_c000102 | ARSoilOldRDRAFT_00010214 | 114 |
| 303 | 3300000045 | ARCol0oldRDRAFT_c01043 | ARCol0oldRDRAFT_010432 | 114 |
| 304 | 3300000652 | ARCol0yngRDRAFT_1000092 | ARCol0yngRDRAFT_100009214 | 114 |
| 305 | 3300001430 | JGI24032J14994_100041 | JGI24032J14994_1000413 | 114 |
| 306 | 3300001904 | JGI24736J21556_1064614 | JGI24736J21556_10646142 | 114 |
| 307 | 3300001976 | JGI24752J21851_1042901 | JGI24752J21851_10429012 | 114 |
| 308 | 3300001977 | JGI24746J21847_1001712 | JGI24746J21847_10017123 | 114 |
| 309 | 3300001979 | JGI24740J21852_10011798 | JGI24740J21852_100117983 | 114 |
| 310 | 3300001989 | JGI24739J22299_10000092 | JGI24739J22299_1000009230 | 114 |
| 311 | 3300001990 | JGI24737J22298_10003955 | JGI24737J22298_100039554 | 114 |
| 312 | 3300001990 | JGI24737J22298_10008311 | JGI24737J22298_100083114 | 114 |
| 313 | 3300001991 | JGI24743J22301_10030239 | JGI24743J22301_100302392 | 114 |
| 314 | 3300002070 | JGI24750J21931_1000128 | JGI24750J21931_10001284 | 114 |
| 315 | 3300002073 | JGI24745J21846_1000110 | JGI24745J21846_10001105 | 114 |
| 316 | 3300002074 | JGI24748J21848_1000158 | JGI24748J21848_10001584 | 114 |
| 317 | 3300002075 | JGI24738J21930_10000010 | JGI24738J21930_1000001011 | 114 |
| 318 | 3300002076 | JGI24749J21850_1001926 | JGI24749J21850_10019262 | 114 |
| 319 | 3300002076 | JGI24749J21850_1018182 | JGI24749J21850_10181822 | 114 |
| 320 | 3300002077 | JGI24744J21845_10000683 | JGI24744J21845_100006835 | 114 |
| 321 | 3300002077 | JGI24744J21845_10110869 | JGI24744J21845_101108692 | 114 |
| 322 | 3300002126 | JGI24035J26624_1000002 | JGI24035J26624_10000024 | 114 |
| 323 | 3300002155 | JGI24033J26618_1002588 | JGI24033J26618_10025882 | 114 |
| 324 | 3300002239 | JGI24034J26672_10000201 | JGI24034J26672_100002013 | 114 |
| 325 | 3300002244 | JGI24742J22300_10000765 | JGI24742J22300_100007653 | 114 |
| 326 | 3300002459 | JGI24751J29686_10021731 | JGI24751J29686_100217312 | 114 |
| 327 | 3300003349 | JGI26129J50193_1007527 | JGI26129J50193_10075271 | 114 |
| 328 | 3300003349 | JGI26129J50193_1015647 | JGI26129J50193_10156472 | 114 |
| 329 | 3300003383 | JGI26140J50224_101872 | JGI26140J50224_1018722 | 114 |
| 330 | 3300003911 | JGI25405J52794_10006144 | JGI25405J52794_100061443 | 114 |
| 331 | 3300005276 | Ga0065717_1003867 | Ga0065717_10038672 | 114 |
| 332 | 3300005277 | Ga0065716_1002550 | Ga0065716_10025502 | 114 |
| 333 | 3300005289 | Ga0065704_10094385 | Ga0065704_100943851 | 114 |
| 334 | 3300005290 | Ga0065712_10000899 | Ga0065712_100008999 | 114 |
| 335 | 3300005290 | Ga0065712_10068648 | Ga0065712_1006864811 | 114 |
| 336 | 3300005293 | Ga0065715_10000752 | Ga0065715_100007524 | 114 |
| 337 | 3300005293 | Ga0065715_10089173 | Ga0065715_1008917311 | 114 |
| 338 | 3300005293 | Ga0065715_10165183 | Ga0065715_101651833 | 114 |
| 339 | 3300005328 | Ga0070676_10000978 | Ga0070676_1000097811 | 114 |
| 340 | 3300005328 | Ga0070676_10241875 | Ga0070676_102418753 | 114 |
| 341 | 3300005329 | Ga0070683_100001029 | Ga0070683_1000010294 | 114 |
| 342 | 3300005329 | Ga0070683_100114195 | Ga0070683_1001141952 | 114 |
| 343 | 3300005329 | Ga0070683_101456400 | Ga0070683_1014564001 | 114 |
| 344 | 3300005330 | Ga0070690_100001038 | Ga0070690_10000103813 | 114 |
| 345 | 3300005331 | Ga0070670_100026956 | Ga0070670_1000269564 | 114 |
| 346 | 3300005331 | Ga0070670_100398935 | Ga0070670_1003989352 | 114 |
| 347 | 3300005333 | Ga0070677_10000126 | Ga0070677_100001264 | 114 |
| 348 | 3300005333 | Ga0070677_10285506 | Ga0070677_102855062 | 114 |
| 349 | 3300005334 | Ga0068869_100000079 | Ga0068869_1000000794 | 114 |
| 350 | 3300005335 | Ga0070666_10019358 | Ga0070666_100193583 | 114 |
| 351 | 3300005335 | Ga0070666_10250122 | Ga0070666_102501222 | 114 |
| 352 | 3300005336 | Ga0070680_100007030 | Ga0070680_1000070304 | 114 |
| 353 | 3300005336 | Ga0070680_100129426 | Ga0070680_1001294262 | 114 |
| 354 | 3300005337 | Ga0070682_100000641 | Ga0070682_10000064114 | 114 |
| 355 | 3300005338 | Ga0068868_100002114 | Ga0068868_1000021147 | 114 |
| 356 | 3300005339 | Ga0070660_100002411 | Ga0070660_1000024115 | 114 |
| 357 | 3300005339 | Ga0070660_100019320 | Ga0070660_1000193204 | 114 |
| 358 | 3300005340 | Ga0070689_100003727 | Ga0070689_1000037274 | 114 |
| 359 | 3300005340 | Ga0070689_100021372 | Ga0070689_1000213724 | 114 |
| 360 | 3300005341 | Ga0070691_10000161 | Ga0070691_100001615 | 114 |
| 361 | 3300005341 | Ga0070691_10033380 | Ga0070691_100333804 | 114 |
| 362 | 3300005343 | Ga0070687_100000085 | Ga0070687_10000008519 | 114 |
| 363 | 3300005343 | Ga0070687_100013028 | Ga0070687_1000130282 | 114 |
| 364 | 3300005343 | Ga0070687_100760099 | Ga0070687_1007600992 | 114 |
| 365 | 3300005343 | Ga0070687_100917709 | Ga0070687_1009177092 | 114 |
| 366 | 3300005344 | Ga0070661_100000307 | Ga0070661_10000030729 | 114 |
| 367 | 3300005344 | Ga0070661_100855173 | Ga0070661_1008551732 | 114 |
| 368 | 3300005345 | Ga0070692_10001915 | Ga0070692_100019156 | 114 |
| 369 | 3300005345 | Ga0070692_10048702 | Ga0070692_100487021 | 114 |
| 370 | 3300005347 | Ga0070668_100009110 | Ga0070668_1000091105 | 114 |
| 371 | 3300005347 | Ga0070668_100039131 | Ga0070668_1000391313 | 114 |
| 372 | 3300005347 | Ga0070668_102210166 | Ga0070668_1022101661 | 114 |
| 373 | 3300005353 | Ga0070669_100000571 | Ga0070669_10000057111 | 114 |
| 374 | 3300005353 | Ga0070669_100037439 | Ga0070669_1000374393 | 114 |
| 375 | 3300005354 | Ga0070675_100014189 | Ga0070675_1000141895 | 114 |
| 376 | 3300005354 | Ga0070675_100075720 | Ga0070675_1000757203 | 114 |
| 377 | 3300005355 | Ga0070671_100000104 | Ga0070671_10000010451 | 114 |
| 378 | 3300005356 | Ga0070674_100000238 | Ga0070674_10000023811 | 114 |
| 379 | 3300005356 | Ga0070674_100057646 | Ga0070674_1000576463 | 114 |
| 380 | 3300005364 | Ga0070673_100000152 | Ga0070673_10000015221 | 114 |
| 381 | 3300005364 | Ga0070673_101435931 | Ga0070673_1014359311 | 114 |
| 382 | 3300005365 | Ga0070688_100001552 | Ga0070688_1000015524 | 114 |
| 383 | 3300005365 | Ga0070688_100010437 | Ga0070688_1000104374 | 114 |
| 384 | 3300005365 | Ga0070688_100185664 | Ga0070688_1001856642 | 114 |
| 385 | 3300005366 | Ga0070659_100000551 | Ga0070659_10000055111 | 114 |
| 386 | 3300005366 | Ga0070659_100014072 | Ga0070659_1000140724 | 114 |
| 387 | 3300005367 | Ga0070667_100002365 | Ga0070667_1000023653 | 114 |
| 388 | 3300005367 | Ga0070667_100082240 | Ga0070667_1000822403 | 114 |
| 389 | 3300005367 | Ga0070667_100126878 | Ga0070667_1001268783 | 114 |
| 390 | 3300005406 | Ga0070703_10008783 | Ga0070703_100087833 | 114 |
| 391 | 3300005406 | Ga0070703_10277971 | Ga0070703_102779711 | 114 |
| 392 | 3300005435 | Ga0070714_100382247 | Ga0070714_1003822471 | 114 |
| 393 | 3300005435 | Ga0070714_100521871 | Ga0070714_1005218711 | 114 |
| 394 | 3300005437 | Ga0070710_10903011 | Ga0070710_109030112 | 114 |
| 395 | 3300005438 | Ga0070701_10000674 | Ga0070701_1000067410 | 114 |
| 396 | 3300005438 | Ga0070701_10027601 | Ga0070701_100276012 | 114 |
| 397 | 3300005439 | Ga0070711_100898965 | Ga0070711_1008989652 | 114 |
| 398 | 3300005440 | Ga0070705_100000148 | Ga0070705_10000014810 | 114 |
| 399 | 3300005440 | Ga0070705_100039756 | Ga0070705_1000397564 | 114 |
| 400 | 3300005441 | Ga0070700_100000277 | Ga0070700_10000027722 | 114 |
| 401 | 3300005441 | Ga0070700_100071695 | Ga0070700_1000716952 | 114 |
| 402 | 3300005441 | Ga0070700_101978793 | Ga0070700_1019787931 | 114 |
| 403 | 3300005444 | Ga0070694_100025210 | Ga0070694_1000252103 | 114 |
| 404 | 3300005444 | Ga0070694_100028101 | Ga0070694_1000281015 | 114 |
| 405 | 3300005445 | Ga0070708_100080131 | Ga0070708_1000801313 | 114 |
| 406 | 3300005455 | Ga0070663_100000522 | Ga0070663_1000005225 | 114 |
| 407 | 3300005455 | Ga0070663_101465575 | Ga0070663_1014655751 | 114 |
| 408 | 3300005456 | Ga0070678_100000718 | Ga0070678_10000071814 | 114 |
| 409 | 3300005456 | Ga0070678_102109210 | Ga0070678_1021092101 | 114 |
| 410 | 3300005457 | Ga0070662_100019850 | Ga0070662_1000198504 | 114 |
| 411 | 3300005457 | Ga0070662_100078008 | Ga0070662_1000780083 | 114 |
| 412 | 3300005458 | Ga0070681_10003456 | Ga0070681_100034564 | 114 |
| 413 | 3300005458 | Ga0070681_10064843 | Ga0070681_100648432 | 114 |
| 414 | 3300005458 | Ga0070681_10141932 | Ga0070681_101419322 | 114 |
| 415 | 3300005458 | Ga0070681_11854580 | Ga0070681_118545801 | 114 |
| 416 | 3300005459 | Ga0068867_100004407 | Ga0068867_10000440710 | 114 |
| 417 | 3300005459 | Ga0068867_100017974 | Ga0068867_1000179744 | 114 |
| 418 | 3300005466 | Ga0070685_10012102 | Ga0070685_100121024 | 114 |
| 419 | 3300005507 | Ga0074259_11111610 | Ga0074259_111116102 | 114 |
| 420 | 3300005518 | Ga0070699_101296327 | Ga0070699_1012963271 | 114 |
| 421 | 3300005530 | Ga0070679_100031781 | Ga0070679_1000317813 | 114 |
| 422 | 3300005530 | Ga0070679_100033806 | Ga0070679_1000338064 | 114 |
| 423 | 3300005530 | Ga0070679_100133048 | Ga0070679_1001330482 | 114 |
| 424 | 3300005535 | Ga0070684_100000894 | Ga0070684_1000008945 | 114 |
| 425 | 3300005535 | Ga0070684_100310980 | Ga0070684_1003109802 | 114 |
| 426 | 3300005535 | Ga0070684_100925204 | Ga0070684_1009252042 | 114 |
| 427 | 3300005536 | Ga0070697_100390178 | Ga0070697_1003901782 | 114 |
| 428 | 3300005536 | Ga0070697_100659297 | Ga0070697_1006592972 | 114 |
| 429 | 3300005539 | Ga0068853_100002891 | Ga0068853_10000289112 | 114 |
| 430 | 3300005539 | Ga0068853_100259619 | Ga0068853_1002596192 | 114 |
| 431 | 3300005543 | Ga0070672_100000088 | Ga0070672_10000008843 | 114 |
| 432 | 3300005543 | Ga0070672_100091389 | Ga0070672_1000913892 | 114 |
| 433 | 3300005543 | Ga0070672_100573416 | Ga0070672_1005734161 | 114 |
| 434 | 3300005544 | Ga0070686_100000719 | Ga0070686_10000071910 | 114 |
| 435 | 3300005544 | Ga0070686_100032503 | Ga0070686_1000325034 | 114 |
| 436 | 3300005545 | Ga0070695_100001789 | Ga0070695_1000017895 | 114 |
| 437 | 3300005545 | Ga0070695_100027104 | Ga0070695_1000271043 | 114 |
| 438 | 3300005546 | Ga0070696_100013552 | Ga0070696_1000135524 | 114 |
| 439 | 3300005546 | Ga0070696_100020079 | Ga0070696_1000200795 | 114 |
| 440 | 3300005546 | Ga0070696_100421267 | Ga0070696_1004212672 | 114 |
| 441 | 3300005547 | Ga0070693_100000134 | Ga0070693_10000013418 | 114 |
| 442 | 3300005548 | Ga0070665_100050659 | Ga0070665_1000506592 | 114 |
| 443 | 3300005549 | Ga0070704_100000026 | Ga0070704_1000000264 | 114 |
| 444 | 3300005549 | Ga0070704_100011965 | Ga0070704_1000119654 | 114 |
| 445 | 3300005549 | Ga0070704_100309229 | Ga0070704_1003092292 | 114 |
| 446 | 3300005549 | Ga0070704_100607338 | Ga0070704_1006073382 | 114 |
| 447 | 3300005563 | Ga0068855_100006834 | Ga0068855_10000683411 | 114 |
| 448 | 3300005563 | Ga0068855_102355802 | Ga0068855_1023558022 | 114 |
| 449 | 3300005564 | Ga0070664_100002234 | Ga0070664_1000022345 | 114 |
| 450 | 3300005564 | Ga0070664_100179423 | Ga0070664_1001794233 | 114 |
| 451 | 3300005577 | Ga0068857_100002935 | Ga0068857_1000029355 | 114 |
| 452 | 3300005578 | Ga0068854_100000546 | Ga0068854_1000005466 | 114 |
| 453 | 3300005614 | Ga0068856_100002000 | Ga0068856_10000200012 | 114 |
| 454 | 3300005614 | Ga0068856_100541781 | Ga0068856_1005417812 | 114 |
| 455 | 3300005615 | Ga0070702_100000245 | Ga0070702_10000024522 | 114 |
| 456 | 3300005616 | Ga0068852_100008609 | Ga0068852_1000086095 | 114 |
| 457 | 3300005616 | Ga0068852_100091269 | Ga0068852_1000912693 | 114 |
| 458 | 3300005616 | Ga0068852_101149115 | Ga0068852_1011491152 | 114 |
| 459 | 3300005616 | Ga0068852_101348714 | Ga0068852_1013487141 | 114 |
| 460 | 3300005616 | Ga0068852_101580847 | Ga0068852_1015808472 | 114 |
| 461 | 3300005617 | Ga0068859_100006734 | Ga0068859_10000673411 | 114 |
| 462 | 3300005617 | Ga0068859_100041857 | Ga0068859_1000418574 | 114 |
| 463 | 3300005618 | Ga0068864_100000890 | Ga0068864_1000008904 | 114 |
| 464 | 3300005618 | Ga0068864_100277961 | Ga0068864_1002779612 | 114 |
| 465 | 3300005718 | Ga0068866_10000221 | Ga0068866_100002214 | 114 |
| 466 | 3300005719 | Ga0068861_100011785 | Ga0068861_1000117854 | 114 |
| 467 | 3300005719 | Ga0068861_100018274 | Ga0068861_1000182744 | 114 |
| 468 | 3300005840 | Ga0068870_10003727 | Ga0068870_100037274 | 114 |
| 469 | 3300005840 | Ga0068870_10844419 | Ga0068870_108444191 | 114 |
| 470 | 3300005841 | Ga0068863_100000340 | Ga0068863_10000034010 | 114 |
| 471 | 3300005841 | Ga0068863_100431802 | Ga0068863_1004318022 | 114 |
| 472 | 3300005842 | Ga0068858_100000295 | Ga0068858_10000029553 | 114 |
| 473 | 3300005842 | Ga0068858_100102941 | Ga0068858_1001029412 | 114 |
| 474 | 3300005842 | Ga0068858_100150676 | Ga0068858_1001506763 | 114 |
| 475 | 3300005843 | Ga0068860_100001285 | Ga0068860_10000128521 | 114 |
| 476 | 3300005843 | Ga0068860_100158254 | Ga0068860_1001582544 | 114 |
| 477 | 3300005843 | Ga0068860_102061263 | Ga0068860_1020612631 | 114 |
| 478 | 3300005844 | Ga0068862_100003236 | Ga0068862_1000032365 | 114 |
| 479 | 3300005844 | Ga0068862_100063398 | Ga0068862_1000633984 | 114 |
| 480 | 3300005937 | Ga0081455_10000007 | Ga0081455_10000007222 | 114 |
| 481 | 3300006028 | Ga0070717_10037964 | Ga0070717_100379642 | 114 |
| 482 | 3300006028 | Ga0070717_10127591 | Ga0070717_101275912 | 114 |
| 483 | 3300006038 | Ga0075365_10358614 | Ga0075365_103586142 | 114 |
| 484 | 3300006058 | Ga0075432_10027241 | Ga0075432_100272413 | 114 |
| 485 | 3300006163 | Ga0070715_10325721 | Ga0070715_103257212 | 114 |
| 486 | 3300006173 | Ga0070716_100357488 | Ga0070716_1003574882 | 114 |
| 487 | 3300006175 | Ga0070712_100000052 | Ga0070712_10000005216 | 114 |
| 488 | 3300006175 | Ga0070712_100377819 | Ga0070712_1003778192 | 114 |
| 489 | 3300006175 | Ga0070712_100908656 | Ga0070712_1009086562 | 114 |
| 490 | 3300006178 | Ga0075367_10011053 | Ga0075367_100110536 | 114 |
| 491 | 3300006178 | Ga0075367_10394533 | Ga0075367_103945332 | 114 |
| 492 | 3300006237 | Ga0097621_100000040 | Ga0097621_10000004058 | 114 |
| 493 | 3300006353 | Ga0075370_10374773 | Ga0075370_103747732 | 114 |
| 494 | 3300006358 | Ga0068871_100000301 | Ga0068871_1000003015 | 114 |
| 495 | 3300006847 | Ga0075431_100199738 | Ga0075431_1001997383 | 114 |
| 496 | 3300006847 | Ga0075431_100269493 | Ga0075431_1002694932 | 114 |
| 497 | 3300006847 | Ga0075431_101914954 | Ga0075431_1019149542 | 114 |
| 498 | 3300006852 | Ga0075433_10016057 | Ga0075433_100160574 | 114 |
| 499 | 3300006852 | Ga0075433_10067742 | Ga0075433_100677423 | 114 |
| 500 | 3300006871 | Ga0075434_100002477 | Ga0075434_10000247721 | 114 |
| 501 | 3300006871 | Ga0075434_100249805 | Ga0075434_1002498052 | 114 |
| 502 | 3300006871 | Ga0075434_100441171 | Ga0075434_1004411712 | 114 |
| 503 | 3300006881 | Ga0068865_100000275 | Ga0068865_10000027518 | 114 |
| 504 | 3300006914 | Ga0075436_100005032 | Ga0075436_1000050322 | 114 |
| 505 | 3300006914 | Ga0075436_100042636 | Ga0075436_1000426362 | 114 |
| 506 | 3300006931 | Ga0097620_100006734 | Ga0097620_10000673411 | 114 |
| 507 | 3300006931 | Ga0097620_100041858 | Ga0097620_1000418584 | 114 |
| 508 | 3300007076 | Ga0075435_100096492 | Ga0075435_1000964922 | 114 |
| 509 | 3300007076 | Ga0075435_100250148 | Ga0075435_1002501481 | 114 |
| 510 | 3300007076 | Ga0075435_101291276 | Ga0075435_1012912762 | 114 |
| 511 | 3300007788 | Ga0099795_10012252 | Ga0099795_100122522 | 114 |
| 512 | 3300009011 | Ga0105251_10052992 | Ga0105251_100529923 | 114 |
| 513 | 3300009092 | Ga0105250_10011042 | Ga0105250_100110422 | 114 |
| 514 | 3300009092 | Ga0105250_10192936 | Ga0105250_101929362 | 114 |
| 515 | 3300009093 | Ga0105240_10212812 | Ga0105240_102128124 | 114 |
| 516 | 3300009093 | Ga0105240_10367463 | Ga0105240_103674633 | 114 |
| 517 | 3300009094 | Ga0111539_10000394 | Ga0111539_1000039448 | 114 |
| 518 | 3300009094 | Ga0111539_10003483 | Ga0111539_1000348322 | 114 |
| 519 | 3300009094 | Ga0111539_10043754 | Ga0111539_100437544 | 114 |
| 520 | 3300009098 | Ga0105245_10000462 | Ga0105245_1000046215 | 114 |
| 521 | 3300009101 | Ga0105247_10000442 | Ga0105247_100004426 | 114 |
| 522 | 3300009101 | Ga0105247_10171228 | Ga0105247_101712283 | 114 |
| 523 | 3300009147 | Ga0114129_10178784 | Ga0114129_101787843 | 114 |
| 524 | 3300009148 | Ga0105243_10000282 | Ga0105243_1000028252 | 114 |
| 525 | 3300009148 | Ga0105243_10031294 | Ga0105243_100312944 | 114 |
| 526 | 3300009148 | Ga0105243_10398541 | Ga0105243_103985412 | 114 |
| 527 | 3300009174 | Ga0105241_10000652 | Ga0105241_1000065214 | 114 |
| 528 | 3300009174 | Ga0105241_10151582 | Ga0105241_101515823 | 114 |
| 529 | 3300009176 | Ga0105242_10001726 | Ga0105242_1000172621 | 114 |
| 530 | 3300009177 | Ga0105248_10010575 | Ga0105248_100105754 | 114 |
| 531 | 3300009177 | Ga0105248_10023284 | Ga0105248_100232843 | 114 |
| 532 | 3300009177 | Ga0105248_10388826 | Ga0105248_103888262 | 114 |
| 533 | 3300009545 | Ga0105237_10008154 | Ga0105237_100081544 | 114 |
| 534 | 3300009551 | Ga0105238_10106046 | Ga0105238_101060464 | 114 |
| 535 | 3300009551 | Ga0105238_12073122 | Ga0105238_120731221 | 114 |
| 536 | 3300009553 | Ga0105249_10001210 | Ga0105249_1000121015 | 114 |
| 537 | 3300009553 | Ga0105249_10010878 | Ga0105249_100108783 | 114 |
| 538 | 3300009553 | Ga0105249_10399550 | Ga0105249_103995502 | 114 |
| 539 | 3300010159 | Ga0099796_10006469 | Ga0099796_100064694 | 114 |
| 540 | 3300010375 | Ga0105239_10006303 | Ga0105239_100063034 | 114 |
| 541 | 3300010375 | Ga0105239_10258581 | Ga0105239_102585812 | 114 |
| 542 | 3300010375 | Ga0105239_12355476 | Ga0105239_123554762 | 114 |
| 543 | 3300011119 | Ga0105246_10000312 | Ga0105246_100003124 | 114 |
| 544 | 3300011119 | Ga0105246_10078510 | Ga0105246_100785102 | 114 |
| 545 | 3300012476 | Ga0157344_1002004 | Ga0157344_10020042 | 114 |
| 546 | 3300012478 | Ga0157328_1013142 | Ga0157328_10131422 | 114 |
| 547 | 3300012485 | Ga0157325_1002945 | Ga0157325_10029452 | 114 |
| 548 | 3300012488 | Ga0157343_1003240 | Ga0157343_10032402 | 114 |
| 549 | 3300012491 | Ga0157329_1010294 | Ga0157329_10102942 | 114 |
| 550 | 3300012494 | Ga0157341_1004268 | Ga0157341_10042682 | 114 |
| 551 | 3300012503 | Ga0157313_1000657 | Ga0157313_10006573 | 114 |
| 552 | 3300012508 | Ga0157315_1014475 | Ga0157315_10144752 | 114 |
| 553 | 3300012512 | Ga0157327_1031858 | Ga0157327_10318582 | 114 |
| 554 | 3300013100 | Ga0157373_10035915 | Ga0157373_100359153 | 114 |
| 555 | 3300013102 | Ga0157371_10029433 | Ga0157371_100294332 | 114 |
| 556 | 3300013102 | Ga0157371_10457690 | Ga0157371_104576902 | 114 |
| 557 | 3300013104 | Ga0157370_11531953 | Ga0157370_115319532 | 114 |
| 558 | 3300013105 | Ga0157369_11568099 | Ga0157369_115680991 | 114 |
| 559 | 3300013105 | Ga0157369_12043287 | Ga0157369_120432872 | 114 |
| 560 | 3300013296 | Ga0157374_10001123 | Ga0157374_100011232 | 114 |
| 561 | 3300013296 | Ga0157374_10708914 | Ga0157374_107089142 | 114 |
| 562 | 3300013297 | Ga0157378_10000270 | Ga0157378_1000027011 | 114 |
| 563 | 3300013306 | Ga0163162_10000145 | Ga0163162_1000014513 | 114 |
| 564 | 3300013306 | Ga0163162_10021406 | Ga0163162_100214065 | 114 |
| 565 | 3300013307 | Ga0157372_10004025 | Ga0157372_100040254 | 114 |
| 566 | 3300013307 | Ga0157372_10224278 | Ga0157372_102242782 | 114 |
| 567 | 3300013307 | Ga0157372_13276400 | Ga0157372_132764001 | 114 |
| 568 | 3300013308 | Ga0157375_10000332 | Ga0157375_1000033210 | 114 |
| 569 | 3300013308 | Ga0157375_10106184 | Ga0157375_101061845 | 114 |
| 570 | 3300014325 | Ga0163163_10000865 | Ga0163163_1000086516 | 114 |
| 571 | 3300014325 | Ga0163163_10019523 | Ga0163163_100195235 | 114 |
| 572 | 3300014326 | Ga0157380_10003074 | Ga0157380_1000307410 | 114 |
| 573 | 3300014326 | Ga0157380_10090270 | Ga0157380_100902702 | 114 |
| 574 | 3300014745 | Ga0157377_10000137 | Ga0157377_1000013714 | 114 |
| 575 | 3300014968 | Ga0157379_10001761 | Ga0157379_1000176110 | 114 |
| 576 | 3300014968 | Ga0157379_10034305 | Ga0157379_100343054 | 114 |
| 577 | 3300014969 | Ga0157376_10000088 | Ga0157376_1000008852 | 114 |
| 578 | 3300017792 | Ga0163161_10000144 | Ga0163161_1000014419 | 114 |
| 579 | 3300025271 | Ga0207666_1000048 | Ga0207666_100004817 | 114 |
| 580 | 3300025271 | Ga0207666_1000232 | Ga0207666_10002328 | 114 |
| 581 | 3300025290 | Ga0207673_1000013 | Ga0207673_10000138 | 114 |
| 582 | 3300025315 | Ga0207697_10000136 | Ga0207697_100001364 | 114 |
| 583 | 3300025315 | Ga0207697_10006414 | Ga0207697_100064144 | 114 |
| 584 | 3300025735 | Ga0207713_1063062 | Ga0207713_10630622 | 114 |
| 585 | 3300025885 | Ga0207653_10001370 | Ga0207653_100013707 | 114 |
| 586 | 3300025893 | Ga0207682_10000006 | Ga0207682_100000063 | 114 |
| 587 | 3300025893 | Ga0207682_10243760 | Ga0207682_102437601 | 114 |
| 588 | 3300025898 | Ga0207692_10226829 | Ga0207692_102268292 | 114 |
| 589 | 3300025899 | Ga0207642_10003385 | Ga0207642_100033854 | 114 |
| 590 | 3300025900 | Ga0207710_10001915 | Ga0207710_100019159 | 114 |
| 591 | 3300025900 | Ga0207710_10018748 | Ga0207710_100187482 | 114 |
| 592 | 3300025901 | Ga0207688_10000027 | Ga0207688_1000002752 | 114 |
| 593 | 3300025901 | Ga0207688_10013378 | Ga0207688_100133783 | 114 |
| 594 | 3300025904 | Ga0207647_10005467 | Ga0207647_100054679 | 114 |
| 595 | 3300025904 | Ga0207647_10014058 | Ga0207647_100140585 | 114 |
| 596 | 3300025905 | Ga0207685_10255435 | Ga0207685_102554352 | 114 |
| 597 | 3300025906 | Ga0207699_10089456 | Ga0207699_100894562 | 114 |
| 598 | 3300025907 | Ga0207645_10000100 | Ga0207645_1000010052 | 114 |
| 599 | 3300025908 | Ga0207643_10000007 | Ga0207643_10000007163 | 114 |
| 600 | 3300025908 | Ga0207643_10566913 | Ga0207643_105669131 | 114 |
| 601 | 3300025910 | Ga0207684_11610847 | Ga0207684_116108471 | 114 |
| 602 | 3300025911 | Ga0207654_10000314 | Ga0207654_1000031417 | 114 |
| 603 | 3300025912 | Ga0207707_10003553 | Ga0207707_1000355313 | 114 |
| 604 | 3300025912 | Ga0207707_10334681 | Ga0207707_103346812 | 114 |
| 605 | 3300025912 | Ga0207707_10649541 | Ga0207707_106495412 | 114 |
| 606 | 3300025912 | Ga0207707_10961805 | Ga0207707_109618051 | 114 |
| 607 | 3300025913 | Ga0207695_10031101 | Ga0207695_100311013 | 114 |
| 608 | 3300025914 | Ga0207671_10029994 | Ga0207671_100299945 | 114 |
| 609 | 3300025914 | Ga0207671_10040362 | Ga0207671_100403622 | 114 |
| 610 | 3300025915 | Ga0207693_10000835 | Ga0207693_1000083510 | 114 |
| 611 | 3300025915 | Ga0207693_10451262 | Ga0207693_104512622 | 114 |
| 612 | 3300025915 | Ga0207693_10766771 | Ga0207693_107667712 | 114 |
| 613 | 3300025916 | Ga0207663_10310252 | Ga0207663_103102522 | 114 |
| 614 | 3300025917 | Ga0207660_10000041 | Ga0207660_1000004120 | 114 |
| 615 | 3300025917 | Ga0207660_10063155 | Ga0207660_100631554 | 114 |
| 616 | 3300025917 | Ga0207660_10468332 | Ga0207660_104683322 | 114 |
| 617 | 3300025917 | Ga0207660_10956360 | Ga0207660_109563602 | 114 |
| 618 | 3300025918 | Ga0207662_10000282 | Ga0207662_1000028217 | 114 |
| 619 | 3300025918 | Ga0207662_10012555 | Ga0207662_100125554 | 114 |
| 620 | 3300025918 | Ga0207662_10554950 | Ga0207662_105549502 | 114 |
| 621 | 3300025919 | Ga0207657_10003933 | Ga0207657_1000393317 | 114 |
| 622 | 3300025919 | Ga0207657_10024595 | Ga0207657_100245954 | 114 |
| 623 | 3300025920 | Ga0207649_10002204 | Ga0207649_100022044 | 114 |
| 624 | 3300025921 | Ga0207652_10006361 | Ga0207652_100063618 | 114 |
| 625 | 3300025921 | Ga0207652_10041684 | Ga0207652_100416843 | 114 |
| 626 | 3300025922 | Ga0207646_10925371 | Ga0207646_109253712 | 114 |
| 627 | 3300025923 | Ga0207681_10000100 | Ga0207681_1000010083 | 114 |
| 628 | 3300025923 | Ga0207681_10035203 | Ga0207681_100352033 | 114 |
| 629 | 3300025924 | Ga0207694_10058343 | Ga0207694_100583434 | 114 |
| 630 | 3300025924 | Ga0207694_11157445 | Ga0207694_111574451 | 114 |
| 631 | 3300025925 | Ga0207650_10031197 | Ga0207650_100311974 | 114 |
| 632 | 3300025926 | Ga0207659_10000044 | Ga0207659_1000004498 | 114 |
| 633 | 3300025926 | Ga0207659_10356560 | Ga0207659_103565602 | 114 |
| 634 | 3300025927 | Ga0207687_10000072 | Ga0207687_1000007254 | 114 |
| 635 | 3300025929 | Ga0207664_10474955 | Ga0207664_104749552 | 114 |
| 636 | 3300025931 | Ga0207644_10007313 | Ga0207644_100073134 | 114 |
| 637 | 3300025932 | Ga0207690_10000140 | Ga0207690_1000014057 | 114 |
| 638 | 3300025932 | Ga0207690_10045487 | Ga0207690_100454874 | 114 |
| 639 | 3300025932 | Ga0207690_10416557 | Ga0207690_104165572 | 114 |
| 640 | 3300025933 | Ga0207706_10003180 | Ga0207706_100031804 | 114 |
| 641 | 3300025933 | Ga0207706_10023633 | Ga0207706_100236334 | 114 |
| 642 | 3300025934 | Ga0207686_10018123 | Ga0207686_100181235 | 114 |
| 643 | 3300025934 | Ga0207686_11120960 | Ga0207686_111209602 | 114 |
| 644 | 3300025935 | Ga0207709_10000154 | Ga0207709_10000154101 | 114 |
| 645 | 3300025935 | Ga0207709_10007823 | Ga0207709_100078233 | 114 |
| 646 | 3300025936 | Ga0207670_10000444 | Ga0207670_1000044426 | 114 |
| 647 | 3300025936 | Ga0207670_10468651 | Ga0207670_104686513 | 114 |
| 648 | 3300025936 | Ga0207670_10818838 | Ga0207670_108188382 | 114 |
| 649 | 3300025937 | Ga0207669_10000176 | Ga0207669_1000017612 | 114 |
| 650 | 3300025937 | Ga0207669_10026689 | Ga0207669_100266894 | 114 |
| 651 | 3300025938 | Ga0207704_10000086 | Ga0207704_1000008611 | 114 |
| 652 | 3300025938 | Ga0207704_10033653 | Ga0207704_100336534 | 114 |
| 653 | 3300025939 | Ga0207665_10132210 | Ga0207665_101322103 | 114 |
| 654 | 3300025939 | Ga0207665_10242924 | Ga0207665_102429242 | 114 |
| 655 | 3300025940 | Ga0207691_10000214 | Ga0207691_1000021452 | 114 |
| 656 | 3300025940 | Ga0207691_10059545 | Ga0207691_100595454 | 114 |
| 657 | 3300025941 | Ga0207711_10001773 | Ga0207711_100017734 | 114 |
| 658 | 3300025941 | Ga0207711_10014174 | Ga0207711_100141747 | 114 |
| 659 | 3300025942 | Ga0207689_10000366 | Ga0207689_1000036634 | 114 |
| 660 | 3300025944 | Ga0207661_10000087 | Ga0207661_1000008719 | 114 |
| 661 | 3300025944 | Ga0207661_10604003 | Ga0207661_106040032 | 114 |
| 662 | 3300025945 | Ga0207679_10000029 | Ga0207679_1000002934 | 114 |
| 663 | 3300025945 | Ga0207679_10269457 | Ga0207679_102694572 | 114 |
| 664 | 3300025949 | Ga0207667_10022798 | Ga0207667_100227985 | 114 |
| 665 | 3300025949 | Ga0207667_10834510 | Ga0207667_108345102 | 114 |
| 666 | 3300025960 | Ga0207651_10000264 | Ga0207651_1000026415 | 114 |
| 667 | 3300025960 | Ga0207651_10735947 | Ga0207651_107359472 | 114 |
| 668 | 3300025961 | Ga0207712_10000129 | Ga0207712_1000012989 | 114 |
| 669 | 3300025961 | Ga0207712_10008947 | Ga0207712_100089473 | 114 |
| 670 | 3300025972 | Ga0207668_10000100 | Ga0207668_1000010067 | 114 |
| 671 | 3300025972 | Ga0207668_10248086 | Ga0207668_102480862 | 114 |
| 672 | 3300025972 | Ga0207668_10707679 | Ga0207668_107076792 | 114 |
| 673 | 3300025972 | Ga0207668_11724260 | Ga0207668_117242602 | 114 |
| 674 | 3300025981 | Ga0207640_10001860 | Ga0207640_100018608 | 114 |
| 675 | 3300025986 | Ga0207658_10011163 | Ga0207658_100111634 | 114 |
| 676 | 3300025986 | Ga0207658_10110125 | Ga0207658_101101252 | 114 |
| 677 | 3300025986 | Ga0207658_10425745 | Ga0207658_104257452 | 114 |
| 678 | 3300026023 | Ga0207677_10006287 | Ga0207677_100062877 | 114 |
| 679 | 3300026035 | Ga0207703_10006917 | Ga0207703_100069178 | 114 |
| 680 | 3300026035 | Ga0207703_10042113 | Ga0207703_100421134 | 114 |
| 681 | 3300026035 | Ga0207703_10899707 | Ga0207703_108997071 | 114 |
| 682 | 3300026041 | Ga0207639_10002204 | Ga0207639_100022044 | 114 |
| 683 | 3300026041 | Ga0207639_10025420 | Ga0207639_100254204 | 114 |
| 684 | 3300026067 | Ga0207678_10002814 | Ga0207678_100028144 | 114 |
| 685 | 3300026075 | Ga0207708_10001802 | Ga0207708_1000180217 | 114 |
| 686 | 3300026075 | Ga0207708_10002366 | Ga0207708_1000236614 | 114 |
| 687 | 3300026078 | Ga0207702_10001819 | Ga0207702_100018197 | 114 |
| 688 | 3300026078 | Ga0207702_10309599 | Ga0207702_103095992 | 114 |
| 689 | 3300026088 | Ga0207641_10000476 | Ga0207641_1000047611 | 114 |
| 690 | 3300026088 | Ga0207641_10182723 | Ga0207641_101827232 | 114 |
| 691 | 3300026089 | Ga0207648_10000072 | Ga0207648_1000007211 | 114 |
| 692 | 3300026089 | Ga0207648_10074884 | Ga0207648_100748843 | 114 |
| 693 | 3300026095 | Ga0207676_10000512 | Ga0207676_1000051228 | 114 |
| 694 | 3300026095 | Ga0207676_10153966 | Ga0207676_101539662 | 114 |
| 695 | 3300026116 | Ga0207674_10000697 | Ga0207674_1000069732 | 114 |
| 696 | 3300026118 | Ga0207675_100002384 | Ga0207675_1000023846 | 114 |
| 697 | 3300026118 | Ga0207675_100026129 | Ga0207675_1000261295 | 114 |
| 698 | 3300026121 | Ga0207683_10000029 | Ga0207683_1000002921 | 114 |
| 699 | 3300026142 | Ga0207698_10000523 | Ga0207698_1000052314 | 114 |
| 700 | 3300026142 | Ga0207698_10066725 | Ga0207698_100667253 | 114 |
| 701 | 3300027252 | Ga0209973_1007912 | Ga0209973_10079122 | 114 |
| 702 | 3300027364 | Ga0209967_1008658 | Ga0209967_10086582 | 114 |
| 703 | 3300027364 | Ga0209967_1020422 | Ga0209967_10204222 | 114 |
| 704 | 3300027424 | Ga0209984_1008235 | Ga0209984_10082352 | 114 |
| 705 | 3300027526 | Ga0209968_1019510 | Ga0209968_10195102 | 114 |
| 706 | 3300027543 | Ga0209999_1006967 | Ga0209999_10069673 | 114 |
| 707 | 3300027552 | Ga0209982_1015508 | Ga0209982_10155082 | 114 |
| 708 | 3300027617 | Ga0210002_1000381 | Ga0210002_10003815 | 114 |
| 709 | 3300027665 | Ga0209983_1009047 | Ga0209983_10090472 | 114 |
| 710 | 3300027695 | Ga0209966_1001626 | Ga0209966_10016262 | 114 |
| 711 | 3300027695 | Ga0209966_1010167 | Ga0209966_10101673 | 114 |
| 712 | 3300027695 | Ga0209966_1094199 | Ga0209966_10941991 | 114 |
| 713 | 3300027717 | Ga0209998_10003967 | Ga0209998_100039674 | 114 |
| 714 | 3300027717 | Ga0209998_10006957 | Ga0209998_100069573 | 114 |
| 715 | 3300027717 | Ga0209998_10112281 | Ga0209998_101122811 | 114 |
| 716 | 3300027876 | Ga0209974_10028078 | Ga0209974_100280782 | 114 |
| 717 | 3300027876 | Ga0209974_10047690 | Ga0209974_100476903 | 114 |
| 718 | 3300027907 | Ga0207428_10000100 | Ga0207428_10000100115 | 114 |
| 719 | 3300027907 | Ga0207428_10000228 | Ga0207428_1000022833 | 114 |
| 720 | 3300027907 | Ga0207428_10250934 | Ga0207428_102509342 | 114 |
| 721 | 3300028379 | Ga0268266_10026692 | Ga0268266_100266924 | 114 |
| 722 | 3300028380 | Ga0268265_10001240 | Ga0268265_1000124010 | 114 |
| 723 | 3300028380 | Ga0268265_10635181 | Ga0268265_106351812 | 114 |
| 724 | 3300028381 | Ga0268264_10006796 | Ga0268264_100067964 | 114 |
| 725 | 3300028381 | Ga0268264_10023946 | Ga0268264_100239464 | 114 |
| 726 | 3300028381 | Ga0268264_11821256 | Ga0268264_118212562 | 114 |
| 727 | 3300031238 | Ga0265332_10001262 | Ga0265332_1000126211 | 114 |
| 728 | 3300031241 | Ga0265325_10035258 | Ga0265325_100352583 | 114 |
| 729 | 3300031242 | Ga0265329_10007990 | Ga0265329_100079903 | 114 |
| 730 | 3300031247 | Ga0265340_10010191 | Ga0265340_100101915 | 114 |
| 731 | 3300031247 | Ga0265340_10187919 | Ga0265340_101879192 | 114 |
| 732 | 3300031344 | Ga0265316_10737023 | Ga0265316_107370231 | 114 |
| 733 | 3300031691 | Ga0316579_10196012 | Ga0316579_101960122 | 114 |
| 734 | 3300031712 | Ga0265342_10000069 | Ga0265342_1000006979 | 114 |
| 735 | 3300031727 | Ga0316576_10108378 | Ga0316576_101083783 | 114 |
| 736 | 3300031728 | Ga0316578_10010476 | Ga0316578_100104765 | 114 |
| 737 | 3300031731 | Ga0307405_10373372 | Ga0307405_103733722 | 114 |
| 738 | 3300031824 | Ga0307413_10368925 | Ga0307413_103689252 | 114 |
| 739 | 3300031852 | Ga0307410_10149906 | Ga0307410_101499062 | 114 |
| 740 | 3300031901 | Ga0307406_10883851 | Ga0307406_108838512 | 114 |
| 741 | 3300031995 | Ga0307409_100461723 | Ga0307409_1004617232 | 114 |
| 742 | 3300032005 | Ga0307411_10032708 | Ga0307411_100327084 | 114 |
| 743 | 3300032126 | Ga0307415_100620440 | Ga0307415_1006204402 | 114 |
| 744 | 3300032133 | Ga0316583_10018501 | Ga0316583_100185012 | 114 |
| 745 | 3300034816 | Ga0373930_0000036 | Ga0373930_0000036_6241_6609 | 114 |
| 746 | 3300034817 | Ga0373948_0001276 | Ga0373948_0001276_911_1279 | 114 |
| 747 | 3300034818 | Ga0373950_0000274 | Ga0373950_0000274_633_1001 | 114 |
| 748 | 3300034818 | Ga0373950_0006173 | Ga0373950_0006173_1113_1481 | 114 |
| 749 | 3300034819 | Ga0373958_0000036 | Ga0373958_0000036_8308_8676 | 114 |
| 750 | 3300034819 | Ga0373958_0000512 | Ga0373958_0000512_999_1367 | 114 |
| 751 | 3300034820 | Ga0373959_0001045 | Ga0373959_0001045_3357_3725 | 114 |
| 752 | 3300034957 | Ga0373938_0000752 | Ga0373938_0000752_1998_2366 | 114 |
| 753 | 3300034957 | Ga0373938_0001980 | Ga0373938_0001980_2813_3181 | 114 |
| 754 | 3300035084 | Ga0373928_0000727 | Ga0373928_0000727_3723_4091 | 114 |
| 755 | 3300035084 | Ga0373928_0002885 | Ga0373928_0002885_1164_1532 | 114 |
| 756 | 3300035085 | Ga0373929_0000805 | Ga0373929_0000805_4694_5062 | 114 |
| 757 | 3300035086 | Ga0373934_0088515 | Ga0373934_0088515_458_835 | 114 |
| 758 | 3300035088 | Ga0373940_0000107 | Ga0373940_0000107_4694_5062 | 114 |
| 759 | 3300035088 | Ga0373940_0005262 | Ga0373940_0005262_590_958 | 114 |
| 760 | 3300035090 | Ga0373949_0000284 | Ga0373949_0000284_6098_6466 | 114 |
| 761 | 3300035090 | Ga0373949_0001237 | Ga0373949_0001237_3929_4297 | 114 |
| 762 | 3300035091 | Ga0373951_0000560 | Ga0373951_0000560_6739_7107 | 114 |
| 763 | 3300035091 | Ga0373951_0004835 | Ga0373951_0004835_948_1316 | 114 |
| 764 | 3300035092 | Ga0373952_0000135 | Ga0373952_0000135_6784_7152 | 114 |
| 765 | 3300035092 | Ga0373952_0000152 | Ga0373952_0000152_4946_5314 | 114 |
| 766 | 3300035111 | Ga0373923_0005530 | Ga0373923_0005530_289_657 | 114 |
| 767 | 3300035112 | Ga0373932_0000172 | Ga0373932_0000172_10939_11307 | 114 |
| 768 | 3300035112 | Ga0373932_0002592 | Ga0373932_0002592_486_854 | 114 |
| 769 | 3300035113 | Ga0373936_0012581 | Ga0373936_0012581_95_463 | 114 |
| 770 | 3300035113 | Ga0373936_0012931 | Ga0373936_0012931_1608_1976 | 114 |
| 771 | 3300035114 | Ga0373939_0007160 | Ga0373939_0007160_268_636 | 114 |
| 772 | 3300035114 | Ga0373939_0011782 | Ga0373939_0011782_669_1037 | 114 |
| 773 | 3300035115 | Ga0373941_0000081 | Ga0373941_0000081_8486_8854 | 114 |
| 774 | 3300035115 | Ga0373941_0002269 | Ga0373941_0002269_1446_1814 | 114 |
| 775 | 3300035115 | Ga0373941_0121660 | Ga0373941_0121660_372_758 | 114 |
| 776 | 3300035116 | Ga0373945_0040392 | Ga0373945_0040392_1142_1510 | 114 |
| 777 | 3300035116 | Ga0373945_0083557 | Ga0373945_0083557_431_799 | 114 |
| 778 | 3300035117 | Ga0373953_0002122 | Ga0373953_0002122_3692_4060 | 114 |
| 779 | 3300035117 | Ga0373953_0075559 | Ga0373953_0075559_872_1249 | 114 |
| 780 | 3300035118 | Ga0373954_0002543 | Ga0373954_0002543_6927_7295 | 114 |
| 781 | 3300035118 | Ga0373954_0014017 | Ga0373954_0014017_2327_2704 | 114 |
| 782 | 3300035119 | Ga0373956_0060477 | Ga0373956_0060477_841_1209 | 114 |
| 783 | 3300035120 | Ga0373957_0012970 | Ga0373957_0012970_386_763 | 114 |
| 784 | 3300035120 | Ga0373957_0014625 | Ga0373957_0014625_1029_1397 | 114 |
| 785 | 3300035121 | Ga0373960_0001550 | Ga0373960_0001550_1998_2366 | 114 |
| 786 | 3300035121 | Ga0373960_0003760 | Ga0373960_0003760_1688_2056 | 114 |
| 787 | 3300035170 | Ga0373943_0005071 | Ga0373943_0005071_4368_4736 | 114 |
| 788 | 3300035171 | Ga0373946_0000195 | Ga0373946_0000195_3891_4259 | 114 |
| 789 | 3300035172 | Ga0373955_0000728 | Ga0373955_0000728_4630_5007 | 114 |
| 790 | 3300035172 | Ga0373955_0003373 | Ga0373955_0003373_6425_6793 | 114 |
| 791 | 3300035207 | Ga0373942_0000173 | Ga0373942_0000173_9071_9439 | 114 |
| 792 | 3300035207 | Ga0373942_0065726 | Ga0373942_0065726_240_608 | 114 |
| 793 | 3300035241 | Ga0373961_0000196 | Ga0373961_0000196_20618_20986 | 114 |
| 794 | 3300035241 | Ga0373961_0003123 | Ga0373961_0003123_2476_2844 | 114 |
| 795 | 3300035242 | Ga0373962_0000151 | Ga0373962_0000151_10779_11147 | 114 |
| 796 | 3300035242 | Ga0373962_0000452 | Ga0373962_0000452_3119_3487 | 114 |
| 797 | 3300035398 | Ga0316574_0025731 | Ga0316574_0025731_1812_2189 | 114 |
| 798 | 3300035410 | Ga0373924_0000908 | Ga0373924_0000908_3949_4317 | 114 |
| 799 | 3300035410 | Ga0373924_0014025 | Ga0373924_0014025_376_753 | 114 |
| 800 | 3300035691 | Ga0373931_0001253 | Ga0373931_0001253_3340_3708 | 114 |
| 801 | 3300035691 | Ga0373931_0002490 | Ga0373931_0002490_7537_7905 | 114 |
| 802 | 3300035691 | Ga0373931_0324267 | Ga0373931_0324267_253_621 | 114 |
| 803 | 3300035691 | Ga0373931_1030836 | Ga0373931_1030836_122_490 | 114 |
| 804 | 3300035692 | Ga0373935_0000192 | Ga0373935_0000192_11567_11935 | 114 |
| 805 | 3300035695 | Ga0373927_0324268 | Ga0373927_0324268_308_676 | 114 |
| 806 | 3300035695 | Ga0373927_0822081 | Ga0373927_0822081_92_460 | 114 |
| 807 | 3300035724 | Ga0373933_0004316 | Ga0373933_0004316_113_481 | 114 |
| 808 | 3300035724 | Ga0373933_0006946 | Ga0373933_0006946_4331_4708 | 114 |
| 809 | 3300035724 | Ga0373933_0388058 | Ga0373933_0388058_394_762 | 114 |
| 810 | 3300035725 | Ga0373947_0002278 | Ga0373947_0002278_7283_7651 | 114 |
| 811 | 3300035725 | Ga0373947_0021129 | Ga0373947_0021129_1126_1494 | 114 |
| 812 | 3300035725 | Ga0373947_0026478 | Ga0373947_0026478_174_542 | 114 |
| 813 | 3300036401 | Ga0373937_0000018 | Ga0373937_0000018_4795_5163 | 114 |
| 814 | 3300036401 | Ga0373937_0738293 | Ga0373937_0738293_520_894 | 114 |
| 815 | 3300036647 | Ga0316582_0076318 | Ga0316582_0076318_591_968 | 114 |
| 816 | 3300036712 | Ga0316584_0073155 | Ga0316584_0073155_859_1236 | 114 |
| 817 | 3300037068 | Ga0373925_0000055 | Ga0373925_0000055_44546_44914 | 114 |
| 818 | 3300037068 | Ga0373925_0056277 | Ga0373925_0056277_1086_1454 | 114 |
| 819 | 3300037068 | Ga0373925_0345257 | Ga0373925_0345257_349_717 | 114 |
| 820 | 3300038996 | Ga0242420_003017 | Ga0242420_003017_1749_2117 | 114 |
| 821 | 3300039447 | Ga0436361_0155875 | Ga0436361_0155875_354_722 | 114 |
| 822 | 3300042008 | Ga0439450_090220 | Ga0439450_090220_130_498 | 114 |
| 823 | 3300042012 | Ga0439455_0040110 | Ga0439455_0040110_572_940 | 114 |
| 824 | 3300042016 | Ga0439463_200409 | Ga0439463_200409_44_412 | 114 |
| 825 | 3300042437 | Ga0439444_0123655 | Ga0439444_0123655_111_479 | 114 |
| 826 | 3300042439 | Ga0439464_0142683 | Ga0439464_0142683_182_550 | 114 |
| 827 | 3300042461 | Ga0439460_0095645 | Ga0439460_0095645_101_469 | 114 |
| 828 | 3300042876 | Ga0451577_0327081 | Ga0451577_0327081_35_403 | 114 |
| 829 | 3300044712 | Ga0453684_0171995 | Ga0453684_0171995_743_1111 | 114 |
| 830 | 3300044842 | Ga0466957_0064591 | Ga0466957_0064591_1383_1751 | 114 |
| 831 | 3300045051 | Ga0451576_0041638 | Ga0451576_0041638_504_872 | 114 |
| 832 | 3300045976 | Ga0466967_0524362 | Ga0466967_0524362_682_1062 | 114 |
| 833 | 3300046454 | Ga0495592_0000235 | Ga0495592_0000235_26263_26631 | 114 |
| 834 | 3300046454 | Ga0495592_0093466 | Ga0495592_0093466_931_1299 | 114 |
| 835 | 3300046457 | Ga0495590_0052060 | Ga0495590_0052060_641_1009 | 114 |
| 836 | 3300046459 | Ga0495629_0002430 | Ga0495629_0002430_12271_12639 | 114 |
| 837 | 3300046460 | Ga0495638_0271792 | Ga0495638_0271792_282_650 | 114 |
| 838 | 3300046462 | Ga0495651_0000516 | Ga0495651_0000516_5376_5744 | 114 |
| 839 | 3300046462 | Ga0495651_0390249 | Ga0495651_0390249_170_538 | 114 |
| 840 | 3300046463 | Ga0495653_0000003 | Ga0495653_0000003_104641_105009 | 114 |
| 841 | 3300046463 | Ga0495653_0418520 | Ga0495653_0418520_450_827 | 114 |
| 842 | 3300046473 | Ga0495582_0034749 | Ga0495582_0034749_1008_1376 | 114 |
| 843 | 3300046476 | Ga0495662_0011854 | Ga0495662_0011854_3699_4067 | 114 |
| 844 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_435931_436299 | 114 |
| 845 | 3300046511 | Ga0495608_0000033 | Ga0495608_0000033_38683_39051 | 114 |
| 846 | 3300046511 | Ga0495608_0045528 | Ga0495608_0045528_606_983 | 114 |
| 847 | 3300046511 | Ga0495608_0154901 | Ga0495608_0154901_943_1317 | 114 |
| 848 | 3300046514 | Ga0495618_0000012 | Ga0495618_0000012_5183_5551 | 114 |
| 849 | 3300046516 | Ga0495628_0000003 | Ga0495628_0000003_267114_267482 | 114 |
| 850 | 3300046517 | Ga0495630_0004336 | Ga0495630_0004336_7017_7385 | 114 |
| 851 | 3300046517 | Ga0495630_0325694 | Ga0495630_0325694_731_1099 | 114 |
| 852 | 3300046520 | Ga0495637_0290906 | Ga0495637_0290906_111_479 | 114 |
| 853 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_390866_391234 | 114 |
| 854 | 3300046529 | Ga0495652_0082958 | Ga0495652_0082958_213_590 | 114 |
| 855 | 3300046529 | Ga0495652_0592264 | Ga0495652_0592264_227_601 | 114 |
| 856 | 3300046533 | Ga0495640_0000012 | Ga0495640_0000012_33158_33526 | 114 |
| 857 | 3300046536 | Ga0495587_0000003 | Ga0495587_0000003_102265_102633 | 114 |
| 858 | 3300046536 | Ga0495587_0031814 | Ga0495587_0031814_333_710 | 114 |
| 859 | 3300046536 | Ga0495587_0271814 | Ga0495587_0271814_325_693 | 114 |
| 860 | 3300046538 | Ga0495609_0124607 | Ga0495609_0124607_329_697 | 114 |
| 861 | 3300046543 | Ga0495645_0000004 | Ga0495645_0000004_329437_329805 | 114 |
| 862 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_230666_231034 | 114 |
| 863 | 3300046559 | Ga0495667_0032697 | Ga0495667_0032697_2231_2608 | 114 |
| 864 | 3300046642 | Ga0495634_0000163 | Ga0495634_0000163_24087_24455 | 114 |
| 865 | 3300046663 | Ga0495635_0000015 | Ga0495635_0000015_33158_33526 | 114 |
| 866 | 3300046663 | Ga0495635_0229038 | Ga0495635_0229038_535_912 | 114 |
| 867 | 3300046663 | Ga0495635_0845041 | Ga0495635_0845041_78_446 | 114 |
| 868 | 3300046675 | Ga0495657_0000061 | Ga0495657_0000061_87998_88366 | 114 |
| 869 | 3300046675 | Ga0495657_0028219 | Ga0495657_0028219_1030_1407 | 114 |
| 870 | 3300046678 | Ga0495599_0000004 | Ga0495599_0000004_65688_66056 | 114 |
| 871 | 3300046679 | Ga0495623_0000020 | Ga0495623_0000020_59308_59676 | 114 |
| 872 | 3300046679 | Ga0495623_0041069 | Ga0495623_0041069_1640_2017 | 114 |
| 873 | 3300046679 | Ga0495623_0387829 | Ga0495623_0387829_124_492 | 114 |
| 874 | 3300046680 | Ga0495646_0000006 | Ga0495646_0000006_78752_79120 | 114 |
| 875 | 3300046680 | Ga0495646_0355101 | Ga0495646_0355101_374_742 | 114 |
| 876 | 3300046681 | Ga0495647_0478379 | Ga0495647_0478379_192_560 | 114 |
| 877 | 3300046683 | Ga0495658_0030078 | Ga0495658_0030078_351_719 | 114 |
| 878 | 3300046689 | Ga0495613_0002383 | Ga0495613_0002383_11094_11462 | 114 |
| 879 | 3300046689 | Ga0495613_0147438 | Ga0495613_0147438_585_953 | 114 |
| 880 | 3300046690 | Ga0495624_0012717 | Ga0495624_0012717_1521_1889 | 114 |
| 881 | 3300046690 | Ga0495624_0340139 | Ga0495624_0340139_349_717 | 114 |
| 882 | 3300046809 | Ga0495600_0000029 | Ga0495600_0000029_10758_11126 | 114 |
| 883 | 3300047315 | Ga0495581_0001267 | Ga0495581_0001267_9314_9682 | 114 |
| 884 | 3300047317 | Ga0495604_0000018 | Ga0495604_0000018_102364_102732 | 114 |
| 885 | 3300047317 | Ga0495604_0199106 | Ga0495604_0199106_217_585 | 114 |
| 886 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_635868_636236 | 114 |
| 887 | 3300047319 | Ga0495674_0053333 | Ga0495674_0053333_2380_2748 | 114 |
| 888 | 3300047319 | Ga0495674_0178558 | Ga0495674_0178558_52_420 | 114 |
| 889 | 3300047320 | Ga0495672_0124293 | Ga0495672_0124293_548_934 | 114 |
| 890 | 3300047320 | Ga0495672_0279408 | Ga0495672_0279408_107_475 | 114 |
| 891 | 3300047322 | Ga0495680_0000147 | Ga0495680_0000147_49559_49927 | 114 |
| 892 | 3300047322 | Ga0495680_0005610 | Ga0495680_0005610_3648_4025 | 114 |
| 893 | 3300047444 | Ga0495675_0000034 | Ga0495675_0000034_58542_58910 | 114 |
| 894 | 3300047471 | Ga0495684_0000005 | Ga0495684_0000005_189407_189775 | 114 |
| 895 | 3300047471 | Ga0495684_0502670 | Ga0495684_0502670_367_744 | 114 |
| 896 | 3300047673 | Ga0495593_0002540 | Ga0495593_0002540_7330_7698 | 114 |
| 897 | 3300048088 | Ga0495602_0000002 | Ga0495602_0000002_179411_179779 | 114 |
| 898 | 3300048088 | Ga0495602_0260578 | Ga0495602_0260578_477_854 | 114 |
| 899 | 3300048088 | Ga0495602_0383473 | Ga0495602_0383473_26_394 | 114 |
| 900 | 3300048903 | Ga0496100_0000530 | Ga0496100_0000530_9168_9536 | 114 |
| 901 | 3300048903 | Ga0496100_0129276 | Ga0496100_0129276_1335_1709 | 114 |
| 902 | 3300048903 | Ga0496100_0459229 | Ga0496100_0459229_37_411 | 114 |
| 903 | 3300048904 | Ga0496101_0000189 | Ga0496101_0000189_34476_34844 | 114 |
| 904 | 3300048904 | Ga0496101_0067265 | Ga0496101_0067265_1019_1393 | 114 |
| 905 | 3300048904 | Ga0496101_0255871 | Ga0496101_0255871_952_1320 | 114 |
| 906 | 3300048905 | Ga0496102_0026992 | Ga0496102_0026992_3340_3708 | 114 |
| 907 | 3300048905 | Ga0496102_0053152 | Ga0496102_0053152_346_714 | 114 |
| 908 | 3300048905 | Ga0496102_1405045 | Ga0496102_1405045_71_439 | 114 |
| 909 | 3300048906 | Ga0496103_0020763 | Ga0496103_0020763_2910_3278 | 114 |
| 910 | 3300048906 | Ga0496103_0399992 | Ga0496103_0399992_162_530 | 114 |
| 911 | 3300048907 | Ga0496104_0004877 | Ga0496104_0004877_2560_2934 | 114 |
| 912 | 3300048907 | Ga0496104_0076771 | Ga0496104_0076771_1844_2212 | 114 |
| 913 | 3300048907 | Ga0496104_0102063 | Ga0496104_0102063_453_821 | 114 |
| 914 | 3300048907 | Ga0496104_0590549 | Ga0496104_0590549_91_471 | 114 |
| 915 | 3300048907 | Ga0496104_0937430 | Ga0496104_0937430_247_621 | 114 |
| 916 | 3300048908 | Ga0496105_0007511 | Ga0496105_0007511_4356_4730 | 114 |
| 917 | 3300048908 | Ga0496105_0329944 | Ga0496105_0329944_505_879 | 114 |
| 918 | 3300048908 | Ga0496105_0642762 | Ga0496105_0642762_43_411 | 114 |
| 919 | 3300048909 | Ga0496106_0002185 | Ga0496106_0002185_671_1039 | 114 |
| 920 | 3300048909 | Ga0496106_0040009 | Ga0496106_0040009_2444_2812 | 114 |
| 921 | 3300048909 | Ga0496106_0110134 | Ga0496106_0110134_906_1274 | 114 |
| 922 | 3300048909 | Ga0496106_0195661 | Ga0496106_0195661_852_1226 | 114 |
| 923 | 3300048909 | Ga0496106_0465257 | Ga0496106_0465257_558_932 | 114 |
| 924 | 3300048909 | Ga0496106_0537812 | Ga0496106_0537812_331_699 | 114 |
| 925 | 3300048910 | Ga0496107_0003085 | Ga0496107_0003085_6580_6948 | 114 |
| 926 | 3300048910 | Ga0496107_0121975 | Ga0496107_0121975_303_671 | 114 |
| 927 | 3300048910 | Ga0496107_0295133 | Ga0496107_0295133_762_1130 | 114 |
| 928 | 3300048911 | Ga0496108_0002465 | Ga0496108_0002465_8080_8448 | 114 |
| 929 | 3300048911 | Ga0496108_0011168 | Ga0496108_0011168_3673_4041 | 114 |
| 930 | 3300048912 | Ga0496109_0000488 | Ga0496109_0000488_15867_16235 | 114 |
| 931 | 3300048912 | Ga0496109_0006884 | Ga0496109_0006884_5824_6192 | 114 |
| 932 | 3300048912 | Ga0496109_0084382 | Ga0496109_0084382_1450_1818 | 114 |
| 933 | 3300048912 | Ga0496109_0173976 | Ga0496109_0173976_1148_1522 | 114 |
| 934 | 3300048913 | Ga0496110_0069646 | Ga0496110_0069646_1354_1722 | 114 |
| 935 | 3300048913 | Ga0496110_0111002 | Ga0496110_0111002_1319_1687 | 114 |
| 936 | 3300048913 | Ga0496110_0526456 | Ga0496110_0526456_500_868 | 114 |
| 937 | 3300048914 | Ga0496111_0098927 | Ga0496111_0098927_584_952 | 114 |
| 938 | 3300048914 | Ga0496111_0140843 | Ga0496111_0140843_1315_1683 | 114 |
| 939 | 3300048914 | Ga0496111_0436514 | Ga0496111_0436514_524_898 | 114 |
| 940 | 3300048915 | Ga0496112_0030833 | Ga0496112_0030833_1140_1508 | 114 |
| 941 | 3300048915 | Ga0496112_0184312 | Ga0496112_0184312_1187_1555 | 114 |
| 942 | 3300048916 | Ga0496113_0021686 | Ga0496113_0021686_1510_1884 | 114 |
| 943 | 3300048916 | Ga0496113_0037283 | Ga0496113_0037283_1281_1649 | 114 |
| 944 | 3300048916 | Ga0496113_0055553 | Ga0496113_0055553_781_1149 | 114 |
| 945 | 3300048916 | Ga0496113_0500650 | Ga0496113_0500650_430_798 | 114 |
| 946 | 3300048917 | Ga0496114_0001960 | Ga0496114_0001960_3528_3896 | 114 |
| 947 | 3300048917 | Ga0496114_0318888 | Ga0496114_0318888_194_568 | 114 |
| 948 | 3300048918 | Ga0496115_0002442 | Ga0496115_0002442_11525_11893 | 114 |
| 949 | 3300048918 | Ga0496115_0095823 | Ga0496115_0095823_1007_1381 | 114 |
| 950 | 3300048918 | Ga0496115_0293453 | Ga0496115_0293453_261_635 | 114 |
| 951 | 3300049568 | Ga0501031_0075381 | Ga0501031_0075381_724_1092 | 114 |
| 952 | 3300049569 | Ga0501032_0251647 | Ga0501032_0251647_306_674 | 114 |
| 953 | 3300049570 | Ga0501033_0278704 | Ga0501033_0278704_253_621 | 114 |
| 954 | 3300049571 | Ga0501034_0963848 | Ga0501034_0963848_333_701 | 114 |
| 955 | 3300049572 | Ga0501036_0034721 | Ga0501036_0034721_3086_3454 | 114 |
| 956 | 3300049572 | Ga0501036_0038602 | Ga0501036_0038602_1011_1379 | 114 |
| 957 | 3300049574 | Ga0501038_0172863 | Ga0501038_0172863_1142_1510 | 114 |
| 958 | 3300049575 | Ga0501039_0129166 | Ga0501039_0129166_918_1286 | 114 |
| 959 | 3300049575 | Ga0501039_0740727 | Ga0501039_0740727_330_722 | 114 |
| 960 | 3300049576 | Ga0501040_0820205 | Ga0501040_0820205_205_573 | 114 |
| 961 | 3300049578 | Ga0501042_1029229 | Ga0501042_1029229_55_423 | 114 |
| 962 | 3300049579 | Ga0501043_0117371 | Ga0501043_0117371_239_607 | 114 |
| 963 | 3300049579 | Ga0501043_0389891 | Ga0501043_0389891_95_463 | 114 |
| 964 | 3300049581 | Ga0501047_0343734 | Ga0501047_0343734_423_791 | 114 |
| 965 | 3300049581 | Ga0501047_0504463 | Ga0501047_0504463_26_394 | 114 |
| 966 | 3300049582 | Ga0501048_1046248 | Ga0501048_1046248_181_549 | 114 |
| 967 | 3300049584 | Ga0501068_0561863 | Ga0501068_0561863_286_654 | 114 |
| 968 | 3300049584 | Ga0501068_0890866 | Ga0501068_0890866_146_514 | 114 |
| 969 | 3300049585 | Ga0501069_0194151 | Ga0501069_0194151_721_1089 | 114 |
| 970 | 3300049586 | Ga0501070_0086430 | Ga0501070_0086430_1311_1679 | 114 |
| 971 | 3300049586 | Ga0501070_0335000 | Ga0501070_0335000_781_1149 | 114 |
| 972 | 3300049588 | Ga0501072_0163577 | Ga0501072_0163577_1325_1693 | 114 |
| 973 | 3300049588 | Ga0501072_0605319 | Ga0501072_0605319_259_627 | 114 |
| 974 | 3300049591 | Ga0501075_0252633 | Ga0501075_0252633_653_1021 | 114 |
| 975 | 3300049591 | Ga0501075_0312204 | Ga0501075_0312204_26_394 | 114 |
| 976 | 3300049592 | Ga0501076_0156240 | Ga0501076_0156240_553_921 | 114 |
| 977 | 3300049593 | Ga0501077_0131914 | Ga0501077_0131914_319_687 | 114 |
| 978 | 3300049741 | Ga0501079_0039132 | Ga0501079_0039132_3008_3376 | 114 |
| 979 | 3300049741 | Ga0501079_0728916 | Ga0501079_0728916_160_528 | 114 |
| 980 | 3300049743 | Ga0501081_0204727 | Ga0501081_0204727_292_660 | 114 |
| 981 | 3300049744 | Ga0501083_0076461 | Ga0501083_0076461_424_792 | 114 |
| 982 | 3300049744 | Ga0501083_0120344 | Ga0501083_0120344_1273_1641 | 114 |
| 983 | 3300049822 | Ga0501035_0063205 | Ga0501035_0063205_1115_1483 | 114 |
| 984 | 3300049822 | Ga0501035_1271270 | Ga0501035_1271270_34_402 | 114 |
| 985 | 3300049823 | Ga0501044_0058058 | Ga0501044_0058058_771_1139 | 114 |
| 986 | 3300049823 | Ga0501044_0958332 | Ga0501044_0958332_269_637 | 114 |
| 987 | 3300050494 | nmdc:mga06z11_11012_c1 | nmdc:mga06z11_11012_c1_3227_3595 | 114 |
| 988 | 3300050496 | nmdc:mga07m45_342931_c1 | nmdc:mga07m45_342931_c1_194_562 | 114 |
| 989 | 3300050507 | nmdc:mga05p37_306787_c1 | nmdc:mga05p37_306787_c1_796_1182 | 114 |
| 990 | 3300050508 | nmdc:mga09592_1462109_c1 | nmdc:mga09592_1462109_c1_152_538 | 114 |
| 991 | 3300050510 | nmdc:mga06r32_106007_c1 | nmdc:mga06r32_106007_c1_1711_2097 | 114 |
| 992 | 3300050510 | nmdc:mga06r32_1123471_c1 | nmdc:mga06r32_1123471_c1_28_414 | 114 |
| 993 | 3300050510 | nmdc:mga06r32_2052604_c1 | nmdc:mga06r32_2052604_c1_25_393 | 114 |
| 994 | 3300050510 | nmdc:mga06r32_545779_c1 | nmdc:mga06r32_545779_c1_243_629 | 114 |
| 995 | 3300050511 | nmdc:mga08y16_1045_c1 | nmdc:mga08y16_1045_c1_23145_23513 | 114 |
| 996 | 3300050511 | nmdc:mga08y16_11105_c1 | nmdc:mga08y16_11105_c1_8619_8987 | 114 |
| 997 | 3300050511 | nmdc:mga08y16_84627_c1 | nmdc:mga08y16_84627_c1_1588_1956 | 114 |
| 998 | 3300050512 | nmdc:mga0n895_1396109_c1 | nmdc:mga0n895_1396109_c1_131_499 | 114 |
| 999 | 3300050512 | nmdc:mga0n895_206826_c1 | nmdc:mga0n895_206826_c1_870_1238 | 114 |
| 1000 | 3300050512 | nmdc:mga0n895_239240_c1 | nmdc:mga0n895_239240_c1_543_911 | 114 |
| 1001 | 3300050512 | nmdc:mga0n895_242719_c1 | nmdc:mga0n895_242719_c1_623_991 | 114 |
| 1002 | 3300050512 | nmdc:mga0n895_6556_c1 | nmdc:mga0n895_6556_c1_3084_3458 | 114 |
| 1003 | 3300050512 | nmdc:mga0n895_749056_c1 | nmdc:mga0n895_749056_c1_528_902 | 114 |
| 1004 | 3300050512 | nmdc:mga0n895_82905_c1 | nmdc:mga0n895_82905_c1_2272_2640 | 114 |
| 1005 | 3300050513 | nmdc:mga0rr50_1209514_c1 | nmdc:mga0rr50_1209514_c1_264_632 | 114 |
| 1006 | 3300050513 | nmdc:mga0rr50_174817_c1 | nmdc:mga0rr50_174817_c1_1050_1418 | 114 |
| 1007 | 3300050513 | nmdc:mga0rr50_179658_c1 | nmdc:mga0rr50_179658_c1_366_734 | 114 |
| 1008 | 3300050514 | nmdc:mga08x19_3619_c1 | nmdc:mga08x19_3619_c1_6277_6645 | 114 |
| 1009 | 3300050514 | nmdc:mga08x19_45947_c1 | nmdc:mga08x19_45947_c1_967_1335 | 114 |
| 1010 | 3300050515 | nmdc:mga0a205_1492_c1 | nmdc:mga0a205_1492_c1_11869_12237 | 114 |
| 1011 | 3300050515 | nmdc:mga0a205_30267_c1 | nmdc:mga0a205_30267_c1_2792_3160 | 114 |
| 1012 | 3300053077 | Ga0495601_0000003 | Ga0495601_0000003_390992_391360 | 114 |
| 1013 | 3300053077 | Ga0495601_0004661 | Ga0495601_0004661_6062_6439 | 114 |
| 1014 | 3300053077 | Ga0495601_0060828 | Ga0495601_0060828_1516_1890 | 114 |
| 1015 | 3300053078 | Ga0495612_0000007 | Ga0495612_0000007_161329_161697 | 114 |
| 1016 | 3300053078 | Ga0495612_0081412 | Ga0495612_0081412_710_1084 | 114 |
| 1017 | 3300053084 | Ga0495595_0000018 | Ga0495595_0000018_98935_99303 | 114 |
| 1018 | 3300053084 | Ga0495595_0044171 | Ga0495595_0044171_635_1012 | 114 |
| 1019 | 3300053084 | Ga0495595_0246404 | Ga0495595_0246404_351_725 | 114 |
| 1020 | 3300053085 | Ga0495619_0000009 | Ga0495619_0000009_102371_102739 | 114 |
| 1021 | 3300053085 | Ga0495619_0141403 | Ga0495619_0141403_547_924 | 114 |
| 1022 | 3300053085 | Ga0495619_0184650 | Ga0495619_0184650_649_1023 | 114 |
| 1023 | 3300053131 | Ga0500652_000080 | Ga0500652_000080_7116_7484 | 114 |
| 1024 | 3300053177 | Ga0500636_0040041 | Ga0500636_0040041_810_1178 | 114 |
| 1025 | 3300054114 | Ga0501084_0068797 | Ga0501084_0068797_1520_1888 | 114 |
| 1026 | 3300054114 | Ga0501084_0239755 | Ga0501084_0239755_416_784 | 114 |
| 1027 | 3300060353 | Ga0501082_0428464 | Ga0501082_0428464_275_643 | 114 |
| 1028 | 3300061734 | Ga0530510_0147766 | Ga0530510_0147766_883_1251 | 114 |
| 1029 | 3300061734 | Ga0530510_0806643 | Ga0530510_0806643_288_656 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7su6-assembly1.cif.gz_C | dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin | 0.8489 | 1 | 112 |
| 1nbu-assembly1.cif.gz_D | 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis | 0.8466 | 2 | 112 |
| 2cg8-assembly1.cif.gz_C-2 | the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae | 0.8452 | 3 | 111 |
| 1nbu-assembly1.cif.gz_G | 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis | 0.8444 | 2 | 112 |
| 5f3m-assembly1.cif.gz_A | crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . | 0.8444 | 3 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2nm2B00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8631 | 1 | 111 | 3.30.1130.10 |
| af_A0A0R0J0C6_26_148_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8452 | 3 | 113 | 3.30.1130.10 |
| 5farH00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.836 | 3 | 112 | 3.30.1130.10 |
| 2nm2B00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8358 | 1 | 111 | 3.30.1130.10 |
| 2o9mC00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8231 | 3 | 111 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U7KYL6-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.8951 | 1 | 112 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A259ZZX0-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.8881 | 2 | 112 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A7R9TAB4-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.887 | 3 | 114 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-D7W9Z0-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.8852 | 1 | 112 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A661ZHN2-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.8822 | 3 | 90 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar