F488587

General Info

Members Datasets Scaffolds Average Seq Length
1029 462 1029 118

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0740727|Ga0501039_0740727_330_722
Length 130
Sequence MKDDAIFITGLLIHAHHGVMEHESKVGQRFILDLVLSVDLDDAARSDKLADTASYAAIVECATRAFTARNHKLVESAAGMVADAILSEFTKVTAVRVTVHKPHAPIAATFADVGVTIVRYRNAFDEPSHA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
16 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
21 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
22 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
23 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
24 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
25 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
28 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
32 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
148 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
149 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
150 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
151 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
152 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
153 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
154 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
155 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
164 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
165 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
166 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
167 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
168 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
258 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
259 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
260 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
261 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
262 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
263 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
264 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
265 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
266 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
267 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
268 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
269 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
274 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
275 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
276 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
277 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
278 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
279 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
280 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
281 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
282 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
283 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
284 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
285 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
286 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
287 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
288 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
289 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
291 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
294 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
295 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
296 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
297 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
298 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
299 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
300 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
301 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
302 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
303 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
304 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
305 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
306 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
307 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
308 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
309 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
310 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
311 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
312 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
313 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
314 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
315 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
318 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
319 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
320 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
321 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
322 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
323 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
324 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
325 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
326 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
327 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
328 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
329 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
330 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
331 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
332 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
333 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
334 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
335 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
336 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
337 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
338 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
339 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
340 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
341 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
342 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
343 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
344 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
345 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
346 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
347 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
348 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
349 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
350 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
351 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
355 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
360 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
361 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
362 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
363 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
364 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
365 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
366 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
367 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
368 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
369 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
370 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
371 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
372 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
373 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
374 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
375 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
376 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
377 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
378 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
381 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
382 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
383 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
384 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
385 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
386 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
387 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
388 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
389 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
390 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
391 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
392 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
393 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
394 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
395 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
396 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
397 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
398 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
399 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
400 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
401 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
402 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
403 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
404 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
419 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
420 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
421 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
422 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
423 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
424 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
425 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
426 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
427 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
428 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
429 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
430 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
431 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
432 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
433 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
436 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
437 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
438 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
450 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
451 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
452 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
456 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
457 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
462 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.43
Nodule 0
Rhizoplane 5.54
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745210 2209111006 Bacteria 15141
2 ARcpr5oldR_c000144 3300000041 Bacteria 12262
3 ARSoilYngRDRAFT_c00009 3300000042 Bacteria 30468
4 ARcpr5yngRDRAFT_c000006 3300000043 Bacteria 44193
5 ARSoilOldRDRAFT_c000102 3300000044 Bacteria 16000
6 ARCol0oldRDRAFT_c01043 3300000045 Bacteria 2085
7 ARCol0yngRDRAFT_1000092 3300000652 Bacteria 16856
8 JGI24032J14994_100041 3300001430 Bacteria 4933
9 JGI24736J21556_1064614 3300001904 Bacteria 567
10 JGI24752J21851_1042901 3300001976 Bacteria 608
11 JGI24746J21847_1001712 3300001977 Bacteria 3514
12 JGI24740J21852_10011798 3300001979 Bacteria 3316
13 JGI24739J22299_10000092 3300001989 Bacteria 26283
14 JGI24737J22298_10003955 3300001990 Bacteria 5189
15 JGI24737J22298_10008311 3300001990 Bacteria 3481
16 JGI24743J22301_10030239 3300001991 Bacteria 1064
17 JGI24750J21931_1000128 3300002070 Bacteria 12041
18 JGI24745J21846_1000110 3300002073 Bacteria 6290
19 JGI24748J21848_1000158 3300002074 Bacteria 9876
20 JGI24738J21930_10000010 3300002075 Bacteria 37976
21 JGI24749J21850_1001926 3300002076 Bacteria 2933
22 JGI24749J21850_1018182 3300002076 Bacteria 992
23 JGI24744J21845_10000683 3300002077 Bacteria 6233
24 JGI24744J21845_10110869 3300002077 Bacteria 509
25 JGI24035J26624_1000002 3300002126 Bacteria 16706
26 JGI24033J26618_1002588 3300002155 Bacteria 1858
27 JGI24034J26672_10000201 3300002239 Bacteria 8012
28 JGI24742J22300_10000765 3300002244 Bacteria 4898
29 JGI24751J29686_10021731 3300002459 Bacteria 1330
30 JGI26129J50193_1007527 3300003349 Bacteria 787
31 JGI26129J50193_1015647 3300003349 Bacteria 558
32 JGI26140J50224_101872 3300003383 Bacteria 756
33 Ga0055526_1030168 3300003771 Bacteria 1588
34 JGI25405J52794_10006144 3300003911 Bacteria 2190
35 Ga0065717_1003867 3300005276 Bacteria 1160
36 Ga0065716_1002550 3300005277 Bacteria 1687
37 Ga0065704_10094385 3300005289 Bacteria 2543
38 Ga0065712_10000899 3300005290 Bacteria 8202
39 Ga0065712_10068648 3300005290 Bacteria 9527
40 Ga0065715_10000752 3300005293 Bacteria 15084
41 Ga0065715_10089173 3300005293 Bacteria 13131
42 Ga0065715_10165183 3300005293 Bacteria 1572
43 Ga0070658_10504520 3300005327 Bacteria 1045
44 Ga0070676_10000978 3300005328 Bacteria 14208
45 Ga0070676_10241875 3300005328 Bacteria 1201
46 Ga0070683_100001029 3300005329 Bacteria 20930
47 Ga0070683_100114195 3300005329 Bacteria 2549
48 Ga0070683_101456400 3300005329 Bacteria 658
49 Ga0070690_100001038 3300005330 Bacteria 14220
50 Ga0070690_100615176 3300005330 Bacteria 826
51 Ga0070670_100026956 3300005331 Bacteria 4943
52 Ga0070670_100398935 3300005331 Bacteria 1214
53 Ga0070677_10000126 3300005333 Bacteria 25482
54 Ga0070677_10285506 3300005333 Bacteria 833
55 Ga0068869_100000079 3300005334 Bacteria 44000
56 Ga0068869_100035044 3300005334 Bacteria 3555
57 Ga0068869_102041152 3300005334 Bacteria 515
58 Ga0070666_10019358 3300005335 Bacteria 4394
59 Ga0070666_10250122 3300005335 Bacteria 1255
60 Ga0070680_100002329 3300005336 Bacteria 14022
61 Ga0070680_100007030 3300005336 Bacteria 8579
62 Ga0070680_100129426 3300005336 Bacteria 2111
63 Ga0070682_100000641 3300005337 Bacteria 21233
64 Ga0070682_100663111 3300005337 Unclassified 832
65 Ga0068868_100002114 3300005338 Bacteria 13683
66 Ga0070660_100002411 3300005339 Bacteria 12843
67 Ga0070660_100019320 3300005339 Bacteria 4990
68 Ga0070660_101957305 3300005339 Bacteria 500
69 Ga0070689_100003727 3300005340 Bacteria 10202
70 Ga0070689_100021372 3300005340 Bacteria 4817
71 Ga0070691_10000161 3300005341 Bacteria 21699
72 Ga0070691_10033380 3300005341 Bacteria 2422
73 Ga0070687_100000085 3300005343 Bacteria 30647
74 Ga0070687_100013028 3300005343 Bacteria 3693
75 Ga0070687_100760099 3300005343 Bacteria 683
76 Ga0070687_100917709 3300005343 Bacteria 629
77 Ga0070661_100000307 3300005344 Bacteria 39479
78 Ga0070661_100454154 3300005344 Bacteria 1020
79 Ga0070661_100551561 3300005344 Bacteria 927
80 Ga0070661_100855173 3300005344 Bacteria 749
81 Ga0070692_10001915 3300005345 Bacteria 7857
82 Ga0070692_10048702 3300005345 Bacteria 2196
83 Ga0070668_100009110 3300005347 Bacteria 7371
84 Ga0070668_100039131 3300005347 Bacteria 3627
85 Ga0070668_102210166 3300005347 Unclassified 508
86 Ga0070669_100000571 3300005353 Bacteria 27367
87 Ga0070669_100037439 3300005353 Bacteria 3519
88 Ga0070675_100014189 3300005354 Bacteria 6280
89 Ga0070675_100075720 3300005354 Bacteria 2798
90 Ga0070675_101151216 3300005354 Unclassified 714
91 Ga0070671_100000104 3300005355 Bacteria 53922
92 Ga0070674_100000238 3300005356 Bacteria 27260
93 Ga0070674_100057646 3300005356 Bacteria 2697
94 Ga0070673_100000152 3300005364 Bacteria 33183
95 Ga0070673_101435931 3300005364 Bacteria 650
96 Ga0070688_100001552 3300005365 Bacteria 11464
97 Ga0070688_100010437 3300005365 Bacteria 5120
98 Ga0070688_100185664 3300005365 Bacteria 1445
99 Ga0070659_100000551 3300005366 Bacteria 27372
100 Ga0070659_100014072 3300005366 Bacteria 5970
101 Ga0070667_100002365 3300005367 Bacteria 16513
102 Ga0070667_100082240 3300005367 Bacteria 2757
103 Ga0070667_100126878 3300005367 Bacteria 2224
104 Ga0070703_10002446 3300005406 Bacteria 5352
105 Ga0070703_10008783 3300005406 Bacteria 2845
106 Ga0070703_10277971 3300005406 Bacteria 690
107 Ga0070714_100382247 3300005435 Bacteria 1328
108 Ga0070714_100521871 3300005435 Bacteria 1135
109 Ga0070710_10903011 3300005437 Bacteria 638
110 Ga0070701_10000674 3300005438 Bacteria 12016
111 Ga0070701_10024327 3300005438 Bacteria 2929
112 Ga0070701_10027601 3300005438 Bacteria 2783
113 Ga0070711_100898965 3300005439 Bacteria 756
114 Ga0070711_102008838 3300005439 Bacteria 509
115 Ga0070705_100000096 3300005440 Bacteria 49240
116 Ga0070705_100000148 3300005440 Bacteria 41687
117 Ga0070705_100039756 3300005440 Bacteria 2671
118 Ga0070700_100000277 3300005441 Bacteria 27391
119 Ga0070700_100004184 3300005441 Bacteria 7525
120 Ga0070700_100071695 3300005441 Bacteria 2212
121 Ga0070700_101978793 3300005441 Bacteria 505
122 Ga0070694_100009315 3300005444 Bacteria 6029
123 Ga0070694_100025210 3300005444 Bacteria 3846
124 Ga0070694_100028101 3300005444 Bacteria 3657
125 Ga0070708_100013438 3300005445 Bacteria 6704
126 Ga0070708_100080131 3300005445 Bacteria 2955
127 Ga0070663_100000522 3300005455 Bacteria 20244
128 Ga0070663_100030853 3300005455 Bacteria 3677
129 Ga0070663_100107269 3300005455 Bacteria 2093
130 Ga0070663_101465575 3300005455 Unclassified 606
131 Ga0070678_100000718 3300005456 Bacteria 16435
132 Ga0070678_102109210 3300005456 Unclassified 534
133 Ga0070662_100019850 3300005457 Bacteria 4570
134 Ga0070662_100078008 3300005457 Bacteria 2459
135 Ga0070662_100479210 3300005457 Unclassified 1036
136 Ga0070662_100815239 3300005457 Bacteria 794
137 Ga0070681_10003456 3300005458 Bacteria 14797
138 Ga0070681_10022561 3300005458 Bacteria 6322
139 Ga0070681_10064843 3300005458 Bacteria 3623
140 Ga0070681_10141932 3300005458 Bacteria 2331
141 Ga0070681_11854580 3300005458 Bacteria 530
142 Ga0068867_100004407 3300005459 Bacteria 9902
143 Ga0068867_100017974 3300005459 Bacteria 5024
144 Ga0068867_100775500 3300005459 Unclassified 853
145 Ga0070685_10012102 3300005466 Bacteria 4525
146 Ga0070706_100069484 3300005467 Bacteria 3257
147 Ga0070698_100076049 3300005471 Bacteria 3361
148 Ga0074259_11111610 3300005507 Bacteria 1435
149 Ga0070699_100000255 3300005518 Bacteria 52092
150 Ga0070699_101296327 3300005518 Bacteria 668
151 Ga0070679_100031781 3300005530 Bacteria 5219
152 Ga0070679_100031892 3300005530 Bacteria 5210
153 Ga0070679_100033806 3300005530 Bacteria 5063
154 Ga0070679_100133048 3300005530 Bacteria 2468
155 Ga0070679_101519029 3300005530 Bacteria 617
156 Ga0070684_100000894 3300005535 Bacteria 21105
157 Ga0070684_100310980 3300005535 Bacteria 1447
158 Ga0070684_100925204 3300005535 Unclassified 817
159 Ga0070697_100015667 3300005536 Bacteria 5954
160 Ga0070697_100390178 3300005536 Bacteria 1207
161 Ga0070697_100659297 3300005536 Bacteria 922
162 Ga0068853_100002891 3300005539 Bacteria 13032
163 Ga0068853_100259619 3300005539 Bacteria 1597
164 Ga0070672_100000088 3300005543 Bacteria 44394
165 Ga0070672_100091389 3300005543 Bacteria 2456
166 Ga0070672_100573416 3300005543 Bacteria 981
167 Ga0070686_100000719 3300005544 Bacteria 19252
168 Ga0070686_100032503 3300005544 Bacteria 3199
169 Ga0070695_100000248 3300005545 Bacteria 26990
170 Ga0070695_100001789 3300005545 Bacteria 12107
171 Ga0070695_100027104 3300005545 Bacteria 3547
172 Ga0070696_100000552 3300005546 Bacteria 23812
173 Ga0070696_100013552 3300005546 Bacteria 5471
174 Ga0070696_100020079 3300005546 Bacteria 4530
175 Ga0070696_100421267 3300005546 Bacteria 1048
176 Ga0070693_100000134 3300005547 Bacteria 33408
177 Ga0070693_100009572 3300005547 Bacteria 4822
178 Ga0070665_100050659 3300005548 Bacteria 4166
179 Ga0070704_100000026 3300005549 Bacteria 48700
180 Ga0070704_100011965 3300005549 Bacteria 5345
181 Ga0070704_100044802 3300005549 Bacteria 3076
182 Ga0070704_100309229 3300005549 Bacteria 1320
183 Ga0070704_100607338 3300005549 Unclassified 962
184 Ga0068855_100006834 3300005563 Bacteria 13840
185 Ga0068855_102295069 3300005563 Bacteria 540
186 Ga0068855_102355802 3300005563 Bacteria 532
187 Ga0070664_100002234 3300005564 Bacteria 15585
188 Ga0070664_100011614 3300005564 Bacteria 7146
189 Ga0070664_100179423 3300005564 Bacteria 1882
190 Ga0070664_100397929 3300005564 Unclassified 1259
191 Ga0068857_100002935 3300005577 Bacteria 14058
192 Ga0068857_100010529 3300005577 Bacteria 8039
193 Ga0068854_100000546 3300005578 Bacteria 22673
194 Ga0068854_100932240 3300005578 Unclassified 765
195 Ga0068856_100002000 3300005614 Bacteria 21261
196 Ga0068856_100541781 3300005614 Bacteria 1185
197 Ga0070702_100000245 3300005615 Bacteria 18498
198 Ga0070702_100127545 3300005615 Bacteria 1602
199 Ga0068852_100008609 3300005616 Bacteria 7533
200 Ga0068852_100091269 3300005616 Bacteria 2725
201 Ga0068852_101149115 3300005616 Unclassified 797
202 Ga0068852_101348714 3300005616 Bacteria 735
203 Ga0068852_101580847 3300005616 Unclassified 678
204 Ga0068859_100006734 3300005617 Bacteria 11674
205 Ga0068859_100026101 3300005617 Bacteria 5860
206 Ga0068859_100041857 3300005617 Bacteria 4602
207 Ga0068864_100000890 3300005618 Bacteria 25145
208 Ga0068864_100277961 3300005618 Bacteria 1562
209 Ga0068866_10000221 3300005718 Bacteria 27070
210 Ga0068861_100011785 3300005719 Bacteria 6084
211 Ga0068861_100018274 3300005719 Bacteria 4993
212 Ga0068861_100118272 3300005719 Bacteria 2134
213 Ga0068870_10003727 3300005840 Bacteria 6480
214 Ga0068870_10844419 3300005840 Bacteria 643
215 Ga0068863_100000340 3300005841 Bacteria 47641
216 Ga0068863_100056996 3300005841 Bacteria 3698
217 Ga0068863_100431802 3300005841 Bacteria 1291
218 Ga0068858_100000295 3300005842 Bacteria 53892
219 Ga0068858_100102941 3300005842 Bacteria 2663
220 Ga0068858_100150676 3300005842 Bacteria 2187
221 Ga0068860_100001285 3300005843 Bacteria 27247
222 Ga0068860_100004629 3300005843 Bacteria 14046
223 Ga0068860_100158254 3300005843 Bacteria 2183
224 Ga0068860_102061263 3300005843 Bacteria 592
225 Ga0068862_100003236 3300005844 Bacteria 14093
226 Ga0068862_100003354 3300005844 Bacteria 13821
227 Ga0068862_100063398 3300005844 Bacteria 3180
228 Ga0081455_10000007 3300005937 Bacteria 269394
229 Ga0070717_10037964 3300006028 Bacteria 3913
230 Ga0070717_10127591 3300006028 Bacteria 2185
231 Ga0075365_10358614 3300006038 Bacteria 1028
232 Ga0075363_100115462 3300006048 Bacteria 1495
233 Ga0075363_100519829 3300006048 Bacteria 708
234 Ga0075432_10027241 3300006058 Bacteria 1967
235 Ga0070715_10325721 3300006163 Bacteria 831
236 Ga0070716_100357488 3300006173 Bacteria 1036
237 Ga0070712_100000052 3300006175 Bacteria 62524
238 Ga0070712_100377819 3300006175 Bacteria 1166
239 Ga0070712_100908656 3300006175 Bacteria 759
240 Ga0075362_10188980 3300006177 Bacteria 1000
241 Ga0075362_10436132 3300006177 Bacteria 664
242 Ga0075367_10011053 3300006178 Bacteria 4761
243 Ga0075367_10394533 3300006178 Bacteria 875
244 Ga0075369_10139621 3300006186 Bacteria 1104
245 Ga0097621_100000040 3300006237 Bacteria 66339
246 Ga0075370_10374773 3300006353 Bacteria 852
247 Ga0068871_100000301 3300006358 Bacteria 34368
248 Ga0075431_100199738 3300006847 Bacteria 2046
249 Ga0075431_100269493 3300006847 Bacteria 1726
250 Ga0075431_101914954 3300006847 Unclassified 548
251 Ga0075433_10016057 3300006852 Bacteria 6160
252 Ga0075433_10067742 3300006852 Bacteria 3133
253 Ga0075434_100002477 3300006871 Bacteria 16252
254 Ga0075434_100249805 3300006871 Bacteria 1793
255 Ga0075434_100441171 3300006871 Bacteria 1323
256 Ga0068865_100000275 3300006881 Bacteria 28270
257 Ga0075436_100005032 3300006914 Bacteria 9089
258 Ga0075436_100042636 3300006914 Unclassified 3130
259 Ga0097620_100006734 3300006931 Bacteria 11674
260 Ga0097620_100026102 3300006931 Bacteria 5860
261 Ga0097620_100041858 3300006931 Bacteria 4602
262 Ga0075435_100096492 3300007076 Bacteria 2446
263 Ga0075435_100250148 3300007076 Bacteria 1509
264 Ga0075435_101291276 3300007076 Bacteria 639
265 Ga0099795_10012252 3300007788 Bacteria 2594
266 Ga0105251_10052992 3300009011 Bacteria 1930
267 Ga0105250_10011042 3300009092 Bacteria 3754
268 Ga0105250_10192936 3300009092 Unclassified 858
269 Ga0105240_10212812 3300009093 Bacteria 2257
270 Ga0105240_10367463 3300009093 Bacteria 1628
271 Ga0111539_10000394 3300009094 Bacteria 54170
272 Ga0111539_10003483 3300009094 Bacteria 20741
273 Ga0111539_10043754 3300009094 Bacteria 5367
274 Ga0105245_10000462 3300009098 Bacteria 37242
275 Ga0105245_11078352 3300009098 Bacteria 849
276 Ga0105245_11279654 3300009098 Bacteria 782
277 Ga0105247_10000442 3300009101 Bacteria 35071
278 Ga0105247_10171228 3300009101 Bacteria 1444
279 Ga0114129_10178784 3300009147 Bacteria 2889
280 Ga0114129_10905858 3300009147 Bacteria 1117
281 Ga0105243_10000282 3300009148 Bacteria 56666
282 Ga0105243_10031294 3300009148 Bacteria 4102
283 Ga0105243_10398541 3300009148 Bacteria 1278
284 Ga0105243_11105948 3300009148 Bacteria 801
285 Ga0105241_10000652 3300009174 Bacteria 26004
286 Ga0105241_10151582 3300009174 Bacteria 1897
287 Ga0105241_10642950 3300009174 Bacteria 963
288 Ga0105242_10001726 3300009176 Bacteria 17253
289 Ga0105248_10010575 3300009177 Bacteria 10168
290 Ga0105248_10023284 3300009177 Bacteria 6879
291 Ga0105248_10388826 3300009177 Bacteria 1570
292 Ga0105237_10008154 3300009545 Bacteria 11375
293 Ga0105237_10875312 3300009545 Bacteria 905
294 Ga0105238_10106046 3300009551 Bacteria 2792
295 Ga0105238_12073122 3300009551 Bacteria 603
296 Ga0105249_10001210 3300009553 Bacteria 22796
297 Ga0105249_10003736 3300009553 Bacteria 13134
298 Ga0105249_10010878 3300009553 Bacteria 7996
299 Ga0105249_10399550 3300009553 Bacteria 1404
300 Ga0099796_10006469 3300010159 Bacteria 3000
301 Ga0105239_10006303 3300010375 Bacteria 13795
302 Ga0105239_10163008 3300010375 Bacteria 2491
303 Ga0105239_10258581 3300010375 Bacteria 1956
304 Ga0105239_10282303 3300010375 Bacteria 1869
305 Ga0105239_12355476 3300010375 Bacteria 620
306 Ga0105246_10000312 3300011119 Bacteria 25800
307 Ga0105246_10078510 3300011119 Bacteria 2345
308 Ga0105246_10114945 3300011119 Bacteria 1984
309 Ga0105246_10309787 3300011119 Bacteria 1278
310 Ga0157344_1002004 3300012476 Bacteria 1038
311 Ga0157328_1013142 3300012478 Bacteria 611
312 Ga0157325_1002945 3300012485 Bacteria 907
313 Ga0157343_1003240 3300012488 Bacteria 942
314 Ga0157329_1010294 3300012491 Bacteria 731
315 Ga0157341_1004268 3300012494 Bacteria 1028
316 Ga0157313_1000657 3300012503 Bacteria 1665
317 Ga0157315_1014475 3300012508 Bacteria 756
318 Ga0157327_1031858 3300012512 Bacteria 662
319 Ga0157373_10035915 3300013100 Bacteria 3557
320 Ga0157371_10029433 3300013102 Bacteria 3972
321 Ga0157371_10457690 3300013102 Bacteria 939
322 Ga0157370_11531953 3300013104 Bacteria 599
323 Ga0157369_11568099 3300013105 Bacteria 670
324 Ga0157369_12043287 3300013105 Bacteria 581
325 Ga0157374_10001123 3300013296 Bacteria 23027
326 Ga0157374_10708914 3300013296 Bacteria 1020
327 Ga0157378_10000270 3300013297 Bacteria 50517
328 Ga0163162_10000145 3300013306 Bacteria 65191
329 Ga0163162_10021406 3300013306 Bacteria 6368
330 Ga0157372_10004025 3300013307 Bacteria 15762
331 Ga0157372_10224278 3300013307 Bacteria 2179
332 Ga0157372_11770094 3300013307 Bacteria 711
333 Ga0157372_13276400 3300013307 Unclassified 516
334 Ga0157375_10000332 3300013308 Bacteria 42513
335 Ga0157375_10106184 3300013308 Bacteria 2900
336 Ga0163163_10000865 3300014325 Bacteria 25811
337 Ga0163163_10019523 3300014325 Bacteria 6367
338 Ga0157380_10003074 3300014326 Bacteria 11374
339 Ga0157380_10090270 3300014326 Bacteria 2527
340 Ga0157377_10000137 3300014745 Bacteria 46698
341 Ga0157379_10001761 3300014968 Bacteria 17895
342 Ga0157379_10034305 3300014968 Bacteria 4524
343 Ga0157376_10000088 3300014969 Bacteria 70084
344 Ga0182006_1105742 3300015261 Bacteria 993
345 Ga0163161_10000144 3300017792 Bacteria 64771
346 Ga0197907_10831634 3300020069 Bacteria 525
347 Ga0207666_1000048 3300025271 Bacteria 23535
348 Ga0207666_1000232 3300025271 Bacteria 8175
349 Ga0207673_1000013 3300025290 Bacteria 13878
350 Ga0209564_1002100 3300025295 Bacteria 17043
351 Ga0207697_10000136 3300025315 Bacteria 35274
352 Ga0207697_10006414 3300025315 Bacteria 5326
353 Ga0207713_1063062 3300025735 Bacteria 1401
354 Ga0207653_10001370 3300025885 Bacteria 7928
355 Ga0207653_10002887 3300025885 Bacteria 5457
356 Ga0207682_10000006 3300025893 Bacteria 94953
357 Ga0207682_10243760 3300025893 Bacteria 836
358 Ga0207692_10226829 3300025898 Bacteria 1110
359 Ga0207642_10003385 3300025899 Bacteria 5030
360 Ga0207710_10001915 3300025900 Bacteria 9975
361 Ga0207710_10018748 3300025900 Bacteria 2946
362 Ga0207688_10000027 3300025901 Bacteria 48448
363 Ga0207688_10013378 3300025901 Bacteria 4458
364 Ga0207647_10005467 3300025904 Bacteria 9310
365 Ga0207647_10014058 3300025904 Bacteria 5533
366 Ga0207685_10255435 3300025905 Bacteria 849
367 Ga0207699_10089456 3300025906 Bacteria 1930
368 Ga0207645_10000100 3300025907 Bacteria 64057
369 Ga0207643_10000007 3300025908 Bacteria 171706
370 Ga0207643_10566913 3300025908 Bacteria 729
371 Ga0207684_11610847 3300025910 Bacteria 525
372 Ga0207654_10000314 3300025911 Bacteria 29106
373 Ga0207654_10654077 3300025911 Bacteria 753
374 Ga0207707_10003030 3300025912 Bacteria 14935
375 Ga0207707_10003553 3300025912 Bacteria 13808
376 Ga0207707_10334681 3300025912 Bacteria 1306
377 Ga0207707_10649541 3300025912 Bacteria 889
378 Ga0207707_10961805 3300025912 Bacteria 703
379 Ga0207695_10031101 3300025913 Bacteria 5862
380 Ga0207671_10029994 3300025914 Bacteria 4058
381 Ga0207671_10040362 3300025914 Bacteria 3455
382 Ga0207671_11033306 3300025914 Bacteria 647
383 Ga0207693_10000835 3300025915 Bacteria 27434
384 Ga0207693_10451262 3300025915 Bacteria 1005
385 Ga0207693_10766771 3300025915 Bacteria 745
386 Ga0207663_10263165 3300025916 Bacteria 1274
387 Ga0207663_10310252 3300025916 Bacteria 1182
388 Ga0207660_10000041 3300025917 Bacteria 63485
389 Ga0207660_10030841 3300025917 Bacteria 3687
390 Ga0207660_10063155 3300025917 Bacteria 2669
391 Ga0207660_10468332 3300025917 Bacteria 1020
392 Ga0207660_10956360 3300025917 Bacteria 699
393 Ga0207660_11187095 3300025917 Bacteria 621
394 Ga0207662_10000282 3300025918 Bacteria 23540
395 Ga0207662_10012555 3300025918 Bacteria 4720
396 Ga0207662_10554950 3300025918 Bacteria 796
397 Ga0207657_10003933 3300025919 Bacteria 15773
398 Ga0207657_10024595 3300025919 Bacteria 5572
399 Ga0207649_10002204 3300025920 Bacteria 11011
400 Ga0207649_10629545 3300025920 Bacteria 827
401 Ga0207652_10006361 3300025921 Bacteria 9537
402 Ga0207652_10041684 3300025921 Bacteria 3904
403 Ga0207652_10052780 3300025921 Bacteria 3491
404 Ga0207646_10925371 3300025922 Bacteria 773
405 Ga0207681_10000100 3300025923 Bacteria 72913
406 Ga0207681_10035203 3300025923 Bacteria 3298
407 Ga0207694_10058343 3300025924 Bacteria 3002
408 Ga0207694_11157445 3300025924 Bacteria 655
409 Ga0207650_10031197 3300025925 Bacteria 3846
410 Ga0207659_10000044 3300025926 Bacteria 88759
411 Ga0207659_10356560 3300025926 Bacteria 1214
412 Ga0207687_10000072 3300025927 Bacteria 76222
413 Ga0207664_10474955 3300025929 Bacteria 1118
414 Ga0207644_10007313 3300025931 Bacteria 7187
415 Ga0207690_10000140 3300025932 Bacteria 58923
416 Ga0207690_10045487 3300025932 Bacteria 2900
417 Ga0207690_10416557 3300025932 Bacteria 1074
418 Ga0207706_10003180 3300025933 Bacteria 15778
419 Ga0207706_10023633 3300025933 Bacteria 5519
420 Ga0207706_10088083 3300025933 Bacteria 2730
421 Ga0207706_10107818 3300025933 Bacteria 2451
422 Ga0207706_10606124 3300025933 Bacteria 940
423 Ga0207686_10018123 3300025934 Bacteria 3980
424 Ga0207686_11120960 3300025934 Bacteria 642
425 Ga0207709_10000154 3300025935 Bacteria 93456
426 Ga0207709_10007823 3300025935 Bacteria 5925
427 Ga0207709_10682084 3300025935 Bacteria 821
428 Ga0207670_10000444 3300025936 Bacteria 23206
429 Ga0207670_10468651 3300025936 Bacteria 1018
430 Ga0207670_10818838 3300025936 Bacteria 776
431 Ga0207670_10857592 3300025936 Unclassified 759
432 Ga0207669_10000176 3300025937 Bacteria 29979
433 Ga0207669_10026689 3300025937 Bacteria 3147
434 Ga0207704_10000086 3300025938 Bacteria 54866
435 Ga0207704_10033653 3300025938 Bacteria 2917
436 Ga0207704_10220588 3300025938 Unclassified 1403
437 Ga0207665_10132210 3300025939 Bacteria 1773
438 Ga0207665_10242924 3300025939 Bacteria 1327
439 Ga0207691_10000214 3300025940 Bacteria 56205
440 Ga0207691_10059545 3300025940 Bacteria 3472
441 Ga0207711_10001773 3300025941 Bacteria 19760
442 Ga0207711_10014174 3300025941 Bacteria 6621
443 Ga0207689_10000366 3300025942 Bacteria 42711
444 Ga0207689_10062365 3300025942 Bacteria 3065
445 Ga0207689_11612069 3300025942 Bacteria 540
446 Ga0207661_10000087 3300025944 Bacteria 63263
447 Ga0207661_10604003 3300025944 Bacteria 1007
448 Ga0207679_10000029 3300025945 Bacteria 183002
449 Ga0207679_10008732 3300025945 Bacteria 6463
450 Ga0207679_10269457 3300025945 Bacteria 1456
451 Ga0207667_10022798 3300025949 Bacteria 6906
452 Ga0207667_10834510 3300025949 Bacteria 916
453 Ga0207651_10000264 3300025960 Bacteria 22299
454 Ga0207651_10735947 3300025960 Bacteria 871
455 Ga0207712_10000129 3300025961 Bacteria 79246
456 Ga0207712_10002495 3300025961 Bacteria 11837
457 Ga0207712_10008947 3300025961 Bacteria 6333
458 Ga0207668_10000100 3300025972 Bacteria 60574
459 Ga0207668_10248086 3300025972 Bacteria 1444
460 Ga0207668_10707679 3300025972 Bacteria 886
461 Ga0207668_11724260 3300025972 Unclassified 565
462 Ga0207640_10001860 3300025981 Bacteria 11310
463 Ga0207640_10683863 3300025981 Unclassified 878
464 Ga0207658_10011163 3300025986 Bacteria 6117
465 Ga0207658_10110125 3300025986 Bacteria 2175
466 Ga0207658_10425745 3300025986 Bacteria 1171
467 Ga0207677_10006287 3300026023 Bacteria 6500
468 Ga0207703_10006917 3300026035 Bacteria 9029
469 Ga0207703_10042113 3300026035 Bacteria 3661
470 Ga0207703_10899707 3300026035 Bacteria 847
471 Ga0207639_10002204 3300026041 Bacteria 13124
472 Ga0207639_10025420 3300026041 Bacteria 4294
473 Ga0207639_10661600 3300026041 Bacteria 967
474 Ga0207678_10002814 3300026067 Bacteria 15778
475 Ga0207678_10004143 3300026067 Bacteria 13031
476 Ga0207678_10139405 3300026067 Bacteria 2069
477 Ga0207708_10001802 3300026075 Bacteria 15778
478 Ga0207708_10002366 3300026075 Bacteria 13852
479 Ga0207708_10004097 3300026075 Bacteria 10724
480 Ga0207702_10001819 3300026078 Bacteria 20980
481 Ga0207702_10309599 3300026078 Bacteria 1501
482 Ga0207641_10000476 3300026088 Bacteria 45413
483 Ga0207641_10039915 3300026088 Bacteria 3927
484 Ga0207641_10182723 3300026088 Bacteria 1922
485 Ga0207648_10000072 3300026089 Bacteria 94957
486 Ga0207648_10074884 3300026089 Bacteria 2951
487 Ga0207676_10000512 3300026095 Bacteria 32630
488 Ga0207676_10145923 3300026095 Bacteria 2032
489 Ga0207676_10153966 3300026095 Bacteria 1983
490 Ga0207674_10000697 3300026116 Bacteria 43729
491 Ga0207674_10003652 3300026116 Bacteria 18763
492 Ga0207675_100002384 3300026118 Bacteria 18614
493 Ga0207675_100026129 3300026118 Bacteria 5435
494 Ga0207675_100082231 3300026118 Bacteria 3020
495 Ga0207683_10000029 3300026121 Bacteria 109665
496 Ga0207698_10000523 3300026142 Bacteria 22323
497 Ga0207698_10066725 3300026142 Bacteria 2834
498 Ga0209973_1007912 3300027252 Bacteria 1199
499 Ga0209967_1008658 3300027364 Bacteria 1403
500 Ga0209967_1020422 3300027364 Bacteria 965
501 Ga0209984_1008235 3300027424 Bacteria 1309
502 Ga0209968_1019510 3300027526 Bacteria 1092
503 Ga0209999_1006967 3300027543 Bacteria 2033
504 Ga0209982_1015508 3300027552 Bacteria 1157
505 Ga0210002_1000381 3300027617 Bacteria 6055
506 Ga0209983_1009047 3300027665 Bacteria 2035
507 Ga0209966_1001626 3300027695 Bacteria 3839
508 Ga0209966_1010167 3300027695 Bacteria 1692
509 Ga0209966_1094199 3300027695 Bacteria 673
510 Ga0209998_10003967 3300027717 Bacteria 3182
511 Ga0209998_10006957 3300027717 Bacteria 2346
512 Ga0209998_10112281 3300027717 Bacteria 681
513 Ga0209813_10001957 3300027866 Bacteria 4658
514 Ga0209974_10028078 3300027876 Bacteria 1863
515 Ga0209974_10047690 3300027876 Bacteria 1435
516 Ga0207428_10000100 3300027907 Bacteria 119495
517 Ga0207428_10000228 3300027907 Bacteria 77812
518 Ga0207428_10250934 3300027907 Unclassified 1319
519 Ga0268266_10026692 3300028379 Bacteria 4914
520 Ga0268265_10001240 3300028380 Bacteria 22083
521 Ga0268265_10002707 3300028380 Bacteria 13120
522 Ga0268265_10635181 3300028380 Bacteria 1024
523 Ga0268264_10006796 3300028381 Bacteria 9610
524 Ga0268264_10023946 3300028381 Bacteria 4981
525 Ga0268264_10086087 3300028381 Bacteria 2699
526 Ga0268264_11821256 3300028381 Bacteria 619
527 Ga0265332_10001262 3300031238 Bacteria 14505
528 Ga0265325_10035258 3300031241 Bacteria 2658
529 Ga0265329_10007990 3300031242 Bacteria 4049
530 Ga0265340_10010191 3300031247 Bacteria 5033
531 Ga0265340_10050420 3300031247 Bacteria 2019
532 Ga0265340_10187919 3300031247 Bacteria 932
533 Ga0265316_10737023 3300031344 Bacteria 693
534 Ga0307408_100226002 3300031548 Bacteria 1530
535 Ga0316579_10196012 3300031691 Bacteria 976
536 Ga0265342_10000069 3300031712 Bacteria 110550
537 Ga0316576_10108378 3300031727 Bacteria 2081
538 Ga0316578_10010476 3300031728 Bacteria 4813
539 Ga0307405_10373372 3300031731 Bacteria 1108
540 Ga0307413_10368925 3300031824 Bacteria 1114
541 Ga0307410_10149906 3300031852 Bacteria 1735
542 Ga0307406_10883851 3300031901 Bacteria 760
543 Ga0307412_10542996 3300031911 Bacteria 975
544 Ga0307412_11539426 3300031911 Bacteria 606
545 Ga0307409_100175231 3300031995 Bacteria 1892
546 Ga0307409_100461723 3300031995 Bacteria 1228
547 Ga0307411_10032708 3300032005 Bacteria 3217
548 Ga0307411_10947454 3300032005 Bacteria 768
549 Ga0307415_100620440 3300032126 Bacteria 965
550 Ga0316583_10018501 3300032133 Bacteria 2501
551 Ga0373930_0000036 3300034816 Bacteria 11808
552 Ga0373948_0001276 3300034817 Bacteria 3442
553 Ga0373950_0000274 3300034818 Bacteria 6492
554 Ga0373950_0006173 3300034818 Bacteria 1818
555 Ga0373958_0000036 3300034819 Bacteria 13507
556 Ga0373958_0000512 3300034819 Bacteria 4815
557 Ga0373959_0001045 3300034820 Bacteria 4542
558 Ga0373959_0074521 3300034820 Bacteria 772
559 Ga0373938_0000752 3300034957 Bacteria 5239
560 Ga0373938_0001980 3300034957 Bacteria 3283
561 Ga0373928_0000727 3300035084 Bacteria 6461
562 Ga0373928_0002885 3300035084 Bacteria 3313
563 Ga0373929_0000805 3300035085 Bacteria 6102
564 Ga0373934_0088515 3300035086 Bacteria 1247
565 Ga0373940_0000107 3300035088 Bacteria 10202
566 Ga0373940_0005262 3300035088 Bacteria 2791
567 Ga0373949_0000284 3300035090 Bacteria 18664
568 Ga0373949_0001237 3300035090 Bacteria 7538
569 Ga0373951_0000560 3300035091 Bacteria 10396
570 Ga0373951_0004835 3300035091 Bacteria 3170
571 Ga0373952_0000135 3300035092 Bacteria 10680
572 Ga0373952_0000152 3300035092 Bacteria 10287
573 Ga0373952_0203300 3300035092 Unclassified 581
574 Ga0373923_0005530 3300035111 Bacteria 4296
575 Ga0373932_0000172 3300035112 Bacteria 18943
576 Ga0373932_0002592 3300035112 Bacteria 4511
577 Ga0373936_0012581 3300035113 Bacteria 3221
578 Ga0373936_0012931 3300035113 Bacteria 3183
579 Ga0373939_0007160 3300035114 Bacteria 2704
580 Ga0373939_0011782 3300035114 Bacteria 2215
581 Ga0373941_0000081 3300035115 Bacteria 15592
582 Ga0373941_0000225 3300035115 Bacteria 10871
583 Ga0373941_0002269 3300035115 Bacteria 4208
584 Ga0373941_0121660 3300035115 Bacteria 931
585 Ga0373945_0040392 3300035116 Bacteria 1684
586 Ga0373945_0083557 3300035116 Bacteria 1227
587 Ga0373953_0002122 3300035117 Bacteria 5929
588 Ga0373953_0075559 3300035117 Bacteria 1395
589 Ga0373954_0002543 3300035118 Bacteria 7653
590 Ga0373954_0014017 3300035118 Bacteria 3573
591 Ga0373956_0060477 3300035119 Bacteria 1715
592 Ga0373957_0012970 3300035120 Bacteria 2818
593 Ga0373957_0014625 3300035120 Bacteria 2686
594 Ga0373960_0001550 3300035121 Bacteria 5123
595 Ga0373960_0003760 3300035121 Bacteria 3450
596 Ga0373943_0005071 3300035170 Bacteria 5939
597 Ga0373946_0000195 3300035171 Bacteria 18740
598 Ga0373955_0000728 3300035172 Bacteria 14088
599 Ga0373955_0003373 3300035172 Bacteria 7021
600 Ga0373942_0000173 3300035207 Bacteria 16049
601 Ga0373942_0065726 3300035207 Bacteria 1048
602 Ga0373961_0000196 3300035241 Bacteria 28662
603 Ga0373961_0003123 3300035241 Bacteria 4151
604 Ga0373962_0000151 3300035242 Bacteria 14355
605 Ga0373962_0000452 3300035242 Bacteria 9022
606 Ga0316574_0025731 3300035398 Bacteria 3534
607 Ga0373924_0000908 3300035410 Bacteria 9373
608 Ga0373924_0014025 3300035410 Bacteria 3022
609 Ga0373931_0001253 3300035691 Bacteria 10836
610 Ga0373931_0002490 3300035691 Bacteria 8167
611 Ga0373931_0324267 3300035691 Bacteria 957
612 Ga0373931_1030836 3300035691 Bacteria 558
613 Ga0373935_0000192 3300035692 Bacteria 29081
614 Ga0373927_0324268 3300035695 Bacteria 1014
615 Ga0373927_0351808 3300035695 Bacteria 971
616 Ga0373927_0822081 3300035695 Bacteria 613
617 Ga0373933_0004316 3300035724 Bacteria 7806
618 Ga0373933_0006946 3300035724 Bacteria 6170
619 Ga0373933_0388058 3300035724 Bacteria 910
620 Ga0373947_0002278 3300035725 Bacteria 11598
621 Ga0373947_0021129 3300035725 Bacteria 3766
622 Ga0373947_0026478 3300035725 Bacteria 3390
623 Ga0373937_0000018 3300036401 Bacteria 144056
624 Ga0373937_0738293 3300036401 Bacteria 932
625 Ga0316582_0076318 3300036647 Bacteria 2179
626 Ga0316584_0073155 3300036712 Bacteria 2568
627 Ga0373925_0000055 3300037068 Bacteria 123638
628 Ga0373925_0056277 3300037068 Bacteria 2946
629 Ga0373925_0345257 3300037068 Bacteria 1208
630 Ga0395898_0119462 3300037466 Bacteria 2525
631 Ga0242420_003017 3300038996 Bacteria 2460
632 Ga0436361_0155875 3300039447 Bacteria 855
633 Ga0439441_172451 3300042001 Bacteria 517
634 Ga0439450_090220 3300042008 Bacteria 769
635 Ga0439455_0040110 3300042012 Bacteria 1196
636 Ga0439463_200409 3300042016 Bacteria 518
637 Ga0439458_0070207 3300042157 Bacteria 884
638 Ga0439444_0123655 3300042437 Bacteria 606
639 Ga0439464_0042609 3300042439 Bacteria 1296
640 Ga0439464_0142683 3300042439 Bacteria 746
641 Ga0439460_0095645 3300042461 Bacteria 949
642 Ga0451577_0327081 3300042876 Bacteria 1390
643 Ga0466972_0019709 3300044658 Bacteria 3373
644 Ga0466972_0033799 3300044658 Bacteria 2508
645 Ga0466965_0020059 3300044683 Bacteria 3211
646 Ga0466965_0024731 3300044683 Bacteria 2906
647 Ga0466961_0016205 3300044693 Bacteria 4786
648 Ga0466964_0017573 3300044706 Bacteria 2737
649 Ga0453684_0171995 3300044712 Bacteria 2552
650 Ga0466971_0020441 3300044719 Bacteria 2943
651 Ga0466970_0009267 3300044765 Bacteria 4969
652 Ga0466970_0121027 3300044765 Bacteria 1434
653 Ga0466957_0011379 3300044842 Bacteria 5131
654 Ga0466957_0064591 3300044842 Bacteria 2252
655 Ga0466960_0077820 3300044901 Bacteria 1664
656 Ga0466960_0831607 3300044901 Bacteria 560
657 Ga0451576_0041638 3300045051 Bacteria 4855
658 Ga0466958_0036691 3300045836 Bacteria 2935
659 Ga0466967_0025379 3300045976 Bacteria 4886
660 Ga0466967_0119885 3300045976 Bacteria 2429
661 Ga0466967_0524362 3300045976 Bacteria 1164
662 Ga0466967_0627373 3300045976 Bacteria 1062
663 Ga0495592_0000235 3300046454 Bacteria 47623
664 Ga0495592_0093466 3300046454 Bacteria 2154
665 Ga0495590_0052060 3300046457 Bacteria 1430
666 Ga0495629_0002430 3300046459 Bacteria 14300
667 Ga0495638_0271792 3300046460 Bacteria 925
668 Ga0495651_0000516 3300046462 Bacteria 30037
669 Ga0495651_0390249 3300046462 Bacteria 911
670 Ga0495653_0000003 3300046463 Bacteria 377892
671 Ga0495653_0418520 3300046463 Bacteria 848
672 Ga0495582_0034749 3300046473 Bacteria 2771
673 Ga0495662_0011854 3300046476 Bacteria 4261
674 Ga0495664_0000001 3300046477 Bacteria 757730
675 Ga0495608_0000033 3300046511 Bacteria 141349
676 Ga0495608_0045528 3300046511 Bacteria 2923
677 Ga0495608_0154901 3300046511 Bacteria 1459
678 Ga0495618_0000012 3300046514 Bacteria 170881
679 Ga0495628_0000003 3300046516 Bacteria 470339
680 Ga0495630_0004336 3300046517 Bacteria 9954
681 Ga0495630_0325694 3300046517 Bacteria 1175
682 Ga0495637_0290906 3300046520 Bacteria 581
683 Ga0495642_0289634 3300046528 Bacteria 717
684 Ga0495652_0000001 3300046529 Bacteria 1045081
685 Ga0495652_0082958 3300046529 Bacteria 2640
686 Ga0495652_0592264 3300046529 Bacteria 757
687 Ga0495640_0000012 3300046533 Bacteria 194692
688 Ga0495640_0698415 3300046533 Bacteria 609
689 Ga0495587_0000003 3300046536 Bacteria 424188
690 Ga0495587_0031814 3300046536 Bacteria 3192
691 Ga0495587_0271814 3300046536 Bacteria 951
692 Ga0495609_0124607 3300046538 Bacteria 1106
693 Ga0495645_0000004 3300046543 Bacteria 532661
694 Ga0495667_0000001 3300046559 Bacteria 834831
695 Ga0495667_0032697 3300046559 Bacteria 3484
696 Ga0495634_0000163 3300046642 Bacteria 60720
697 Ga0495635_0000015 3300046663 Bacteria 215468
698 Ga0495635_0229038 3300046663 Bacteria 1256
699 Ga0495635_0845041 3300046663 Bacteria 588
700 Ga0495657_0000061 3300046675 Bacteria 96199
701 Ga0495657_0028219 3300046675 Bacteria 3951
702 Ga0495599_0000004 3300046678 Bacteria 316231
703 Ga0495623_0000020 3300046679 Bacteria 100523
704 Ga0495623_0041069 3300046679 Bacteria 2952
705 Ga0495623_0387829 3300046679 Bacteria 754
706 Ga0495646_0000006 3300046680 Bacteria 258496
707 Ga0495646_0355101 3300046680 Bacteria 767
708 Ga0495647_0478379 3300046681 Bacteria 578
709 Ga0495658_0030078 3300046683 Bacteria 2946
710 Ga0495613_0002383 3300046689 Bacteria 14238
711 Ga0495613_0147438 3300046689 Bacteria 1679
712 Ga0495624_0012717 3300046690 Bacteria 5747
713 Ga0495624_0340139 3300046690 Bacteria 903
714 Ga0495600_0000029 3300046809 Bacteria 89914
715 Ga0495581_0001267 3300047315 Bacteria 13913
716 Ga0495604_0000018 3300047317 Bacteria 181417
717 Ga0495604_0199106 3300047317 Bacteria 1391
718 Ga0495674_0000001 3300047319 Bacteria 778665
719 Ga0495674_0053333 3300047319 Bacteria 3555
720 Ga0495674_0178558 3300047319 Bacteria 1769
721 Ga0495672_0124293 3300047320 Bacteria 1367
722 Ga0495672_0279408 3300047320 Bacteria 799
723 Ga0495680_0000147 3300047322 Bacteria 70915
724 Ga0495680_0005610 3300047322 Bacteria 11761
725 Ga0495675_0000034 3300047444 Bacteria 97963
726 Ga0495684_0000005 3300047471 Bacteria 291932
727 Ga0495684_0502670 3300047471 Bacteria 833
728 Ga0495593_0002540 3300047673 Bacteria 10956
729 Ga0495602_0000002 3300048088 Bacteria 422216
730 Ga0495602_0260578 3300048088 Bacteria 1286
731 Ga0495602_0383473 3300048088 Bacteria 1006
732 Ga0496100_0000530 3300048903 Bacteria 18154
733 Ga0496100_0129276 3300048903 Bacteria 1777
734 Ga0496100_0459229 3300048903 Bacteria 977
735 Ga0496101_0000189 3300048904 Bacteria 48416
736 Ga0496101_0067265 3300048904 Bacteria 2616
737 Ga0496101_0181949 3300048904 Bacteria 1619
738 Ga0496101_0255871 3300048904 Bacteria 1365
739 Ga0496102_0001085 3300048905 Bacteria 25158
740 Ga0496102_0026992 3300048905 Bacteria 5127
741 Ga0496102_0053152 3300048905 Bacteria 3693
742 Ga0496102_1405045 3300048905 Bacteria 617
743 Ga0496103_0020763 3300048906 Bacteria 3948
744 Ga0496103_0399992 3300048906 Bacteria 882
745 Ga0496104_0004877 3300048907 Bacteria 11694
746 Ga0496104_0076771 3300048907 Bacteria 3182
747 Ga0496104_0102063 3300048907 Bacteria 2747
748 Ga0496104_0590549 3300048907 Unclassified 1021
749 Ga0496104_0937430 3300048907 Bacteria 770
750 Ga0496105_0007511 3300048908 Bacteria 8445
751 Ga0496105_0329944 3300048908 Bacteria 1221
752 Ga0496105_0642762 3300048908 Bacteria 819
753 Ga0496106_0002185 3300048909 Bacteria 14611
754 Ga0496106_0004993 3300048909 Bacteria 9819
755 Ga0496106_0040009 3300048909 Bacteria 3510
756 Ga0496106_0110134 3300048909 Bacteria 2143
757 Ga0496106_0195661 3300048909 Bacteria 1608
758 Ga0496106_0465257 3300048909 Bacteria 1016
759 Ga0496106_0537812 3300048909 Bacteria 938
760 Ga0496107_0003085 3300048910 Bacteria 11063
761 Ga0496107_0006647 3300048910 Bacteria 7961
762 Ga0496107_0121975 3300048910 Bacteria 1920
763 Ga0496107_0295133 3300048910 Bacteria 1206
764 Ga0496108_0002465 3300048911 Bacteria 14815
765 Ga0496108_0011168 3300048911 Bacteria 7296
766 Ga0496108_0502321 3300048911 Unclassified 1059
767 Ga0496109_0000488 3300048912 Bacteria 33914
768 Ga0496109_0006884 3300048912 Bacteria 9588
769 Ga0496109_0084382 3300048912 Bacteria 2931
770 Ga0496109_0173976 3300048912 Bacteria 2021
771 Ga0496109_0784305 3300048912 Unclassified 891
772 Ga0496110_0069646 3300048913 Bacteria 3116
773 Ga0496110_0111002 3300048913 Bacteria 2464
774 Ga0496110_0526456 3300048913 Bacteria 1075
775 Ga0496111_0098927 3300048914 Bacteria 2142
776 Ga0496111_0140843 3300048914 Bacteria 1787
777 Ga0496111_0436514 3300048914 Bacteria 967
778 Ga0496112_0030833 3300048915 Bacteria 5194
779 Ga0496112_0184312 3300048915 Bacteria 2051
780 Ga0496113_0021686 3300048916 Bacteria 4534
781 Ga0496113_0037283 3300048916 Bacteria 3566
782 Ga0496113_0055553 3300048916 Bacteria 2968
783 Ga0496113_0500650 3300048916 Unclassified 975
784 Ga0496114_0001960 3300048917 Bacteria 15650
785 Ga0496114_0318888 3300048917 Bacteria 1373
786 Ga0496115_0002442 3300048918 Bacteria 13349
787 Ga0496115_0095823 3300048918 Bacteria 2429
788 Ga0496115_0293453 3300048918 Bacteria 1333
789 Ga0496121_0656819 3300048924 Bacteria 638
790 Ga0496122_0179782 3300048925 Bacteria 1263
791 Ga0496123_0028949 3300048926 Bacteria 4089
792 Ga0496124_0594816 3300048927 Bacteria 721
793 Ga0496125_0289770 3300048928 Bacteria 1009
794 Ga0496126_0652286 3300048929 Bacteria 823
795 Ga0501031_0008966 3300049568 Bacteria 6506
796 Ga0501031_0048550 3300049568 Bacteria 2766
797 Ga0501031_0075381 3300049568 Bacteria 2196
798 Ga0501032_0032190 3300049569 Bacteria 3593
799 Ga0501032_0053337 3300049569 Bacteria 2723
800 Ga0501032_0122015 3300049569 Bacteria 1722
801 Ga0501032_0251647 3300049569 Bacteria 1147
802 Ga0501032_0339287 3300049569 Bacteria 968
803 Ga0501032_0633903 3300049569 Bacteria 679
804 Ga0501033_0127784 3300049570 Bacteria 1842
805 Ga0501033_0153285 3300049570 Bacteria 1661
806 Ga0501033_0158723 3300049570 Bacteria 1628
807 Ga0501033_0278704 3300049570 Bacteria 1180
808 Ga0501033_0804144 3300049570 Bacteria 635
809 Ga0501034_0000616 3300049571 Bacteria 55864
810 Ga0501034_0000850 3300049571 Bacteria 45243
811 Ga0501034_0016718 3300049571 Bacteria 7522
812 Ga0501034_0023602 3300049571 Bacteria 6266
813 Ga0501034_0071171 3300049571 Bacteria 3488
814 Ga0501034_0076450 3300049571 Bacteria 3354
815 Ga0501034_0118117 3300049571 Bacteria 2639
816 Ga0501034_0420067 3300049571 Bacteria 1258
817 Ga0501034_0427856 3300049571 Bacteria 1244
818 Ga0501034_0963848 3300049571 Bacteria 738
819 Ga0501034_1042437 3300049571 Bacteria 700
820 Ga0501034_1064263 3300049571 Unclassified 691
821 Ga0501036_0000547 3300049572 Bacteria 26976
822 Ga0501036_0034721 3300049572 Bacteria 4266
823 Ga0501036_0038602 3300049572 Bacteria 4041
824 Ga0501036_0065268 3300049572 Bacteria 3081
825 Ga0501036_0073228 3300049572 Bacteria 2896
826 Ga0501036_0352825 3300049572 Bacteria 1228
827 Ga0501036_0796033 3300049572 Bacteria 778
828 Ga0501037_0001864 3300049573 Bacteria 15310
829 Ga0501037_0055103 3300049573 Bacteria 2907
830 Ga0501037_0079089 3300049573 Bacteria 2386
831 Ga0501037_0131522 3300049573 Bacteria 1794
832 Ga0501037_0199016 3300049573 Bacteria 1416
833 Ga0501037_0656609 3300049573 Bacteria 700
834 Ga0501038_0011775 3300049574 Bacteria 7979
835 Ga0501038_0093671 3300049574 Bacteria 2512
836 Ga0501038_0167015 3300049574 Bacteria 1784
837 Ga0501038_0172863 3300049574 Bacteria 1747
838 Ga0501038_0352777 3300049574 Bacteria 1145
839 Ga0501038_0544194 3300049574 Bacteria 883
840 Ga0501039_0009820 3300049575 Bacteria 7293
841 Ga0501039_0054526 3300049575 Bacteria 3094
842 Ga0501039_0129166 3300049575 Bacteria 1983
843 Ga0501039_0740727 3300049575 Bacteria 768
844 Ga0501040_0082795 3300049576 Bacteria 2225
845 Ga0501040_0820205 3300049576 Unclassified 673
846 Ga0501042_1029229 3300049578 Unclassified 600
847 Ga0501043_0001850 3300049579 Bacteria 18123
848 Ga0501043_0012323 3300049579 Bacteria 6685
849 Ga0501043_0065891 3300049579 Bacteria 2844
850 Ga0501043_0117371 3300049579 Bacteria 2088
851 Ga0501043_0117907 3300049579 Unclassified 2082
852 Ga0501043_0118826 3300049579 Bacteria 2073
853 Ga0501043_0169344 3300049579 Bacteria 1704
854 Ga0501043_0389891 3300049579 Bacteria 1053
855 Ga0501046_0011532 3300049580 Bacteria 7558
856 Ga0501046_0049782 3300049580 Bacteria 3313
857 Ga0501046_0076847 3300049580 Bacteria 2586
858 Ga0501046_0084305 3300049580 Bacteria 2451
859 Ga0501046_0485179 3300049580 Bacteria 886
860 Ga0501047_0000455 3300049581 Bacteria 45200
861 Ga0501047_0004194 3300049581 Bacteria 13570
862 Ga0501047_0189989 3300049581 Bacteria 1917
863 Ga0501047_0253119 3300049581 Bacteria 1609
864 Ga0501047_0316763 3300049581 Bacteria 1400
865 Ga0501047_0343734 3300049581 Bacteria 1329
866 Ga0501047_0429194 3300049581 Bacteria 1152
867 Ga0501047_0504463 3300049581 Bacteria 1036
868 Ga0501047_0807331 3300049581 Bacteria 753
869 Ga0501047_0954825 3300049581 Bacteria 670
870 Ga0501048_0001113 3300049582 Bacteria 20168
871 Ga0501048_0074084 3300049582 Bacteria 2402
872 Ga0501048_0078673 3300049582 Bacteria 2327
873 Ga0501048_0328389 3300049582 Bacteria 1090
874 Ga0501048_1046248 3300049582 Bacteria 587
875 Ga0501067_0017220 3300049583 Bacteria 3994
876 Ga0501068_0014384 3300049584 Bacteria 4522
877 Ga0501068_0060046 3300049584 Bacteria 2308
878 Ga0501068_0111176 3300049584 Bacteria 1703
879 Ga0501068_0561863 3300049584 Bacteria 742
880 Ga0501068_0890866 3300049584 Bacteria 585
881 Ga0501069_0037404 3300049585 Bacteria 2678
882 Ga0501069_0061150 3300049585 Bacteria 2102
883 Ga0501069_0156637 3300049585 Bacteria 1310
884 Ga0501069_0166813 3300049585 Bacteria 1269
885 Ga0501069_0194151 3300049585 Bacteria 1175
886 Ga0501069_0421308 3300049585 Bacteria 791
887 Ga0501070_0003292 3300049586 Bacteria 14019
888 Ga0501070_0005448 3300049586 Bacteria 10863
889 Ga0501070_0017466 3300049586 Bacteria 6024
890 Ga0501070_0048170 3300049586 Bacteria 3540
891 Ga0501070_0052248 3300049586 Bacteria 3392
892 Ga0501070_0077534 3300049586 Bacteria 2750
893 Ga0501070_0085866 3300049586 Bacteria 2605
894 Ga0501070_0086430 3300049586 Bacteria 2596
895 Ga0501070_0167163 3300049586 Bacteria 1812
896 Ga0501070_0233512 3300049586 Bacteria 1507
897 Ga0501070_0305835 3300049586 Bacteria 1294
898 Ga0501070_0334427 3300049586 Bacteria 1230
899 Ga0501070_0335000 3300049586 Bacteria 1229
900 Ga0501070_0378459 3300049586 Bacteria 1147
901 Ga0501070_0488873 3300049586 Bacteria 989
902 Ga0501070_1199378 3300049586 Bacteria 582
903 Ga0501071_0026287 3300049587 Bacteria 4084
904 Ga0501071_0032614 3300049587 Bacteria 3700
905 Ga0501072_0042458 3300049588 Bacteria 3572
906 Ga0501072_0150085 3300049588 Bacteria 1858
907 Ga0501072_0163577 3300049588 Bacteria 1775
908 Ga0501072_0605319 3300049588 Unclassified 864
909 Ga0501072_1078776 3300049588 Unclassified 625
910 Ga0501073_0023747 3300049589 Bacteria 4402
911 Ga0501073_0142005 3300049589 Bacteria 1664
912 Ga0501073_0317161 3300049589 Bacteria 1075
913 Ga0501074_0006027 3300049590 Bacteria 8750
914 Ga0501074_0010081 3300049590 Bacteria 6860
915 Ga0501074_0090880 3300049590 Bacteria 2186
916 Ga0501074_0266623 3300049590 Bacteria 1217
917 Ga0501074_0501960 3300049590 Unclassified 859
918 Ga0501075_0090438 3300049591 Bacteria 2322
919 Ga0501075_0252633 3300049591 Bacteria 1344
920 Ga0501075_0312204 3300049591 Bacteria 1198
921 Ga0501076_0156240 3300049592 Bacteria 1857
922 Ga0501077_0131914 3300049593 Bacteria 1584
923 Ga0501077_0542348 3300049593 Bacteria 746
924 Ga0501079_0014949 3300049741 Bacteria 5916
925 Ga0501079_0039132 3300049741 Bacteria 3657
926 Ga0501079_0056857 3300049741 Bacteria 3019
927 Ga0501079_0728916 3300049741 Bacteria 780
928 Ga0501079_1676934 3300049741 Unclassified 500
929 Ga0501080_0005235 3300049742 Bacteria 11555
930 Ga0501080_0006633 3300049742 Bacteria 10411
931 Ga0501080_0023839 3300049742 Bacteria 5672
932 Ga0501080_0272356 3300049742 Bacteria 1541
933 Ga0501080_0577445 3300049742 Bacteria 999
934 Ga0501080_0684720 3300049742 Bacteria 905
935 Ga0501080_0765243 3300049742 Bacteria 848
936 Ga0501081_0204727 3300049743 Bacteria 1432
937 Ga0501081_0799210 3300049743 Bacteria 710
938 Ga0501083_0000437 3300049744 Bacteria 26753
939 Ga0501083_0056364 3300049744 Bacteria 2633
940 Ga0501083_0076461 3300049744 Bacteria 2222
941 Ga0501083_0120344 3300049744 Bacteria 1722
942 Ga0501083_0218872 3300049744 Bacteria 1241
943 Ga0501083_0231490 3300049744 Bacteria 1203
944 Ga0501083_0441481 3300049744 Bacteria 847
945 Ga0501035_0000837 3300049822 Bacteria 32871
946 Ga0501035_0046997 3300049822 Bacteria 3878
947 Ga0501035_0052690 3300049822 Bacteria 3640
948 Ga0501035_0063205 3300049822 Bacteria 3293
949 Ga0501035_0077206 3300049822 Bacteria 2943
950 Ga0501035_0177704 3300049822 Bacteria 1835
951 Ga0501035_0200239 3300049822 Bacteria 1713
952 Ga0501035_0230125 3300049822 Bacteria 1580
953 Ga0501035_0591901 3300049822 Bacteria 905
954 Ga0501035_1271270 3300049822 Unclassified 568
955 Ga0501044_0015432 3300049823 Bacteria 8227
956 Ga0501044_0015853 3300049823 Bacteria 8108
957 Ga0501044_0035180 3300049823 Bacteria 5246
958 Ga0501044_0058058 3300049823 Bacteria 3969
959 Ga0501044_0065969 3300049823 Bacteria 3691
960 Ga0501044_0085528 3300049823 Bacteria 3186
961 Ga0501044_0112301 3300049823 Bacteria 2732
962 Ga0501044_0281194 3300049823 Bacteria 1597
963 Ga0501044_0372002 3300049823 Bacteria 1345
964 Ga0501044_0475287 3300049823 Bacteria 1153
965 Ga0501044_0482396 3300049823 Bacteria 1143
966 Ga0501044_0899510 3300049823 Bacteria 760
967 Ga0501044_0958332 3300049823 Bacteria 728
968 Ga0501045_0130953 3300049824 Bacteria 1865
969 Ga0501045_0276003 3300049824 Bacteria 1251
970 nmdc:mga03683_306883_c1 3300050489 Bacteria 745
971 nmdc:mga03n38_364009_c1 3300050490 Bacteria 789
972 nmdc:mga00v17_326156_c1 3300050491 Bacteria 998
973 nmdc:mga06z11_11012_c1 3300050494 Bacteria 3880
974 nmdc:mga06z11_310787_c1 3300050494 Bacteria 939
975 nmdc:mga04h51_1452_c1 3300050495 Bacteria 5485
976 nmdc:mga07m45_342931_c1 3300050496 Bacteria 868
977 nmdc:mga07m45_452579_c1 3300050496 Bacteria 744
978 nmdc:mga05p37_306787_c1 3300050507 Bacteria 1883
979 nmdc:mga09592_1462109_c1 3300050508 Unclassified 557
980 nmdc:mga06r32_106007_c1 3300050510 Bacteria 2761
981 nmdc:mga06r32_1123471_c1 3300050510 Bacteria 734
982 nmdc:mga06r32_2052604_c1 3300050510 Unclassified 505
983 nmdc:mga06r32_545779_c1 3300050510 Bacteria 1133
984 nmdc:mga08y16_1045_c1 3300050511 Bacteria 27157
985 nmdc:mga08y16_11105_c1 3300050511 Bacteria 9458
986 nmdc:mga08y16_84627_c1 3300050511 Bacteria 3306
987 nmdc:mga0n895_1396109_c1 3300050512 Bacteria 669
988 nmdc:mga0n895_206826_c1 3300050512 Bacteria 1993
989 nmdc:mga0n895_239240_c1 3300050512 Unclassified 1842
990 nmdc:mga0n895_242719_c1 3300050512 Bacteria 1828
991 nmdc:mga0n895_6556_c1 3300050512 Bacteria 9906
992 nmdc:mga0n895_749056_c1 3300050512 Bacteria 970
993 nmdc:mga0n895_82905_c1 3300050512 Bacteria 3197
994 nmdc:mga0rr50_1209514_c1 3300050513 Bacteria 642
995 nmdc:mga0rr50_174817_c1 3300050513 Bacteria 1752
996 nmdc:mga0rr50_179658_c1 3300050513 Bacteria 1729
997 nmdc:mga08x19_3619_c1 3300050514 Bacteria 9202
998 nmdc:mga08x19_45947_c1 3300050514 Unclassified 2791
999 nmdc:mga0a205_1492_c1 3300050515 Bacteria 19963
1000 nmdc:mga0a205_30267_c1 3300050515 Bacteria 5182
1001 nmdc:mga0sz30_235576_c1 3300050516 Bacteria 815
1002 Ga0495601_0000003 3300053077 Bacteria 493642
1003 Ga0495601_0004661 3300053077 Bacteria 7935
1004 Ga0495601_0060828 3300053077 Bacteria 2397
1005 Ga0495612_0000007 3300053078 Bacteria 253300
1006 Ga0495612_0081412 3300053078 Bacteria 1361
1007 Ga0495595_0000018 3300053084 Bacteria 126874
1008 Ga0495595_0044171 3300053084 Bacteria 2046
1009 Ga0495595_0246404 3300053084 Bacteria 894
1010 Ga0495619_0000009 3300053085 Bacteria 305595
1011 Ga0495619_0141403 3300053085 Bacteria 1657
1012 Ga0495619_0184650 3300053085 Bacteria 1443
1013 Ga0500641_0007998 3300053096 Bacteria 3768
1014 Ga0500641_0057847 3300053096 Bacteria 1609
1015 Ga0500652_000080 3300053131 Bacteria 42009
1016 Ga0500636_0040041 3300053177 Bacteria 2772
1017 Ga0501084_0068797 3300054114 Bacteria 2964
1018 Ga0501084_0239755 3300054114 Bacteria 1531
1019 Ga0501084_0266357 3300054114 Bacteria 1447
1020 Ga0501084_1731539 3300054114 Bacteria 522
1021 Ga0587092_149011 3300059512 Bacteria 521
1022 Ga0501082_0105643 3300060353 Bacteria 2436
1023 Ga0501082_0146392 3300060353 Bacteria 2051
1024 Ga0501082_0334620 3300060353 Bacteria 1319
1025 Ga0501082_0351801 3300060353 Bacteria 1284
1026 Ga0501082_0428464 3300060353 Bacteria 1155
1027 Ga0466962_0031835 3300061719 Bacteria 2525
1028 Ga0530510_0147766 3300061734 Bacteria 1734
1029 Ga0530510_0806643 3300061734 Bacteria 716

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_11078352 Ga0105245_110783521 94
2 3300034820 Ga0373959_0074521 Ga0373959_0074521_448_762 96
3 3300042001 Ga0439441_172451 Ga0439441_172451_51_365 96
4 3300046528 Ga0495642_0289634 Ga0495642_0289634_389_703 96
5 3300046533 Ga0495640_0698415 Ga0495640_0698415_275_595 96
6 3300048927 Ga0496124_0594816 Ga0496124_0594816_289_645 97
7 3300048924 Ga0496121_0656819 Ga0496121_0656819_239_604 100
8 3300003771 Ga0055526_1030168 Ga0055526_10301682 103
9 3300006177 Ga0075362_10436132 Ga0075362_104361322 103
10 3300025295 Ga0209564_1002100 Ga0209564_10021006 103
11 3300005439 Ga0070711_102008838 Ga0070711_1020088381 104
12 3300005530 Ga0070679_101519029 Ga0070679_1015190292 104
13 3300025916 Ga0207663_10263165 Ga0207663_102631653 104
14 3300025917 Ga0207660_11187095 Ga0207660_111870952 104
15 3300031247 Ga0265340_10050420 Ga0265340_100504203 104
16 3300037466 Ga0395898_0119462 Ga0395898_0119462_882_1259 104
17 3300049571 Ga0501034_0071171 Ga0501034_0071171_2034_2411 104
18 3300049581 Ga0501047_0316763 Ga0501047_0316763_131_508 104
19 3300049744 Ga0501083_0218872 Ga0501083_0218872_695_1069 104
20 3300049822 Ga0501035_0230125 Ga0501035_0230125_1193_1570 104
21 3300053096 Ga0500641_0007998 Ga0500641_0007998_2121_2498 104
22 3300049741 Ga0501079_1676934 Ga0501079_1676934_86_454 106
23 3300048925 Ga0496122_0179782 Ga0496122_0179782_166_531 108
24 3300048926 Ga0496123_0028949 Ga0496123_0028949_3187_3552 108
25 3300048928 Ga0496125_0289770 Ga0496125_0289770_580_945 108
26 3300048929 Ga0496126_0652286 Ga0496126_0652286_287_652 108
27 3300005330 Ga0070690_100615176 Ga0070690_1006151762 109
28 3300005334 Ga0068869_100035044 Ga0068869_1000350442 109
29 3300005336 Ga0070680_100002329 Ga0070680_1000023292 109
30 3300005337 Ga0070682_100663111 Ga0070682_1006631111 109
31 3300005406 Ga0070703_10002446 Ga0070703_100024462 109
32 3300005438 Ga0070701_10024327 Ga0070701_100243272 109
33 3300005440 Ga0070705_100000096 Ga0070705_10000009647 109
34 3300005441 Ga0070700_100004184 Ga0070700_1000041842 109
35 3300005444 Ga0070694_100009315 Ga0070694_1000093152 109
36 3300005445 Ga0070708_100013438 Ga0070708_1000134382 109
37 3300005455 Ga0070663_100030853 Ga0070663_1000308532 109
38 3300005457 Ga0070662_100479210 Ga0070662_1004792102 109
39 3300005458 Ga0070681_10022561 Ga0070681_100225611 109
40 3300005459 Ga0068867_100775500 Ga0068867_1007755001 109
41 3300005467 Ga0070706_100069484 Ga0070706_1000694842 109
42 3300005471 Ga0070698_100076049 Ga0070698_1000760492 109
43 3300005518 Ga0070699_100000255 Ga0070699_10000025531 109
44 3300005530 Ga0070679_100031892 Ga0070679_1000318922 109
45 3300005536 Ga0070697_100015667 Ga0070697_1000156672 109
46 3300005545 Ga0070695_100000248 Ga0070695_10000024814 109
47 3300005546 Ga0070696_100000552 Ga0070696_1000005524 109
48 3300005547 Ga0070693_100009572 Ga0070693_1000095722 109
49 3300005549 Ga0070704_100044802 Ga0070704_1000448022 109
50 3300005564 Ga0070664_100397929 Ga0070664_1003979292 109
51 3300005577 Ga0068857_100010529 Ga0068857_1000105294 109
52 3300005578 Ga0068854_100932240 Ga0068854_1009322402 109
53 3300005615 Ga0070702_100127545 Ga0070702_1001275452 109
54 3300005617 Ga0068859_100026101 Ga0068859_1000261017 109
55 3300005719 Ga0068861_100118272 Ga0068861_1001182722 109
56 3300005841 Ga0068863_100056996 Ga0068863_1000569963 109
57 3300005843 Ga0068860_100004629 Ga0068860_10000462914 109
58 3300005844 Ga0068862_100003354 Ga0068862_1000033542 109
59 3300006931 Ga0097620_100026102 Ga0097620_1000261021 109
60 3300009553 Ga0105249_10003736 Ga0105249_100037369 109
61 3300011119 Ga0105246_10114945 Ga0105246_101149452 109
62 3300025885 Ga0207653_10002887 Ga0207653_100028871 109
63 3300025912 Ga0207707_10003030 Ga0207707_100030306 109
64 3300025917 Ga0207660_10030841 Ga0207660_100308412 109
65 3300025921 Ga0207652_10052780 Ga0207652_100527803 109
66 3300025933 Ga0207706_10107818 Ga0207706_101078182 109
67 3300025936 Ga0207670_10857592 Ga0207670_108575921 109
68 3300025938 Ga0207704_10220588 Ga0207704_102205882 109
69 3300025942 Ga0207689_10062365 Ga0207689_100623652 109
70 3300025961 Ga0207712_10002495 Ga0207712_100024952 109
71 3300025981 Ga0207640_10683863 Ga0207640_106838632 109
72 3300026041 Ga0207639_10661600 Ga0207639_106616002 109
73 3300026067 Ga0207678_10004143 Ga0207678_100041434 109
74 3300026075 Ga0207708_10004097 Ga0207708_100040977 109
75 3300026088 Ga0207641_10039915 Ga0207641_100399153 109
76 3300026095 Ga0207676_10145923 Ga0207676_101459232 109
77 3300026116 Ga0207674_10003652 Ga0207674_1000365212 109
78 3300026118 Ga0207675_100082231 Ga0207675_1000822312 109
79 3300028380 Ga0268265_10002707 Ga0268265_100027072 109
80 3300028381 Ga0268264_10086087 Ga0268264_100860872 109
81 3300035092 Ga0373952_0203300 Ga0373952_0203300_147_527 109
82 3300048904 Ga0496101_0181949 Ga0496101_0181949_438_818 109
83 3300048905 Ga0496102_0001085 Ga0496102_0001085_23520_23900 109
84 3300048909 Ga0496106_0004993 Ga0496106_0004993_7031_7411 109
85 3300048910 Ga0496107_0006647 Ga0496107_0006647_993_1373 109
86 3300048911 Ga0496108_0502321 Ga0496108_0502321_347_727 109
87 3300048912 Ga0496109_0784305 Ga0496109_0784305_66_446 109
88 3300005327 Ga0070658_10504520 Ga0070658_105045201 112
89 3300005334 Ga0068869_102041152 Ga0068869_1020411522 112
90 3300005339 Ga0070660_101957305 Ga0070660_1019573052 112
91 3300005344 Ga0070661_100454154 Ga0070661_1004541542 112
92 3300005344 Ga0070661_100551561 Ga0070661_1005515612 112
93 3300005354 Ga0070675_101151216 Ga0070675_1011512162 112
94 3300005455 Ga0070663_100107269 Ga0070663_1001072691 112
95 3300005457 Ga0070662_100815239 Ga0070662_1008152392 112
96 3300005564 Ga0070664_100011614 Ga0070664_1000116148 112
97 3300009098 Ga0105245_11279654 Ga0105245_112796542 112
98 3300009148 Ga0105243_11105948 Ga0105243_111059482 112
99 3300009174 Ga0105241_10642950 Ga0105241_106429502 112
100 3300009545 Ga0105237_10875312 Ga0105237_108753122 112
101 3300010375 Ga0105239_10163008 Ga0105239_101630082 112
102 3300010375 Ga0105239_10282303 Ga0105239_102823033 112
103 3300011119 Ga0105246_10309787 Ga0105246_103097872 112
104 3300013307 Ga0157372_11770094 Ga0157372_117700942 112
105 3300015261 Ga0182006_1105742 Ga0182006_11057422 112
106 3300020069 Ga0197907_10831634 Ga0197907_108316342 112
107 3300025911 Ga0207654_10654077 Ga0207654_106540772 112
108 3300025914 Ga0207671_11033306 Ga0207671_110333062 112
109 3300025920 Ga0207649_10629545 Ga0207649_106295451 112
110 3300025933 Ga0207706_10088083 Ga0207706_100880832 112
111 3300025933 Ga0207706_10606124 Ga0207706_106061242 112
112 3300025935 Ga0207709_10682084 Ga0207709_106820841 112
113 3300025942 Ga0207689_11612069 Ga0207689_116120692 112
114 3300025945 Ga0207679_10008732 Ga0207679_100087328 112
115 3300026067 Ga0207678_10139405 Ga0207678_101394052 112
116 3300031548 Ga0307408_100226002 Ga0307408_1002260022 112
117 3300031911 Ga0307412_10542996 Ga0307412_105429962 112
118 3300031911 Ga0307412_11539426 Ga0307412_115394262 112
119 3300031995 Ga0307409_100175231 Ga0307409_1001752312 112
120 3300032005 Ga0307411_10947454 Ga0307411_109474541 112
121 3300035115 Ga0373941_0000225 Ga0373941_0000225_3898_4260 112
122 3300035695 Ga0373927_0351808 Ga0373927_0351808_278_646 112
123 3300042157 Ga0439458_0070207 Ga0439458_0070207_500_862 112
124 3300042439 Ga0439464_0042609 Ga0439464_0042609_662_1024 112
125 3300044658 Ga0466972_0019709 Ga0466972_0019709_502_864 112
126 3300044658 Ga0466972_0033799 Ga0466972_0033799_1918_2280 112
127 3300044683 Ga0466965_0020059 Ga0466965_0020059_1142_1504 112
128 3300044683 Ga0466965_0024731 Ga0466965_0024731_2033_2395 112
129 3300044693 Ga0466961_0016205 Ga0466961_0016205_2901_3263 112
130 3300044706 Ga0466964_0017573 Ga0466964_0017573_1271_1633 112
131 3300044719 Ga0466971_0020441 Ga0466971_0020441_602_964 112
132 3300044765 Ga0466970_0009267 Ga0466970_0009267_2900_3262 112
133 3300044765 Ga0466970_0121027 Ga0466970_0121027_481_843 112
134 3300044842 Ga0466957_0011379 Ga0466957_0011379_2767_3129 112
135 3300044901 Ga0466960_0077820 Ga0466960_0077820_151_513 112
136 3300044901 Ga0466960_0831607 Ga0466960_0831607_111_473 112
137 3300045836 Ga0466958_0036691 Ga0466958_0036691_1291_1653 112
138 3300045976 Ga0466967_0025379 Ga0466967_0025379_2277_2639 112
139 3300045976 Ga0466967_0119885 Ga0466967_0119885_2043_2405 112
140 3300045976 Ga0466967_0627373 Ga0466967_0627373_454_816 112
141 3300049568 Ga0501031_0008966 Ga0501031_0008966_5007_5369 112
142 3300049568 Ga0501031_0048550 Ga0501031_0048550_2371_2733 112
143 3300049569 Ga0501032_0032190 Ga0501032_0032190_2748_3110 112
144 3300049569 Ga0501032_0053337 Ga0501032_0053337_562_924 112
145 3300049569 Ga0501032_0122015 Ga0501032_0122015_930_1292 112
146 3300049569 Ga0501032_0339287 Ga0501032_0339287_406_768 112
147 3300049570 Ga0501033_0153285 Ga0501033_0153285_692_1054 112
148 3300049570 Ga0501033_0158723 Ga0501033_0158723_1062_1424 112
149 3300049570 Ga0501033_0804144 Ga0501033_0804144_20_382 112
150 3300049571 Ga0501034_0000616 Ga0501034_0000616_43305_43667 112
151 3300049571 Ga0501034_0000850 Ga0501034_0000850_15842_16204 112
152 3300049571 Ga0501034_0016718 Ga0501034_0016718_2077_2439 112
153 3300049571 Ga0501034_0023602 Ga0501034_0023602_5801_6163 112
154 3300049571 Ga0501034_0076450 Ga0501034_0076450_2142_2504 112
155 3300049571 Ga0501034_0118117 Ga0501034_0118117_1349_1711 112
156 3300049571 Ga0501034_0420067 Ga0501034_0420067_542_904 112
157 3300049571 Ga0501034_1042437 Ga0501034_1042437_134_496 112
158 3300049571 Ga0501034_1064263 Ga0501034_1064263_53_415 112
159 3300049572 Ga0501036_0000547 Ga0501036_0000547_25764_26126 112
160 3300049572 Ga0501036_0065268 Ga0501036_0065268_1078_1440 112
161 3300049572 Ga0501036_0073228 Ga0501036_0073228_452_814 112
162 3300049572 Ga0501036_0352825 Ga0501036_0352825_232_594 112
163 3300049572 Ga0501036_0796033 Ga0501036_0796033_216_578 112
164 3300049573 Ga0501037_0001864 Ga0501037_0001864_14545_14907 112
165 3300049573 Ga0501037_0055103 Ga0501037_0055103_832_1194 112
166 3300049573 Ga0501037_0079089 Ga0501037_0079089_636_998 112
167 3300049573 Ga0501037_0131522 Ga0501037_0131522_488_850 112
168 3300049573 Ga0501037_0656609 Ga0501037_0656609_205_567 112
169 3300049574 Ga0501038_0011775 Ga0501038_0011775_4981_5343 112
170 3300049574 Ga0501038_0093671 Ga0501038_0093671_439_801 112
171 3300049574 Ga0501038_0352777 Ga0501038_0352777_439_801 112
172 3300049574 Ga0501038_0544194 Ga0501038_0544194_66_428 112
173 3300049575 Ga0501039_0009820 Ga0501039_0009820_2790_3152 112
174 3300049575 Ga0501039_0054526 Ga0501039_0054526_964_1326 112
175 3300049576 Ga0501040_0082795 Ga0501040_0082795_1051_1413 112
176 3300049579 Ga0501043_0001850 Ga0501043_0001850_6556_6918 112
177 3300049579 Ga0501043_0012323 Ga0501043_0012323_2891_3253 112
178 3300049579 Ga0501043_0065891 Ga0501043_0065891_2053_2415 112
179 3300049579 Ga0501043_0117907 Ga0501043_0117907_1707_2069 112
180 3300049579 Ga0501043_0169344 Ga0501043_0169344_1208_1570 112
181 3300049580 Ga0501046_0011532 Ga0501046_0011532_586_948 112
182 3300049580 Ga0501046_0049782 Ga0501046_0049782_1155_1517 112
183 3300049580 Ga0501046_0084305 Ga0501046_0084305_1097_1459 112
184 3300049580 Ga0501046_0485179 Ga0501046_0485179_414_776 112
185 3300049581 Ga0501047_0000455 Ga0501047_0000455_29020_29382 112
186 3300049581 Ga0501047_0189989 Ga0501047_0189989_437_799 112
187 3300049581 Ga0501047_0253119 Ga0501047_0253119_790_1152 112
188 3300049581 Ga0501047_0429194 Ga0501047_0429194_658_1020 112
189 3300049581 Ga0501047_0807331 Ga0501047_0807331_221_583 112
190 3300049581 Ga0501047_0954825 Ga0501047_0954825_182_544 112
191 3300049582 Ga0501048_0001113 Ga0501048_0001113_15792_16154 112
192 3300049582 Ga0501048_0074084 Ga0501048_0074084_886_1248 112
193 3300049582 Ga0501048_0078673 Ga0501048_0078673_1092_1454 112
194 3300049583 Ga0501067_0017220 Ga0501067_0017220_1261_1623 112
195 3300049584 Ga0501068_0014384 Ga0501068_0014384_684_1046 112
196 3300049584 Ga0501068_0060046 Ga0501068_0060046_1207_1569 112
197 3300049584 Ga0501068_0111176 Ga0501068_0111176_201_563 112
198 3300049585 Ga0501069_0037404 Ga0501069_0037404_722_1084 112
199 3300049585 Ga0501069_0061150 Ga0501069_0061150_929_1291 112
200 3300049585 Ga0501069_0156637 Ga0501069_0156637_114_476 112
201 3300049585 Ga0501069_0166813 Ga0501069_0166813_730_1092 112
202 3300049585 Ga0501069_0421308 Ga0501069_0421308_345_707 112
203 3300049586 Ga0501070_0003292 Ga0501070_0003292_839_1201 112
204 3300049586 Ga0501070_0005448 Ga0501070_0005448_6796_7158 112
205 3300049586 Ga0501070_0017466 Ga0501070_0017466_1923_2285 112
206 3300049586 Ga0501070_0048170 Ga0501070_0048170_2089_2451 112
207 3300049586 Ga0501070_0052248 Ga0501070_0052248_1376_1738 112
208 3300049586 Ga0501070_0077534 Ga0501070_0077534_2078_2440 112
209 3300049586 Ga0501070_0085866 Ga0501070_0085866_2080_2442 112
210 3300049586 Ga0501070_0233512 Ga0501070_0233512_1102_1464 112
211 3300049586 Ga0501070_0305835 Ga0501070_0305835_765_1127 112
212 3300049586 Ga0501070_0334427 Ga0501070_0334427_608_970 112
213 3300049586 Ga0501070_0378459 Ga0501070_0378459_47_409 112
214 3300049586 Ga0501070_0488873 Ga0501070_0488873_608_970 112
215 3300049586 Ga0501070_1199378 Ga0501070_1199378_193_555 112
216 3300049587 Ga0501071_0026287 Ga0501071_0026287_915_1277 112
217 3300049588 Ga0501072_0042458 Ga0501072_0042458_563_925 112
218 3300049588 Ga0501072_1078776 Ga0501072_1078776_13_375 112
219 3300049589 Ga0501073_0023747 Ga0501073_0023747_2960_3322 112
220 3300049589 Ga0501073_0142005 Ga0501073_0142005_966_1328 112
221 3300049589 Ga0501073_0317161 Ga0501073_0317161_106_468 112
222 3300049590 Ga0501074_0006027 Ga0501074_0006027_7292_7654 112
223 3300049590 Ga0501074_0010081 Ga0501074_0010081_205_567 112
224 3300049590 Ga0501074_0090880 Ga0501074_0090880_493_855 112
225 3300049590 Ga0501074_0501960 Ga0501074_0501960_356_718 112
226 3300049593 Ga0501077_0542348 Ga0501077_0542348_290_652 112
227 3300049741 Ga0501079_0014949 Ga0501079_0014949_4094_4456 112
228 3300049742 Ga0501080_0005235 Ga0501080_0005235_2302_2664 112
229 3300049742 Ga0501080_0006633 Ga0501080_0006633_6190_6552 112
230 3300049742 Ga0501080_0023839 Ga0501080_0023839_2897_3259 112
231 3300049742 Ga0501080_0272356 Ga0501080_0272356_285_647 112
232 3300049742 Ga0501080_0577445 Ga0501080_0577445_201_563 112
233 3300049742 Ga0501080_0684720 Ga0501080_0684720_297_659 112
234 3300049742 Ga0501080_0765243 Ga0501080_0765243_282_644 112
235 3300049743 Ga0501081_0799210 Ga0501081_0799210_321_683 112
236 3300049744 Ga0501083_0000437 Ga0501083_0000437_10523_10885 112
237 3300049744 Ga0501083_0056364 Ga0501083_0056364_580_942 112
238 3300049744 Ga0501083_0231490 Ga0501083_0231490_569_931 112
239 3300049744 Ga0501083_0441481 Ga0501083_0441481_60_422 112
240 3300049822 Ga0501035_0000837 Ga0501035_0000837_31708_32070 112
241 3300049822 Ga0501035_0046997 Ga0501035_0046997_1075_1437 112
242 3300049822 Ga0501035_0052690 Ga0501035_0052690_1808_2170 112
243 3300049822 Ga0501035_0077206 Ga0501035_0077206_969_1331 112
244 3300049822 Ga0501035_0177704 Ga0501035_0177704_656_1018 112
245 3300049822 Ga0501035_0200239 Ga0501035_0200239_410_772 112
246 3300049822 Ga0501035_0591901 Ga0501035_0591901_233_595 112
247 3300049823 Ga0501044_0015853 Ga0501044_0015853_5462_5824 112
248 3300049823 Ga0501044_0035180 Ga0501044_0035180_3795_4157 112
249 3300049823 Ga0501044_0065969 Ga0501044_0065969_1785_2147 112
250 3300049823 Ga0501044_0085528 Ga0501044_0085528_962_1324 112
251 3300049823 Ga0501044_0281194 Ga0501044_0281194_89_451 112
252 3300049823 Ga0501044_0372002 Ga0501044_0372002_304_666 112
253 3300049823 Ga0501044_0475287 Ga0501044_0475287_608_970 112
254 3300049823 Ga0501044_0482396 Ga0501044_0482396_565_927 112
255 3300049823 Ga0501044_0899510 Ga0501044_0899510_282_644 112
256 3300049824 Ga0501045_0130953 Ga0501045_0130953_1405_1767 112
257 3300049824 Ga0501045_0276003 Ga0501045_0276003_450_812 112
258 3300050496 nmdc:mga07m45_452579_c1 nmdc:mga07m45_452579_c1_85_447 112
259 3300053096 Ga0500641_0057847 Ga0500641_0057847_1017_1379 112
260 3300054114 Ga0501084_0266357 Ga0501084_0266357_798_1160 112
261 3300054114 Ga0501084_1731539 Ga0501084_1731539_14_376 112
262 3300059512 Ga0587092_149011 Ga0587092_149011_36_398 112
263 3300060353 Ga0501082_0105643 Ga0501082_0105643_1762_2124 112
264 3300060353 Ga0501082_0334620 Ga0501082_0334620_391_753 112
265 3300060353 Ga0501082_0351801 Ga0501082_0351801_102_464 112
266 3300061719 Ga0466962_0031835 Ga0466962_0031835_672_1034 112
267 3300005563 Ga0068855_102295069 Ga0068855_1022950691 113
268 3300006048 Ga0075363_100115462 Ga0075363_1001154622 113
269 3300006048 Ga0075363_100519829 Ga0075363_1005198292 113
270 3300006177 Ga0075362_10188980 Ga0075362_101889802 113
271 3300006186 Ga0075369_10139621 Ga0075369_101396213 113
272 3300009147 Ga0114129_10905858 Ga0114129_109058582 113
273 3300027866 Ga0209813_10001957 Ga0209813_100019571 113
274 3300049569 Ga0501032_0633903 Ga0501032_0633903_96_503 113
275 3300049570 Ga0501033_0127784 Ga0501033_0127784_1082_1450 113
276 3300049571 Ga0501034_0427856 Ga0501034_0427856_703_1071 113
277 3300049573 Ga0501037_0199016 Ga0501037_0199016_605_973 113
278 3300049574 Ga0501038_0167015 Ga0501038_0167015_702_1070 113
279 3300049579 Ga0501043_0118826 Ga0501043_0118826_43_411 113
280 3300049580 Ga0501046_0076847 Ga0501046_0076847_358_726 113
281 3300049581 Ga0501047_0004194 Ga0501047_0004194_4067_4435 113
282 3300049582 Ga0501048_0328389 Ga0501048_0328389_422_790 113
283 3300049586 Ga0501070_0167163 Ga0501070_0167163_862_1230 113
284 3300049587 Ga0501071_0032614 Ga0501071_0032614_2061_2426 113
285 3300049588 Ga0501072_0150085 Ga0501072_0150085_1179_1544 113
286 3300049590 Ga0501074_0266623 Ga0501074_0266623_366_731 113
287 3300049591 Ga0501075_0090438 Ga0501075_0090438_1010_1375 113
288 3300049741 Ga0501079_0056857 Ga0501079_0056857_1179_1544 113
289 3300049823 Ga0501044_0015432 Ga0501044_0015432_6334_6702 113
290 3300049823 Ga0501044_0112301 Ga0501044_0112301_1042_1410 113
291 3300050489 nmdc:mga03683_306883_c1 nmdc:mga03683_306883_c1_76_441 113
292 3300050490 nmdc:mga03n38_364009_c1 nmdc:mga03n38_364009_c1_174_539 113
293 3300050491 nmdc:mga00v17_326156_c1 nmdc:mga00v17_326156_c1_211_576 113
294 3300050494 nmdc:mga06z11_310787_c1 nmdc:mga06z11_310787_c1_227_592 113
295 3300050495 nmdc:mga04h51_1452_c1 nmdc:mga04h51_1452_c1_55_420 113
296 3300050516 nmdc:mga0sz30_235576_c1 nmdc:mga0sz30_235576_c1_83_448 113
297 3300060353 Ga0501082_0146392 Ga0501082_0146392_925_1290 113
298 2209111006 2214745210 2213754785 114
299 3300000041 ARcpr5oldR_c000144 ARcpr5oldR_0001444 114
300 3300000042 ARSoilYngRDRAFT_c00009 ARSoilYngRDRAFT_0000914 114
301 3300000043 ARcpr5yngRDRAFT_c000006 ARcpr5yngRDRAFT_00000614 114
302 3300000044 ARSoilOldRDRAFT_c000102 ARSoilOldRDRAFT_00010214 114
303 3300000045 ARCol0oldRDRAFT_c01043 ARCol0oldRDRAFT_010432 114
304 3300000652 ARCol0yngRDRAFT_1000092 ARCol0yngRDRAFT_100009214 114
305 3300001430 JGI24032J14994_100041 JGI24032J14994_1000413 114
306 3300001904 JGI24736J21556_1064614 JGI24736J21556_10646142 114
307 3300001976 JGI24752J21851_1042901 JGI24752J21851_10429012 114
308 3300001977 JGI24746J21847_1001712 JGI24746J21847_10017123 114
309 3300001979 JGI24740J21852_10011798 JGI24740J21852_100117983 114
310 3300001989 JGI24739J22299_10000092 JGI24739J22299_1000009230 114
311 3300001990 JGI24737J22298_10003955 JGI24737J22298_100039554 114
312 3300001990 JGI24737J22298_10008311 JGI24737J22298_100083114 114
313 3300001991 JGI24743J22301_10030239 JGI24743J22301_100302392 114
314 3300002070 JGI24750J21931_1000128 JGI24750J21931_10001284 114
315 3300002073 JGI24745J21846_1000110 JGI24745J21846_10001105 114
316 3300002074 JGI24748J21848_1000158 JGI24748J21848_10001584 114
317 3300002075 JGI24738J21930_10000010 JGI24738J21930_1000001011 114
318 3300002076 JGI24749J21850_1001926 JGI24749J21850_10019262 114
319 3300002076 JGI24749J21850_1018182 JGI24749J21850_10181822 114
320 3300002077 JGI24744J21845_10000683 JGI24744J21845_100006835 114
321 3300002077 JGI24744J21845_10110869 JGI24744J21845_101108692 114
322 3300002126 JGI24035J26624_1000002 JGI24035J26624_10000024 114
323 3300002155 JGI24033J26618_1002588 JGI24033J26618_10025882 114
324 3300002239 JGI24034J26672_10000201 JGI24034J26672_100002013 114
325 3300002244 JGI24742J22300_10000765 JGI24742J22300_100007653 114
326 3300002459 JGI24751J29686_10021731 JGI24751J29686_100217312 114
327 3300003349 JGI26129J50193_1007527 JGI26129J50193_10075271 114
328 3300003349 JGI26129J50193_1015647 JGI26129J50193_10156472 114
329 3300003383 JGI26140J50224_101872 JGI26140J50224_1018722 114
330 3300003911 JGI25405J52794_10006144 JGI25405J52794_100061443 114
331 3300005276 Ga0065717_1003867 Ga0065717_10038672 114
332 3300005277 Ga0065716_1002550 Ga0065716_10025502 114
333 3300005289 Ga0065704_10094385 Ga0065704_100943851 114
334 3300005290 Ga0065712_10000899 Ga0065712_100008999 114
335 3300005290 Ga0065712_10068648 Ga0065712_1006864811 114
336 3300005293 Ga0065715_10000752 Ga0065715_100007524 114
337 3300005293 Ga0065715_10089173 Ga0065715_1008917311 114
338 3300005293 Ga0065715_10165183 Ga0065715_101651833 114
339 3300005328 Ga0070676_10000978 Ga0070676_1000097811 114
340 3300005328 Ga0070676_10241875 Ga0070676_102418753 114
341 3300005329 Ga0070683_100001029 Ga0070683_1000010294 114
342 3300005329 Ga0070683_100114195 Ga0070683_1001141952 114
343 3300005329 Ga0070683_101456400 Ga0070683_1014564001 114
344 3300005330 Ga0070690_100001038 Ga0070690_10000103813 114
345 3300005331 Ga0070670_100026956 Ga0070670_1000269564 114
346 3300005331 Ga0070670_100398935 Ga0070670_1003989352 114
347 3300005333 Ga0070677_10000126 Ga0070677_100001264 114
348 3300005333 Ga0070677_10285506 Ga0070677_102855062 114
349 3300005334 Ga0068869_100000079 Ga0068869_1000000794 114
350 3300005335 Ga0070666_10019358 Ga0070666_100193583 114
351 3300005335 Ga0070666_10250122 Ga0070666_102501222 114
352 3300005336 Ga0070680_100007030 Ga0070680_1000070304 114
353 3300005336 Ga0070680_100129426 Ga0070680_1001294262 114
354 3300005337 Ga0070682_100000641 Ga0070682_10000064114 114
355 3300005338 Ga0068868_100002114 Ga0068868_1000021147 114
356 3300005339 Ga0070660_100002411 Ga0070660_1000024115 114
357 3300005339 Ga0070660_100019320 Ga0070660_1000193204 114
358 3300005340 Ga0070689_100003727 Ga0070689_1000037274 114
359 3300005340 Ga0070689_100021372 Ga0070689_1000213724 114
360 3300005341 Ga0070691_10000161 Ga0070691_100001615 114
361 3300005341 Ga0070691_10033380 Ga0070691_100333804 114
362 3300005343 Ga0070687_100000085 Ga0070687_10000008519 114
363 3300005343 Ga0070687_100013028 Ga0070687_1000130282 114
364 3300005343 Ga0070687_100760099 Ga0070687_1007600992 114
365 3300005343 Ga0070687_100917709 Ga0070687_1009177092 114
366 3300005344 Ga0070661_100000307 Ga0070661_10000030729 114
367 3300005344 Ga0070661_100855173 Ga0070661_1008551732 114
368 3300005345 Ga0070692_10001915 Ga0070692_100019156 114
369 3300005345 Ga0070692_10048702 Ga0070692_100487021 114
370 3300005347 Ga0070668_100009110 Ga0070668_1000091105 114
371 3300005347 Ga0070668_100039131 Ga0070668_1000391313 114
372 3300005347 Ga0070668_102210166 Ga0070668_1022101661 114
373 3300005353 Ga0070669_100000571 Ga0070669_10000057111 114
374 3300005353 Ga0070669_100037439 Ga0070669_1000374393 114
375 3300005354 Ga0070675_100014189 Ga0070675_1000141895 114
376 3300005354 Ga0070675_100075720 Ga0070675_1000757203 114
377 3300005355 Ga0070671_100000104 Ga0070671_10000010451 114
378 3300005356 Ga0070674_100000238 Ga0070674_10000023811 114
379 3300005356 Ga0070674_100057646 Ga0070674_1000576463 114
380 3300005364 Ga0070673_100000152 Ga0070673_10000015221 114
381 3300005364 Ga0070673_101435931 Ga0070673_1014359311 114
382 3300005365 Ga0070688_100001552 Ga0070688_1000015524 114
383 3300005365 Ga0070688_100010437 Ga0070688_1000104374 114
384 3300005365 Ga0070688_100185664 Ga0070688_1001856642 114
385 3300005366 Ga0070659_100000551 Ga0070659_10000055111 114
386 3300005366 Ga0070659_100014072 Ga0070659_1000140724 114
387 3300005367 Ga0070667_100002365 Ga0070667_1000023653 114
388 3300005367 Ga0070667_100082240 Ga0070667_1000822403 114
389 3300005367 Ga0070667_100126878 Ga0070667_1001268783 114
390 3300005406 Ga0070703_10008783 Ga0070703_100087833 114
391 3300005406 Ga0070703_10277971 Ga0070703_102779711 114
392 3300005435 Ga0070714_100382247 Ga0070714_1003822471 114
393 3300005435 Ga0070714_100521871 Ga0070714_1005218711 114
394 3300005437 Ga0070710_10903011 Ga0070710_109030112 114
395 3300005438 Ga0070701_10000674 Ga0070701_1000067410 114
396 3300005438 Ga0070701_10027601 Ga0070701_100276012 114
397 3300005439 Ga0070711_100898965 Ga0070711_1008989652 114
398 3300005440 Ga0070705_100000148 Ga0070705_10000014810 114
399 3300005440 Ga0070705_100039756 Ga0070705_1000397564 114
400 3300005441 Ga0070700_100000277 Ga0070700_10000027722 114
401 3300005441 Ga0070700_100071695 Ga0070700_1000716952 114
402 3300005441 Ga0070700_101978793 Ga0070700_1019787931 114
403 3300005444 Ga0070694_100025210 Ga0070694_1000252103 114
404 3300005444 Ga0070694_100028101 Ga0070694_1000281015 114
405 3300005445 Ga0070708_100080131 Ga0070708_1000801313 114
406 3300005455 Ga0070663_100000522 Ga0070663_1000005225 114
407 3300005455 Ga0070663_101465575 Ga0070663_1014655751 114
408 3300005456 Ga0070678_100000718 Ga0070678_10000071814 114
409 3300005456 Ga0070678_102109210 Ga0070678_1021092101 114
410 3300005457 Ga0070662_100019850 Ga0070662_1000198504 114
411 3300005457 Ga0070662_100078008 Ga0070662_1000780083 114
412 3300005458 Ga0070681_10003456 Ga0070681_100034564 114
413 3300005458 Ga0070681_10064843 Ga0070681_100648432 114
414 3300005458 Ga0070681_10141932 Ga0070681_101419322 114
415 3300005458 Ga0070681_11854580 Ga0070681_118545801 114
416 3300005459 Ga0068867_100004407 Ga0068867_10000440710 114
417 3300005459 Ga0068867_100017974 Ga0068867_1000179744 114
418 3300005466 Ga0070685_10012102 Ga0070685_100121024 114
419 3300005507 Ga0074259_11111610 Ga0074259_111116102 114
420 3300005518 Ga0070699_101296327 Ga0070699_1012963271 114
421 3300005530 Ga0070679_100031781 Ga0070679_1000317813 114
422 3300005530 Ga0070679_100033806 Ga0070679_1000338064 114
423 3300005530 Ga0070679_100133048 Ga0070679_1001330482 114
424 3300005535 Ga0070684_100000894 Ga0070684_1000008945 114
425 3300005535 Ga0070684_100310980 Ga0070684_1003109802 114
426 3300005535 Ga0070684_100925204 Ga0070684_1009252042 114
427 3300005536 Ga0070697_100390178 Ga0070697_1003901782 114
428 3300005536 Ga0070697_100659297 Ga0070697_1006592972 114
429 3300005539 Ga0068853_100002891 Ga0068853_10000289112 114
430 3300005539 Ga0068853_100259619 Ga0068853_1002596192 114
431 3300005543 Ga0070672_100000088 Ga0070672_10000008843 114
432 3300005543 Ga0070672_100091389 Ga0070672_1000913892 114
433 3300005543 Ga0070672_100573416 Ga0070672_1005734161 114
434 3300005544 Ga0070686_100000719 Ga0070686_10000071910 114
435 3300005544 Ga0070686_100032503 Ga0070686_1000325034 114
436 3300005545 Ga0070695_100001789 Ga0070695_1000017895 114
437 3300005545 Ga0070695_100027104 Ga0070695_1000271043 114
438 3300005546 Ga0070696_100013552 Ga0070696_1000135524 114
439 3300005546 Ga0070696_100020079 Ga0070696_1000200795 114
440 3300005546 Ga0070696_100421267 Ga0070696_1004212672 114
441 3300005547 Ga0070693_100000134 Ga0070693_10000013418 114
442 3300005548 Ga0070665_100050659 Ga0070665_1000506592 114
443 3300005549 Ga0070704_100000026 Ga0070704_1000000264 114
444 3300005549 Ga0070704_100011965 Ga0070704_1000119654 114
445 3300005549 Ga0070704_100309229 Ga0070704_1003092292 114
446 3300005549 Ga0070704_100607338 Ga0070704_1006073382 114
447 3300005563 Ga0068855_100006834 Ga0068855_10000683411 114
448 3300005563 Ga0068855_102355802 Ga0068855_1023558022 114
449 3300005564 Ga0070664_100002234 Ga0070664_1000022345 114
450 3300005564 Ga0070664_100179423 Ga0070664_1001794233 114
451 3300005577 Ga0068857_100002935 Ga0068857_1000029355 114
452 3300005578 Ga0068854_100000546 Ga0068854_1000005466 114
453 3300005614 Ga0068856_100002000 Ga0068856_10000200012 114
454 3300005614 Ga0068856_100541781 Ga0068856_1005417812 114
455 3300005615 Ga0070702_100000245 Ga0070702_10000024522 114
456 3300005616 Ga0068852_100008609 Ga0068852_1000086095 114
457 3300005616 Ga0068852_100091269 Ga0068852_1000912693 114
458 3300005616 Ga0068852_101149115 Ga0068852_1011491152 114
459 3300005616 Ga0068852_101348714 Ga0068852_1013487141 114
460 3300005616 Ga0068852_101580847 Ga0068852_1015808472 114
461 3300005617 Ga0068859_100006734 Ga0068859_10000673411 114
462 3300005617 Ga0068859_100041857 Ga0068859_1000418574 114
463 3300005618 Ga0068864_100000890 Ga0068864_1000008904 114
464 3300005618 Ga0068864_100277961 Ga0068864_1002779612 114
465 3300005718 Ga0068866_10000221 Ga0068866_100002214 114
466 3300005719 Ga0068861_100011785 Ga0068861_1000117854 114
467 3300005719 Ga0068861_100018274 Ga0068861_1000182744 114
468 3300005840 Ga0068870_10003727 Ga0068870_100037274 114
469 3300005840 Ga0068870_10844419 Ga0068870_108444191 114
470 3300005841 Ga0068863_100000340 Ga0068863_10000034010 114
471 3300005841 Ga0068863_100431802 Ga0068863_1004318022 114
472 3300005842 Ga0068858_100000295 Ga0068858_10000029553 114
473 3300005842 Ga0068858_100102941 Ga0068858_1001029412 114
474 3300005842 Ga0068858_100150676 Ga0068858_1001506763 114
475 3300005843 Ga0068860_100001285 Ga0068860_10000128521 114
476 3300005843 Ga0068860_100158254 Ga0068860_1001582544 114
477 3300005843 Ga0068860_102061263 Ga0068860_1020612631 114
478 3300005844 Ga0068862_100003236 Ga0068862_1000032365 114
479 3300005844 Ga0068862_100063398 Ga0068862_1000633984 114
480 3300005937 Ga0081455_10000007 Ga0081455_10000007222 114
481 3300006028 Ga0070717_10037964 Ga0070717_100379642 114
482 3300006028 Ga0070717_10127591 Ga0070717_101275912 114
483 3300006038 Ga0075365_10358614 Ga0075365_103586142 114
484 3300006058 Ga0075432_10027241 Ga0075432_100272413 114
485 3300006163 Ga0070715_10325721 Ga0070715_103257212 114
486 3300006173 Ga0070716_100357488 Ga0070716_1003574882 114
487 3300006175 Ga0070712_100000052 Ga0070712_10000005216 114
488 3300006175 Ga0070712_100377819 Ga0070712_1003778192 114
489 3300006175 Ga0070712_100908656 Ga0070712_1009086562 114
490 3300006178 Ga0075367_10011053 Ga0075367_100110536 114
491 3300006178 Ga0075367_10394533 Ga0075367_103945332 114
492 3300006237 Ga0097621_100000040 Ga0097621_10000004058 114
493 3300006353 Ga0075370_10374773 Ga0075370_103747732 114
494 3300006358 Ga0068871_100000301 Ga0068871_1000003015 114
495 3300006847 Ga0075431_100199738 Ga0075431_1001997383 114
496 3300006847 Ga0075431_100269493 Ga0075431_1002694932 114
497 3300006847 Ga0075431_101914954 Ga0075431_1019149542 114
498 3300006852 Ga0075433_10016057 Ga0075433_100160574 114
499 3300006852 Ga0075433_10067742 Ga0075433_100677423 114
500 3300006871 Ga0075434_100002477 Ga0075434_10000247721 114
501 3300006871 Ga0075434_100249805 Ga0075434_1002498052 114
502 3300006871 Ga0075434_100441171 Ga0075434_1004411712 114
503 3300006881 Ga0068865_100000275 Ga0068865_10000027518 114
504 3300006914 Ga0075436_100005032 Ga0075436_1000050322 114
505 3300006914 Ga0075436_100042636 Ga0075436_1000426362 114
506 3300006931 Ga0097620_100006734 Ga0097620_10000673411 114
507 3300006931 Ga0097620_100041858 Ga0097620_1000418584 114
508 3300007076 Ga0075435_100096492 Ga0075435_1000964922 114
509 3300007076 Ga0075435_100250148 Ga0075435_1002501481 114
510 3300007076 Ga0075435_101291276 Ga0075435_1012912762 114
511 3300007788 Ga0099795_10012252 Ga0099795_100122522 114
512 3300009011 Ga0105251_10052992 Ga0105251_100529923 114
513 3300009092 Ga0105250_10011042 Ga0105250_100110422 114
514 3300009092 Ga0105250_10192936 Ga0105250_101929362 114
515 3300009093 Ga0105240_10212812 Ga0105240_102128124 114
516 3300009093 Ga0105240_10367463 Ga0105240_103674633 114
517 3300009094 Ga0111539_10000394 Ga0111539_1000039448 114
518 3300009094 Ga0111539_10003483 Ga0111539_1000348322 114
519 3300009094 Ga0111539_10043754 Ga0111539_100437544 114
520 3300009098 Ga0105245_10000462 Ga0105245_1000046215 114
521 3300009101 Ga0105247_10000442 Ga0105247_100004426 114
522 3300009101 Ga0105247_10171228 Ga0105247_101712283 114
523 3300009147 Ga0114129_10178784 Ga0114129_101787843 114
524 3300009148 Ga0105243_10000282 Ga0105243_1000028252 114
525 3300009148 Ga0105243_10031294 Ga0105243_100312944 114
526 3300009148 Ga0105243_10398541 Ga0105243_103985412 114
527 3300009174 Ga0105241_10000652 Ga0105241_1000065214 114
528 3300009174 Ga0105241_10151582 Ga0105241_101515823 114
529 3300009176 Ga0105242_10001726 Ga0105242_1000172621 114
530 3300009177 Ga0105248_10010575 Ga0105248_100105754 114
531 3300009177 Ga0105248_10023284 Ga0105248_100232843 114
532 3300009177 Ga0105248_10388826 Ga0105248_103888262 114
533 3300009545 Ga0105237_10008154 Ga0105237_100081544 114
534 3300009551 Ga0105238_10106046 Ga0105238_101060464 114
535 3300009551 Ga0105238_12073122 Ga0105238_120731221 114
536 3300009553 Ga0105249_10001210 Ga0105249_1000121015 114
537 3300009553 Ga0105249_10010878 Ga0105249_100108783 114
538 3300009553 Ga0105249_10399550 Ga0105249_103995502 114
539 3300010159 Ga0099796_10006469 Ga0099796_100064694 114
540 3300010375 Ga0105239_10006303 Ga0105239_100063034 114
541 3300010375 Ga0105239_10258581 Ga0105239_102585812 114
542 3300010375 Ga0105239_12355476 Ga0105239_123554762 114
543 3300011119 Ga0105246_10000312 Ga0105246_100003124 114
544 3300011119 Ga0105246_10078510 Ga0105246_100785102 114
545 3300012476 Ga0157344_1002004 Ga0157344_10020042 114
546 3300012478 Ga0157328_1013142 Ga0157328_10131422 114
547 3300012485 Ga0157325_1002945 Ga0157325_10029452 114
548 3300012488 Ga0157343_1003240 Ga0157343_10032402 114
549 3300012491 Ga0157329_1010294 Ga0157329_10102942 114
550 3300012494 Ga0157341_1004268 Ga0157341_10042682 114
551 3300012503 Ga0157313_1000657 Ga0157313_10006573 114
552 3300012508 Ga0157315_1014475 Ga0157315_10144752 114
553 3300012512 Ga0157327_1031858 Ga0157327_10318582 114
554 3300013100 Ga0157373_10035915 Ga0157373_100359153 114
555 3300013102 Ga0157371_10029433 Ga0157371_100294332 114
556 3300013102 Ga0157371_10457690 Ga0157371_104576902 114
557 3300013104 Ga0157370_11531953 Ga0157370_115319532 114
558 3300013105 Ga0157369_11568099 Ga0157369_115680991 114
559 3300013105 Ga0157369_12043287 Ga0157369_120432872 114
560 3300013296 Ga0157374_10001123 Ga0157374_100011232 114
561 3300013296 Ga0157374_10708914 Ga0157374_107089142 114
562 3300013297 Ga0157378_10000270 Ga0157378_1000027011 114
563 3300013306 Ga0163162_10000145 Ga0163162_1000014513 114
564 3300013306 Ga0163162_10021406 Ga0163162_100214065 114
565 3300013307 Ga0157372_10004025 Ga0157372_100040254 114
566 3300013307 Ga0157372_10224278 Ga0157372_102242782 114
567 3300013307 Ga0157372_13276400 Ga0157372_132764001 114
568 3300013308 Ga0157375_10000332 Ga0157375_1000033210 114
569 3300013308 Ga0157375_10106184 Ga0157375_101061845 114
570 3300014325 Ga0163163_10000865 Ga0163163_1000086516 114
571 3300014325 Ga0163163_10019523 Ga0163163_100195235 114
572 3300014326 Ga0157380_10003074 Ga0157380_1000307410 114
573 3300014326 Ga0157380_10090270 Ga0157380_100902702 114
574 3300014745 Ga0157377_10000137 Ga0157377_1000013714 114
575 3300014968 Ga0157379_10001761 Ga0157379_1000176110 114
576 3300014968 Ga0157379_10034305 Ga0157379_100343054 114
577 3300014969 Ga0157376_10000088 Ga0157376_1000008852 114
578 3300017792 Ga0163161_10000144 Ga0163161_1000014419 114
579 3300025271 Ga0207666_1000048 Ga0207666_100004817 114
580 3300025271 Ga0207666_1000232 Ga0207666_10002328 114
581 3300025290 Ga0207673_1000013 Ga0207673_10000138 114
582 3300025315 Ga0207697_10000136 Ga0207697_100001364 114
583 3300025315 Ga0207697_10006414 Ga0207697_100064144 114
584 3300025735 Ga0207713_1063062 Ga0207713_10630622 114
585 3300025885 Ga0207653_10001370 Ga0207653_100013707 114
586 3300025893 Ga0207682_10000006 Ga0207682_100000063 114
587 3300025893 Ga0207682_10243760 Ga0207682_102437601 114
588 3300025898 Ga0207692_10226829 Ga0207692_102268292 114
589 3300025899 Ga0207642_10003385 Ga0207642_100033854 114
590 3300025900 Ga0207710_10001915 Ga0207710_100019159 114
591 3300025900 Ga0207710_10018748 Ga0207710_100187482 114
592 3300025901 Ga0207688_10000027 Ga0207688_1000002752 114
593 3300025901 Ga0207688_10013378 Ga0207688_100133783 114
594 3300025904 Ga0207647_10005467 Ga0207647_100054679 114
595 3300025904 Ga0207647_10014058 Ga0207647_100140585 114
596 3300025905 Ga0207685_10255435 Ga0207685_102554352 114
597 3300025906 Ga0207699_10089456 Ga0207699_100894562 114
598 3300025907 Ga0207645_10000100 Ga0207645_1000010052 114
599 3300025908 Ga0207643_10000007 Ga0207643_10000007163 114
600 3300025908 Ga0207643_10566913 Ga0207643_105669131 114
601 3300025910 Ga0207684_11610847 Ga0207684_116108471 114
602 3300025911 Ga0207654_10000314 Ga0207654_1000031417 114
603 3300025912 Ga0207707_10003553 Ga0207707_1000355313 114
604 3300025912 Ga0207707_10334681 Ga0207707_103346812 114
605 3300025912 Ga0207707_10649541 Ga0207707_106495412 114
606 3300025912 Ga0207707_10961805 Ga0207707_109618051 114
607 3300025913 Ga0207695_10031101 Ga0207695_100311013 114
608 3300025914 Ga0207671_10029994 Ga0207671_100299945 114
609 3300025914 Ga0207671_10040362 Ga0207671_100403622 114
610 3300025915 Ga0207693_10000835 Ga0207693_1000083510 114
611 3300025915 Ga0207693_10451262 Ga0207693_104512622 114
612 3300025915 Ga0207693_10766771 Ga0207693_107667712 114
613 3300025916 Ga0207663_10310252 Ga0207663_103102522 114
614 3300025917 Ga0207660_10000041 Ga0207660_1000004120 114
615 3300025917 Ga0207660_10063155 Ga0207660_100631554 114
616 3300025917 Ga0207660_10468332 Ga0207660_104683322 114
617 3300025917 Ga0207660_10956360 Ga0207660_109563602 114
618 3300025918 Ga0207662_10000282 Ga0207662_1000028217 114
619 3300025918 Ga0207662_10012555 Ga0207662_100125554 114
620 3300025918 Ga0207662_10554950 Ga0207662_105549502 114
621 3300025919 Ga0207657_10003933 Ga0207657_1000393317 114
622 3300025919 Ga0207657_10024595 Ga0207657_100245954 114
623 3300025920 Ga0207649_10002204 Ga0207649_100022044 114
624 3300025921 Ga0207652_10006361 Ga0207652_100063618 114
625 3300025921 Ga0207652_10041684 Ga0207652_100416843 114
626 3300025922 Ga0207646_10925371 Ga0207646_109253712 114
627 3300025923 Ga0207681_10000100 Ga0207681_1000010083 114
628 3300025923 Ga0207681_10035203 Ga0207681_100352033 114
629 3300025924 Ga0207694_10058343 Ga0207694_100583434 114
630 3300025924 Ga0207694_11157445 Ga0207694_111574451 114
631 3300025925 Ga0207650_10031197 Ga0207650_100311974 114
632 3300025926 Ga0207659_10000044 Ga0207659_1000004498 114
633 3300025926 Ga0207659_10356560 Ga0207659_103565602 114
634 3300025927 Ga0207687_10000072 Ga0207687_1000007254 114
635 3300025929 Ga0207664_10474955 Ga0207664_104749552 114
636 3300025931 Ga0207644_10007313 Ga0207644_100073134 114
637 3300025932 Ga0207690_10000140 Ga0207690_1000014057 114
638 3300025932 Ga0207690_10045487 Ga0207690_100454874 114
639 3300025932 Ga0207690_10416557 Ga0207690_104165572 114
640 3300025933 Ga0207706_10003180 Ga0207706_100031804 114
641 3300025933 Ga0207706_10023633 Ga0207706_100236334 114
642 3300025934 Ga0207686_10018123 Ga0207686_100181235 114
643 3300025934 Ga0207686_11120960 Ga0207686_111209602 114
644 3300025935 Ga0207709_10000154 Ga0207709_10000154101 114
645 3300025935 Ga0207709_10007823 Ga0207709_100078233 114
646 3300025936 Ga0207670_10000444 Ga0207670_1000044426 114
647 3300025936 Ga0207670_10468651 Ga0207670_104686513 114
648 3300025936 Ga0207670_10818838 Ga0207670_108188382 114
649 3300025937 Ga0207669_10000176 Ga0207669_1000017612 114
650 3300025937 Ga0207669_10026689 Ga0207669_100266894 114
651 3300025938 Ga0207704_10000086 Ga0207704_1000008611 114
652 3300025938 Ga0207704_10033653 Ga0207704_100336534 114
653 3300025939 Ga0207665_10132210 Ga0207665_101322103 114
654 3300025939 Ga0207665_10242924 Ga0207665_102429242 114
655 3300025940 Ga0207691_10000214 Ga0207691_1000021452 114
656 3300025940 Ga0207691_10059545 Ga0207691_100595454 114
657 3300025941 Ga0207711_10001773 Ga0207711_100017734 114
658 3300025941 Ga0207711_10014174 Ga0207711_100141747 114
659 3300025942 Ga0207689_10000366 Ga0207689_1000036634 114
660 3300025944 Ga0207661_10000087 Ga0207661_1000008719 114
661 3300025944 Ga0207661_10604003 Ga0207661_106040032 114
662 3300025945 Ga0207679_10000029 Ga0207679_1000002934 114
663 3300025945 Ga0207679_10269457 Ga0207679_102694572 114
664 3300025949 Ga0207667_10022798 Ga0207667_100227985 114
665 3300025949 Ga0207667_10834510 Ga0207667_108345102 114
666 3300025960 Ga0207651_10000264 Ga0207651_1000026415 114
667 3300025960 Ga0207651_10735947 Ga0207651_107359472 114
668 3300025961 Ga0207712_10000129 Ga0207712_1000012989 114
669 3300025961 Ga0207712_10008947 Ga0207712_100089473 114
670 3300025972 Ga0207668_10000100 Ga0207668_1000010067 114
671 3300025972 Ga0207668_10248086 Ga0207668_102480862 114
672 3300025972 Ga0207668_10707679 Ga0207668_107076792 114
673 3300025972 Ga0207668_11724260 Ga0207668_117242602 114
674 3300025981 Ga0207640_10001860 Ga0207640_100018608 114
675 3300025986 Ga0207658_10011163 Ga0207658_100111634 114
676 3300025986 Ga0207658_10110125 Ga0207658_101101252 114
677 3300025986 Ga0207658_10425745 Ga0207658_104257452 114
678 3300026023 Ga0207677_10006287 Ga0207677_100062877 114
679 3300026035 Ga0207703_10006917 Ga0207703_100069178 114
680 3300026035 Ga0207703_10042113 Ga0207703_100421134 114
681 3300026035 Ga0207703_10899707 Ga0207703_108997071 114
682 3300026041 Ga0207639_10002204 Ga0207639_100022044 114
683 3300026041 Ga0207639_10025420 Ga0207639_100254204 114
684 3300026067 Ga0207678_10002814 Ga0207678_100028144 114
685 3300026075 Ga0207708_10001802 Ga0207708_1000180217 114
686 3300026075 Ga0207708_10002366 Ga0207708_1000236614 114
687 3300026078 Ga0207702_10001819 Ga0207702_100018197 114
688 3300026078 Ga0207702_10309599 Ga0207702_103095992 114
689 3300026088 Ga0207641_10000476 Ga0207641_1000047611 114
690 3300026088 Ga0207641_10182723 Ga0207641_101827232 114
691 3300026089 Ga0207648_10000072 Ga0207648_1000007211 114
692 3300026089 Ga0207648_10074884 Ga0207648_100748843 114
693 3300026095 Ga0207676_10000512 Ga0207676_1000051228 114
694 3300026095 Ga0207676_10153966 Ga0207676_101539662 114
695 3300026116 Ga0207674_10000697 Ga0207674_1000069732 114
696 3300026118 Ga0207675_100002384 Ga0207675_1000023846 114
697 3300026118 Ga0207675_100026129 Ga0207675_1000261295 114
698 3300026121 Ga0207683_10000029 Ga0207683_1000002921 114
699 3300026142 Ga0207698_10000523 Ga0207698_1000052314 114
700 3300026142 Ga0207698_10066725 Ga0207698_100667253 114
701 3300027252 Ga0209973_1007912 Ga0209973_10079122 114
702 3300027364 Ga0209967_1008658 Ga0209967_10086582 114
703 3300027364 Ga0209967_1020422 Ga0209967_10204222 114
704 3300027424 Ga0209984_1008235 Ga0209984_10082352 114
705 3300027526 Ga0209968_1019510 Ga0209968_10195102 114
706 3300027543 Ga0209999_1006967 Ga0209999_10069673 114
707 3300027552 Ga0209982_1015508 Ga0209982_10155082 114
708 3300027617 Ga0210002_1000381 Ga0210002_10003815 114
709 3300027665 Ga0209983_1009047 Ga0209983_10090472 114
710 3300027695 Ga0209966_1001626 Ga0209966_10016262 114
711 3300027695 Ga0209966_1010167 Ga0209966_10101673 114
712 3300027695 Ga0209966_1094199 Ga0209966_10941991 114
713 3300027717 Ga0209998_10003967 Ga0209998_100039674 114
714 3300027717 Ga0209998_10006957 Ga0209998_100069573 114
715 3300027717 Ga0209998_10112281 Ga0209998_101122811 114
716 3300027876 Ga0209974_10028078 Ga0209974_100280782 114
717 3300027876 Ga0209974_10047690 Ga0209974_100476903 114
718 3300027907 Ga0207428_10000100 Ga0207428_10000100115 114
719 3300027907 Ga0207428_10000228 Ga0207428_1000022833 114
720 3300027907 Ga0207428_10250934 Ga0207428_102509342 114
721 3300028379 Ga0268266_10026692 Ga0268266_100266924 114
722 3300028380 Ga0268265_10001240 Ga0268265_1000124010 114
723 3300028380 Ga0268265_10635181 Ga0268265_106351812 114
724 3300028381 Ga0268264_10006796 Ga0268264_100067964 114
725 3300028381 Ga0268264_10023946 Ga0268264_100239464 114
726 3300028381 Ga0268264_11821256 Ga0268264_118212562 114
727 3300031238 Ga0265332_10001262 Ga0265332_1000126211 114
728 3300031241 Ga0265325_10035258 Ga0265325_100352583 114
729 3300031242 Ga0265329_10007990 Ga0265329_100079903 114
730 3300031247 Ga0265340_10010191 Ga0265340_100101915 114
731 3300031247 Ga0265340_10187919 Ga0265340_101879192 114
732 3300031344 Ga0265316_10737023 Ga0265316_107370231 114
733 3300031691 Ga0316579_10196012 Ga0316579_101960122 114
734 3300031712 Ga0265342_10000069 Ga0265342_1000006979 114
735 3300031727 Ga0316576_10108378 Ga0316576_101083783 114
736 3300031728 Ga0316578_10010476 Ga0316578_100104765 114
737 3300031731 Ga0307405_10373372 Ga0307405_103733722 114
738 3300031824 Ga0307413_10368925 Ga0307413_103689252 114
739 3300031852 Ga0307410_10149906 Ga0307410_101499062 114
740 3300031901 Ga0307406_10883851 Ga0307406_108838512 114
741 3300031995 Ga0307409_100461723 Ga0307409_1004617232 114
742 3300032005 Ga0307411_10032708 Ga0307411_100327084 114
743 3300032126 Ga0307415_100620440 Ga0307415_1006204402 114
744 3300032133 Ga0316583_10018501 Ga0316583_100185012 114
745 3300034816 Ga0373930_0000036 Ga0373930_0000036_6241_6609 114
746 3300034817 Ga0373948_0001276 Ga0373948_0001276_911_1279 114
747 3300034818 Ga0373950_0000274 Ga0373950_0000274_633_1001 114
748 3300034818 Ga0373950_0006173 Ga0373950_0006173_1113_1481 114
749 3300034819 Ga0373958_0000036 Ga0373958_0000036_8308_8676 114
750 3300034819 Ga0373958_0000512 Ga0373958_0000512_999_1367 114
751 3300034820 Ga0373959_0001045 Ga0373959_0001045_3357_3725 114
752 3300034957 Ga0373938_0000752 Ga0373938_0000752_1998_2366 114
753 3300034957 Ga0373938_0001980 Ga0373938_0001980_2813_3181 114
754 3300035084 Ga0373928_0000727 Ga0373928_0000727_3723_4091 114
755 3300035084 Ga0373928_0002885 Ga0373928_0002885_1164_1532 114
756 3300035085 Ga0373929_0000805 Ga0373929_0000805_4694_5062 114
757 3300035086 Ga0373934_0088515 Ga0373934_0088515_458_835 114
758 3300035088 Ga0373940_0000107 Ga0373940_0000107_4694_5062 114
759 3300035088 Ga0373940_0005262 Ga0373940_0005262_590_958 114
760 3300035090 Ga0373949_0000284 Ga0373949_0000284_6098_6466 114
761 3300035090 Ga0373949_0001237 Ga0373949_0001237_3929_4297 114
762 3300035091 Ga0373951_0000560 Ga0373951_0000560_6739_7107 114
763 3300035091 Ga0373951_0004835 Ga0373951_0004835_948_1316 114
764 3300035092 Ga0373952_0000135 Ga0373952_0000135_6784_7152 114
765 3300035092 Ga0373952_0000152 Ga0373952_0000152_4946_5314 114
766 3300035111 Ga0373923_0005530 Ga0373923_0005530_289_657 114
767 3300035112 Ga0373932_0000172 Ga0373932_0000172_10939_11307 114
768 3300035112 Ga0373932_0002592 Ga0373932_0002592_486_854 114
769 3300035113 Ga0373936_0012581 Ga0373936_0012581_95_463 114
770 3300035113 Ga0373936_0012931 Ga0373936_0012931_1608_1976 114
771 3300035114 Ga0373939_0007160 Ga0373939_0007160_268_636 114
772 3300035114 Ga0373939_0011782 Ga0373939_0011782_669_1037 114
773 3300035115 Ga0373941_0000081 Ga0373941_0000081_8486_8854 114
774 3300035115 Ga0373941_0002269 Ga0373941_0002269_1446_1814 114
775 3300035115 Ga0373941_0121660 Ga0373941_0121660_372_758 114
776 3300035116 Ga0373945_0040392 Ga0373945_0040392_1142_1510 114
777 3300035116 Ga0373945_0083557 Ga0373945_0083557_431_799 114
778 3300035117 Ga0373953_0002122 Ga0373953_0002122_3692_4060 114
779 3300035117 Ga0373953_0075559 Ga0373953_0075559_872_1249 114
780 3300035118 Ga0373954_0002543 Ga0373954_0002543_6927_7295 114
781 3300035118 Ga0373954_0014017 Ga0373954_0014017_2327_2704 114
782 3300035119 Ga0373956_0060477 Ga0373956_0060477_841_1209 114
783 3300035120 Ga0373957_0012970 Ga0373957_0012970_386_763 114
784 3300035120 Ga0373957_0014625 Ga0373957_0014625_1029_1397 114
785 3300035121 Ga0373960_0001550 Ga0373960_0001550_1998_2366 114
786 3300035121 Ga0373960_0003760 Ga0373960_0003760_1688_2056 114
787 3300035170 Ga0373943_0005071 Ga0373943_0005071_4368_4736 114
788 3300035171 Ga0373946_0000195 Ga0373946_0000195_3891_4259 114
789 3300035172 Ga0373955_0000728 Ga0373955_0000728_4630_5007 114
790 3300035172 Ga0373955_0003373 Ga0373955_0003373_6425_6793 114
791 3300035207 Ga0373942_0000173 Ga0373942_0000173_9071_9439 114
792 3300035207 Ga0373942_0065726 Ga0373942_0065726_240_608 114
793 3300035241 Ga0373961_0000196 Ga0373961_0000196_20618_20986 114
794 3300035241 Ga0373961_0003123 Ga0373961_0003123_2476_2844 114
795 3300035242 Ga0373962_0000151 Ga0373962_0000151_10779_11147 114
796 3300035242 Ga0373962_0000452 Ga0373962_0000452_3119_3487 114
797 3300035398 Ga0316574_0025731 Ga0316574_0025731_1812_2189 114
798 3300035410 Ga0373924_0000908 Ga0373924_0000908_3949_4317 114
799 3300035410 Ga0373924_0014025 Ga0373924_0014025_376_753 114
800 3300035691 Ga0373931_0001253 Ga0373931_0001253_3340_3708 114
801 3300035691 Ga0373931_0002490 Ga0373931_0002490_7537_7905 114
802 3300035691 Ga0373931_0324267 Ga0373931_0324267_253_621 114
803 3300035691 Ga0373931_1030836 Ga0373931_1030836_122_490 114
804 3300035692 Ga0373935_0000192 Ga0373935_0000192_11567_11935 114
805 3300035695 Ga0373927_0324268 Ga0373927_0324268_308_676 114
806 3300035695 Ga0373927_0822081 Ga0373927_0822081_92_460 114
807 3300035724 Ga0373933_0004316 Ga0373933_0004316_113_481 114
808 3300035724 Ga0373933_0006946 Ga0373933_0006946_4331_4708 114
809 3300035724 Ga0373933_0388058 Ga0373933_0388058_394_762 114
810 3300035725 Ga0373947_0002278 Ga0373947_0002278_7283_7651 114
811 3300035725 Ga0373947_0021129 Ga0373947_0021129_1126_1494 114
812 3300035725 Ga0373947_0026478 Ga0373947_0026478_174_542 114
813 3300036401 Ga0373937_0000018 Ga0373937_0000018_4795_5163 114
814 3300036401 Ga0373937_0738293 Ga0373937_0738293_520_894 114
815 3300036647 Ga0316582_0076318 Ga0316582_0076318_591_968 114
816 3300036712 Ga0316584_0073155 Ga0316584_0073155_859_1236 114
817 3300037068 Ga0373925_0000055 Ga0373925_0000055_44546_44914 114
818 3300037068 Ga0373925_0056277 Ga0373925_0056277_1086_1454 114
819 3300037068 Ga0373925_0345257 Ga0373925_0345257_349_717 114
820 3300038996 Ga0242420_003017 Ga0242420_003017_1749_2117 114
821 3300039447 Ga0436361_0155875 Ga0436361_0155875_354_722 114
822 3300042008 Ga0439450_090220 Ga0439450_090220_130_498 114
823 3300042012 Ga0439455_0040110 Ga0439455_0040110_572_940 114
824 3300042016 Ga0439463_200409 Ga0439463_200409_44_412 114
825 3300042437 Ga0439444_0123655 Ga0439444_0123655_111_479 114
826 3300042439 Ga0439464_0142683 Ga0439464_0142683_182_550 114
827 3300042461 Ga0439460_0095645 Ga0439460_0095645_101_469 114
828 3300042876 Ga0451577_0327081 Ga0451577_0327081_35_403 114
829 3300044712 Ga0453684_0171995 Ga0453684_0171995_743_1111 114
830 3300044842 Ga0466957_0064591 Ga0466957_0064591_1383_1751 114
831 3300045051 Ga0451576_0041638 Ga0451576_0041638_504_872 114
832 3300045976 Ga0466967_0524362 Ga0466967_0524362_682_1062 114
833 3300046454 Ga0495592_0000235 Ga0495592_0000235_26263_26631 114
834 3300046454 Ga0495592_0093466 Ga0495592_0093466_931_1299 114
835 3300046457 Ga0495590_0052060 Ga0495590_0052060_641_1009 114
836 3300046459 Ga0495629_0002430 Ga0495629_0002430_12271_12639 114
837 3300046460 Ga0495638_0271792 Ga0495638_0271792_282_650 114
838 3300046462 Ga0495651_0000516 Ga0495651_0000516_5376_5744 114
839 3300046462 Ga0495651_0390249 Ga0495651_0390249_170_538 114
840 3300046463 Ga0495653_0000003 Ga0495653_0000003_104641_105009 114
841 3300046463 Ga0495653_0418520 Ga0495653_0418520_450_827 114
842 3300046473 Ga0495582_0034749 Ga0495582_0034749_1008_1376 114
843 3300046476 Ga0495662_0011854 Ga0495662_0011854_3699_4067 114
844 3300046477 Ga0495664_0000001 Ga0495664_0000001_435931_436299 114
845 3300046511 Ga0495608_0000033 Ga0495608_0000033_38683_39051 114
846 3300046511 Ga0495608_0045528 Ga0495608_0045528_606_983 114
847 3300046511 Ga0495608_0154901 Ga0495608_0154901_943_1317 114
848 3300046514 Ga0495618_0000012 Ga0495618_0000012_5183_5551 114
849 3300046516 Ga0495628_0000003 Ga0495628_0000003_267114_267482 114
850 3300046517 Ga0495630_0004336 Ga0495630_0004336_7017_7385 114
851 3300046517 Ga0495630_0325694 Ga0495630_0325694_731_1099 114
852 3300046520 Ga0495637_0290906 Ga0495637_0290906_111_479 114
853 3300046529 Ga0495652_0000001 Ga0495652_0000001_390866_391234 114
854 3300046529 Ga0495652_0082958 Ga0495652_0082958_213_590 114
855 3300046529 Ga0495652_0592264 Ga0495652_0592264_227_601 114
856 3300046533 Ga0495640_0000012 Ga0495640_0000012_33158_33526 114
857 3300046536 Ga0495587_0000003 Ga0495587_0000003_102265_102633 114
858 3300046536 Ga0495587_0031814 Ga0495587_0031814_333_710 114
859 3300046536 Ga0495587_0271814 Ga0495587_0271814_325_693 114
860 3300046538 Ga0495609_0124607 Ga0495609_0124607_329_697 114
861 3300046543 Ga0495645_0000004 Ga0495645_0000004_329437_329805 114
862 3300046559 Ga0495667_0000001 Ga0495667_0000001_230666_231034 114
863 3300046559 Ga0495667_0032697 Ga0495667_0032697_2231_2608 114
864 3300046642 Ga0495634_0000163 Ga0495634_0000163_24087_24455 114
865 3300046663 Ga0495635_0000015 Ga0495635_0000015_33158_33526 114
866 3300046663 Ga0495635_0229038 Ga0495635_0229038_535_912 114
867 3300046663 Ga0495635_0845041 Ga0495635_0845041_78_446 114
868 3300046675 Ga0495657_0000061 Ga0495657_0000061_87998_88366 114
869 3300046675 Ga0495657_0028219 Ga0495657_0028219_1030_1407 114
870 3300046678 Ga0495599_0000004 Ga0495599_0000004_65688_66056 114
871 3300046679 Ga0495623_0000020 Ga0495623_0000020_59308_59676 114
872 3300046679 Ga0495623_0041069 Ga0495623_0041069_1640_2017 114
873 3300046679 Ga0495623_0387829 Ga0495623_0387829_124_492 114
874 3300046680 Ga0495646_0000006 Ga0495646_0000006_78752_79120 114
875 3300046680 Ga0495646_0355101 Ga0495646_0355101_374_742 114
876 3300046681 Ga0495647_0478379 Ga0495647_0478379_192_560 114
877 3300046683 Ga0495658_0030078 Ga0495658_0030078_351_719 114
878 3300046689 Ga0495613_0002383 Ga0495613_0002383_11094_11462 114
879 3300046689 Ga0495613_0147438 Ga0495613_0147438_585_953 114
880 3300046690 Ga0495624_0012717 Ga0495624_0012717_1521_1889 114
881 3300046690 Ga0495624_0340139 Ga0495624_0340139_349_717 114
882 3300046809 Ga0495600_0000029 Ga0495600_0000029_10758_11126 114
883 3300047315 Ga0495581_0001267 Ga0495581_0001267_9314_9682 114
884 3300047317 Ga0495604_0000018 Ga0495604_0000018_102364_102732 114
885 3300047317 Ga0495604_0199106 Ga0495604_0199106_217_585 114
886 3300047319 Ga0495674_0000001 Ga0495674_0000001_635868_636236 114
887 3300047319 Ga0495674_0053333 Ga0495674_0053333_2380_2748 114
888 3300047319 Ga0495674_0178558 Ga0495674_0178558_52_420 114
889 3300047320 Ga0495672_0124293 Ga0495672_0124293_548_934 114
890 3300047320 Ga0495672_0279408 Ga0495672_0279408_107_475 114
891 3300047322 Ga0495680_0000147 Ga0495680_0000147_49559_49927 114
892 3300047322 Ga0495680_0005610 Ga0495680_0005610_3648_4025 114
893 3300047444 Ga0495675_0000034 Ga0495675_0000034_58542_58910 114
894 3300047471 Ga0495684_0000005 Ga0495684_0000005_189407_189775 114
895 3300047471 Ga0495684_0502670 Ga0495684_0502670_367_744 114
896 3300047673 Ga0495593_0002540 Ga0495593_0002540_7330_7698 114
897 3300048088 Ga0495602_0000002 Ga0495602_0000002_179411_179779 114
898 3300048088 Ga0495602_0260578 Ga0495602_0260578_477_854 114
899 3300048088 Ga0495602_0383473 Ga0495602_0383473_26_394 114
900 3300048903 Ga0496100_0000530 Ga0496100_0000530_9168_9536 114
901 3300048903 Ga0496100_0129276 Ga0496100_0129276_1335_1709 114
902 3300048903 Ga0496100_0459229 Ga0496100_0459229_37_411 114
903 3300048904 Ga0496101_0000189 Ga0496101_0000189_34476_34844 114
904 3300048904 Ga0496101_0067265 Ga0496101_0067265_1019_1393 114
905 3300048904 Ga0496101_0255871 Ga0496101_0255871_952_1320 114
906 3300048905 Ga0496102_0026992 Ga0496102_0026992_3340_3708 114
907 3300048905 Ga0496102_0053152 Ga0496102_0053152_346_714 114
908 3300048905 Ga0496102_1405045 Ga0496102_1405045_71_439 114
909 3300048906 Ga0496103_0020763 Ga0496103_0020763_2910_3278 114
910 3300048906 Ga0496103_0399992 Ga0496103_0399992_162_530 114
911 3300048907 Ga0496104_0004877 Ga0496104_0004877_2560_2934 114
912 3300048907 Ga0496104_0076771 Ga0496104_0076771_1844_2212 114
913 3300048907 Ga0496104_0102063 Ga0496104_0102063_453_821 114
914 3300048907 Ga0496104_0590549 Ga0496104_0590549_91_471 114
915 3300048907 Ga0496104_0937430 Ga0496104_0937430_247_621 114
916 3300048908 Ga0496105_0007511 Ga0496105_0007511_4356_4730 114
917 3300048908 Ga0496105_0329944 Ga0496105_0329944_505_879 114
918 3300048908 Ga0496105_0642762 Ga0496105_0642762_43_411 114
919 3300048909 Ga0496106_0002185 Ga0496106_0002185_671_1039 114
920 3300048909 Ga0496106_0040009 Ga0496106_0040009_2444_2812 114
921 3300048909 Ga0496106_0110134 Ga0496106_0110134_906_1274 114
922 3300048909 Ga0496106_0195661 Ga0496106_0195661_852_1226 114
923 3300048909 Ga0496106_0465257 Ga0496106_0465257_558_932 114
924 3300048909 Ga0496106_0537812 Ga0496106_0537812_331_699 114
925 3300048910 Ga0496107_0003085 Ga0496107_0003085_6580_6948 114
926 3300048910 Ga0496107_0121975 Ga0496107_0121975_303_671 114
927 3300048910 Ga0496107_0295133 Ga0496107_0295133_762_1130 114
928 3300048911 Ga0496108_0002465 Ga0496108_0002465_8080_8448 114
929 3300048911 Ga0496108_0011168 Ga0496108_0011168_3673_4041 114
930 3300048912 Ga0496109_0000488 Ga0496109_0000488_15867_16235 114
931 3300048912 Ga0496109_0006884 Ga0496109_0006884_5824_6192 114
932 3300048912 Ga0496109_0084382 Ga0496109_0084382_1450_1818 114
933 3300048912 Ga0496109_0173976 Ga0496109_0173976_1148_1522 114
934 3300048913 Ga0496110_0069646 Ga0496110_0069646_1354_1722 114
935 3300048913 Ga0496110_0111002 Ga0496110_0111002_1319_1687 114
936 3300048913 Ga0496110_0526456 Ga0496110_0526456_500_868 114
937 3300048914 Ga0496111_0098927 Ga0496111_0098927_584_952 114
938 3300048914 Ga0496111_0140843 Ga0496111_0140843_1315_1683 114
939 3300048914 Ga0496111_0436514 Ga0496111_0436514_524_898 114
940 3300048915 Ga0496112_0030833 Ga0496112_0030833_1140_1508 114
941 3300048915 Ga0496112_0184312 Ga0496112_0184312_1187_1555 114
942 3300048916 Ga0496113_0021686 Ga0496113_0021686_1510_1884 114
943 3300048916 Ga0496113_0037283 Ga0496113_0037283_1281_1649 114
944 3300048916 Ga0496113_0055553 Ga0496113_0055553_781_1149 114
945 3300048916 Ga0496113_0500650 Ga0496113_0500650_430_798 114
946 3300048917 Ga0496114_0001960 Ga0496114_0001960_3528_3896 114
947 3300048917 Ga0496114_0318888 Ga0496114_0318888_194_568 114
948 3300048918 Ga0496115_0002442 Ga0496115_0002442_11525_11893 114
949 3300048918 Ga0496115_0095823 Ga0496115_0095823_1007_1381 114
950 3300048918 Ga0496115_0293453 Ga0496115_0293453_261_635 114
951 3300049568 Ga0501031_0075381 Ga0501031_0075381_724_1092 114
952 3300049569 Ga0501032_0251647 Ga0501032_0251647_306_674 114
953 3300049570 Ga0501033_0278704 Ga0501033_0278704_253_621 114
954 3300049571 Ga0501034_0963848 Ga0501034_0963848_333_701 114
955 3300049572 Ga0501036_0034721 Ga0501036_0034721_3086_3454 114
956 3300049572 Ga0501036_0038602 Ga0501036_0038602_1011_1379 114
957 3300049574 Ga0501038_0172863 Ga0501038_0172863_1142_1510 114
958 3300049575 Ga0501039_0129166 Ga0501039_0129166_918_1286 114
959 3300049575 Ga0501039_0740727 Ga0501039_0740727_330_722 114
960 3300049576 Ga0501040_0820205 Ga0501040_0820205_205_573 114
961 3300049578 Ga0501042_1029229 Ga0501042_1029229_55_423 114
962 3300049579 Ga0501043_0117371 Ga0501043_0117371_239_607 114
963 3300049579 Ga0501043_0389891 Ga0501043_0389891_95_463 114
964 3300049581 Ga0501047_0343734 Ga0501047_0343734_423_791 114
965 3300049581 Ga0501047_0504463 Ga0501047_0504463_26_394 114
966 3300049582 Ga0501048_1046248 Ga0501048_1046248_181_549 114
967 3300049584 Ga0501068_0561863 Ga0501068_0561863_286_654 114
968 3300049584 Ga0501068_0890866 Ga0501068_0890866_146_514 114
969 3300049585 Ga0501069_0194151 Ga0501069_0194151_721_1089 114
970 3300049586 Ga0501070_0086430 Ga0501070_0086430_1311_1679 114
971 3300049586 Ga0501070_0335000 Ga0501070_0335000_781_1149 114
972 3300049588 Ga0501072_0163577 Ga0501072_0163577_1325_1693 114
973 3300049588 Ga0501072_0605319 Ga0501072_0605319_259_627 114
974 3300049591 Ga0501075_0252633 Ga0501075_0252633_653_1021 114
975 3300049591 Ga0501075_0312204 Ga0501075_0312204_26_394 114
976 3300049592 Ga0501076_0156240 Ga0501076_0156240_553_921 114
977 3300049593 Ga0501077_0131914 Ga0501077_0131914_319_687 114
978 3300049741 Ga0501079_0039132 Ga0501079_0039132_3008_3376 114
979 3300049741 Ga0501079_0728916 Ga0501079_0728916_160_528 114
980 3300049743 Ga0501081_0204727 Ga0501081_0204727_292_660 114
981 3300049744 Ga0501083_0076461 Ga0501083_0076461_424_792 114
982 3300049744 Ga0501083_0120344 Ga0501083_0120344_1273_1641 114
983 3300049822 Ga0501035_0063205 Ga0501035_0063205_1115_1483 114
984 3300049822 Ga0501035_1271270 Ga0501035_1271270_34_402 114
985 3300049823 Ga0501044_0058058 Ga0501044_0058058_771_1139 114
986 3300049823 Ga0501044_0958332 Ga0501044_0958332_269_637 114
987 3300050494 nmdc:mga06z11_11012_c1 nmdc:mga06z11_11012_c1_3227_3595 114
988 3300050496 nmdc:mga07m45_342931_c1 nmdc:mga07m45_342931_c1_194_562 114
989 3300050507 nmdc:mga05p37_306787_c1 nmdc:mga05p37_306787_c1_796_1182 114
990 3300050508 nmdc:mga09592_1462109_c1 nmdc:mga09592_1462109_c1_152_538 114
991 3300050510 nmdc:mga06r32_106007_c1 nmdc:mga06r32_106007_c1_1711_2097 114
992 3300050510 nmdc:mga06r32_1123471_c1 nmdc:mga06r32_1123471_c1_28_414 114
993 3300050510 nmdc:mga06r32_2052604_c1 nmdc:mga06r32_2052604_c1_25_393 114
994 3300050510 nmdc:mga06r32_545779_c1 nmdc:mga06r32_545779_c1_243_629 114
995 3300050511 nmdc:mga08y16_1045_c1 nmdc:mga08y16_1045_c1_23145_23513 114
996 3300050511 nmdc:mga08y16_11105_c1 nmdc:mga08y16_11105_c1_8619_8987 114
997 3300050511 nmdc:mga08y16_84627_c1 nmdc:mga08y16_84627_c1_1588_1956 114
998 3300050512 nmdc:mga0n895_1396109_c1 nmdc:mga0n895_1396109_c1_131_499 114
999 3300050512 nmdc:mga0n895_206826_c1 nmdc:mga0n895_206826_c1_870_1238 114
1000 3300050512 nmdc:mga0n895_239240_c1 nmdc:mga0n895_239240_c1_543_911 114
1001 3300050512 nmdc:mga0n895_242719_c1 nmdc:mga0n895_242719_c1_623_991 114
1002 3300050512 nmdc:mga0n895_6556_c1 nmdc:mga0n895_6556_c1_3084_3458 114
1003 3300050512 nmdc:mga0n895_749056_c1 nmdc:mga0n895_749056_c1_528_902 114
1004 3300050512 nmdc:mga0n895_82905_c1 nmdc:mga0n895_82905_c1_2272_2640 114
1005 3300050513 nmdc:mga0rr50_1209514_c1 nmdc:mga0rr50_1209514_c1_264_632 114
1006 3300050513 nmdc:mga0rr50_174817_c1 nmdc:mga0rr50_174817_c1_1050_1418 114
1007 3300050513 nmdc:mga0rr50_179658_c1 nmdc:mga0rr50_179658_c1_366_734 114
1008 3300050514 nmdc:mga08x19_3619_c1 nmdc:mga08x19_3619_c1_6277_6645 114
1009 3300050514 nmdc:mga08x19_45947_c1 nmdc:mga08x19_45947_c1_967_1335 114
1010 3300050515 nmdc:mga0a205_1492_c1 nmdc:mga0a205_1492_c1_11869_12237 114
1011 3300050515 nmdc:mga0a205_30267_c1 nmdc:mga0a205_30267_c1_2792_3160 114
1012 3300053077 Ga0495601_0000003 Ga0495601_0000003_390992_391360 114
1013 3300053077 Ga0495601_0004661 Ga0495601_0004661_6062_6439 114
1014 3300053077 Ga0495601_0060828 Ga0495601_0060828_1516_1890 114
1015 3300053078 Ga0495612_0000007 Ga0495612_0000007_161329_161697 114
1016 3300053078 Ga0495612_0081412 Ga0495612_0081412_710_1084 114
1017 3300053084 Ga0495595_0000018 Ga0495595_0000018_98935_99303 114
1018 3300053084 Ga0495595_0044171 Ga0495595_0044171_635_1012 114
1019 3300053084 Ga0495595_0246404 Ga0495595_0246404_351_725 114
1020 3300053085 Ga0495619_0000009 Ga0495619_0000009_102371_102739 114
1021 3300053085 Ga0495619_0141403 Ga0495619_0141403_547_924 114
1022 3300053085 Ga0495619_0184650 Ga0495619_0184650_649_1023 114
1023 3300053131 Ga0500652_000080 Ga0500652_000080_7116_7484 114
1024 3300053177 Ga0500636_0040041 Ga0500636_0040041_810_1178 114
1025 3300054114 Ga0501084_0068797 Ga0501084_0068797_1520_1888 114
1026 3300054114 Ga0501084_0239755 Ga0501084_0239755_416_784 114
1027 3300060353 Ga0501082_0428464 Ga0501082_0428464_275_643 114
1028 3300061734 Ga0530510_0147766 Ga0530510_0147766_883_1251 114
1029 3300061734 Ga0530510_0806643 Ga0530510_0806643_288_656 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02152

FolB

Dihydroneopterin aldolase

6

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7su6-assembly1.cif.gz_C dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin 0.8489 1 112
1nbu-assembly1.cif.gz_D 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.8466 2 112
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.8452 3 111
1nbu-assembly1.cif.gz_G 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.8444 2 112
5f3m-assembly1.cif.gz_A crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . 0.8444 3 112
ID Description Score Start End Superfamily
2nm2B00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8631 1 111 3.30.1130.10
af_A0A0R0J0C6_26_148_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8452 3 113 3.30.1130.10
5farH00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.836 3 112 3.30.1130.10
2nm2B00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8358 1 111 3.30.1130.10
2o9mC00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8231 3 111 3.30.1130.10
ID Description Score Start End GO Terms
AF-U7KYL6-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8951 1 112 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A259ZZX0-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8881 2 112 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A7R9TAB4-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.887 3 114 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-D7W9Z0-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8852 1 112 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A661ZHN2-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8822 3 90 GO:0004150
GO:0005737
GO:0046654
GO:0046656

Feature Viewer

pLDDT pTM Quality
73.39 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map