F488541

General Info

Members Datasets Scaffolds Average Seq Length
1027 496 939 372

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_41038_c1|nmdc:mga0k408_41038_c1_987_2234
Length 415
Sequence MRAASRSIDALDPGHWRSPDKVRQNRAQFRLHRSTKRQRRQSMLIGVPLETAAGETRVAVTPETAKKLKAQGHTLKVQSGAGVAASVPDAAYEAAGAEITDATGAFGCDLVLKVRSPLHSELSMMKTGAAVVGMLNPFDADGLHRLAGAGVTGFALEAAPRTTRAQSMDVLSSQANIAGYKAVMIAADKYQRFFPMLMTAAGTVKAARVVILGVGVAGLQAIATAKRLGAVIEASDVRPSVKEQVESLGAKFIDVSYDTPEEKEAAEGVGGYAKPMPQSWLDRQKVEVAKRVAAADVVITTALIPGRAAPVLVTEEMVKAMKPGSVIVDLAAPNGGNCPLTEAGKTVVKHGVTLVGETNLPALVAADASALYARNVLDFLKLVITKEGTFHVPMDDDIVAACLMTQGGEVKRANK

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
5 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
6 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
10 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
13 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
14 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
15 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
16 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
17 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
18 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
19 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
20 2643221585 Pelomonas sp. Root662 Isolate Unclassified
21 2643221609 Acidovorax sp. Root217 Isolate Unclassified
22 2643221611 Acidovorax sp. Root219 Isolate Unclassified
23 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
24 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
25 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
26 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
27 2643221656 Pelomonas sp. Root405 Isolate Unclassified
28 2643221658 Variovorax sp. Root411 Isolate Unclassified
29 2643221683 Variovorax sp. Root473 Isolate Unclassified
30 2721755523 Delftia sp. HK171 Isolate Unclassified
31 2738541277 Variovorax sp. GV051 Isolate Unclassified
32 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
33 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
34 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
35 2738541307 Variovorax sp. GV008 Isolate Unclassified
36 2738541337 Pelomonas sp. BT06 Isolate Unclassified
37 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
38 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
39 2738543012 Acidovorax sp. CF301 Isolate Unclassified
40 2738543019 Variovorax sp. GV040 Isolate Unclassified
41 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
42 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
43 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
44 2816332133 Acidovorax radicis 2721A Isolate Unclassified
45 2818991446 Variovorax sp. 1180 Isolate Unclassified
46 2818991450 Burkholderia sp. 604 Isolate Unclassified
47 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
48 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
49 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
50 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
51 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
52 2842733646 Variovorax sp. R-72446 Isolate Unclassified
53 2842747753 Variovorax sp. R-72060 Isolate Unclassified
54 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
55 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
56 2885198086 Variovorax sp. 679 Isolate Unclassified
57 2885211737 Variovorax sp. 553 Isolate Unclassified
58 2899924645 Variovorax sp. 369 Isolate Unclassified
59 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
60 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
61 2928037797 Variovorax sp. 1126 Isolate Unclassified
62 2928044640 Variovorax sp. 1128 Isolate Unclassified
63 2928051484 Variovorax sp. 1133 Isolate Unclassified
64 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
65 2928070936 Variovorax gossypii 1167 Isolate Unclassified
66 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
67 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
68 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
69 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
70 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
71 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
72 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
73 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
74 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
75 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
76 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
77 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
78 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
79 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
80 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
81 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
82 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
83 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
84 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
85 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
86 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
87 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
88 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
89 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
90 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
91 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
92 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
93 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
94 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
95 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
96 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
97 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
98 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
99 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
100 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
101 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
102 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
103 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
104 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
105 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
106 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
107 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
108 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
109 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
110 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
111 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
112 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
113 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
114 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
115 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
116 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
117 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
118 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
119 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
120 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
121 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
122 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
123 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
124 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
125 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
126 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
127 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
128 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
129 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
130 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
131 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
132 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
133 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
134 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
135 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
136 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
137 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
138 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
139 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
140 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
141 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
142 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
143 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
144 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
145 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
146 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
149 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
150 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
151 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
152 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
153 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
154 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
155 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
156 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
157 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
158 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
159 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
160 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
161 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
162 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
163 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
164 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
165 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
166 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
167 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
168 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
169 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
170 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
171 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
172 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
173 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
174 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
175 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
176 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
177 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
178 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
179 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
180 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
181 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
182 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
183 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
184 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
185 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
186 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
187 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
188 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
189 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
190 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
191 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
192 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
193 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
194 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
195 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
196 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
197 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
198 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
199 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
200 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
206 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
207 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
208 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
211 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
212 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
213 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
220 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
222 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
225 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
270 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
275 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
279 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
280 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
281 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
282 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
283 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
284 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
285 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
286 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
287 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
288 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
289 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
290 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
291 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
292 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
293 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
294 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
295 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
296 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
297 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
298 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
299 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
300 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
301 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
302 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
303 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
304 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
305 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
306 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
307 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
308 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
309 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
311 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
312 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
313 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
314 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
315 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
316 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
317 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
318 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
319 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
320 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
321 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
322 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
323 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
324 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
325 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
326 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
327 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
328 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
329 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
330 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
331 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
332 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
333 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
334 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
335 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
340 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
341 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
342 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
343 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
344 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
345 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
346 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
347 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
348 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
349 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
350 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
351 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
352 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
353 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
354 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
355 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
356 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
357 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
358 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
359 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
360 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
361 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
362 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
363 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
364 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
365 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
366 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
367 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
370 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
375 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
376 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
377 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
378 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
379 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
380 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
381 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
382 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
383 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
384 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
385 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
386 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
387 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
388 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
389 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
390 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
391 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
392 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
393 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
394 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
395 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
396 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
397 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
398 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
399 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
400 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
401 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
402 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
403 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
404 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
405 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
406 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
407 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
408 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
409 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
410 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
411 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
412 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
413 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
414 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
415 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
416 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
417 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
418 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
419 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
420 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
421 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
422 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
423 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
424 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
425 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
426 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
427 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
428 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
429 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
430 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
431 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
432 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
433 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
434 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
435 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
436 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
437 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
438 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
439 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
440 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
441 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
447 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
448 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
449 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
450 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
451 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
452 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
453 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
454 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
460 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
461 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
462 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
463 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
464 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
465 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
466 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
467 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
469 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
470 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
471 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
472 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
473 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
474 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
475 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
476 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
477 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
478 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
479 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
480 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
481 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
482 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
483 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
484 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
485 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
486 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
487 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
488 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
489 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
490 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
491 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
492 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
493 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
494 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
495 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
496 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.14
Metatranscriptomes 0.29
Isolates 8.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.4
Nodule 1.56
Rhizoplane 3.99
Rhizosphere 61.25
Stem 0
Stem Tuber 0
Unclassified 14.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002979 3300001979 Bacteria 7499
2 JGI24739J22299_10002019 3300001989 Bacteria 7768
3 JGI24739J22299_10002611 3300001989 Bacteria 6939
4 JGI24735J21928_10000321 3300002067 Bacteria 16677
5 JGI24735J21928_10004512 3300002067 Bacteria 4682
6 JGI24738J21930_10005717 3300002075 Bacteria 2959
7 JGI25155J39150_1000042 3300002704 Bacteria 88585
8 JGI25156J39149_1000053 3300002705 Bacteria 88796
9 JGI25156J39149_1003037 3300002705 Bacteria 5696
10 JGI25156J39149_1003053 3300002705 Bacteria 5674
11 JGI25154J39366_1000082 3300002738 Bacteria 88767
12 JGI25157J39369_1000072 3300002741 Bacteria 88796
13 JGI25150J39212_1002959 3300002774 Bacteria 4094
14 JGI25159J45721_1003277 3300002987 Bacteria 5791
15 JGI25151J46595_10009109 3300003187 Bacteria 4728
16 JGI25151J46595_10023163 3300003187 Bacteria 2564
17 JGI25151J46595_10053555 3300003187 Bacteria 1347
18 JGI25165J46597_1001342 3300003214 Bacteria 13757
19 JGI25153J46596_10001249 3300003215 Bacteria 15301
20 JGI26128J50194_1000014 3300003347 Bacteria 5558
21 JGI25160J50197_1000188 3300003354 Bacteria 52036
22 JGI25161J50226_1000007 3300003374 Bacteria 256181
23 Ga0006554J51385_1036275 3300003567 Bacteria 2243
24 Ga0006562J51391_1047714 3300003578 Bacteria 3659
25 Ga0006562J51391_1047716 3300003578 Bacteria 1770
26 Ga0055539_1000536 3300003752 Bacteria 11499
27 Ga0055533_1002147 3300003756 Bacteria 4718
28 Ga0055525_1000053 3300003759 Bacteria 218067
29 Ga0055542_1000013 3300003762 Bacteria 387560
30 Ga0055526_1012883 3300003771 Bacteria 3595
31 Ga0055526_1015140 3300003771 Bacteria 3113
32 Ga0055526_1023769 3300003771 Bacteria 2033
33 Ga0055537_1005041 3300003773 Bacteria 3618
34 Ga0055524_1000148 3300003775 Bacteria 83128
35 Ga0055524_1000213 3300003775 Bacteria 61225
36 Ga0055536_1000526 3300003781 Bacteria 26477
37 Ga0055536_1009279 3300003781 Bacteria 4094
38 Ga0055536_1028413 3300003781 Bacteria 1524
39 Ga0055536_1028847 3300003781 Bacteria 1504
40 Ga0055534_1000726 3300003784 Bacteria 15931
41 Ga0055534_1002320 3300003784 Bacteria 6670
42 Ga0055534_1003088 3300003784 Bacteria 5422
43 Ga0055528_1007035 3300003790 Bacteria 5028
44 Ga0055528_1011042 3300003790 Bacteria 3618
45 Ga0055530_10000233 3300003791 Bacteria 49812
46 Ga0055530_10007767 3300003791 Bacteria 4444
47 Ga0055530_10007960 3300003791 Bacteria 4335
48 Ga0055530_10008285 3300003791 Bacteria 4195
49 Ga0055540_1000018 3300003792 Bacteria 218360
50 Ga0055540_1000176 3300003792 Bacteria 63046
51 Ga0055531_10000135 3300003794 Bacteria 83831
52 Ga0055531_10000850 3300003794 Bacteria 25221
53 Ga0055531_10002836 3300003794 Bacteria 11342
54 Ga0055531_10007099 3300003794 Bacteria 6188
55 Ga0055531_10043465 3300003794 Bacteria 1271
56 Ga0055531_10043509 3300003794 Bacteria 1270
57 Ga0055543_1000842 3300004625 Bacteria 14843
58 Ga0065165_1013122 3300005262 Bacteria 3316
59 Ga0065165_1025541 3300005262 Bacteria 1961
60 Ga0065707_10087951 3300005295 Bacteria 4833
61 Ga0070658_10002933 3300005327 Bacteria 14139
62 Ga0070676_10019022 3300005328 Bacteria 3816
63 Ga0070676_10044513 3300005328 Bacteria 2583
64 Ga0070670_100063696 3300005331 Bacteria 3164
65 Ga0070670_100083241 3300005331 Bacteria 2749
66 Ga0070670_100216812 3300005331 Bacteria 1665
67 Ga0070670_100300305 3300005331 Bacteria 1404
68 Ga0068869_100004605 3300005334 Bacteria 8594
69 Ga0068869_100091722 3300005334 Bacteria 2285
70 Ga0068869_100276724 3300005334 Bacteria 1348
71 Ga0070666_10067889 3300005335 Bacteria 2421
72 Ga0070682_100080255 3300005337 Bacteria 2109
73 Ga0068868_100002058 3300005338 Bacteria 13824
74 Ga0068868_100049592 3300005338 Bacteria 3295
75 Ga0068868_100125503 3300005338 Bacteria 2096
76 Ga0068868_100263391 3300005338 Bacteria 1454
77 Ga0070660_100156926 3300005339 Bacteria 1832
78 Ga0070689_100034608 3300005340 Bacteria 3854
79 Ga0070687_100075811 3300005343 Bacteria 1820
80 Ga0070687_100076885 3300005343 Bacteria 1809
81 Ga0070661_100005909 3300005344 Bacteria 8425
82 Ga0070661_100093593 3300005344 Bacteria 2227
83 Ga0070661_100346673 3300005344 Bacteria 1164
84 Ga0070668_100009964 3300005347 Bacteria 7040
85 Ga0070675_100000203 3300005354 Bacteria 37729
86 Ga0070675_100005491 3300005354 Bacteria 9708
87 Ga0070675_100017687 3300005354 Bacteria 5670
88 Ga0070671_100010136 3300005355 Bacteria 7568
89 Ga0070671_100011587 3300005355 Bacteria 7094
90 Ga0070671_100108908 3300005355 Bacteria 2326
91 Ga0070671_100169807 3300005355 Bacteria 1844
92 Ga0070671_100318780 3300005355 Bacteria 1324
93 Ga0070674_100052167 3300005356 Bacteria 2820
94 Ga0070674_100057781 3300005356 Bacteria 2694
95 Ga0070674_100125280 3300005356 Bacteria 1907
96 Ga0070673_100060820 3300005364 Bacteria 2994
97 Ga0070673_100105185 3300005364 Bacteria 2331
98 Ga0070688_100035286 3300005365 Bacteria 3037
99 Ga0070659_100011689 3300005366 Bacteria 6498
100 Ga0070659_100054814 3300005366 Bacteria 3141
101 Ga0070659_100058177 3300005366 Bacteria 3050
102 Ga0070667_100021414 3300005367 Bacteria 5369
103 Ga0070667_100096863 3300005367 Bacteria 2545
104 Ga0070667_100304029 3300005367 Bacteria 1436
105 Ga0070714_100077741 3300005435 Bacteria 2883
106 Ga0070663_100003487 3300005455 Bacteria 9072
107 Ga0070663_100235793 3300005455 Bacteria 1442
108 Ga0070678_100000925 3300005456 Bacteria 15083
109 Ga0070678_100161723 3300005456 Bacteria 1815
110 Ga0070678_100304817 3300005456 Bacteria 1355
111 Ga0070662_100002619 3300005457 Bacteria 11101
112 Ga0070662_100012490 3300005457 Bacteria 5632
113 Ga0070662_100081276 3300005457 Bacteria 2414
114 Ga0068867_100000036 3300005459 Bacteria 81113
115 Ga0068867_100054879 3300005459 Bacteria 2944
116 Ga0068867_100070233 3300005459 Bacteria 2618
117 Ga0068867_100108564 3300005459 Bacteria 2129
118 Ga0068867_100127254 3300005459 Bacteria 1975
119 Ga0068867_100127629 3300005459 Bacteria 1972
120 Ga0070706_100000719 3300005467 Bacteria 37271
121 Ga0070707_100048898 3300005468 Bacteria 4052
122 Ga0070679_100012792 3300005530 Bacteria 8029
123 Ga0070679_100075705 3300005530 Bacteria 3355
124 Ga0070679_100080076 3300005530 Bacteria 3256
125 Ga0068853_100014870 3300005539 Bacteria 6390
126 Ga0068853_100200363 3300005539 Bacteria 1816
127 Ga0068853_100237170 3300005539 Bacteria 1670
128 Ga0070672_100053623 3300005543 Bacteria 3153
129 Ga0070672_100070303 3300005543 Bacteria 2781
130 Ga0070672_100082186 3300005543 Bacteria 2584
131 Ga0070672_100112051 3300005543 Bacteria 2225
132 Ga0070695_100295728 3300005545 Bacteria 1195
133 Ga0070665_100158221 3300005548 Bacteria 2267
134 Ga0070665_100202071 3300005548 Bacteria 1988
135 Ga0068855_100015898 3300005563 Bacteria 9053
136 Ga0070664_100020774 3300005564 Bacteria 5409
137 Ga0070664_100294451 3300005564 Bacteria 1465
138 Ga0068854_100123553 3300005578 Bacteria 1968
139 Ga0068854_100334182 3300005578 Bacteria 1235
140 Ga0068856_100179611 3300005614 Bacteria 2129
141 Ga0068852_100122083 3300005616 Bacteria 2387
142 Ga0068852_100287369 3300005616 Bacteria 1587
143 Ga0068852_100300940 3300005616 Bacteria 1552
144 Ga0068859_100087739 3300005617 Bacteria 3159
145 Ga0068859_100287334 3300005617 Bacteria 1737
146 Ga0068864_100000196 3300005618 Bacteria 55294
147 Ga0068861_100001918 3300005719 Bacteria 13388
148 Ga0068861_100277618 3300005719 Bacteria 1441
149 Ga0068851_10011910 3300005834 Bacteria 4090
150 Ga0068863_100314491 3300005841 Bacteria 1520
151 Ga0068858_100000578 3300005842 Bacteria 38346
152 Ga0068858_100003067 3300005842 Bacteria 16738
153 Ga0068860_100118065 3300005843 Bacteria 2539
154 Ga0068860_100161066 3300005843 Bacteria 2163
155 Ga0068862_100097108 3300005844 Bacteria 2572
156 Ga0068862_100133296 3300005844 Bacteria 2199
157 Ga0075365_10008212 3300006038 Bacteria 5909
158 Ga0075368_10014592 3300006042 Bacteria 2904
159 Ga0075368_10067103 3300006042 Bacteria 1443
160 Ga0075364_10040717 3300006051 Bacteria 3014
161 Ga0075362_10002462 3300006177 Bacteria 6226
162 Ga0075362_10018548 3300006177 Bacteria 2881
163 Ga0075362_10020327 3300006177 Bacteria 2773
164 Ga0075367_10031303 3300006178 Bacteria 3054
165 Ga0075367_10042274 3300006178 Bacteria 2666
166 Ga0075367_10124082 3300006178 Bacteria 1593
167 Ga0075366_10001452 3300006195 Bacteria 11798
168 Ga0075366_10006086 3300006195 Bacteria 6577
169 Ga0075366_10011562 3300006195 Bacteria 4985
170 Ga0075366_10029907 3300006195 Bacteria 3201
171 Ga0075366_10033364 3300006195 Bacteria 3032
172 Ga0075366_10061328 3300006195 Bacteria 2235
173 Ga0097621_100129536 3300006237 Bacteria 2146
174 Ga0097621_100226926 3300006237 Bacteria 1629
175 Ga0075370_10000620 3300006353 Bacteria 13703
176 Ga0075370_10010931 3300006353 Bacteria 4759
177 Ga0075370_10105034 3300006353 Bacteria 1637
178 Ga0075430_100008182 3300006846 Bacteria 8838
179 Ga0075429_100015843 3300006880 Bacteria 6528
180 Ga0068865_100210001 3300006881 Bacteria 1516
181 Ga0097620_100087729 3300006931 Bacteria 3159
182 Ga0097620_100287349 3300006931 Bacteria 1737
183 Ga0079104_1000012 3300006946 Bacteria 355143
184 Ga0079104_1000170 3300006946 Bacteria 92339
185 Ga0079104_1017203 3300006946 Bacteria 2086
186 Ga0079104_1025121 3300006946 Bacteria 1560
187 Ga0105251_10000298 3300009011 Bacteria 49831
188 Ga0105251_10000578 3300009011 Bacteria 34039
189 Ga0105244_10007870 3300009036 Bacteria 6722
190 Ga0105244_10092900 3300009036 Bacteria 1482
191 Ga0105250_10000214 3300009092 Bacteria 47939
192 Ga0105240_10000945 3300009093 Bacteria 51693
193 Ga0105240_10184155 3300009093 Bacteria 2461
194 Ga0105247_10106168 3300009101 Bacteria 1801
195 Ga0105243_10002148 3300009148 Bacteria 16656
196 Ga0105243_10008147 3300009148 Bacteria 8047
197 Ga0105243_10029092 3300009148 Bacteria 4247
198 Ga0105243_10066692 3300009148 Bacteria 2895
199 Ga0105243_10287379 3300009148 Bacteria 1484
200 Ga0105241_10180813 3300009174 Bacteria 1749
201 Ga0105248_10021617 3300009177 Bacteria 7126
202 Ga0105248_10093998 3300009177 Bacteria 3376
203 Ga0105237_10011900 3300009545 Bacteria 9201
204 Ga0105237_10045591 3300009545 Bacteria 4411
205 Ga0105237_10062346 3300009545 Bacteria 3728
206 Ga0105238_10030518 3300009551 Bacteria 5487
207 Ga0105238_10293595 3300009551 Bacteria 1608
208 Ga0105238_10434781 3300009551 Bacteria 1308
209 Ga0105239_10150700 3300010375 Bacteria 2595
210 Ga0157373_10064705 3300013100 Bacteria 2588
211 Ga0157371_10178122 3300013102 Bacteria 1520
212 Ga0157370_10000583 3300013104 Bacteria 45511
213 Ga0157370_10037869 3300013104 Bacteria 4669
214 Ga0157370_10070544 3300013104 Bacteria 3298
215 Ga0157369_10007613 3300013105 Bacteria 12461
216 Ga0157369_10026376 3300013105 Bacteria 6446
217 Ga0157374_10036523 3300013296 Bacteria 4501
218 Ga0157374_10039525 3300013296 Bacteria 4342
219 Ga0157374_10143374 3300013296 Bacteria 2319
220 Ga0157378_10235571 3300013297 Bacteria 1746
221 Ga0163162_10000817 3300013306 Bacteria 28890
222 Ga0163162_10061068 3300013306 Bacteria 3806
223 Ga0163162_10136950 3300013306 Bacteria 2560
224 Ga0157372_10070826 3300013307 Bacteria 3925
225 Ga0157375_10131913 3300013308 Bacteria 2619
226 Ga0163163_10110969 3300014325 Bacteria 2771
227 Ga0157380_10021561 3300014326 Bacteria 4834
228 Ga0157380_10307617 3300014326 Bacteria 1463
229 Ga0182008_10013567 3300014497 Bacteria 4284
230 Ga0182008_10033037 3300014497 Bacteria 2597
231 Ga0182008_10137599 3300014497 Bacteria 1220
232 Ga0157377_10000036 3300014745 Bacteria 116358
233 Ga0157377_10181049 3300014745 Bacteria 1325
234 Ga0157379_10072333 3300014968 Bacteria 3084
235 Ga0157379_10152287 3300014968 Bacteria 2086
236 Ga0157379_10153651 3300014968 Bacteria 2076
237 Ga0182006_1016005 3300015261 Bacteria 3205
238 Ga0182007_10001643 3300015262 Bacteria 11837
239 Ga0182007_10004201 3300015262 Bacteria 6587
240 Ga0163161_10000533 3300017792 Bacteria 31107
241 Ga0163161_10024309 3300017792 Bacteria 4280
242 Ga0163161_10182948 3300017792 Bacteria 1608
243 Ga0213872_10000023 3300021361 Bacteria 157443
244 Ga0213872_10000033 3300021361 Bacteria 135667
245 Ga0213872_10000226 3300021361 Bacteria 49354
246 Ga0213872_10001044 3300021361 Bacteria 19293
247 Ga0213872_10008848 3300021361 Bacteria 4853
248 Ga0213872_10021420 3300021361 Bacteria 2977
249 Ga0209435_100019 3300025206 Bacteria 260989
250 Ga0209674_100005 3300025226 Bacteria 1708125
251 Ga0209674_100092 3300025226 Bacteria 172272
252 Ga0209672_100001 3300025228 Bacteria 2828210
253 Ga0209672_100561 3300025228 Bacteria 19776
254 Ga0209147_100001 3300025229 Bacteria 2384371
255 Ga0209563_100014 3300025230 Bacteria 940582
256 Ga0209563_103139 3300025230 Bacteria 3497
257 Ga0209258_100001 3300025242 Bacteria 2384269
258 Ga0209258_100020 3300025242 Bacteria 565241
259 Ga0207425_1001908 3300025245 Bacteria 7911
260 Ga0207425_1004700 3300025245 Bacteria 4033
261 Ga0209646_1000038 3300025246 Bacteria 353982
262 Ga0209026_1000048 3300025250 Bacteria 257264
263 Ga0209677_100060 3300025253 Bacteria 155728
264 Ga0209148_1000003 3300025254 Bacteria 2384288
265 Ga0209148_1000031 3300025254 Bacteria 564601
266 Ga0209759_1000038 3300025256 Bacteria 257264
267 Ga0209759_1000053 3300025256 Bacteria 212789
268 Ga0209759_1000342 3300025256 Bacteria 61422
269 Ga0209129_1000055 3300025258 Bacteria 261708
270 Ga0209129_1004101 3300025258 Bacteria 5928
271 Ga0209129_1004821 3300025258 Bacteria 5083
272 Ga0209129_1006445 3300025258 Bacteria 3786
273 Ga0209233_1000204 3300025261 Bacteria 118907
274 Ga0209565_1000041 3300025263 Bacteria 251081
275 Ga0209565_1000807 3300025263 Bacteria 17937
276 Ga0209565_1006087 3300025263 Bacteria 3425
277 Ga0209455_1000001 3300025272 Bacteria 2384278
278 Ga0209673_1000009 3300025273 Bacteria 620735
279 Ga0209673_1001770 3300025273 Bacteria 17941
280 Ga0209130_1000835 3300025284 Bacteria 25749
281 Ga0209130_1000878 3300025284 Bacteria 24573
282 Ga0209130_1001181 3300025284 Bacteria 18680
283 Ga0209130_1001582 3300025284 Bacteria 14304
284 Ga0209130_1007797 3300025284 Bacteria 3251
285 Ga0209675_1000473 3300025291 Bacteria 30855
286 Ga0209675_1001263 3300025291 Bacteria 15156
287 Ga0209675_1003615 3300025291 Bacteria 7263
288 Ga0209675_1010614 3300025291 Bacteria 3128
289 Ga0209675_1011102 3300025291 Bacteria 3009
290 Ga0209675_1026810 3300025291 Bacteria 1427
291 Ga0209676_1000013 3300025292 Bacteria 816080
292 Ga0209676_1000040 3300025292 Bacteria 438184
293 Ga0209676_1000464 3300025292 Bacteria 68185
294 Ga0209676_1000578 3300025292 Bacteria 55144
295 Ga0209676_1003527 3300025292 Bacteria 9539
296 Ga0209676_1009942 3300025292 Bacteria 4030
297 Ga0209025_1000065 3300025294 Bacteria 300915
298 Ga0209025_1000359 3300025294 Bacteria 97475
299 Ga0209025_1000728 3300025294 Bacteria 55852
300 Ga0209025_1001383 3300025294 Bacteria 32383
301 Ga0209025_1007166 3300025294 Bacteria 8419
302 Ga0209025_1013780 3300025294 Bacteria 5047
303 Ga0209025_1014797 3300025294 Bacteria 4764
304 Ga0209025_1020655 3300025294 Bacteria 3587
305 Ga0209025_1060235 3300025294 Bacteria 1427
306 Ga0209564_1000101 3300025295 Bacteria 222879
307 Ga0209564_1000875 3300025295 Bacteria 40039
308 Ga0209564_1001904 3300025295 Bacteria 18680
309 Ga0209564_1011249 3300025295 Bacteria 4029
310 Ga0209564_1016536 3300025295 Bacteria 2928
311 Ga0209758_1000042 3300025297 Bacteria 407145
312 Ga0209758_1000268 3300025297 Bacteria 103231
313 Ga0209758_1003499 3300025297 Bacteria 14183
314 Ga0209758_1013492 3300025297 Bacteria 4448
315 Ga0209050_1000008 3300025298 Bacteria 1144179
316 Ga0209050_1000021 3300025298 Bacteria 574406
317 Ga0209050_1003242 3300025298 Bacteria 12258
318 Ga0209050_1011817 3300025298 Bacteria 4087
319 Ga0209050_1020365 3300025298 Bacteria 2471
320 Ga0209256_1000003 3300025299 Bacteria 1661127
321 Ga0209256_1000271 3300025299 Bacteria 90540
322 Ga0209256_1000454 3300025299 Bacteria 61876
323 Ga0209256_1001042 3300025299 Bacteria 32384
324 Ga0207426_1000091 3300025302 Bacteria 280561
325 Ga0207426_1000659 3300025302 Bacteria 42288
326 Ga0207426_1000842 3300025302 Bacteria 32384
327 Ga0207426_1001760 3300025302 Bacteria 16400
328 Ga0207426_1002540 3300025302 Bacteria 11444
329 Ga0209051_1000004 3300025303 Bacteria 1155596
330 Ga0209051_1000005 3300025303 Bacteria 1142353
331 Ga0209051_1000028 3300025303 Bacteria 404269
332 Ga0209051_1003347 3300025303 Bacteria 10565
333 Ga0209051_1008840 3300025303 Bacteria 5272
334 Ga0209257_1000016 3300025304 Bacteria 908015
335 Ga0209257_1000043 3300025304 Bacteria 512127
336 Ga0209257_1000048 3300025304 Bacteria 455536
337 Ga0209257_1000214 3300025304 Bacteria 136547
338 Ga0209257_1000360 3300025304 Bacteria 92894
339 Ga0209257_1002238 3300025304 Bacteria 19855
340 Ga0209257_1003715 3300025304 Bacteria 12680
341 Ga0209257_1008978 3300025304 Bacteria 5491
342 Ga0209257_1011767 3300025304 Bacteria 4156
343 Ga0209257_1012696 3300025304 Bacteria 3854
344 Ga0207655_1006752 3300025728 Bacteria 7550
345 Ga0207713_1000612 3300025735 Bacteria 35126
346 Ga0207713_1010327 3300025735 Bacteria 5180
347 Ga0207682_10008066 3300025893 Bacteria 4177
348 Ga0207688_10037909 3300025901 Bacteria 2674
349 Ga0207647_10010124 3300025904 Bacteria 6667
350 Ga0207647_10013609 3300025904 Bacteria 5633
351 Ga0207645_10007189 3300025907 Bacteria 7894
352 Ga0207645_10018118 3300025907 Bacteria 4641
353 Ga0207684_10007603 3300025910 Bacteria 9729
354 Ga0207654_10177945 3300025911 Bacteria 1386
355 Ga0207695_10234831 3300025913 Bacteria 1736
356 Ga0207695_10310227 3300025913 Bacteria 1468
357 Ga0207695_10327640 3300025913 Bacteria 1420
358 Ga0207695_10354934 3300025913 Bacteria 1353
359 Ga0207671_10039095 3300025914 Bacteria 3515
360 Ga0207660_10036283 3300025917 Bacteria 3426
361 Ga0207660_10156103 3300025917 Bacteria 1757
362 Ga0207657_10127588 3300025919 Bacteria 2088
363 Ga0207652_10013943 3300025921 Bacteria 6507
364 Ga0207652_10045417 3300025921 Bacteria 3745
365 Ga0207694_10064586 3300025924 Bacteria 2852
366 Ga0207650_10031814 3300025925 Bacteria 3813
367 Ga0207650_10136111 3300025925 Bacteria 1927
368 Ga0207650_10249170 3300025925 Bacteria 1438
369 Ga0207659_10198932 3300025926 Bacteria 1599
370 Ga0207659_10209311 3300025926 Bacteria 1562
371 Ga0207644_10005230 3300025931 Bacteria 8472
372 Ga0207644_10019445 3300025931 Bacteria 4607
373 Ga0207644_10279820 3300025931 Bacteria 1339
374 Ga0207690_10002461 3300025932 Bacteria 11193
375 Ga0207690_10130089 3300025932 Bacteria 1841
376 Ga0207706_10000266 3300025933 Bacteria 56883
377 Ga0207706_10088156 3300025933 Bacteria 2728
378 Ga0207706_10328171 3300025933 Bacteria 1331
379 Ga0207686_10016083 3300025934 Bacteria 4194
380 Ga0207709_10000141 3300025935 Bacteria 101455
381 Ga0207709_10000672 3300025935 Bacteria 27636
382 Ga0207709_10008115 3300025935 Bacteria 5817
383 Ga0207709_10022099 3300025935 Bacteria 3607
384 Ga0207709_10046956 3300025935 Bacteria 2623
385 Ga0207670_10236280 3300025936 Bacteria 1406
386 Ga0207669_10057605 3300025937 Bacteria 2366
387 Ga0207669_10075822 3300025937 Bacteria 2132
388 Ga0207669_10088495 3300025937 Bacteria 2008
389 Ga0207691_10013332 3300025940 Bacteria 7873
390 Ga0207691_10089596 3300025940 Bacteria 2758
391 Ga0207691_10092065 3300025940 Bacteria 2715
392 Ga0207711_10006876 3300025941 Bacteria 9551
393 Ga0207711_10020488 3300025941 Bacteria 5514
394 Ga0207711_10038203 3300025941 Bacteria 4081
395 Ga0207711_10058849 3300025941 Bacteria 3308
396 Ga0207711_10176227 3300025941 Bacteria 1942
397 Ga0207689_10001693 3300025942 Bacteria 20955
398 Ga0207689_10064878 3300025942 Bacteria 3004
399 Ga0207679_10003077 3300025945 Bacteria 10332
400 Ga0207667_10283623 3300025949 Bacteria 1692
401 Ga0207667_10378211 3300025949 Bacteria 1443
402 Ga0207651_10027934 3300025960 Bacteria 3551
403 Ga0207658_10024595 3300025986 Bacteria 4214
404 Ga0207658_10070699 3300025986 Bacteria 2641
405 Ga0207658_10086679 3300025986 Bacteria 2415
406 Ga0207658_10090122 3300025986 Bacteria 2376
407 Ga0207658_10110068 3300025986 Bacteria 2176
408 Ga0207658_10304857 3300025986 Bacteria 1373
409 Ga0207677_10001015 3300026023 Bacteria 15452
410 Ga0207677_10010554 3300026023 Bacteria 5234
411 Ga0207677_10195167 3300026023 Bacteria 1605
412 Ga0207703_10007781 3300026035 Bacteria 8483
413 Ga0207703_10022928 3300026035 Bacteria 4903
414 Ga0207703_10180344 3300026035 Bacteria 1863
415 Ga0207639_10024503 3300026041 Bacteria 4367
416 Ga0207678_10008575 3300026067 Bacteria 9006
417 Ga0207678_10030802 3300026067 Bacteria 4685
418 Ga0207678_10032552 3300026067 Bacteria 4543
419 Ga0207702_10023292 3300026078 Bacteria 5134
420 Ga0207641_10016767 3300026088 Bacteria 5999
421 Ga0207641_10188737 3300026088 Bacteria 1893
422 Ga0207648_10000037 3300026089 Bacteria 120856
423 Ga0207648_10041815 3300026089 Bacteria 4025
424 Ga0207648_10051645 3300026089 Bacteria 3594
425 Ga0207648_10134830 3300026089 Bacteria 2175
426 Ga0207648_10146040 3300026089 Bacteria 2086
427 Ga0207676_10005140 3300026095 Bacteria 9262
428 Ga0207676_10065709 3300026095 Bacteria 2889
429 Ga0207676_10111148 3300026095 Bacteria 2293
430 Ga0207676_10217743 3300026095 Bacteria 1698
431 Ga0207676_10243260 3300026095 Bacteria 1615
432 Ga0207674_10047037 3300026116 Bacteria 4426
433 Ga0207674_10184856 3300026116 Bacteria 2035
434 Ga0207674_10280324 3300026116 Bacteria 1615
435 Ga0207675_100002105 3300026118 Bacteria 19716
436 Ga0207675_100160176 3300026118 Bacteria 2146
437 Ga0207675_100217524 3300026118 Bacteria 1840
438 Ga0207675_100488154 3300026118 Bacteria 1225
439 Ga0207675_100528983 3300026118 Bacteria 1176
440 Ga0207683_10090382 3300026121 Bacteria 2727
441 Ga0207683_10126385 3300026121 Bacteria 2298
442 Ga0207683_10200916 3300026121 Bacteria 1812
443 Ga0207698_10169338 3300026142 Bacteria 1921
444 Ga0209281_1000039 3300027111 Bacteria 355150
445 Ga0209281_1000072 3300027111 Bacteria 273114
446 Ga0209969_1000798 3300027360 Bacteria 4227
447 Ga0209981_1007516 3300027378 Bacteria 1471
448 Ga0209996_1000695 3300027395 Bacteria 4025
449 Ga0209999_1006689 3300027543 Bacteria 2073
450 Ga0209282_1029830 3300027666 Bacteria 3363
451 Ga0209966_1000856 3300027695 Bacteria 5930
452 Ga0268266_10146010 3300028379 Bacteria 2127
453 Ga0268264_10028545 3300028381 Bacteria 4564
454 Ga0268264_10080924 3300028381 Bacteria 2775
455 Ga0268264_10247546 3300028381 Bacteria 1654
456 Ga0307517_10112060 3300028786 Bacteria 2069
457 Ga0307515_10000179 3300028794 Bacteria 156716
458 Ga0307515_10000586 3300028794 Bacteria 85517
459 Ga0307515_10017937 3300028794 Bacteria 12853
460 Ga0307515_10018687 3300028794 Bacteria 12518
461 Ga0307515_10039346 3300028794 Bacteria 7526
462 Ga0307515_10050608 3300028794 Bacteria 6216
463 Ga0307515_10092450 3300028794 Bacteria 3765
464 Ga0307515_10118376 3300028794 Bacteria 3023
465 Ga0307515_10128603 3300028794 Bacteria 2807
466 Ga0307515_10178772 3300028794 Bacteria 2081
467 Ga0307515_10185711 3300028794 Bacteria 2009
468 Ga0265338_10000113 3300028800 Bacteria 150993
469 Ga0307512_10056371 3300030522 Bacteria 3087
470 Ga0307512_10172530 3300030522 Bacteria 1236
471 Ga0265332_10053299 3300031238 Bacteria 1736
472 Ga0265328_10000002 3300031239 Bacteria 275819
473 Ga0265340_10066536 3300031247 Bacteria 1714
474 Ga0265331_10012849 3300031250 Bacteria 4519
475 Ga0265327_10000020 3300031251 Bacteria 424552
476 Ga0265327_10005210 3300031251 Bacteria 10972
477 Ga0307513_10000543 3300031456 Bacteria 53868
478 Ga0307513_10000653 3300031456 Bacteria 49874
479 Ga0307513_10034448 3300031456 Bacteria 5683
480 Ga0307513_10048415 3300031456 Bacteria 4614
481 Ga0307513_10108803 3300031456 Bacteria 2771
482 Ga0307509_10001648 3300031507 Bacteria 37411
483 Ga0307509_10004900 3300031507 Bacteria 18966
484 Ga0307509_10010962 3300031507 Bacteria 11047
485 Ga0307509_10167947 3300031507 Bacteria 2079
486 Ga0307408_100000073 3300031548 Bacteria 113106
487 Ga0307408_100002072 3300031548 Bacteria 14440
488 Ga0307408_100018250 3300031548 Bacteria 4709
489 Ga0307408_100048239 3300031548 Bacteria 3054
490 Ga0307408_100060229 3300031548 Bacteria 2766
491 Ga0307408_100145298 3300031548 Bacteria 1866
492 Ga0307508_10000649 3300031616 Bacteria 41802
493 Ga0307514_10000746 3300031649 Bacteria 55099
494 Ga0307514_10063798 3300031649 Bacteria 2796
495 Ga0307516_10004295 3300031730 Bacteria 17687
496 Ga0307516_10004304 3300031730 Bacteria 17665
497 Ga0307516_10006051 3300031730 Bacteria 14298
498 Ga0307516_10009811 3300031730 Bacteria 10620
499 Ga0307516_10021887 3300031730 Bacteria 6568
500 Ga0307516_10048733 3300031730 Bacteria 4168
501 Ga0307516_10055606 3300031730 Bacteria 3862
502 Ga0307516_10076649 3300031730 Bacteria 3195
503 Ga0307405_10138244 3300031731 Bacteria 1694
504 Ga0307406_10142822 3300031901 Bacteria 1697
505 Ga0307407_10002551 3300031903 Bacteria 7164
506 Ga0307412_10000014 3300031911 Bacteria 353795
507 Ga0307412_10045203 3300031911 Bacteria 2877
508 Ga0307412_10132804 3300031911 Bacteria 1811
509 Ga0307412_10216962 3300031911 Bacteria 1464
510 Ga0307409_100003515 3300031995 Bacteria 8540
511 Ga0307409_100004354 3300031995 Bacteria 7940
512 Ga0307416_100015237 3300032002 Bacteria 5303
513 Ga0307416_100149319 3300032002 Bacteria 2140
514 Ga0307414_10285708 3300032004 Bacteria 1388
515 Ga0307414_10349355 3300032004 Bacteria 1269
516 Ga0307411_10250012 3300032005 Bacteria 1393
517 Ga0307415_100015503 3300032126 Bacteria 4515
518 Ga0307507_10071231 3300033179 Bacteria 3145
519 Ga0307510_10003840 3300033180 Bacteria 17605
520 Ga0307510_10186159 3300033180 Bacteria 1631
521 Ga0373930_0015587 3300034816 Bacteria 1428
522 Ga0373950_0006176 3300034818 Bacteria 1818
523 Ga0373939_0000056 3300035114 Bacteria 39684
524 Ga0373946_0030925 3300035171 Bacteria 2140
525 Ga0373955_0028213 3300035172 Bacteria 2909
526 Ga0373924_0018195 3300035410 Bacteria 2705
527 Ga0373931_0004502 3300035691 Bacteria 6371
528 Ga0373931_0005160 3300035691 Bacteria 6020
529 Ga0373931_0042854 3300035691 Bacteria 2381
530 Ga0373933_0149166 3300035724 Bacteria 1480
531 Ga0373937_0043909 3300036401 Bacteria 4082
532 Ga0373925_0002961 3300037068 Bacteria 13405
533 Ga0395899_0006799 3300037312 Bacteria 8863
534 Ga0395899_0061653 3300037312 Bacteria 2762
535 Ga0395900_0001185 3300037418 Bacteria 32334
536 Ga0395900_0020073 3300037418 Bacteria 6815
537 Ga0395900_0101074 3300037418 Bacteria 2961
538 Ga0395900_0156275 3300037418 Bacteria 2329
539 Ga0395900_0343002 3300037418 Bacteria 1469
540 Ga0395898_0000792 3300037466 Bacteria 53811
541 Ga0395898_0000973 3300037466 Bacteria 45223
542 Ga0395898_0012269 3300037466 Bacteria 8861
543 Ga0395898_0022071 3300037466 Bacteria 6449
544 Ga0395898_0309972 3300037466 Bacteria 1505
545 Ga0395905_0000279 3300037471 Bacteria 75846
546 Ga0395905_0003420 3300037471 Bacteria 16979
547 Ga0395905_0004718 3300037471 Bacteria 14081
548 Ga0395905_0020785 3300037471 Bacteria 6215
549 Ga0395905_0026482 3300037471 Bacteria 5466
550 Ga0395905_0043858 3300037471 Bacteria 4196
551 Ga0395905_0056046 3300037471 Bacteria 3688
552 Ga0395905_0199413 3300037471 Bacteria 1876
553 Ga0395905_0406557 3300037471 Bacteria 1256
554 Ga0395901_0000034 3300038443 Bacteria 230365
555 Ga0395901_0000665 3300038443 Bacteria 39507
556 Ga0395901_0003064 3300038443 Bacteria 16847
557 Ga0395901_0035576 3300038443 Bacteria 5146
558 Ga0395901_0056313 3300038443 Bacteria 4089
559 Ga0395901_0073503 3300038443 Bacteria 3566
560 Ga0395901_0223637 3300038443 Bacteria 1967
561 Ga0436365_0034357 3300039437 Bacteria 1980
562 Ga0436361_0060434 3300039447 Bacteria 165633
563 Ga0436361_0096676 3300039447 Bacteria 32751
564 Ga0436361_0199744 3300039447 Bacteria 17215
565 Ga0436361_0247389 3300039447 Bacteria 2767
566 Ga0436361_0547369 3300039447 Bacteria 17117
567 Ga0436361_0678863 3300039447 Bacteria 3279
568 Ga0436361_1032254 3300039447 Bacteria 5642
569 Ga0436361_1216292 3300039447 Bacteria 2962
570 Ga0439466_0033666 3300041411 Bacteria 1740
571 Ga0451849_0172705 3300041505 Bacteria 1298
572 Ga0451853_3907472 3300041512 Bacteria 2365
573 Ga0439449_0009421 3300042007 Bacteria 3702
574 Ga0439449_0012852 3300042007 Bacteria 3148
575 Ga0450888_001409 3300042126 Bacteria 2300
576 Ga0450890_001891 3300042127 Bacteria 2966
577 Ga0450891_000764 3300042129 Bacteria 3356
578 Ga0450898_000843 3300042134 Bacteria 3816
579 Ga0450898_007899 3300042134 Bacteria 1666
580 Ga0450889_000232 3300042144 Bacteria 6211
581 Ga0439446_0039427 3300042156 Bacteria 1388
582 Ga0439446_0039946 3300042156 Bacteria 1380
583 Ga0439464_0010255 3300042439 Bacteria 2473
584 Ga0450918_000166 3300042531 Bacteria 14753
585 Ga0466969_0000021 3300044656 Bacteria 99939
586 Ga0466969_0018764 3300044656 Bacteria 3600
587 Ga0466969_0040275 3300044656 Bacteria 2340
588 Ga0466972_0000369 3300044658 Bacteria 24350
589 Ga0453683_0001471 3300044673 Bacteria 20249
590 Ga0466966_0017215 3300044684 Bacteria 4778
591 Ga0466961_0014114 3300044693 Bacteria 5125
592 Ga0466963_0018445 3300044694 Bacteria 4363
593 Ga0466964_0021473 3300044706 Bacteria 2497
594 Ga0453684_0074727 3300044712 Bacteria 4265
595 Ga0466971_0008465 3300044719 Bacteria 4487
596 Ga0466968_0035939 3300044735 Bacteria 2074
597 Ga0466970_0080436 3300044765 Bacteria 1761
598 Ga0466970_0091379 3300044765 Bacteria 1652
599 Ga0466957_0011664 3300044842 Bacteria 5078
600 Ga0466957_0088814 3300044842 Bacteria 1934
601 Ga0466960_0007907 3300044901 Bacteria 4339
602 Ga0466959_0000061 3300045049 Bacteria 76186
603 Ga0466959_0000469 3300045049 Bacteria 23529
604 Ga0466959_0074252 3300045049 Bacteria 2459
605 Ga0451576_0007077 3300045051 Bacteria 13550
606 Ga0466958_0067368 3300045836 Bacteria 2187
607 Ga0466967_0340785 3300045976 Bacteria 1450
608 Ga0495627_015304 3300046453 Bacteria 2650
609 Ga0495592_0000202 3300046454 Bacteria 50799
610 Ga0495592_0032830 3300046454 Bacteria 3915
611 Ga0495603_0000061 3300046455 Bacteria 47189
612 Ga0495603_0031531 3300046455 Bacteria 3191
613 Ga0495590_0002144 3300046457 Bacteria 8285
614 Ga0495590_0005540 3300046457 Bacteria 4997
615 Ga0495590_0011292 3300046457 Bacteria 3342
616 Ga0495590_0063850 3300046457 Bacteria 1288
617 Ga0495591_009123 3300046458 Bacteria 3972
618 Ga0495629_0001290 3300046459 Bacteria 19718
619 Ga0495629_0015864 3300046459 Bacteria 5413
620 Ga0495629_0018854 3300046459 Bacteria 4932
621 Ga0495638_0013011 3300046460 Bacteria 5682
622 Ga0495638_0016323 3300046460 Bacteria 4976
623 Ga0495638_0113878 3300046460 Bacteria 1604
624 Ga0495651_0043369 3300046462 Bacteria 3490
625 Ga0495651_0053440 3300046462 Bacteria 3109
626 Ga0495653_0002232 3300046463 Bacteria 15312
627 Ga0495653_0026176 3300046463 Bacteria 4680
628 Ga0495653_0162756 3300046463 Bacteria 1548
629 Ga0495650_0002229 3300046471 Bacteria 16240
630 Ga0495650_0011469 3300046471 Bacteria 4851
631 Ga0495650_0018003 3300046471 Bacteria 3524
632 Ga0495650_0030462 3300046471 Bacteria 2444
633 Ga0495650_0031593 3300046471 Bacteria 2380
634 Ga0495650_0045474 3300046471 Bacteria 1848
635 Ga0495580_0000075 3300046472 Bacteria 62029
636 Ga0495580_0000355 3300046472 Bacteria 37382
637 Ga0495580_0001997 3300046472 Bacteria 17956
638 Ga0495580_0012787 3300046472 Bacteria 6433
639 Ga0495580_0030785 3300046472 Bacteria 3883
640 Ga0495580_0032648 3300046472 Bacteria 3755
641 Ga0495580_0042162 3300046472 Bacteria 3252
642 Ga0495580_0106395 3300046472 Bacteria 1948
643 Ga0495582_0005669 3300046473 Bacteria 6951
644 Ga0495582_0017765 3300046473 Bacteria 3888
645 Ga0495582_0051825 3300046473 Bacteria 2263
646 Ga0495605_0028150 3300046474 Bacteria 2903
647 Ga0495605_0075258 3300046474 Bacteria 1588
648 Ga0495662_0059380 3300046476 Bacteria 1847
649 Ga0495662_0082641 3300046476 Bacteria 1563
650 Ga0495664_0000846 3300046477 Bacteria 15733
651 Ga0495664_0019967 3300046477 Bacteria 3859
652 Ga0495664_0020748 3300046477 Bacteria 3792
653 Ga0495664_0044914 3300046477 Bacteria 2619
654 Ga0495664_0080875 3300046477 Bacteria 1947
655 Ga0495664_0136046 3300046477 Bacteria 1489
656 Ga0495584_0018764 3300046491 Bacteria 3516
657 Ga0495596_0038280 3300046500 Bacteria 1896
658 Ga0495607_0072024 3300046501 Bacteria 1925
659 Ga0495583_0000470 3300046506 Bacteria 59563
660 Ga0495606_0026665 3300046507 Bacteria 4115
661 Ga0495606_0036127 3300046507 Bacteria 3370
662 Ga0495606_0061003 3300046507 Bacteria 2413
663 Ga0495608_0013295 3300046511 Bacteria 5712
664 Ga0495608_0027175 3300046511 Bacteria 3895
665 Ga0495610_0019484 3300046512 Bacteria 3794
666 Ga0495616_0001957 3300046513 Bacteria 13861
667 Ga0495618_0015758 3300046514 Bacteria 4614
668 Ga0495620_0011888 3300046515 Bacteria 4523
669 Ga0495628_0003215 3300046516 Bacteria 14648
670 Ga0495628_0005256 3300046516 Bacteria 11353
671 Ga0495628_0032735 3300046516 Bacteria 4195
672 Ga0495628_0062926 3300046516 Bacteria 2907
673 Ga0495630_0007675 3300046517 Bacteria 7713
674 Ga0495630_0015204 3300046517 Bacteria 5615
675 Ga0495631_0001674 3300046518 Bacteria 13181
676 Ga0495632_0019929 3300046519 Bacteria 3644
677 Ga0495637_0038887 3300046520 Bacteria 2057
678 Ga0495644_0051136 3300046523 Bacteria 1551
679 Ga0495648_0003206 3300046524 Bacteria 14517
680 Ga0495648_0021111 3300046524 Bacteria 4520
681 Ga0495648_0067028 3300046524 Bacteria 2101
682 Ga0495648_0120442 3300046524 Bacteria 1411
683 Ga0495666_0000352 3300046526 Bacteria 20167
684 Ga0495666_0006489 3300046526 Bacteria 5890
685 Ga0495666_0017082 3300046526 Bacteria 3613
686 Ga0495666_0036648 3300046526 Bacteria 2388
687 Ga0495642_0019286 3300046528 Bacteria 2673
688 Ga0495642_0027241 3300046528 Bacteria 2273
689 Ga0495652_0000989 3300046529 Bacteria 32515
690 Ga0495652_0053204 3300046529 Bacteria 3451
691 Ga0495652_0109225 3300046529 Bacteria 2227
692 Ga0495652_0144497 3300046529 Bacteria 1867
693 Ga0495654_0000313 3300046530 Bacteria 42607
694 Ga0495654_0029804 3300046530 Bacteria 2781
695 Ga0495654_0048656 3300046530 Bacteria 2079
696 Ga0495665_0001524 3300046531 Bacteria 12356
697 Ga0495665_0025108 3300046531 Bacteria 3202
698 Ga0495640_0057527 3300046533 Bacteria 2653
699 Ga0495586_0000331 3300046535 Bacteria 29858
700 Ga0495621_0049996 3300046539 Bacteria 1493
701 Ga0495597_0000324 3300046542 Bacteria 43211
702 Ga0495597_0003579 3300046542 Bacteria 8964
703 Ga0495597_0026975 3300046542 Bacteria 2637
704 Ga0495645_0001024 3300046543 Bacteria 19022
705 Ga0495645_0042991 3300046543 Bacteria 3296
706 Ga0495645_0047836 3300046543 Bacteria 3116
707 Ga0495645_0048319 3300046543 Bacteria 3100
708 Ga0495645_0058444 3300046543 Bacteria 2797
709 Ga0495645_0068506 3300046543 Bacteria 2561
710 Ga0495667_0060510 3300046559 Bacteria 2484
711 Ga0495634_0001775 3300046642 Bacteria 18665
712 Ga0495634_0009389 3300046642 Bacteria 7215
713 Ga0495634_0020262 3300046642 Bacteria 4718
714 Ga0495634_0026729 3300046642 Bacteria 4025
715 Ga0495634_0073505 3300046642 Bacteria 2248
716 Ga0495625_0003699 3300046660 Bacteria 14950
717 Ga0495625_0005064 3300046660 Bacteria 12200
718 Ga0495625_0025052 3300046660 Bacteria 4529
719 Ga0495635_0033976 3300046663 Bacteria 3538
720 Ga0495661_0015426 3300046665 Bacteria 5099
721 Ga0495588_0061469 3300046674 Bacteria 1945
722 Ga0495599_0001618 3300046678 Bacteria 12986
723 Ga0495599_0058871 3300046678 Bacteria 2403
724 Ga0495599_0072650 3300046678 Bacteria 2147
725 Ga0495599_0083127 3300046678 Bacteria 2000
726 Ga0495623_0017258 3300046679 Bacteria 4663
727 Ga0495623_0020002 3300046679 Bacteria 4327
728 Ga0495623_0020188 3300046679 Bacteria 4306
729 Ga0495646_0002604 3300046680 Bacteria 11126
730 Ga0495658_0046179 3300046683 Bacteria 2448
731 Ga0495669_0026207 3300046684 Bacteria 2546
732 Ga0495669_0097566 3300046684 Bacteria 1363
733 Ga0495613_0010110 3300046689 Bacteria 7012
734 Ga0495613_0102309 3300046689 Bacteria 2068
735 Ga0495624_0000363 3300046690 Bacteria 36049
736 Ga0495624_0003119 3300046690 Bacteria 12390
737 Ga0495624_0053935 3300046690 Bacteria 2536
738 Ga0495671_0009412 3300046692 Bacteria 5455
739 Ga0495671_0057883 3300046692 Bacteria 1918
740 Ga0495671_0081281 3300046692 Bacteria 1588
741 Ga0495671_0089492 3300046692 Bacteria 1507
742 Ga0495649_0000822 3300046694 Bacteria 24937
743 Ga0495649_0006905 3300046694 Bacteria 7022
744 Ga0495649_0052374 3300046694 Bacteria 2211
745 Ga0495589_0014850 3300046794 Bacteria 4006
746 Ga0495589_0044084 3300046794 Bacteria 2219
747 Ga0495600_0016905 3300046809 Bacteria 4637
748 Ga0495600_0140725 3300046809 Bacteria 1566
749 Ga0495660_0044360 3300046810 Bacteria 2446
750 Ga0495660_0045874 3300046810 Bacteria 2398
751 Ga0495660_0072937 3300046810 Bacteria 1817
752 Ga0495581_0003283 3300047315 Bacteria 9282
753 Ga0495581_0013366 3300047315 Bacteria 4760
754 Ga0495604_0011468 3300047317 Bacteria 7037
755 Ga0495604_0048049 3300047317 Bacteria 3320
756 Ga0495604_0058536 3300047317 Bacteria 2959
757 Ga0495636_0019618 3300047318 Bacteria 2720
758 Ga0495674_0001528 3300047319 Bacteria 22619
759 Ga0495674_0007431 3300047319 Bacteria 10470
760 Ga0495674_0263813 3300047319 Bacteria 1414
761 Ga0495672_0067805 3300047320 Bacteria 2031
762 Ga0495676_0046071 3300047321 Bacteria 3544
763 Ga0495676_0047219 3300047321 Bacteria 3484
764 Ga0495676_0056190 3300047321 Bacteria 3114
765 Ga0495676_0056442 3300047321 Bacteria 3105
766 Ga0495680_0001067 3300047322 Bacteria 30366
767 Ga0495680_0069956 3300047322 Bacteria 2677
768 Ga0495680_0108499 3300047322 Bacteria 2060
769 Ga0495680_0152553 3300047322 Bacteria 1683
770 Ga0495683_0000982 3300047323 Bacteria 19938
771 Ga0495683_0001226 3300047323 Bacteria 17482
772 Ga0495683_0026673 3300047323 Bacteria 2956
773 Ga0495683_0034431 3300047323 Bacteria 2576
774 Ga0495687_000011 3300047443 Bacteria 397225
775 Ga0495687_004295 3300047443 Bacteria 9723
776 Ga0495687_010847 3300047443 Bacteria 4951
777 Ga0495687_023976 3300047443 Bacteria 2908
778 Ga0495675_0003465 3300047444 Bacteria 9507
779 Ga0495675_0021774 3300047444 Bacteria 4083
780 Ga0495675_0033807 3300047444 Bacteria 3263
781 Ga0495675_0037275 3300047444 Bacteria 3096
782 Ga0495675_0127393 3300047444 Bacteria 1584
783 Ga0495679_004005 3300047446 Bacteria 6931
784 Ga0495679_013721 3300047446 Bacteria 3027
785 Ga0495673_0001480 3300047469 Bacteria 18590
786 Ga0495673_0023528 3300047469 Bacteria 2995
787 Ga0495684_0031937 3300047471 Bacteria 4042
788 Ga0495684_0033437 3300047471 Bacteria 3943
789 Ga0495684_0141904 3300047471 Bacteria 1801
790 Ga0495686_0000014 3300047472 Bacteria 474014
791 Ga0495686_0000951 3300047472 Bacteria 35821
792 Ga0495686_0003264 3300047472 Bacteria 14218
793 Ga0495686_0052381 3300047472 Bacteria 2559
794 Ga0495593_0008899 3300047673 Bacteria 5827
795 Ga0495593_0012509 3300047673 Bacteria 4849
796 Ga0495593_0054467 3300047673 Bacteria 2108
797 Ga0495593_0096547 3300047673 Bacteria 1518
798 Ga0495602_0000840 3300048088 Bacteria 29575
799 Ga0495602_0019126 3300048088 Bacteria 6812
800 Ga0495602_0051840 3300048088 Bacteria 3650
801 Ga0495602_0086976 3300048088 Bacteria 2607
802 Ga0495614_0000415 3300048089 Bacteria 17457
803 Ga0496100_0025511 3300048903 Bacteria 3615
804 Ga0496100_0097154 3300048903 Bacteria 2022
805 Ga0496101_0020204 3300048904 Bacteria 4554
806 Ga0496101_0039935 3300048904 Bacteria 3341
807 Ga0496101_0135901 3300048904 Bacteria 1871
808 Ga0496102_0002932 3300048905 Bacteria 14477
809 Ga0496102_0014445 3300048905 Bacteria 6862
810 Ga0496102_0036848 3300048905 Bacteria 4408
811 Ga0496102_0042312 3300048905 Bacteria 4128
812 Ga0496103_0003880 3300048906 Bacteria 9094
813 Ga0496103_0015711 3300048906 Bacteria 4512
814 Ga0496103_0056558 3300048906 Bacteria 2435
815 Ga0496103_0156163 3300048906 Bacteria 1462
816 Ga0496103_0214917 3300048906 Bacteria 1236
817 Ga0496104_0011855 3300048907 Bacteria 7825
818 Ga0496104_0126711 3300048907 Bacteria 2452
819 Ga0496105_0067134 3300048908 Bacteria 2961
820 Ga0496105_0076845 3300048908 Bacteria 2757
821 Ga0496106_0000031 3300048909 Bacteria 135370
822 Ga0496106_0027500 3300048909 Bacteria 4236
823 Ga0496106_0055318 3300048909 Bacteria 2999
824 Ga0496107_0044529 3300048910 Bacteria 3190
825 Ga0496107_0054459 3300048910 Bacteria 2887
826 Ga0496107_0063931 3300048910 Bacteria 2667
827 Ga0496109_0247860 3300048912 Bacteria 1677
828 Ga0496110_0010964 3300048913 Bacteria 7394
829 Ga0496110_0105996 3300048913 Bacteria 2522
830 Ga0496111_0020171 3300048914 Bacteria 4638
831 Ga0496112_0012551 3300048915 Bacteria 7784
832 Ga0496112_0134973 3300048915 Bacteria 2438
833 Ga0496113_0027379 3300048916 Bacteria 4087
834 Ga0496113_0087884 3300048916 Bacteria 2390
835 Ga0496114_0001956 3300048917 Bacteria 15672
836 Ga0496114_0039800 3300048917 Bacteria 3890
837 Ga0496114_0310684 3300048917 Bacteria 1392
838 Ga0496115_0060206 3300048918 Bacteria 3059
839 Ga0496116_0018304 3300048919 Bacteria 5405
840 Ga0496116_0041241 3300048919 Bacteria 3169
841 Ga0496116_0062584 3300048919 Bacteria 2402
842 Ga0496117_0003214 3300048920 Bacteria 19309
843 Ga0496117_0021232 3300048920 Bacteria 5262
844 Ga0496117_0022484 3300048920 Bacteria 5056
845 Ga0496117_0025830 3300048920 Bacteria 4606
846 Ga0496117_0066755 3300048920 Bacteria 2438
847 Ga0496117_0102829 3300048920 Bacteria 1802
848 Ga0496117_0120039 3300048920 Bacteria 1617
849 Ga0496117_0124770 3300048920 Bacteria 1574
850 Ga0496118_0000282 3300048921 Bacteria 89232
851 Ga0496118_0020881 3300048921 Bacteria 5791
852 Ga0496118_0061068 3300048921 Bacteria 2794
853 Ga0496118_0087064 3300048921 Bacteria 2168
854 Ga0496119_0129341 3300048922 Bacteria 1378
855 Ga0496121_0000166 3300048924 Bacteria 145051
856 Ga0496121_0000978 3300048924 Bacteria 51196
857 Ga0496121_0005335 3300048924 Bacteria 16526
858 Ga0496121_0021965 3300048924 Bacteria 6221
859 Ga0496121_0032610 3300048924 Bacteria 4731
860 Ga0496121_0039151 3300048924 Bacteria 4184
861 Ga0496121_0078972 3300048924 Bacteria 2614
862 Ga0496121_0247476 3300048924 Bacteria 1238
863 Ga0496122_0000080 3300048925 Bacteria 212397
864 Ga0496122_0154867 3300048925 Bacteria 1408
865 Ga0496123_0000072 3300048926 Bacteria 198524
866 Ga0496123_0056457 3300048926 Bacteria 2566
867 Ga0496123_0133206 3300048926 Bacteria 1372
868 Ga0496124_0000388 3300048927 Bacteria 80485
869 Ga0496124_0003175 3300048927 Bacteria 20312
870 Ga0496124_0057750 3300048927 Bacteria 3268
871 Ga0496124_0091590 3300048927 Bacteria 2477
872 Ga0496124_0140919 3300048927 Bacteria 1903
873 Ga0496125_0007888 3300048928 Bacteria 11243
874 Ga0496125_0013117 3300048928 Bacteria 8171
875 Ga0496125_0044880 3300048928 Bacteria 3729
876 Ga0496125_0182520 3300048928 Bacteria 1396
877 Ga0496126_0002411 3300048929 Bacteria 25348
878 Ga0496126_0003835 3300048929 Bacteria 18607
879 Ga0496126_0006864 3300048929 Bacteria 12621
880 Ga0496126_0177709 3300048929 Bacteria 1810
881 Ga0495682_0001086 3300049460 Bacteria 15952
882 Ga0495682_0003755 3300049460 Bacteria 6680
883 Ga0501294_002318 3300049517 Bacteria 1819
884 Ga0501032_0025224 3300049569 Bacteria 4099
885 Ga0501038_0025134 3300049574 Bacteria 5310
886 Ga0501043_0000012 3300049579 Bacteria 188907
887 Ga0501046_0000030 3300049580 Bacteria 187803
888 Ga0501047_0001222 3300049581 Bacteria 25487
889 Ga0501069_0057421 3300049585 Bacteria 2169
890 Ga0501070_0012507 3300049586 Bacteria 7159
891 Ga0501074_0013990 3300049590 Bacteria 5832
892 Ga0501198_000003 3300049649 Bacteria 175301
893 Ga0501222_000014 3300049662 Bacteria 83609
894 Ga0501223_005994 3300049663 Bacteria 2528
895 Ga0501265_000615 3300049762 Bacteria 3841
896 Ga0501266_001410 3300049763 Bacteria 3069
897 Ga0501035_0072640 3300049822 Bacteria 3045
898 Ga0501045_0031337 3300049824 Bacteria 3851
899 nmdc:mga00v17_20131_c1 3300050491 Bacteria 3819
900 nmdc:mga00v17_31607_c1 3300050491 Bacteria 3123
901 nmdc:mga0yw44_19466_c1 3300050492 Bacteria 3745
902 nmdc:mga0k408_177875_c1 3300050493 Bacteria 1269
903 nmdc:mga0k408_18366_c1 3300050493 Bacteria 3903
904 nmdc:mga0k408_2047_c1 3300050493 Bacteria 10780
905 nmdc:mga0k408_41038_c1 3300050493 Bacteria 2664
906 nmdc:mga0k408_54783_c1 3300050493 Bacteria 2312
907 nmdc:mga0k408_7277_c1 3300050493 Bacteria 4095
908 nmdc:mga0k408_72968_c1 3300050493 Bacteria 2005
909 nmdc:mga0k408_91249_c1 3300050493 Bacteria 1790
910 nmdc:mga07m45_14324_c1 3300050496 Bacteria 4222
911 nmdc:mga07m45_22816_c1 3300050496 Bacteria 3419
912 nmdc:mga07m45_32984_c1 3300050496 Bacteria 2874
913 nmdc:mga07m45_42024_c1 3300050496 Bacteria 2562
914 nmdc:mga05p37_523886_c1 3300050507 Bacteria 1355
915 Ga0495619_0157217 3300053085 Bacteria 1569
916 Ga0500646_0009218 3300053090 Bacteria 2527
917 Ga0500651_0000420 3300053093 Bacteria 22746
918 Ga0500571_000013 3300053110 Bacteria 71532
919 Ga0500593_007015 3300053117 Bacteria 4554
920 Ga0500594_0000195 3300053118 Bacteria 15186
921 Ga0500597_021317 3300053120 Bacteria 2559
922 Ga0500607_012134 3300053121 Bacteria 5069
923 Ga0500608_008747 3300053122 Bacteria 4271
924 Ga0500655_001318 3300053133 Bacteria 4705
925 Ga0500658_0000012 3300053134 Bacteria 160010
926 Ga0500658_0000799 3300053134 Bacteria 13053
927 Ga0500658_0002681 3300053134 Bacteria 6842
928 Ga0500658_0035960 3300053134 Bacteria 1963
929 Ga0500559_0002514 3300053136 Bacteria 9423
930 Ga0500559_0036011 3300053136 Bacteria 2139
931 Ga0500568_0001449 3300053139 Bacteria 15231
932 Ga0500573_0012096 3300053140 Bacteria 4843
933 Ga0500616_0034450 3300053153 Bacteria 2757
934 Ga0500636_0059561 3300053177 Bacteria 2231
935 Ga0500645_000061 3300053730 Bacteria 85703
936 Ga0500645_011337 3300053730 Bacteria 2915
937 Ga0500645_022110 3300053730 Bacteria 1959
938 Ga0590071_002714 3300059421 Bacteria 4437
939 Ga0466962_0018907 3300061719 Bacteria 3310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_0135901 Ga0496101_0135901_22_936 302
2 3300028800 Ga0265338_10000113 Ga0265338_1000011342 327
3 3300031238 Ga0265332_10053299 Ga0265332_100532991 327
4 3300031247 Ga0265340_10066536 Ga0265340_100665361 327
5 3300048924 Ga0496121_0000978 Ga0496121_0000978_14894_15898 327
6 3300048929 Ga0496126_0003835 Ga0496126_0003835_5040_6044 327
7 3300005331 Ga0070670_100063696 Ga0070670_1000636963 329
8 3300025926 Ga0207659_10198932 Ga0207659_101989322 329
9 3300026095 Ga0207676_10243260 Ga0207676_102432602 329
10 3300026142 Ga0207698_10169338 Ga0207698_101693382 330
11 3300048906 Ga0496103_0156163 Ga0496103_0156163_13_1038 332
12 3300048922 Ga0496119_0129341 Ga0496119_0129341_29_1054 332
13 3300026116 Ga0207674_10184856 Ga0207674_101848562 335
14 3300013104 Ga0157370_10037869 Ga0157370_100378692 337
15 3300035171 Ga0373946_0030925 Ga0373946_0030925_995_2125 337
16 3300035172 Ga0373955_0028213 Ga0373955_0028213_866_1996 337
17 3300035410 Ga0373924_0018195 Ga0373924_0018195_383_1513 337
18 3300035724 Ga0373933_0149166 Ga0373933_0149166_124_1254 337
19 3300036401 Ga0373937_0043909 Ga0373937_0043909_1339_2469 337
20 3300046477 Ga0495664_0136046 Ga0495664_0136046_225_1355 337
21 3300047471 Ga0495684_0031937 Ga0495684_0031937_849_1979 337
22 3300048920 Ga0496117_0120039 Ga0496117_0120039_526_1566 337
23 3300046477 Ga0495664_0080875 Ga0495664_0080875_512_1558 338
24 3300003781 Ga0055536_1009279 Ga0055536_10092795 339
25 3300009148 Ga0105243_10008147 Ga0105243_100081476 339
26 3300025292 Ga0209676_1000464 Ga0209676_100046430 339
27 3300025303 Ga0209051_1003347 Ga0209051_10033475 339
28 3300025935 Ga0207709_10000141 Ga0207709_1000014127 339
29 3300041411 Ga0439466_0033666 Ga0439466_0033666_26_1045 339
30 3300044842 Ga0466957_0088814 Ga0466957_0088814_768_1919 340
31 3300025925 Ga0207650_10031814 Ga0207650_100318143 343
32 3300025941 Ga0207711_10058849 Ga0207711_100588493 343
33 3300026095 Ga0207676_10111148 Ga0207676_101111483 343
34 3300037312 Ga0395899_0061653 Ga0395899_0061653_1243_2310 343
35 3300037418 Ga0395900_0101074 Ga0395900_0101074_266_1333 343
36 3300037466 Ga0395898_0309972 Ga0395898_0309972_249_1316 343
37 3300038443 Ga0395901_0003064 Ga0395901_0003064_14734_15801 343
38 3300005564 Ga0070664_100294451 Ga0070664_1002944512 344
39 3300025933 Ga0207706_10088156 Ga0207706_100881563 344
40 3300048924 Ga0496121_0000166 Ga0496121_0000166_67595_68731 344
41 3300050491 nmdc:mga00v17_31607_c1 nmdc:mga00v17_31607_c1_796_1926 344
42 3300005335 Ga0070666_10067889 Ga0070666_100678891 345
43 3300005343 Ga0070687_100075811 Ga0070687_1000758112 345
44 3300005347 Ga0070668_100009964 Ga0070668_1000099647 345
45 3300005367 Ga0070667_100021414 Ga0070667_1000214146 345
46 3300005616 Ga0068852_100300940 Ga0068852_1003009402 345
47 3300005844 Ga0068862_100133296 Ga0068862_1001332963 345
48 3300009148 Ga0105243_10029092 Ga0105243_100290923 345
49 3300025935 Ga0207709_10022099 Ga0207709_100220991 345
50 3300026095 Ga0207676_10217743 Ga0207676_102177432 345
51 iso_pu_bacteria 2885198086 2885202471 345
52 iso_pu_bacteria 2885211737 2885216124 345
53 iso_pu_bacteria 2899924645 2899929792 345
54 iso_pu_bacteria 2928044640 2928050036 345
55 iso_pu_bacteria 2928051484 2928054617 345
56 iso_pu_bacteria 2928064002 2928070204 345
57 iso_pu_bacteria 2928070936 2928074133 345
58 3300005343 Ga0070687_100076885 Ga0070687_1000768851 347
59 3300005543 Ga0070672_100070303 Ga0070672_1000703033 347
60 3300005617 Ga0068859_100287334 Ga0068859_1002873343 347
61 3300005842 Ga0068858_100003067 Ga0068858_1000030672 347
62 3300006931 Ga0097620_100287349 Ga0097620_1002873491 347
63 3300014326 Ga0157380_10021561 Ga0157380_100215612 347
64 3300025940 Ga0207691_10013332 Ga0207691_100133322 347
65 3300026035 Ga0207703_10007781 Ga0207703_100077817 347
66 3300028381 Ga0268264_10028545 Ga0268264_100285452 347
67 3300039447 Ga0436361_0247389 Ga0436361_0247389_1614_2720 347
68 3300009545 Ga0105237_10062346 Ga0105237_100623464 349
69 3300031507 Ga0307509_10001648 Ga0307509_1000164817 349
70 3300031649 Ga0307514_10063798 Ga0307514_100637983 349
71 3300033180 Ga0307510_10003840 Ga0307510_1000384011 349
72 3300046454 Ga0495592_0000202 Ga0495592_0000202_48619_49761 349
73 3300046519 Ga0495632_0019929 Ga0495632_0019929_623_1738 349
74 3300046542 Ga0495597_0026975 Ga0495597_0026975_1012_2127 349
75 3300046660 Ga0495625_0025052 Ga0495625_0025052_3045_4160 349
76 3300046694 Ga0495649_0006905 Ga0495649_0006905_1125_2240 349
77 3300046810 Ga0495660_0044360 Ga0495660_0044360_1126_2241 349
78 3300047443 Ga0495687_004295 Ga0495687_004295_6866_7981 349
79 3300048905 Ga0496102_0002932 Ga0496102_0002932_2230_3345 349
80 3300053134 Ga0500658_0035960 Ga0500658_0035960_105_1220 349
81 3300053730 Ga0500645_022110 Ga0500645_022110_91_1233 349
82 3300028786 Ga0307517_10112060 Ga0307517_101120602 350
83 3300028794 Ga0307515_10185711 Ga0307515_101857113 350
84 3300050496 nmdc:mga07m45_32984_c1 nmdc:mga07m45_32984_c1_154_1269 350
85 iso_pu_bacteria 2929160207 2929160834 350
86 iso_pu_bacteria 2929160207 2929162304 350
87 3300005338 Ga0068868_100125503 Ga0068868_1001255032 351
88 3300005364 Ga0070673_100060820 Ga0070673_1000608202 351
89 3300005367 Ga0070667_100304029 Ga0070667_1003040292 351
90 3300005455 Ga0070663_100235793 Ga0070663_1002357931 351
91 3300005539 Ga0068853_100200363 Ga0068853_1002003632 351
92 3300006042 Ga0075368_10014592 Ga0075368_100145922 351
93 3300006042 Ga0075368_10067103 Ga0075368_100671032 351
94 3300006051 Ga0075364_10040717 Ga0075364_100407173 351
95 3300006177 Ga0075362_10018548 Ga0075362_100185483 351
96 3300006178 Ga0075367_10042274 Ga0075367_100422742 351
97 3300006195 Ga0075366_10061328 Ga0075366_100613283 351
98 3300006353 Ga0075370_10000620 Ga0075370_100006205 351
99 3300009545 Ga0105237_10011900 Ga0105237_100119007 351
100 3300014326 Ga0157380_10307617 Ga0157380_103076172 351
101 3300025913 Ga0207695_10310227 Ga0207695_103102272 351
102 3300025914 Ga0207671_10039095 Ga0207671_100390952 351
103 3300025942 Ga0207689_10064878 Ga0207689_100648783 351
104 3300025986 Ga0207658_10304857 Ga0207658_103048572 351
105 3300026023 Ga0207677_10195167 Ga0207677_101951672 351
106 3300026067 Ga0207678_10032552 Ga0207678_100325523 351
107 3300026118 Ga0207675_100217524 Ga0207675_1002175242 351
108 3300031730 Ga0307516_10076649 Ga0307516_100766493 351
109 3300048905 Ga0496102_0042312 Ga0496102_0042312_1531_2619 351
110 3300050491 nmdc:mga00v17_20131_c1 nmdc:mga00v17_20131_c1_896_2011 351
111 3300050493 nmdc:mga0k408_18366_c1 nmdc:mga0k408_18366_c1_2335_3450 351
112 3300050493 nmdc:mga0k408_54783_c1 nmdc:mga0k408_54783_c1_88_1203 351
113 3300050496 nmdc:mga07m45_22816_c1 nmdc:mga07m45_22816_c1_320_1435 351
114 3300005459 Ga0068867_100054879 Ga0068867_1000548793 352
115 3300005719 Ga0068861_100277618 Ga0068861_1002776181 352
116 3300006881 Ga0068865_100210001 Ga0068865_1002100012 352
117 3300026118 Ga0207675_100528983 Ga0207675_1005289831 352
118 3300031456 Ga0307513_10108803 Ga0307513_101088033 352
119 iso_pu_bacteria 2831265667 2831270758 352
120 iso_pu_bacteria 2839138175 2839141103 352
121 iso_pu_bacteria 2501025504 2501413779 353
122 3300005338 Ga0068868_100263391 Ga0068868_1002633912 355
123 3300005543 Ga0070672_100053623 Ga0070672_1000536234 355
124 3300005578 Ga0068854_100123553 Ga0068854_1001235533 355
125 3300025931 Ga0207644_10005230 Ga0207644_100052302 355
126 3300025934 Ga0207686_10016083 Ga0207686_100160832 355
127 3300031548 Ga0307408_100145298 Ga0307408_1001452982 356
128 3300039447 Ga0436361_0678863 Ga0436361_0678863_1809_2924 356
129 3300050493 nmdc:mga0k408_177875_c1 nmdc:mga0k408_177875_c1_176_1246 356
130 3300053085 Ga0495619_0157217 Ga0495619_0157217_473_1558 356
131 3300001989 JGI24739J22299_10002019 JGI24739J22299_100020197 357
132 3300002075 JGI24738J21930_10005717 JGI24738J21930_100057173 357
133 3300009551 Ga0105238_10293595 Ga0105238_102935951 357
134 3300025904 Ga0207647_10013609 Ga0207647_100136093 357
135 3300025913 Ga0207695_10327640 Ga0207695_103276401 357
136 3300025949 Ga0207667_10378211 Ga0207667_103782112 357
137 3300026116 Ga0207674_10280324 Ga0207674_102803241 357
138 3300031911 Ga0307412_10000014 Ga0307412_1000001434 357
139 3300046474 Ga0495605_0028150 Ga0495605_0028150_659_1801 357
140 3300046507 Ga0495606_0026665 Ga0495606_0026665_1263_2405 357
141 3300046528 Ga0495642_0019286 Ga0495642_0019286_55_1197 357
142 3300046794 Ga0495589_0044084 Ga0495589_0044084_399_1541 357
143 3300047323 Ga0495683_0026673 Ga0495683_0026673_132_1274 357
144 3300048920 Ga0496117_0025830 Ga0496117_0025830_1720_2862 357
145 3300048921 Ga0496118_0000282 Ga0496118_0000282_34382_35512 358
146 3300005459 Ga0068867_100000036 Ga0068867_10000003671 360
147 3300009148 Ga0105243_10002148 Ga0105243_100021482 360
148 3300014745 Ga0157377_10000036 Ga0157377_100000367 360
149 3300025935 Ga0207709_10008115 Ga0207709_100081152 360
150 3300026089 Ga0207648_10000037 Ga0207648_1000003771 360
151 3300046457 Ga0495590_0005540 Ga0495590_0005540_313_1455 360
152 3300046810 Ga0495660_0072937 Ga0495660_0072937_32_1174 360
153 3300003567 Ga0006554J51385_1036275 Ga0006554J51385_10362751 361
154 3300009093 Ga0105240_10184155 Ga0105240_101841553 361
155 3300025226 Ga0209674_100005 Ga0209674_1000051436 361
156 3300025228 Ga0209672_100001 Ga0209672_1000011834 361
157 3300025229 Ga0209147_100001 Ga0209147_1000011834 361
158 3300025230 Ga0209563_103139 Ga0209563_1031394 361
159 3300025242 Ga0209258_100001 Ga0209258_1000011834 361
160 3300025254 Ga0209148_1000003 Ga0209148_10000031834 361
161 3300025261 Ga0209233_1000204 Ga0209233_100020448 361
162 3300025272 Ga0209455_1000001 Ga0209455_10000011834 361
163 3300025913 Ga0207695_10354934 Ga0207695_103549342 361
164 3300046454 Ga0495592_0032830 Ga0495592_0032830_2626_3768 361
165 3300046473 Ga0495582_0005669 Ga0495582_0005669_2364_3506 361
166 3300046477 Ga0495664_0020748 Ga0495664_0020748_52_1194 361
167 3300046511 Ga0495608_0027175 Ga0495608_0027175_602_1744 361
168 3300046516 Ga0495628_0062926 Ga0495628_0062926_1567_2709 361
169 3300046526 Ga0495666_0006489 Ga0495666_0006489_2950_4092 361
170 3300046529 Ga0495652_0053204 Ga0495652_0053204_1832_2974 361
171 3300046533 Ga0495640_0057527 Ga0495640_0057527_232_1374 361
172 3300046543 Ga0495645_0042991 Ga0495645_0042991_1809_2951 361
173 3300046642 Ga0495634_0009389 Ga0495634_0009389_2707_3849 361
174 3300046679 Ga0495623_0020002 Ga0495623_0020002_1098_2240 361
175 3300047315 Ga0495581_0013366 Ga0495581_0013366_1945_3087 361
176 3300047319 Ga0495674_0263813 Ga0495674_0263813_190_1332 361
177 3300047321 Ga0495676_0047219 Ga0495676_0047219_1632_2774 361
178 3300047444 Ga0495675_0037275 Ga0495675_0037275_260_1402 361
179 3300047471 Ga0495684_0141904 Ga0495684_0141904_136_1278 361
180 3300047673 Ga0495593_0008899 Ga0495593_0008899_2981_4123 361
181 3300048088 Ga0495602_0051840 Ga0495602_0051840_1569_2711 361
182 iso_pu_bacteria 2744054900 2746091747 361
183 3300009011 Ga0105251_10000298 Ga0105251_1000029829 362
184 3300025735 Ga0207713_1000612 Ga0207713_100061220 362
185 3300046455 Ga0495603_0000061 Ga0495603_0000061_17783_18925 362
186 3300046459 Ga0495629_0018854 Ga0495629_0018854_863_2005 362
187 3300046460 Ga0495638_0113878 Ga0495638_0113878_242_1354 362
188 3300046463 Ga0495653_0002232 Ga0495653_0002232_13083_14225 362
189 3300046472 Ga0495580_0000075 Ga0495580_0000075_31783_32925 362
190 3300046472 Ga0495580_0042162 Ga0495580_0042162_493_1635 362
191 3300046473 Ga0495582_0017765 Ga0495582_0017765_1573_2715 362
192 3300046476 Ga0495662_0059380 Ga0495662_0059380_498_1640 362
193 3300046477 Ga0495664_0019967 Ga0495664_0019967_1634_2776 362
194 3300046506 Ga0495583_0000470 Ga0495583_0000470_31213_32325 362
195 3300046507 Ga0495606_0036127 Ga0495606_0036127_765_1877 362
196 3300046516 Ga0495628_0003215 Ga0495628_0003215_3182_4324 362
197 3300046516 Ga0495628_0032735 Ga0495628_0032735_1297_2409 362
198 3300046517 Ga0495630_0015204 Ga0495630_0015204_3339_4481 362
199 3300046524 Ga0495648_0003206 Ga0495648_0003206_13081_14223 362
200 3300046524 Ga0495648_0021111 Ga0495648_0021111_1795_2907 362
201 3300046524 Ga0495648_0067028 Ga0495648_0067028_642_1784 362
202 3300046526 Ga0495666_0000352 Ga0495666_0000352_2867_4009 362
203 3300046529 Ga0495652_0000989 Ga0495652_0000989_28151_29293 362
204 3300046529 Ga0495652_0109225 Ga0495652_0109225_794_1936 362
205 3300046531 Ga0495665_0001524 Ga0495665_0001524_3310_4452 362
206 3300046535 Ga0495586_0000331 Ga0495586_0000331_8088_9230 362
207 3300046543 Ga0495645_0048319 Ga0495645_0048319_1103_2245 362
208 3300046642 Ga0495634_0001775 Ga0495634_0001775_14429_15571 362
209 3300046678 Ga0495599_0001618 Ga0495599_0001618_10930_12072 362
210 3300046679 Ga0495623_0017258 Ga0495623_0017258_863_2005 362
211 3300046680 Ga0495646_0002604 Ga0495646_0002604_903_2045 362
212 3300046689 Ga0495613_0010110 Ga0495613_0010110_1122_2264 362
213 3300046690 Ga0495624_0000363 Ga0495624_0000363_27003_28145 362
214 3300046690 Ga0495624_0003119 Ga0495624_0003119_8852_9964 362
215 3300046694 Ga0495649_0000822 Ga0495649_0000822_2598_3710 362
216 3300047315 Ga0495581_0003283 Ga0495581_0003283_6367_7509 362
217 3300047317 Ga0495604_0011468 Ga0495604_0011468_1128_2270 362
218 3300047317 Ga0495604_0058536 Ga0495604_0058536_997_2139 362
219 3300047319 Ga0495674_0001528 Ga0495674_0001528_18383_19525 362
220 3300047319 Ga0495674_0007431 Ga0495674_0007431_2427_3539 362
221 3300047320 Ga0495672_0067805 Ga0495672_0067805_812_1924 362
222 3300047321 Ga0495676_0056190 Ga0495676_0056190_856_1998 362
223 3300047322 Ga0495680_0001067 Ga0495680_0001067_18772_19914 362
224 3300047322 Ga0495680_0152553 Ga0495680_0152553_39_1181 362
225 3300047323 Ga0495683_0034431 Ga0495683_0034431_693_1805 362
226 3300047444 Ga0495675_0003465 Ga0495675_0003465_1290_2432 362
227 3300047444 Ga0495675_0033807 Ga0495675_0033807_1822_2964 362
228 3300047446 Ga0495679_004005 Ga0495679_004005_4645_5787 362
229 3300047469 Ga0495673_0001480 Ga0495673_0001480_13032_14144 362
230 3300047471 Ga0495684_0033437 Ga0495684_0033437_2566_3708 362
231 3300047673 Ga0495593_0054467 Ga0495593_0054467_326_1468 362
232 3300048088 Ga0495602_0000840 Ga0495602_0000840_27299_28441 362
233 3300048088 Ga0495602_0019126 Ga0495602_0019126_1142_2284 362
234 3300048089 Ga0495614_0000415 Ga0495614_0000415_15165_16307 362
235 3300048920 Ga0496117_0102829 Ga0496117_0102829_556_1698 362
236 3300048929 Ga0496126_0006864 Ga0496126_0006864_8847_9989 362
237 3300049460 Ga0495682_0001086 Ga0495682_0001086_2424_3536 362
238 3300053134 Ga0500658_0000012 Ga0500658_0000012_50241_51356 362
239 3300005295 Ga0065707_10087951 Ga0065707_100879515 363
240 iso_pu_bacteria 2842718218 2842720633 363
241 3300046472 Ga0495580_0012787 Ga0495580_0012787_2565_3719 365
242 3300037471 Ga0395905_0026482 Ga0395905_0026482_742_1845 366
243 iso_pu_bacteria 2939631187 2939634357 366
244 iso_pu_bacteria 2511231002 2511245322 367
245 iso_pu_bacteria 2513020051 2513226765 367
246 iso_pu_bacteria 2515154122 2515679466 367
247 iso_pu_bacteria 2585428062 2587757756 367
248 iso_pu_bacteria 2599185214 2599622234 367
249 iso_pu_bacteria 2599185226 2599676943 367
250 iso_pu_bacteria 2599185227 2599680359 367
251 iso_pu_bacteria 2599185229 2599692375 367
252 iso_pu_bacteria 2643221544 2643741685 367
253 iso_pu_bacteria 2643221585 2643934954 367
254 iso_pu_bacteria 2643221609 2644058381 367
255 iso_pu_bacteria 2643221611 2644073432 367
256 iso_pu_bacteria 2643221639 2644220470 367
257 iso_pu_bacteria 2643221644 2644246692 367
258 iso_pu_bacteria 2643221646 2644259394 367
259 iso_pu_bacteria 2643221654 2644303826 367
260 iso_pu_bacteria 2643221656 2644316441 367
261 iso_pu_bacteria 2643221658 2644326423 367
262 iso_pu_bacteria 2643221683 2644469538 367
263 iso_pu_bacteria 2721755523 2722881162 367
264 iso_pu_bacteria 2738541277 2738719474 367
265 iso_pu_bacteria 2738541277 2738723664 367
266 iso_pu_bacteria 2738541307 2738884529 367
267 iso_pu_bacteria 2738541337 2739053629 367
268 iso_pu_bacteria 2738543012 2739247015 367
269 iso_pu_bacteria 2738543019 2739283704 367
270 iso_pu_bacteria 2738543019 2739284395 367
271 iso_pu_bacteria 2816332133 2816469705 367
272 iso_pu_bacteria 2818991446 2819598972 367
273 iso_pu_bacteria 2838054893 2838058806 367
274 iso_pu_bacteria 2842733646 2842738607 367
275 iso_pu_bacteria 2842747753 2842750027 367
276 iso_pu_bacteria 2902682994 2902689253 367
277 iso_pu_bacteria 2928037797 2928042267 367
278 iso_pu_bacteria 2928084124 2928086393 367
279 iso_pu_bacteria 2929160207 2929168459 367
280 iso_pu_bacteria 2945909444 2945915669 367
281 iso_pu_bacteria 2945945610 2945950327 367
282 iso_pu_bacteria 2945984333 2945988898 367
283 iso_pu_bacteria 2974320154 2974321788 367
284 iso_pu_bacteria 8020953355 8020953811 367
285 iso_pu_bacteria 2508501125 2509129341 368
286 iso_pu_bacteria 2510917014 2511094952 368
287 iso_pu_bacteria 2510917015 2511104611 368
288 iso_pu_bacteria 2513237082 2513551527 368
289 iso_pu_bacteria 2513237083 2513560177 368
290 iso_pu_bacteria 2513237151 2513962505 368
291 iso_pu_bacteria 2515154189 2516016934 368
292 iso_pu_bacteria 2526164713 2527079095 368
293 iso_pu_bacteria 2600255067 2600813634 368
294 iso_pu_bacteria 2738541296 2738820161 368
295 iso_pu_bacteria 2738541298 2738832641 368
296 iso_pu_bacteria 2738541306 2738874168 368
297 iso_pu_bacteria 2738543002 2739185798 368
298 iso_pu_bacteria 2738543008 2739220766 368
299 iso_pu_bacteria 2744054901 2746093867 368
300 iso_pu_bacteria 2744054901 2746095357 368
301 iso_pu_bacteria 2751185846 2753565827 368
302 iso_pu_bacteria 2818991450 2819620826 368
303 iso_pu_bacteria 2842454564 2842462087 368
304 iso_pu_bacteria 2857357740 2857366482 368
305 iso_pu_bacteria 2883087390 2883094692 368
306 iso_pu_bacteria 2900634093 2900636288 368
307 iso_pu_bacteria 2928108538 2928109626 368
308 iso_pu_bacteria 2928115317 2928118897 368
309 iso_pu_bacteria 2928135762 2928136920 368
310 iso_pu_bacteria 2928503688 2928506448 368
311 iso_pu_bacteria 2945934425 2945935378 368
312 iso_pu_bacteria 2990703756 2990704071 368
313 iso_pu_bacteria 641736151 642422228 368
314 iso_pu_bacteria 641736151 642425835 368
315 iso_pu_bacteria 642555113 642620255 368
316 iso_pu_bacteria 8003955200 8003957444 368
317 3300005366 Ga0070659_100058177 Ga0070659_1000581772 370
318 3300005435 Ga0070714_100077741 Ga0070714_1000777411 370
319 3300006038 Ga0075365_10008212 Ga0075365_100082126 370
320 3300037471 Ga0395905_0043858 Ga0395905_0043858_717_1835 370
321 3300049569 Ga0501032_0025224 Ga0501032_0025224_1905_3032 370
322 3300049574 Ga0501038_0025134 Ga0501038_0025134_3710_4837 370
323 3300049585 Ga0501069_0057421 Ga0501069_0057421_990_2117 370
324 3300049586 Ga0501070_0012507 Ga0501070_0012507_1714_2841 370
325 3300049590 Ga0501074_0013990 Ga0501074_0013990_3866_4993 370
326 3300050492 nmdc:mga0yw44_19466_c1 nmdc:mga0yw44_19466_c1_2310_3440 370
327 3300050493 nmdc:mga0k408_7277_c1 nmdc:mga0k408_7277_c1_33_1163 370
328 3300002704 JGI25155J39150_1000042 JGI25155J39150_100004261 371
329 3300002705 JGI25156J39149_1000053 JGI25156J39149_100005320 371
330 3300002738 JGI25154J39366_1000082 JGI25154J39366_100008220 371
331 3300002741 JGI25157J39369_1000072 JGI25157J39369_100007261 371
332 3300002774 JGI25150J39212_1002959 JGI25150J39212_10029591 371
333 3300002987 JGI25159J45721_1003277 JGI25159J45721_10032772 371
334 3300003187 JGI25151J46595_10009109 JGI25151J46595_100091096 371
335 3300003187 JGI25151J46595_10023163 JGI25151J46595_100231633 371
336 3300003187 JGI25151J46595_10053555 JGI25151J46595_100535551 371
337 3300003215 JGI25153J46596_10001249 JGI25153J46596_1000124913 371
338 3300003347 JGI26128J50194_1000014 JGI26128J50194_10000146 371
339 3300003354 JGI25160J50197_1000188 JGI25160J50197_100018818 371
340 3300003374 JGI25161J50226_1000007 JGI25161J50226_100000761 371
341 3300003578 Ga0006562J51391_1047714 Ga0006562J51391_10477141 371
342 3300003578 Ga0006562J51391_1047716 Ga0006562J51391_10477162 371
343 3300003762 Ga0055542_1000013 Ga0055542_100001325 371
344 3300003771 Ga0055526_1012883 Ga0055526_10128833 371
345 3300003771 Ga0055526_1015140 Ga0055526_10151401 371
346 3300003771 Ga0055526_1023769 Ga0055526_10237693 371
347 3300003773 Ga0055537_1005041 Ga0055537_10050413 371
348 3300003775 Ga0055524_1000148 Ga0055524_100014843 371
349 3300003775 Ga0055524_1000213 Ga0055524_100021348 371
350 3300003781 Ga0055536_1000526 Ga0055536_100052613 371
351 3300003781 Ga0055536_1028413 Ga0055536_10284132 371
352 3300003781 Ga0055536_1028847 Ga0055536_10288471 371
353 3300003784 Ga0055534_1000726 Ga0055534_100072613 371
354 3300003784 Ga0055534_1002320 Ga0055534_10023202 371
355 3300003784 Ga0055534_1003088 Ga0055534_10030883 371
356 3300003790 Ga0055528_1007035 Ga0055528_10070352 371
357 3300003790 Ga0055528_1011042 Ga0055528_10110423 371
358 3300003791 Ga0055530_10000233 Ga0055530_100002335 371
359 3300003791 Ga0055530_10007767 Ga0055530_100077672 371
360 3300003791 Ga0055530_10007960 Ga0055530_100079604 371
361 3300003791 Ga0055530_10008285 Ga0055530_100082851 371
362 3300003792 Ga0055540_1000018 Ga0055540_1000018115 371
363 3300003792 Ga0055540_1000176 Ga0055540_100017640 371
364 3300003794 Ga0055531_10000135 Ga0055531_1000013561 371
365 3300003794 Ga0055531_10000850 Ga0055531_1000085013 371
366 3300003794 Ga0055531_10002836 Ga0055531_100028367 371
367 3300003794 Ga0055531_10007099 Ga0055531_100070995 371
368 3300003794 Ga0055531_10043465 Ga0055531_100434651 371
369 3300003794 Ga0055531_10043509 Ga0055531_100435091 371
370 3300004625 Ga0055543_1000842 Ga0055543_10008423 371
371 3300005262 Ga0065165_1013122 Ga0065165_10131221 371
372 3300005262 Ga0065165_1025541 Ga0065165_10255411 371
373 3300005328 Ga0070676_10019022 Ga0070676_100190224 371
374 3300005328 Ga0070676_10044513 Ga0070676_100445133 371
375 3300005331 Ga0070670_100083241 Ga0070670_1000832412 371
376 3300005331 Ga0070670_100300305 Ga0070670_1003003051 371
377 3300005334 Ga0068869_100004605 Ga0068869_1000046054 371
378 3300005334 Ga0068869_100091722 Ga0068869_1000917221 371
379 3300005334 Ga0068869_100276724 Ga0068869_1002767241 371
380 3300005337 Ga0070682_100080255 Ga0070682_1000802552 371
381 3300005338 Ga0068868_100002058 Ga0068868_10000205811 371
382 3300005338 Ga0068868_100049592 Ga0068868_1000495921 371
383 3300005339 Ga0070660_100156926 Ga0070660_1001569261 371
384 3300005340 Ga0070689_100034608 Ga0070689_1000346084 371
385 3300005344 Ga0070661_100005909 Ga0070661_1000059095 371
386 3300005344 Ga0070661_100093593 Ga0070661_1000935932 371
387 3300005344 Ga0070661_100346673 Ga0070661_1003466731 371
388 3300005354 Ga0070675_100000203 Ga0070675_10000020325 371
389 3300005354 Ga0070675_100005491 Ga0070675_10000549110 371
390 3300005354 Ga0070675_100017687 Ga0070675_1000176874 371
391 3300005355 Ga0070671_100010136 Ga0070671_1000101363 371
392 3300005355 Ga0070671_100011587 Ga0070671_1000115875 371
393 3300005355 Ga0070671_100108908 Ga0070671_1001089082 371
394 3300005355 Ga0070671_100169807 Ga0070671_1001698072 371
395 3300005355 Ga0070671_100318780 Ga0070671_1003187801 371
396 3300005356 Ga0070674_100052167 Ga0070674_1000521673 371
397 3300005356 Ga0070674_100057781 Ga0070674_1000577811 371
398 3300005356 Ga0070674_100125280 Ga0070674_1001252801 371
399 3300005364 Ga0070673_100105185 Ga0070673_1001051853 371
400 3300005365 Ga0070688_100035286 Ga0070688_1000352863 371
401 3300005366 Ga0070659_100011689 Ga0070659_1000116895 371
402 3300005366 Ga0070659_100054814 Ga0070659_1000548143 371
403 3300005367 Ga0070667_100096863 Ga0070667_1000968633 371
404 3300005455 Ga0070663_100003487 Ga0070663_1000034872 371
405 3300005456 Ga0070678_100000925 Ga0070678_1000009253 371
406 3300005456 Ga0070678_100161723 Ga0070678_1001617232 371
407 3300005456 Ga0070678_100304817 Ga0070678_1003048171 371
408 3300005457 Ga0070662_100002619 Ga0070662_1000026193 371
409 3300005457 Ga0070662_100012490 Ga0070662_1000124905 371
410 3300005457 Ga0070662_100081276 Ga0070662_1000812761 371
411 3300005459 Ga0068867_100070233 Ga0068867_1000702333 371
412 3300005459 Ga0068867_100108564 Ga0068867_1001085642 371
413 3300005459 Ga0068867_100127254 Ga0068867_1001272542 371
414 3300005459 Ga0068867_100127629 Ga0068867_1001276292 371
415 3300005530 Ga0070679_100012792 Ga0070679_1000127928 371
416 3300005530 Ga0070679_100075705 Ga0070679_1000757053 371
417 3300005539 Ga0068853_100014870 Ga0068853_1000148702 371
418 3300005539 Ga0068853_100237170 Ga0068853_1002371702 371
419 3300005543 Ga0070672_100082186 Ga0070672_1000821863 371
420 3300005545 Ga0070695_100295728 Ga0070695_1002957281 371
421 3300005548 Ga0070665_100158221 Ga0070665_1001582211 371
422 3300005548 Ga0070665_100202071 Ga0070665_1002020712 371
423 3300005563 Ga0068855_100015898 Ga0068855_1000158989 371
424 3300005564 Ga0070664_100020774 Ga0070664_1000207743 371
425 3300005578 Ga0068854_100334182 Ga0068854_1003341822 371
426 3300005614 Ga0068856_100179611 Ga0068856_1001796111 371
427 3300005616 Ga0068852_100122083 Ga0068852_1001220831 371
428 3300005616 Ga0068852_100287369 Ga0068852_1002873691 371
429 3300005617 Ga0068859_100087739 Ga0068859_1000877392 371
430 3300005618 Ga0068864_100000196 Ga0068864_10000019621 371
431 3300005719 Ga0068861_100001918 Ga0068861_1000019183 371
432 3300005834 Ga0068851_10011910 Ga0068851_100119102 371
433 3300005841 Ga0068863_100314491 Ga0068863_1003144911 371
434 3300005842 Ga0068858_100000578 Ga0068858_10000057817 371
435 3300005843 Ga0068860_100118065 Ga0068860_1001180653 371
436 3300005843 Ga0068860_100161066 Ga0068860_1001610662 371
437 3300005844 Ga0068862_100097108 Ga0068862_1000971083 371
438 3300006177 Ga0075362_10002462 Ga0075362_100024624 371
439 3300006177 Ga0075362_10020327 Ga0075362_100203272 371
440 3300006178 Ga0075367_10031303 Ga0075367_100313032 371
441 3300006178 Ga0075367_10124082 Ga0075367_101240822 371
442 3300006195 Ga0075366_10001452 Ga0075366_100014529 371
443 3300006195 Ga0075366_10006086 Ga0075366_100060863 371
444 3300006195 Ga0075366_10011562 Ga0075366_100115625 371
445 3300006195 Ga0075366_10029907 Ga0075366_100299074 371
446 3300006195 Ga0075366_10033364 Ga0075366_100333643 371
447 3300006237 Ga0097621_100129536 Ga0097621_1001295362 371
448 3300006237 Ga0097621_100226926 Ga0097621_1002269262 371
449 3300006353 Ga0075370_10010931 Ga0075370_100109313 371
450 3300006353 Ga0075370_10105034 Ga0075370_101050342 371
451 3300006880 Ga0075429_100015843 Ga0075429_1000158431 371
452 3300006931 Ga0097620_100087729 Ga0097620_1000877293 371
453 3300006946 Ga0079104_1000012 Ga0079104_1000012238 371
454 3300006946 Ga0079104_1000170 Ga0079104_100017040 371
455 3300006946 Ga0079104_1017203 Ga0079104_10172032 371
456 3300006946 Ga0079104_1025121 Ga0079104_10251211 371
457 3300009036 Ga0105244_10007870 Ga0105244_100078704 371
458 3300009036 Ga0105244_10092900 Ga0105244_100929001 371
459 3300009092 Ga0105250_10000214 Ga0105250_1000021435 371
460 3300009093 Ga0105240_10000945 Ga0105240_1000094540 371
461 3300009148 Ga0105243_10066692 Ga0105243_100666921 371
462 3300009148 Ga0105243_10287379 Ga0105243_102873791 371
463 3300009174 Ga0105241_10180813 Ga0105241_101808131 371
464 3300009177 Ga0105248_10021617 Ga0105248_100216174 371
465 3300009545 Ga0105237_10045591 Ga0105237_100455912 371
466 3300009551 Ga0105238_10030518 Ga0105238_100305184 371
467 3300010375 Ga0105239_10150700 Ga0105239_101507003 371
468 3300013100 Ga0157373_10064705 Ga0157373_100647053 371
469 3300013102 Ga0157371_10178122 Ga0157371_101781221 371
470 3300013104 Ga0157370_10000583 Ga0157370_1000058339 371
471 3300013104 Ga0157370_10070544 Ga0157370_100705442 371
472 3300013105 Ga0157369_10026376 Ga0157369_100263766 371
473 3300013296 Ga0157374_10039525 Ga0157374_100395254 371
474 3300013296 Ga0157374_10143374 Ga0157374_101433743 371
475 3300013297 Ga0157378_10235571 Ga0157378_102355711 371
476 3300013306 Ga0163162_10061068 Ga0163162_100610684 371
477 3300013306 Ga0163162_10136950 Ga0163162_101369502 371
478 3300013307 Ga0157372_10070826 Ga0157372_100708265 371
479 3300013308 Ga0157375_10131913 Ga0157375_101319133 371
480 3300014325 Ga0163163_10110969 Ga0163163_101109692 371
481 3300014497 Ga0182008_10013567 Ga0182008_100135671 371
482 3300014497 Ga0182008_10033037 Ga0182008_100330373 371
483 3300014745 Ga0157377_10181049 Ga0157377_101810491 371
484 3300014968 Ga0157379_10072333 Ga0157379_100723332 371
485 3300014968 Ga0157379_10152287 Ga0157379_101522872 371
486 3300014968 Ga0157379_10153651 Ga0157379_101536512 371
487 3300015261 Ga0182006_1016005 Ga0182006_10160052 371
488 3300015262 Ga0182007_10001643 Ga0182007_100016433 371
489 3300017792 Ga0163161_10000533 Ga0163161_100005333 371
490 3300017792 Ga0163161_10024309 Ga0163161_100243093 371
491 3300017792 Ga0163161_10182948 Ga0163161_101829481 371
492 3300021361 Ga0213872_10000033 Ga0213872_10000033103 371
493 3300021361 Ga0213872_10000226 Ga0213872_1000022632 371
494 3300021361 Ga0213872_10021420 Ga0213872_100214204 371
495 3300025206 Ga0209435_100019 Ga0209435_100019152 371
496 3300025228 Ga0209672_100561 Ga0209672_1005618 371
497 3300025242 Ga0209258_100020 Ga0209258_100020180 371
498 3300025245 Ga0207425_1001908 Ga0207425_10019085 371
499 3300025245 Ga0207425_1004700 Ga0207425_10047004 371
500 3300025246 Ga0209646_1000038 Ga0209646_1000038153 371
501 3300025250 Ga0209026_1000048 Ga0209026_1000048152 371
502 3300025254 Ga0209148_1000031 Ga0209148_1000031180 371
503 3300025256 Ga0209759_1000038 Ga0209759_100003892 371
504 3300025258 Ga0209129_1000055 Ga0209129_100005526 371
505 3300025258 Ga0209129_1004101 Ga0209129_10041015 371
506 3300025258 Ga0209129_1004821 Ga0209129_10048215 371
507 3300025258 Ga0209129_1006445 Ga0209129_10064454 371
508 3300025263 Ga0209565_1000041 Ga0209565_10000414 371
509 3300025263 Ga0209565_1000807 Ga0209565_10008078 371
510 3300025263 Ga0209565_1006087 Ga0209565_10060874 371
511 3300025273 Ga0209673_1000009 Ga0209673_10000097 371
512 3300025273 Ga0209673_1001770 Ga0209673_10017708 371
513 3300025284 Ga0209130_1000835 Ga0209130_100083520 371
514 3300025284 Ga0209130_1000878 Ga0209130_100087818 371
515 3300025284 Ga0209130_1001181 Ga0209130_10011815 371
516 3300025284 Ga0209130_1001582 Ga0209130_10015825 371
517 3300025284 Ga0209130_1007797 Ga0209130_10077973 371
518 3300025291 Ga0209675_1000473 Ga0209675_10004739 371
519 3300025291 Ga0209675_1001263 Ga0209675_100126312 371
520 3300025291 Ga0209675_1003615 Ga0209675_10036157 371
521 3300025291 Ga0209675_1010614 Ga0209675_10106143 371
522 3300025291 Ga0209675_1011102 Ga0209675_10111024 371
523 3300025291 Ga0209675_1026810 Ga0209675_10268101 371
524 3300025292 Ga0209676_1000013 Ga0209676_1000013239 371
525 3300025292 Ga0209676_1000040 Ga0209676_100004080 371
526 3300025292 Ga0209676_1000578 Ga0209676_100057825 371
527 3300025292 Ga0209676_1003527 Ga0209676_10035277 371
528 3300025292 Ga0209676_1009942 Ga0209676_10099423 371
529 3300025294 Ga0209025_1000065 Ga0209025_1000065124 371
530 3300025294 Ga0209025_1000359 Ga0209025_100035969 371
531 3300025294 Ga0209025_1000728 Ga0209025_100072813 371
532 3300025294 Ga0209025_1001383 Ga0209025_10013835 371
533 3300025294 Ga0209025_1007166 Ga0209025_10071665 371
534 3300025294 Ga0209025_1013780 Ga0209025_10137802 371
535 3300025294 Ga0209025_1014797 Ga0209025_10147972 371
536 3300025294 Ga0209025_1020655 Ga0209025_10206555 371
537 3300025294 Ga0209025_1060235 Ga0209025_10602351 371
538 3300025295 Ga0209564_1000101 Ga0209564_10001015 371
539 3300025295 Ga0209564_1000875 Ga0209564_100087534 371
540 3300025295 Ga0209564_1001904 Ga0209564_100190414 371
541 3300025295 Ga0209564_1011249 Ga0209564_10112492 371
542 3300025295 Ga0209564_1016536 Ga0209564_10165362 371
543 3300025297 Ga0209758_1000042 Ga0209758_1000042334 371
544 3300025297 Ga0209758_1000268 Ga0209758_100026843 371
545 3300025297 Ga0209758_1003499 Ga0209758_10034996 371
546 3300025297 Ga0209758_1013492 Ga0209758_10134922 371
547 3300025298 Ga0209050_1000008 Ga0209050_1000008239 371
548 3300025298 Ga0209050_1000021 Ga0209050_1000021313 371
549 3300025298 Ga0209050_1003242 Ga0209050_10032426 371
550 3300025298 Ga0209050_1011817 Ga0209050_10118172 371
551 3300025298 Ga0209050_1020365 Ga0209050_10203653 371
552 3300025299 Ga0209256_1000003 Ga0209256_1000003162 371
553 3300025299 Ga0209256_1000271 Ga0209256_100027135 371
554 3300025299 Ga0209256_1000454 Ga0209256_10004545 371
555 3300025299 Ga0209256_1001042 Ga0209256_10010425 371
556 3300025302 Ga0207426_1000091 Ga0207426_1000091159 371
557 3300025302 Ga0207426_1000659 Ga0207426_10006595 371
558 3300025302 Ga0207426_1000842 Ga0207426_10008425 371
559 3300025302 Ga0207426_1002540 Ga0207426_10025407 371
560 3300025303 Ga0209051_1000004 Ga0209051_1000004843 371
561 3300025303 Ga0209051_1000005 Ga0209051_1000005239 371
562 3300025303 Ga0209051_1000028 Ga0209051_1000028199 371
563 3300025303 Ga0209051_1008840 Ga0209051_10088405 371
564 3300025304 Ga0209257_1000016 Ga0209257_1000016535 371
565 3300025304 Ga0209257_1000043 Ga0209257_1000043308 371
566 3300025304 Ga0209257_1000048 Ga0209257_1000048239 371
567 3300025304 Ga0209257_1000214 Ga0209257_1000214116 371
568 3300025304 Ga0209257_1000360 Ga0209257_100036014 371
569 3300025304 Ga0209257_1002238 Ga0209257_100223814 371
570 3300025304 Ga0209257_1003715 Ga0209257_10037155 371
571 3300025304 Ga0209257_1008978 Ga0209257_10089785 371
572 3300025304 Ga0209257_1011767 Ga0209257_10117673 371
573 3300025304 Ga0209257_1012696 Ga0209257_10126965 371
574 3300025728 Ga0207655_1006752 Ga0207655_10067525 371
575 3300025893 Ga0207682_10008066 Ga0207682_100080661 371
576 3300025901 Ga0207688_10037909 Ga0207688_100379093 371
577 3300025907 Ga0207645_10007189 Ga0207645_100071893 371
578 3300025907 Ga0207645_10018118 Ga0207645_100181183 371
579 3300025911 Ga0207654_10177945 Ga0207654_101779451 371
580 3300025913 Ga0207695_10234831 Ga0207695_102348311 371
581 3300025917 Ga0207660_10036283 Ga0207660_100362833 371
582 3300025919 Ga0207657_10127588 Ga0207657_101275883 371
583 3300025921 Ga0207652_10013943 Ga0207652_100139437 371
584 3300025921 Ga0207652_10045417 Ga0207652_100454172 371
585 3300025924 Ga0207694_10064586 Ga0207694_100645863 371
586 3300025925 Ga0207650_10249170 Ga0207650_102491702 371
587 3300025926 Ga0207659_10209311 Ga0207659_102093111 371
588 3300025931 Ga0207644_10019445 Ga0207644_100194455 371
589 3300025931 Ga0207644_10279820 Ga0207644_102798202 371
590 3300025932 Ga0207690_10002461 Ga0207690_100024615 371
591 3300025932 Ga0207690_10130089 Ga0207690_101300891 371
592 3300025933 Ga0207706_10000266 Ga0207706_100002664 371
593 3300025935 Ga0207709_10000672 Ga0207709_1000067220 371
594 3300025935 Ga0207709_10046956 Ga0207709_100469563 371
595 3300025936 Ga0207670_10236280 Ga0207670_102362802 371
596 3300025937 Ga0207669_10057605 Ga0207669_100576053 371
597 3300025937 Ga0207669_10075822 Ga0207669_100758222 371
598 3300025937 Ga0207669_10088495 Ga0207669_100884951 371
599 3300025940 Ga0207691_10089596 Ga0207691_100895962 371
600 3300025940 Ga0207691_10092065 Ga0207691_100920652 371
601 3300025941 Ga0207711_10006876 Ga0207711_100068769 371
602 3300025941 Ga0207711_10020488 Ga0207711_100204885 371
603 3300025941 Ga0207711_10038203 Ga0207711_100382034 371
604 3300025942 Ga0207689_10001693 Ga0207689_1000169320 371
605 3300025945 Ga0207679_10003077 Ga0207679_100030777 371
606 3300025960 Ga0207651_10027934 Ga0207651_100279343 371
607 3300025986 Ga0207658_10024595 Ga0207658_100245952 371
608 3300025986 Ga0207658_10070699 Ga0207658_100706992 371
609 3300025986 Ga0207658_10086679 Ga0207658_100866792 371
610 3300025986 Ga0207658_10110068 Ga0207658_101100682 371
611 3300026023 Ga0207677_10001015 Ga0207677_1000101511 371
612 3300026023 Ga0207677_10010554 Ga0207677_100105544 371
613 3300026035 Ga0207703_10022928 Ga0207703_100229283 371
614 3300026035 Ga0207703_10180344 Ga0207703_101803441 371
615 3300026041 Ga0207639_10024503 Ga0207639_100245033 371
616 3300026067 Ga0207678_10008575 Ga0207678_100085752 371
617 3300026067 Ga0207678_10030802 Ga0207678_100308024 371
618 3300026078 Ga0207702_10023292 Ga0207702_100232923 371
619 3300026088 Ga0207641_10016767 Ga0207641_100167673 371
620 3300026088 Ga0207641_10188737 Ga0207641_101887373 371
621 3300026089 Ga0207648_10041815 Ga0207648_100418153 371
622 3300026089 Ga0207648_10051645 Ga0207648_100516453 371
623 3300026089 Ga0207648_10134830 Ga0207648_101348302 371
624 3300026089 Ga0207648_10146040 Ga0207648_101460402 371
625 3300026095 Ga0207676_10005140 Ga0207676_100051408 371
626 3300026116 Ga0207674_10047037 Ga0207674_100470373 371
627 3300026118 Ga0207675_100002105 Ga0207675_10000210519 371
628 3300026118 Ga0207675_100160176 Ga0207675_1001601761 371
629 3300026121 Ga0207683_10090382 Ga0207683_100903822 371
630 3300026121 Ga0207683_10126385 Ga0207683_101263853 371
631 3300026121 Ga0207683_10200916 Ga0207683_102009162 371
632 3300027111 Ga0209281_1000039 Ga0209281_100003989 371
633 3300027111 Ga0209281_1000072 Ga0209281_1000072217 371
634 3300027360 Ga0209969_1000798 Ga0209969_10007984 371
635 3300027378 Ga0209981_1007516 Ga0209981_10075162 371
636 3300027395 Ga0209996_1000695 Ga0209996_10006952 371
637 3300027543 Ga0209999_1006689 Ga0209999_10066892 371
638 3300027666 Ga0209282_1029830 Ga0209282_10298303 371
639 3300027695 Ga0209966_1000856 Ga0209966_10008564 371
640 3300028381 Ga0268264_10080924 Ga0268264_100809243 371
641 3300028381 Ga0268264_10247546 Ga0268264_102475461 371
642 3300028794 Ga0307515_10000179 Ga0307515_1000017943 371
643 3300028794 Ga0307515_10000586 Ga0307515_1000058637 371
644 3300028794 Ga0307515_10017937 Ga0307515_100179377 371
645 3300028794 Ga0307515_10018687 Ga0307515_1001868711 371
646 3300028794 Ga0307515_10039346 Ga0307515_100393466 371
647 3300028794 Ga0307515_10050608 Ga0307515_100506085 371
648 3300028794 Ga0307515_10092450 Ga0307515_100924503 371
649 3300028794 Ga0307515_10118376 Ga0307515_101183763 371
650 3300028794 Ga0307515_10128603 Ga0307515_101286033 371
651 3300028794 Ga0307515_10178772 Ga0307515_101787722 371
652 3300030522 Ga0307512_10056371 Ga0307512_100563714 371
653 3300030522 Ga0307512_10172530 Ga0307512_101725301 371
654 3300031239 Ga0265328_10000002 Ga0265328_100000024 371
655 3300031250 Ga0265331_10012849 Ga0265331_100128493 371
656 3300031251 Ga0265327_10000020 Ga0265327_10000020103 371
657 3300031251 Ga0265327_10005210 Ga0265327_100052109 371
658 3300031456 Ga0307513_10000543 Ga0307513_1000054329 371
659 3300031456 Ga0307513_10000653 Ga0307513_1000065314 371
660 3300031456 Ga0307513_10034448 Ga0307513_100344482 371
661 3300031456 Ga0307513_10048415 Ga0307513_100484153 371
662 3300031507 Ga0307509_10004900 Ga0307509_1000490010 371
663 3300031507 Ga0307509_10010962 Ga0307509_100109625 371
664 3300031507 Ga0307509_10167947 Ga0307509_101679472 371
665 3300031548 Ga0307408_100000073 Ga0307408_10000007314 371
666 3300031548 Ga0307408_100002072 Ga0307408_10000207211 371
667 3300031548 Ga0307408_100048239 Ga0307408_1000482392 371
668 3300031548 Ga0307408_100060229 Ga0307408_1000602293 371
669 3300031616 Ga0307508_10000649 Ga0307508_100006499 371
670 3300031649 Ga0307514_10000746 Ga0307514_1000074640 371
671 3300031730 Ga0307516_10004295 Ga0307516_1000429514 371
672 3300031730 Ga0307516_10004304 Ga0307516_1000430410 371
673 3300031730 Ga0307516_10006051 Ga0307516_100060512 371
674 3300031730 Ga0307516_10009811 Ga0307516_100098113 371
675 3300031730 Ga0307516_10021887 Ga0307516_100218876 371
676 3300031730 Ga0307516_10048733 Ga0307516_100487333 371
677 3300031730 Ga0307516_10055606 Ga0307516_100556061 371
678 3300031731 Ga0307405_10138244 Ga0307405_101382442 371
679 3300031901 Ga0307406_10142822 Ga0307406_101428222 371
680 3300031903 Ga0307407_10002551 Ga0307407_100025517 371
681 3300031911 Ga0307412_10132804 Ga0307412_101328042 371
682 3300031911 Ga0307412_10216962 Ga0307412_102169622 371
683 3300031995 Ga0307409_100003515 Ga0307409_1000035158 371
684 3300031995 Ga0307409_100004354 Ga0307409_1000043548 371
685 3300032002 Ga0307416_100149319 Ga0307416_1001493193 371
686 3300032004 Ga0307414_10285708 Ga0307414_102857081 371
687 3300032004 Ga0307414_10349355 Ga0307414_103493552 371
688 3300032126 Ga0307415_100015503 Ga0307415_1000155033 371
689 3300033179 Ga0307507_10071231 Ga0307507_100712313 371
690 3300033180 Ga0307510_10186159 Ga0307510_101861593 371
691 3300034816 Ga0373930_0015587 Ga0373930_0015587_19_1149 371
692 3300034818 Ga0373950_0006176 Ga0373950_0006176_587_1702 371
693 3300035114 Ga0373939_0000056 Ga0373939_0000056_3691_4806 371
694 3300035691 Ga0373931_0004502 Ga0373931_0004502_4579_5709 371
695 3300035691 Ga0373931_0005160 Ga0373931_0005160_649_1764 371
696 3300035691 Ga0373931_0042854 Ga0373931_0042854_733_1860 371
697 3300037312 Ga0395899_0006799 Ga0395899_0006799_4291_5406 371
698 3300037418 Ga0395900_0001185 Ga0395900_0001185_24324_25439 371
699 3300037418 Ga0395900_0020073 Ga0395900_0020073_1327_2442 371
700 3300037466 Ga0395898_0000973 Ga0395898_0000973_43798_44913 371
701 3300037466 Ga0395898_0012269 Ga0395898_0012269_6420_7535 371
702 3300037471 Ga0395905_0000279 Ga0395905_0000279_6755_7870 371
703 3300037471 Ga0395905_0003420 Ga0395905_0003420_14489_15607 371
704 3300037471 Ga0395905_0004718 Ga0395905_0004718_12_1127 371
705 3300038443 Ga0395901_0056313 Ga0395901_0056313_1327_2442 371
706 3300038443 Ga0395901_0223637 Ga0395901_0223637_441_1556 371
707 3300039437 Ga0436365_0034357 Ga0436365_0034357_695_1825 371
708 3300039447 Ga0436361_0096676 Ga0436361_0096676_22363_23505 371
709 3300039447 Ga0436361_0199744 Ga0436361_0199744_15777_16892 371
710 3300039447 Ga0436361_1216292 Ga0436361_1216292_1289_2431 371
711 3300041505 Ga0451849_0172705 Ga0451849_0172705_154_1281 371
712 3300041512 Ga0451853_3907472 Ga0451853_3907472_1123_2238 371
713 3300042007 Ga0439449_0009421 Ga0439449_0009421_603_1718 371
714 3300042007 Ga0439449_0012852 Ga0439449_0012852_1589_2707 371
715 3300042126 Ga0450888_001409 Ga0450888_001409_265_1380 371
716 3300042127 Ga0450890_001891 Ga0450890_001891_209_1324 371
717 3300042129 Ga0450891_000764 Ga0450891_000764_1634_2749 371
718 3300042134 Ga0450898_000843 Ga0450898_000843_963_2078 371
719 3300042134 Ga0450898_007899 Ga0450898_007899_194_1309 371
720 3300042144 Ga0450889_000232 Ga0450889_000232_834_1949 371
721 3300042156 Ga0439446_0039427 Ga0439446_0039427_238_1353 371
722 3300042156 Ga0439446_0039946 Ga0439446_0039946_132_1247 371
723 3300042439 Ga0439464_0010255 Ga0439464_0010255_175_1290 371
724 3300042531 Ga0450918_000166 Ga0450918_000166_5472_6587 371
725 3300044656 Ga0466969_0000021 Ga0466969_0000021_40752_41867 371
726 3300044656 Ga0466969_0018764 Ga0466969_0018764_1048_2163 371
727 3300044656 Ga0466969_0040275 Ga0466969_0040275_981_2096 371
728 3300044658 Ga0466972_0000369 Ga0466972_0000369_21856_22971 371
729 3300044673 Ga0453683_0001471 Ga0453683_0001471_17061_18176 371
730 3300044684 Ga0466966_0017215 Ga0466966_0017215_773_1888 371
731 3300044694 Ga0466963_0018445 Ga0466963_0018445_1479_2594 371
732 3300044706 Ga0466964_0021473 Ga0466964_0021473_562_1677 371
733 3300044712 Ga0453684_0074727 Ga0453684_0074727_1414_2529 371
734 3300044719 Ga0466971_0008465 Ga0466971_0008465_118_1233 371
735 3300044735 Ga0466968_0035939 Ga0466968_0035939_18_1133 371
736 3300044842 Ga0466957_0011664 Ga0466957_0011664_175_1290 371
737 3300044901 Ga0466960_0007907 Ga0466960_0007907_2390_3505 371
738 3300045049 Ga0466959_0000061 Ga0466959_0000061_3058_4173 371
739 3300045049 Ga0466959_0074252 Ga0466959_0074252_886_2001 371
740 3300045051 Ga0451576_0007077 Ga0451576_0007077_11344_12459 371
741 3300045836 Ga0466958_0067368 Ga0466958_0067368_34_1149 371
742 3300045976 Ga0466967_0340785 Ga0466967_0340785_37_1152 371
743 3300046453 Ga0495627_015304 Ga0495627_015304_1484_2614 371
744 3300046457 Ga0495590_0011292 Ga0495590_0011292_793_1911 371
745 3300046460 Ga0495638_0016323 Ga0495638_0016323_2965_4095 371
746 3300046463 Ga0495653_0162756 Ga0495653_0162756_166_1335 371
747 3300046471 Ga0495650_0011469 Ga0495650_0011469_940_2070 371
748 3300046471 Ga0495650_0030462 Ga0495650_0030462_109_1302 371
749 3300046512 Ga0495610_0019484 Ga0495610_0019484_1741_2871 371
750 3300046513 Ga0495616_0001957 Ga0495616_0001957_12654_13784 371
751 3300046515 Ga0495620_0011888 Ga0495620_0011888_791_1933 371
752 3300046518 Ga0495631_0001674 Ga0495631_0001674_915_2045 371
753 3300046520 Ga0495637_0038887 Ga0495637_0038887_484_1614 371
754 3300046530 Ga0495654_0000313 Ga0495654_0000313_3381_4523 371
755 3300046530 Ga0495654_0029804 Ga0495654_0029804_1159_2289 371
756 3300046539 Ga0495621_0049996 Ga0495621_0049996_209_1339 371
757 3300046660 Ga0495625_0003699 Ga0495625_0003699_12095_13237 371
758 3300046660 Ga0495625_0005064 Ga0495625_0005064_5076_6191 371
759 3300046683 Ga0495658_0046179 Ga0495658_0046179_354_1502 371
760 3300046692 Ga0495671_0009412 Ga0495671_0009412_2810_3952 371
761 3300046810 Ga0495660_0045874 Ga0495660_0045874_617_1735 371
762 3300047321 Ga0495676_0056442 Ga0495676_0056442_945_2075 371
763 3300047443 Ga0495687_023976 Ga0495687_023976_681_1808 371
764 3300047472 Ga0495686_0000951 Ga0495686_0000951_5480_6595 371
765 3300048903 Ga0496100_0097154 Ga0496100_0097154_528_1658 371
766 3300048904 Ga0496101_0020204 Ga0496101_0020204_2717_3847 371
767 3300048906 Ga0496103_0015711 Ga0496103_0015711_3331_4461 371
768 3300048906 Ga0496103_0214917 Ga0496103_0214917_23_1153 371
769 3300048907 Ga0496104_0011855 Ga0496104_0011855_650_1885 371
770 3300048907 Ga0496104_0126711 Ga0496104_0126711_265_1395 371
771 3300048908 Ga0496105_0076845 Ga0496105_0076845_789_2024 371
772 3300048909 Ga0496106_0055318 Ga0496106_0055318_707_1849 371
773 3300048910 Ga0496107_0054459 Ga0496107_0054459_558_1688 371
774 3300048910 Ga0496107_0063931 Ga0496107_0063931_1006_2136 371
775 3300048913 Ga0496110_0010964 Ga0496110_0010964_4343_5473 371
776 3300048915 Ga0496112_0012551 Ga0496112_0012551_3483_4598 371
777 3300048915 Ga0496112_0134973 Ga0496112_0134973_937_2067 371
778 3300048916 Ga0496113_0027379 Ga0496113_0027379_346_1461 371
779 3300048917 Ga0496114_0001956 Ga0496114_0001956_13381_14496 371
780 3300048917 Ga0496114_0310684 Ga0496114_0310684_145_1380 371
781 3300048919 Ga0496116_0041241 Ga0496116_0041241_342_1472 371
782 3300048919 Ga0496116_0062584 Ga0496116_0062584_75_1217 371
783 3300048920 Ga0496117_0021232 Ga0496117_0021232_437_1567 371
784 3300048920 Ga0496117_0066755 Ga0496117_0066755_161_1291 371
785 3300048920 Ga0496117_0124770 Ga0496117_0124770_61_1191 371
786 3300048921 Ga0496118_0020881 Ga0496118_0020881_4471_5601 371
787 3300048921 Ga0496118_0087064 Ga0496118_0087064_206_1321 371
788 3300048924 Ga0496121_0005335 Ga0496121_0005335_14448_15596 371
789 3300048924 Ga0496121_0021965 Ga0496121_0021965_751_1866 371
790 3300048924 Ga0496121_0039151 Ga0496121_0039151_505_1647 371
791 3300048925 Ga0496122_0000080 Ga0496122_0000080_190742_191872 371
792 3300048925 Ga0496122_0154867 Ga0496122_0154867_72_1202 371
793 3300048926 Ga0496123_0000072 Ga0496123_0000072_20514_21644 371
794 3300048926 Ga0496123_0056457 Ga0496123_0056457_976_2106 371
795 3300048926 Ga0496123_0133206 Ga0496123_0133206_84_1226 371
796 3300048927 Ga0496124_0000388 Ga0496124_0000388_1459_2574 371
797 3300048927 Ga0496124_0057750 Ga0496124_0057750_1928_3058 371
798 3300048927 Ga0496124_0091590 Ga0496124_0091590_1308_2438 371
799 3300048928 Ga0496125_0007888 Ga0496125_0007888_1435_2550 371
800 3300048928 Ga0496125_0044880 Ga0496125_0044880_2550_3680 371
801 3300048928 Ga0496125_0182520 Ga0496125_0182520_93_1223 371
802 3300048929 Ga0496126_0002411 Ga0496126_0002411_23126_24274 371
803 3300049517 Ga0501294_002318 Ga0501294_002318_247_1362 371
804 3300049579 Ga0501043_0000012 Ga0501043_0000012_23362_24477 371
805 3300049580 Ga0501046_0000030 Ga0501046_0000030_23334_24449 371
806 3300049581 Ga0501047_0001222 Ga0501047_0001222_23355_24470 371
807 3300049649 Ga0501198_000003 Ga0501198_000003_48376_49536 371
808 3300049662 Ga0501222_000014 Ga0501222_000014_48376_49536 371
809 3300049663 Ga0501223_005994 Ga0501223_005994_792_1907 371
810 3300049762 Ga0501265_000615 Ga0501265_000615_391_1506 371
811 3300049763 Ga0501266_001410 Ga0501266_001410_140_1255 371
812 3300049824 Ga0501045_0031337 Ga0501045_0031337_1886_3001 371
813 3300050493 nmdc:mga0k408_2047_c1 nmdc:mga0k408_2047_c1_1209_2324 371
814 3300050493 nmdc:mga0k408_72968_c1 nmdc:mga0k408_72968_c1_244_1359 371
815 3300050493 nmdc:mga0k408_91249_c1 nmdc:mga0k408_91249_c1_48_1163 371
816 3300050496 nmdc:mga07m45_14324_c1 nmdc:mga07m45_14324_c1_71_1201 371
817 3300050496 nmdc:mga07m45_42024_c1 nmdc:mga07m45_42024_c1_1413_2528 371
818 3300050507 nmdc:mga05p37_523886_c1 nmdc:mga05p37_523886_c1_63_1178 371
819 3300053090 Ga0500646_0009218 Ga0500646_0009218_203_1333 371
820 3300053093 Ga0500651_0000420 Ga0500651_0000420_16916_18046 371
821 3300053110 Ga0500571_000013 Ga0500571_000013_933_2063 371
822 3300053117 Ga0500593_007015 Ga0500593_007015_2603_3745 371
823 3300053118 Ga0500594_0000195 Ga0500594_0000195_887_2017 371
824 3300053120 Ga0500597_021317 Ga0500597_021317_14_1144 371
825 3300053121 Ga0500607_012134 Ga0500607_012134_1204_2334 371
826 3300053122 Ga0500608_008747 Ga0500608_008747_2080_3210 371
827 3300053133 Ga0500655_001318 Ga0500655_001318_847_1977 371
828 3300053134 Ga0500658_0000799 Ga0500658_0000799_998_2128 371
829 3300053134 Ga0500658_0002681 Ga0500658_0002681_3058_4188 371
830 3300053136 Ga0500559_0002514 Ga0500559_0002514_1132_2262 371
831 3300053136 Ga0500559_0036011 Ga0500559_0036011_883_2013 371
832 3300053139 Ga0500568_0001449 Ga0500568_0001449_13736_14866 371
833 3300053140 Ga0500573_0012096 Ga0500573_0012096_458_1588 371
834 3300053153 Ga0500616_0034450 Ga0500616_0034450_1019_2149 371
835 3300053177 Ga0500636_0059561 Ga0500636_0059561_129_1259 371
836 3300053730 Ga0500645_000061 Ga0500645_000061_17427_18542 371
837 3300053730 Ga0500645_011337 Ga0500645_011337_1564_2679 371
838 3300059421 Ga0590071_002714 Ga0590071_002714_1965_3080 371
839 3300061719 Ga0466962_0018907 Ga0466962_0018907_1672_2787 371
840 3300001979 JGI24740J21852_10002979 JGI24740J21852_100029795 372
841 3300001989 JGI24739J22299_10002611 JGI24739J22299_100026113 372
842 3300002067 JGI24735J21928_10000321 JGI24735J21928_1000032114 372
843 3300002067 JGI24735J21928_10004512 JGI24735J21928_100045124 372
844 3300002705 JGI25156J39149_1003037 JGI25156J39149_10030376 372
845 3300002705 JGI25156J39149_1003053 JGI25156J39149_10030534 372
846 3300003214 JGI25165J46597_1001342 JGI25165J46597_10013428 372
847 3300003752 Ga0055539_1000536 Ga0055539_10005364 372
848 3300003756 Ga0055533_1002147 Ga0055533_10021471 372
849 3300003759 Ga0055525_1000053 Ga0055525_1000053133 372
850 3300005327 Ga0070658_10002933 Ga0070658_1000293313 372
851 3300005331 Ga0070670_100216812 Ga0070670_1002168121 372
852 3300005467 Ga0070706_100000719 Ga0070706_1000007196 372
853 3300005468 Ga0070707_100048898 Ga0070707_1000488983 372
854 3300005530 Ga0070679_100080076 Ga0070679_1000800763 372
855 3300005543 Ga0070672_100112051 Ga0070672_1001120511 372
856 3300006846 Ga0075430_100008182 Ga0075430_1000081824 372
857 3300009011 Ga0105251_10000578 Ga0105251_1000057831 372
858 3300009101 Ga0105247_10106168 Ga0105247_101061681 372
859 3300009177 Ga0105248_10093998 Ga0105248_100939983 372
860 3300009551 Ga0105238_10434781 Ga0105238_104347812 372
861 3300013105 Ga0157369_10007613 Ga0157369_100076138 372
862 3300013296 Ga0157374_10036523 Ga0157374_100365232 372
863 3300013306 Ga0163162_10000817 Ga0163162_1000081717 372
864 3300014497 Ga0182008_10137599 Ga0182008_101375991 372
865 3300015262 Ga0182007_10004201 Ga0182007_100042015 372
866 3300021361 Ga0213872_10000023 Ga0213872_1000002318 372
867 3300021361 Ga0213872_10001044 Ga0213872_100010445 372
868 3300021361 Ga0213872_10008848 Ga0213872_100088484 372
869 3300025226 Ga0209674_100092 Ga0209674_10009215 372
870 3300025230 Ga0209563_100014 Ga0209563_100014795 372
871 3300025253 Ga0209677_100060 Ga0209677_100060109 372
872 3300025256 Ga0209759_1000053 Ga0209759_1000053141 372
873 3300025256 Ga0209759_1000342 Ga0209759_10003426 372
874 3300025302 Ga0207426_1001760 Ga0207426_10017603 372
875 3300025735 Ga0207713_1010327 Ga0207713_10103274 372
876 3300025904 Ga0207647_10010124 Ga0207647_100101243 372
877 3300025910 Ga0207684_10007603 Ga0207684_1000760310 372
878 3300025917 Ga0207660_10156103 Ga0207660_101561032 372
879 3300025925 Ga0207650_10136111 Ga0207650_101361113 372
880 3300025933 Ga0207706_10328171 Ga0207706_103281712 372
881 3300025941 Ga0207711_10176227 Ga0207711_101762272 372
882 3300025949 Ga0207667_10283623 Ga0207667_102836233 372
883 3300025986 Ga0207658_10090122 Ga0207658_100901222 372
884 3300026095 Ga0207676_10065709 Ga0207676_100657093 372
885 3300026118 Ga0207675_100488154 Ga0207675_1004881541 372
886 3300028379 Ga0268266_10146010 Ga0268266_101460103 372
887 3300031548 Ga0307408_100018250 Ga0307408_1000182501 372
888 3300031911 Ga0307412_10045203 Ga0307412_100452033 372
889 3300032002 Ga0307416_100015237 Ga0307416_1000152372 372
890 3300032005 Ga0307411_10250012 Ga0307411_102500121 372
891 3300037068 Ga0373925_0002961 Ga0373925_0002961_2334_3452 372
892 3300037418 Ga0395900_0156275 Ga0395900_0156275_107_1261 372
893 3300037418 Ga0395900_0343002 Ga0395900_0343002_130_1251 372
894 3300037466 Ga0395898_0000792 Ga0395898_0000792_23370_24524 372
895 3300037466 Ga0395898_0022071 Ga0395898_0022071_426_1580 372
896 3300037471 Ga0395905_0020785 Ga0395905_0020785_2369_3490 372
897 3300037471 Ga0395905_0056046 Ga0395905_0056046_1219_2364 372
898 3300037471 Ga0395905_0199413 Ga0395905_0199413_661_1782 372
899 3300037471 Ga0395905_0406557 Ga0395905_0406557_127_1245 372
900 3300038443 Ga0395901_0000034 Ga0395901_0000034_170063_171244 372
901 3300038443 Ga0395901_0000665 Ga0395901_0000665_15977_17131 372
902 3300038443 Ga0395901_0035576 Ga0395901_0035576_2307_3461 372
903 3300038443 Ga0395901_0073503 Ga0395901_0073503_282_1400 372
904 3300039447 Ga0436361_0060434 Ga0436361_0060434_149756_150874 372
905 3300039447 Ga0436361_0547369 Ga0436361_0547369_3001_4119 372
906 3300039447 Ga0436361_1032254 Ga0436361_1032254_1871_2989 372
907 3300044693 Ga0466961_0014114 Ga0466961_0014114_2199_3344 372
908 3300044765 Ga0466970_0080436 Ga0466970_0080436_377_1519 372
909 3300044765 Ga0466970_0091379 Ga0466970_0091379_166_1284 372
910 3300045049 Ga0466959_0000469 Ga0466959_0000469_2078_3220 372
911 3300046455 Ga0495603_0031531 Ga0495603_0031531_127_1275 372
912 3300046457 Ga0495590_0002144 Ga0495590_0002144_863_2008 372
913 3300046457 Ga0495590_0063850 Ga0495590_0063850_87_1208 372
914 3300046458 Ga0495591_009123 Ga0495591_009123_855_1997 372
915 3300046459 Ga0495629_0001290 Ga0495629_0001290_15060_16202 372
916 3300046459 Ga0495629_0015864 Ga0495629_0015864_3474_4622 372
917 3300046460 Ga0495638_0013011 Ga0495638_0013011_1771_2919 372
918 3300046462 Ga0495651_0043369 Ga0495651_0043369_38_1180 372
919 3300046462 Ga0495651_0053440 Ga0495651_0053440_251_1393 372
920 3300046463 Ga0495653_0026176 Ga0495653_0026176_1715_2860 372
921 3300046471 Ga0495650_0002229 Ga0495650_0002229_14068_15210 372
922 3300046471 Ga0495650_0018003 Ga0495650_0018003_931_2073 372
923 3300046471 Ga0495650_0031593 Ga0495650_0031593_403_1557 372
924 3300046471 Ga0495650_0045474 Ga0495650_0045474_34_1182 372
925 3300046472 Ga0495580_0000355 Ga0495580_0000355_121_1263 372
926 3300046472 Ga0495580_0001997 Ga0495580_0001997_14297_15439 372
927 3300046472 Ga0495580_0030785 Ga0495580_0030785_1776_2918 372
928 3300046472 Ga0495580_0032648 Ga0495580_0032648_2012_3160 372
929 3300046472 Ga0495580_0106395 Ga0495580_0106395_153_1295 372
930 3300046473 Ga0495582_0051825 Ga0495582_0051825_482_1630 372
931 3300046474 Ga0495605_0075258 Ga0495605_0075258_152_1300 372
932 3300046476 Ga0495662_0082641 Ga0495662_0082641_71_1219 372
933 3300046477 Ga0495664_0000846 Ga0495664_0000846_14476_15648 372
934 3300046477 Ga0495664_0044914 Ga0495664_0044914_291_1433 372
935 3300046491 Ga0495584_0018764 Ga0495584_0018764_2056_3204 372
936 3300046500 Ga0495596_0038280 Ga0495596_0038280_124_1272 372
937 3300046501 Ga0495607_0072024 Ga0495607_0072024_190_1338 372
938 3300046507 Ga0495606_0061003 Ga0495606_0061003_436_1584 372
939 3300046511 Ga0495608_0013295 Ga0495608_0013295_2777_3919 372
940 3300046514 Ga0495618_0015758 Ga0495618_0015758_2805_3947 372
941 3300046516 Ga0495628_0005256 Ga0495628_0005256_8359_9516 372
942 3300046517 Ga0495630_0007675 Ga0495630_0007675_1519_2661 372
943 3300046523 Ga0495644_0051136 Ga0495644_0051136_332_1480 372
944 3300046524 Ga0495648_0120442 Ga0495648_0120442_108_1250 372
945 3300046526 Ga0495666_0017082 Ga0495666_0017082_1885_3027 372
946 3300046526 Ga0495666_0036648 Ga0495666_0036648_1009_2163 372
947 3300046528 Ga0495642_0027241 Ga0495642_0027241_670_1818 372
948 3300046529 Ga0495652_0144497 Ga0495652_0144497_390_1553 372
949 3300046530 Ga0495654_0048656 Ga0495654_0048656_65_1210 372
950 3300046531 Ga0495665_0025108 Ga0495665_0025108_531_1676 372
951 3300046542 Ga0495597_0000324 Ga0495597_0000324_39691_40809 372
952 3300046542 Ga0495597_0003579 Ga0495597_0003579_3311_4456 372
953 3300046543 Ga0495645_0001024 Ga0495645_0001024_9661_10803 372
954 3300046543 Ga0495645_0047836 Ga0495645_0047836_104_1267 372
955 3300046543 Ga0495645_0058444 Ga0495645_0058444_1637_2779 372
956 3300046543 Ga0495645_0068506 Ga0495645_0068506_1263_2405 372
957 3300046559 Ga0495667_0060510 Ga0495667_0060510_92_1234 372
958 3300046642 Ga0495634_0020262 Ga0495634_0020262_3288_4430 372
959 3300046642 Ga0495634_0026729 Ga0495634_0026729_1005_2156 372
960 3300046642 Ga0495634_0073505 Ga0495634_0073505_217_1365 372
961 3300046663 Ga0495635_0033976 Ga0495635_0033976_1290_2435 372
962 3300046665 Ga0495661_0015426 Ga0495661_0015426_79_1221 372
963 3300046674 Ga0495588_0061469 Ga0495588_0061469_566_1714 372
964 3300046678 Ga0495599_0058871 Ga0495599_0058871_716_1870 372
965 3300046678 Ga0495599_0072650 Ga0495599_0072650_625_1776 372
966 3300046678 Ga0495599_0083127 Ga0495599_0083127_441_1586 372
967 3300046679 Ga0495623_0020188 Ga0495623_0020188_2710_3855 372
968 3300046684 Ga0495669_0026207 Ga0495669_0026207_411_1559 372
969 3300046684 Ga0495669_0097566 Ga0495669_0097566_60_1205 372
970 3300046689 Ga0495613_0102309 Ga0495613_0102309_329_1471 372
971 3300046690 Ga0495624_0053935 Ga0495624_0053935_1231_2373 372
972 3300046692 Ga0495671_0057883 Ga0495671_0057883_114_1262 372
973 3300046692 Ga0495671_0081281 Ga0495671_0081281_308_1450 372
974 3300046692 Ga0495671_0089492 Ga0495671_0089492_143_1285 372
975 3300046694 Ga0495649_0052374 Ga0495649_0052374_72_1220 372
976 3300046794 Ga0495589_0014850 Ga0495589_0014850_568_1710 372
977 3300046809 Ga0495600_0016905 Ga0495600_0016905_209_1351 372
978 3300046809 Ga0495600_0140725 Ga0495600_0140725_13_1161 372
979 3300047317 Ga0495604_0048049 Ga0495604_0048049_975_2120 372
980 3300047318 Ga0495636_0019618 Ga0495636_0019618_1125_2246 372
981 3300047321 Ga0495676_0046071 Ga0495676_0046071_1800_2942 372
982 3300047322 Ga0495680_0069956 Ga0495680_0069956_1359_2504 372
983 3300047322 Ga0495680_0108499 Ga0495680_0108499_686_1840 372
984 3300047323 Ga0495683_0000982 Ga0495683_0000982_13868_15010 372
985 3300047323 Ga0495683_0001226 Ga0495683_0001226_6039_7184 372
986 3300047443 Ga0495687_000011 Ga0495687_000011_238934_240079 372
987 3300047443 Ga0495687_010847 Ga0495687_010847_3436_4584 372
988 3300047444 Ga0495675_0021774 Ga0495675_0021774_1146_2288 372
989 3300047444 Ga0495675_0127393 Ga0495675_0127393_82_1224 372
990 3300047446 Ga0495679_013721 Ga0495679_013721_1244_2386 372
991 3300047469 Ga0495673_0023528 Ga0495673_0023528_45_1187 372
992 3300047472 Ga0495686_0000014 Ga0495686_0000014_272986_274143 372
993 3300047472 Ga0495686_0003264 Ga0495686_0003264_2388_3539 372
994 3300047472 Ga0495686_0052381 Ga0495686_0052381_866_2008 372
995 3300047673 Ga0495593_0012509 Ga0495593_0012509_2028_3170 372
996 3300047673 Ga0495593_0096547 Ga0495593_0096547_203_1348 372
997 3300048088 Ga0495602_0086976 Ga0495602_0086976_371_1516 372
998 3300048903 Ga0496100_0025511 Ga0496100_0025511_755_1900 372
999 3300048904 Ga0496101_0039935 Ga0496101_0039935_1361_2503 372
1000 3300048905 Ga0496102_0014445 Ga0496102_0014445_5614_6762 372
1001 3300048905 Ga0496102_0036848 Ga0496102_0036848_1702_2847 372
1002 3300048906 Ga0496103_0003880 Ga0496103_0003880_2985_4130 372
1003 3300048906 Ga0496103_0056558 Ga0496103_0056558_1094_2236 372
1004 3300048908 Ga0496105_0067134 Ga0496105_0067134_954_2096 372
1005 3300048909 Ga0496106_0000031 Ga0496106_0000031_18568_19719 372
1006 3300048909 Ga0496106_0027500 Ga0496106_0027500_1377_2522 372
1007 3300048910 Ga0496107_0044529 Ga0496107_0044529_859_2007 372
1008 3300048912 Ga0496109_0247860 Ga0496109_0247860_142_1290 372
1009 3300048913 Ga0496110_0105996 Ga0496110_0105996_410_1573 372
1010 3300048914 Ga0496111_0020171 Ga0496111_0020171_851_1996 372
1011 3300048916 Ga0496113_0087884 Ga0496113_0087884_526_1671 372
1012 3300048917 Ga0496114_0039800 Ga0496114_0039800_1706_2869 372
1013 3300048918 Ga0496115_0060206 Ga0496115_0060206_1435_2583 372
1014 3300048919 Ga0496116_0018304 Ga0496116_0018304_1597_2742 372
1015 3300048920 Ga0496117_0003214 Ga0496117_0003214_15139_16284 372
1016 3300048920 Ga0496117_0022484 Ga0496117_0022484_2892_4034 372
1017 3300048921 Ga0496118_0061068 Ga0496118_0061068_553_1698 372
1018 3300048924 Ga0496121_0032610 Ga0496121_0032610_2664_3815 372
1019 3300048924 Ga0496121_0078972 Ga0496121_0078972_746_1891 372
1020 3300048924 Ga0496121_0247476 Ga0496121_0247476_42_1190 372
1021 3300048927 Ga0496124_0003175 Ga0496124_0003175_7644_8789 372
1022 3300048927 Ga0496124_0140919 Ga0496124_0140919_378_1526 372
1023 3300048928 Ga0496125_0013117 Ga0496125_0013117_4376_5521 372
1024 3300048929 Ga0496126_0177709 Ga0496126_0177709_269_1414 372
1025 3300049460 Ga0495682_0003755 Ga0495682_0003755_2968_4122 372
1026 3300049822 Ga0501035_0072640 Ga0501035_0072640_1144_2262 372
1027 3300050493 nmdc:mga0k408_41038_c1 nmdc:mga0k408_41038_c1_987_2234 372

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

182

413

0.98

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

46

178

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dio-assembly1.cif.gz_B the crystal structure of transhydrogenase from sinorhizobium meliloti 0.9842 1 368
4dio-assembly1.cif.gz_A the crystal structure of transhydrogenase from sinorhizobium meliloti 0.9758 1 369
4dio-assembly1.cif.gz_A the crystal structure of transhydrogenase from sinorhizobium meliloti 0.973 1 369
1u2g-assembly1.cif.gz_A transhydrogenase (di.adpr)2(diii.nadph)1 asymmetric complex 0.9667 1 372
4dio-assembly1.cif.gz_B the crystal structure of transhydrogenase from sinorhizobium meliloti 0.9666 1 368
ID Description Score Start End Superfamily
af_A0A2R8Q9E6_8_146_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9637 4 134 3.40.50.720
3p2yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.961 1 134 3.40.50.720
af_Q2FYJ2_1_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9596 1 115 3.40.50.720
1l7dA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9588 1 134 3.40.50.720
af_Q2FXL7_2_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9573 3 104 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q5VLK0-F1-model_v4 deleted 1.004 1 87
AF-A0A7Y1UXS1-F1-model_v4 NAD(P)(+) transhydrogenase (Re/Si-specific) subunit alpha 0.9995 2 69 GO:0000286
GO:0005886
GO:0006524
AF-A0A848FDY0-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9987 1 122 GO:0005886
GO:0006740
GO:0050661
AF-A0A3M3A4S3-F1-model_v4 Alanine dehydrogenase/pyridine nucleotide transhydrogenase N-terminal domain-containing protein 0.9984 1 91 GO:0000286
GO:0005886
GO:0006524
AF-A0A4Q7GWA0-F1-model_v4 deleted 0.9979 1 113

Feature Viewer

pLDDT pTM Quality
94.72 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map