F488226
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1014 | 477 | 1005 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300048909|Ga0496106_0215774|Ga0496106_0215774_149_865 |
| Length | 238 |
| Sequence | MADEKAGGKSGKGAKGGTATAAPPKGGSQPQGKGKDKSPAGAVDHTPKAQEGKPRLLDYYEKTIRSRLAKEFGLKNPNQVPRLVKIVLNIGMGDAGKNPKQLEAAVEELGLITGQKAVVTRAKKAIANFGLRAGMPVGATVTLRGARMYEFLDRFINLAVPRIRDFRGLPSRSFDGRGNYTFGIKEQMIFPEIDFDRVEKIHGMDITLVTSADRDDLAMGLLRELGWPFRGETPQRVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 5 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 6 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 7 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 8 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 9 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 10 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 11 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 12 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 13 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 14 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 16 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 17 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 22 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 23 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 24 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 25 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 26 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 27 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 28 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 29 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 30 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 31 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 32 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 33 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 34 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 81 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 115 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 116 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 117 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 121 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 122 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 123 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 137 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 153 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 154 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 155 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 156 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 157 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 158 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 256 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 261 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 262 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 263 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 264 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 266 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 269 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 270 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 271 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 272 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 273 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 274 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 275 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 276 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 277 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 278 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 279 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 280 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 281 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 282 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 283 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 284 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 285 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 286 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 288 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 293 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 295 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 296 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 299 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 303 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 304 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 305 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 306 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 308 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 309 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 310 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 311 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 313 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 314 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 315 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 316 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 317 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 318 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 319 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 320 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 321 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 322 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 323 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 324 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 325 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 387 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 388 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 392 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 395 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 396 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 397 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 398 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 399 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 400 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 401 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 423 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 424 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 425 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 426 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 427 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 428 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 433 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 434 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 435 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 436 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 438 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 439 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 440 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 454 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 456 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 457 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 458 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 459 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 460 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 461 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 462 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 463 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 464 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 466 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 467 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 477 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.22 |
| Metatranscriptomes | 0.89 |
| Isolates | 0.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.35 |
| Nodule | 0.39 |
| Rhizoplane | 5.92 |
| Rhizosphere | 89.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214775776 | 2209111006 | Bacteria | 2582 |
| 2 | ARcpr5oldR_c000035 | 3300000041 | Bacteria | 26838 |
| 3 | ARSoilYngRDRAFT_c00061 | 3300000042 | Bacteria | 17682 |
| 4 | ARcpr5yngRDRAFT_c000075 | 3300000043 | Bacteria | 16570 |
| 5 | ARSoilOldRDRAFT_c000053 | 3300000044 | Bacteria | 23841 |
| 6 | ARCol0oldRDRAFT_c01233 | 3300000045 | Bacteria | 1821 |
| 7 | ARCol0yngRDRAFT_1000025 | 3300000652 | Bacteria | 26845 |
| 8 | JGI24752J21851_1002479 | 3300001976 | Bacteria | 2458 |
| 9 | JGI24746J21847_1000313 | 3300001977 | Bacteria | 6996 |
| 10 | JGI24740J21852_10029468 | 3300001979 | Bacteria | 1802 |
| 11 | JGI24739J22299_10001271 | 3300001989 | Bacteria | 9474 |
| 12 | JGI24739J22299_10006089 | 3300001989 | Bacteria | 4558 |
| 13 | JGI24739J22299_10076202 | 3300001989 | Bacteria | 1036 |
| 14 | JGI24737J22298_10005496 | 3300001990 | Bacteria | 4373 |
| 15 | JGI24737J22298_10007426 | 3300001990 | Bacteria | 3701 |
| 16 | JGI24743J22301_10008078 | 3300001991 | Bacteria | 1838 |
| 17 | JGI24743J22301_10041313 | 3300001991 | Bacteria | 926 |
| 18 | JGI24750J21931_1000691 | 3300002070 | Bacteria | 4880 |
| 19 | JGI24745J21846_1000034 | 3300002073 | Bacteria | 9049 |
| 20 | JGI24748J21848_1002810 | 3300002074 | Bacteria | 1980 |
| 21 | JGI24748J21848_1013980 | 3300002074 | Bacteria | 951 |
| 22 | JGI24738J21930_10001067 | 3300002075 | Bacteria | 7782 |
| 23 | JGI24749J21850_1001313 | 3300002076 | Bacteria | 3522 |
| 24 | JGI24749J21850_1019286 | 3300002076 | Bacteria | 964 |
| 25 | JGI24744J21845_10026642 | 3300002077 | Bacteria | 1121 |
| 26 | JGI24035J26624_1000089 | 3300002126 | Bacteria | 7679 |
| 27 | JGI24035J26624_1000142 | 3300002126 | Bacteria | 6397 |
| 28 | JGI24034J26672_10000419 | 3300002239 | Bacteria | 5507 |
| 29 | JGI24034J26672_10000759 | 3300002239 | Bacteria | 4168 |
| 30 | JGI24742J22300_10001913 | 3300002244 | Bacteria | 3311 |
| 31 | JGI24751J29686_10007231 | 3300002459 | Bacteria | 2268 |
| 32 | rootH1_10113446 | 3300003316 | Bacteria | 1183 |
| 33 | JGI26129J50193_1002889 | 3300003349 | Bacteria | 1209 |
| 34 | Ga0055537_1009925 | 3300003773 | Bacteria | 2053 |
| 35 | Ga0055524_1018915 | 3300003775 | Bacteria | 2373 |
| 36 | Ga0055536_1000296 | 3300003781 | Bacteria | 37428 |
| 37 | Ga0065716_1001741 | 3300005277 | Bacteria | 3669 |
| 38 | Ga0065704_10143315 | 3300005289 | Bacteria | 1492 |
| 39 | Ga0065712_10145928 | 3300005290 | Bacteria | 1409 |
| 40 | Ga0065712_10165564 | 3300005290 | Bacteria | 1275 |
| 41 | Ga0065715_10001888 | 3300005293 | Bacteria | 5622 |
| 42 | Ga0065715_10002477 | 3300005293 | Bacteria | 7875 |
| 43 | Ga0065707_10005566 | 3300005295 | Bacteria | 3127 |
| 44 | Ga0065707_10107090 | 3300005295 | Bacteria | 2569 |
| 45 | Ga0070676_10085171 | 3300005328 | Bacteria | 1925 |
| 46 | Ga0070683_100100106 | 3300005329 | Bacteria | 2728 |
| 47 | Ga0070690_100020637 | 3300005330 | Bacteria | 4015 |
| 48 | Ga0070690_100076604 | 3300005330 | Bacteria | 2182 |
| 49 | Ga0070690_100188793 | 3300005330 | Bacteria | 1428 |
| 50 | Ga0070690_100301780 | 3300005330 | Bacteria | 1149 |
| 51 | Ga0070670_100006103 | 3300005331 | Bacteria | 10185 |
| 52 | Ga0070670_100063491 | 3300005331 | Bacteria | 3170 |
| 53 | Ga0070670_100301041 | 3300005331 | Bacteria | 1403 |
| 54 | Ga0070677_10006617 | 3300005333 | Bacteria | 3852 |
| 55 | Ga0068869_100000755 | 3300005334 | Bacteria | 18338 |
| 56 | Ga0068869_100061324 | 3300005334 | Bacteria | 2758 |
| 57 | Ga0070666_10023127 | 3300005335 | Bacteria | 4042 |
| 58 | Ga0070680_100026487 | 3300005336 | Bacteria | 4638 |
| 59 | Ga0070680_100045978 | 3300005336 | Bacteria | 3550 |
| 60 | Ga0070680_100156350 | 3300005336 | Bacteria | 1916 |
| 61 | Ga0070680_100174605 | 3300005336 | Bacteria | 1809 |
| 62 | Ga0070682_100000693 | 3300005337 | Bacteria | 20306 |
| 63 | Ga0070682_100045774 | 3300005337 | Bacteria | 2713 |
| 64 | Ga0068868_100006260 | 3300005338 | Bacteria | 8418 |
| 65 | Ga0070660_100192040 | 3300005339 | Bacteria | 1654 |
| 66 | Ga0070689_100016123 | 3300005340 | Bacteria | 5464 |
| 67 | Ga0070689_100053325 | 3300005340 | Bacteria | 3129 |
| 68 | Ga0070689_100313380 | 3300005340 | Bacteria | 1308 |
| 69 | Ga0070691_10002710 | 3300005341 | Bacteria | 7884 |
| 70 | Ga0070691_10040483 | 3300005341 | Bacteria | 2202 |
| 71 | Ga0070687_100001952 | 3300005343 | Bacteria | 7531 |
| 72 | Ga0070687_100006904 | 3300005343 | Bacteria | 4689 |
| 73 | Ga0070687_100109341 | 3300005343 | Bacteria | 1562 |
| 74 | Ga0070661_100062742 | 3300005344 | Bacteria | 2728 |
| 75 | Ga0070661_100207864 | 3300005344 | Bacteria | 1497 |
| 76 | Ga0070661_100359199 | 3300005344 | Bacteria | 1144 |
| 77 | Ga0070692_10008004 | 3300005345 | Bacteria | 4690 |
| 78 | Ga0070692_10102861 | 3300005345 | Bacteria | 1568 |
| 79 | Ga0070668_100002043 | 3300005347 | Bacteria | 14764 |
| 80 | Ga0070669_100023313 | 3300005353 | Bacteria | 4432 |
| 81 | Ga0070669_100023519 | 3300005353 | Bacteria | 4411 |
| 82 | Ga0070675_100055612 | 3300005354 | Bacteria | 3258 |
| 83 | Ga0070675_100231381 | 3300005354 | Bacteria | 1612 |
| 84 | Ga0070671_100045038 | 3300005355 | Bacteria | 3667 |
| 85 | Ga0070671_100202293 | 3300005355 | Bacteria | 1684 |
| 86 | Ga0070674_100001294 | 3300005356 | Bacteria | 13164 |
| 87 | Ga0070674_100389058 | 3300005356 | Bacteria | 1136 |
| 88 | Ga0070673_100024964 | 3300005364 | Bacteria | 4391 |
| 89 | Ga0070673_100044532 | 3300005364 | Bacteria | 3437 |
| 90 | Ga0070673_100076697 | 3300005364 | Bacteria | 2700 |
| 91 | Ga0070673_100327518 | 3300005364 | Bacteria | 1354 |
| 92 | Ga0070688_100007596 | 3300005365 | Bacteria | 5852 |
| 93 | Ga0070688_100013675 | 3300005365 | Bacteria | 4583 |
| 94 | Ga0070688_100464201 | 3300005365 | Bacteria | 949 |
| 95 | Ga0070659_100023740 | 3300005366 | Bacteria | 4695 |
| 96 | Ga0070659_100075380 | 3300005366 | Bacteria | 2689 |
| 97 | Ga0070659_100170238 | 3300005366 | Bacteria | 1784 |
| 98 | Ga0070667_100068731 | 3300005367 | Bacteria | 3014 |
| 99 | Ga0070703_10006226 | 3300005406 | Bacteria | 3340 |
| 100 | Ga0070714_100071630 | 3300005435 | Bacteria | 2998 |
| 101 | Ga0070713_100331543 | 3300005436 | Bacteria | 1408 |
| 102 | Ga0070701_10111750 | 3300005438 | Bacteria | 1527 |
| 103 | Ga0070701_10210353 | 3300005438 | Bacteria | 1154 |
| 104 | Ga0070701_10268425 | 3300005438 | Bacteria | 1037 |
| 105 | Ga0070711_100054156 | 3300005439 | Bacteria | 2768 |
| 106 | Ga0070711_100213541 | 3300005439 | Bacteria | 1496 |
| 107 | Ga0070705_100001981 | 3300005440 | Bacteria | 10455 |
| 108 | Ga0070705_100003631 | 3300005440 | Bacteria | 7551 |
| 109 | Ga0070705_100025279 | 3300005440 | Bacteria | 3218 |
| 110 | Ga0070705_100146786 | 3300005440 | Bacteria | 1560 |
| 111 | Ga0070705_100244685 | 3300005440 | Bacteria | 1255 |
| 112 | Ga0070700_100031838 | 3300005441 | Bacteria | 3164 |
| 113 | Ga0070700_100161591 | 3300005441 | Bacteria | 1542 |
| 114 | Ga0070694_100011413 | 3300005444 | Bacteria | 5502 |
| 115 | Ga0070694_100043378 | 3300005444 | Bacteria | 3007 |
| 116 | Ga0070694_100056701 | 3300005444 | Bacteria | 2661 |
| 117 | Ga0070694_100140371 | 3300005444 | Bacteria | 1754 |
| 118 | Ga0070708_100021258 | 3300005445 | Bacteria | 5484 |
| 119 | Ga0070708_100034355 | 3300005445 | Bacteria | 4411 |
| 120 | Ga0070708_100080585 | 3300005445 | Bacteria | 2946 |
| 121 | Ga0070708_100541924 | 3300005445 | Bacteria | 1098 |
| 122 | Ga0070663_100017366 | 3300005455 | Bacteria | 4695 |
| 123 | Ga0070663_100203182 | 3300005455 | Bacteria | 1547 |
| 124 | Ga0070663_100460742 | 3300005455 | Bacteria | 1049 |
| 125 | Ga0070678_100004700 | 3300005456 | Bacteria | 7775 |
| 126 | Ga0070678_100267516 | 3300005456 | Bacteria | 1440 |
| 127 | Ga0070662_100021397 | 3300005457 | Bacteria | 4415 |
| 128 | Ga0070662_100050107 | 3300005457 | Bacteria | 3012 |
| 129 | Ga0070681_10171228 | 3300005458 | Bacteria | 2093 |
| 130 | Ga0070681_10662882 | 3300005458 | Bacteria | 958 |
| 131 | Ga0068867_100003543 | 3300005459 | Bacteria | 10976 |
| 132 | Ga0068867_100365205 | 3300005459 | Bacteria | 1208 |
| 133 | Ga0070685_10011173 | 3300005466 | Bacteria | 4695 |
| 134 | Ga0070685_10012732 | 3300005466 | Bacteria | 4425 |
| 135 | Ga0070685_10121347 | 3300005466 | Bacteria | 1623 |
| 136 | Ga0070706_100723219 | 3300005467 | Bacteria | 923 |
| 137 | Ga0070706_100724527 | 3300005467 | Bacteria | 922 |
| 138 | Ga0070707_100033640 | 3300005468 | Bacteria | 4887 |
| 139 | Ga0070707_100108544 | 3300005468 | Bacteria | 2692 |
| 140 | Ga0070707_100239655 | 3300005468 | Bacteria | 1765 |
| 141 | Ga0070698_100005769 | 3300005471 | Bacteria | 13540 |
| 142 | Ga0070698_100014490 | 3300005471 | Bacteria | 8325 |
| 143 | Ga0070699_100018182 | 3300005518 | Bacteria | 6039 |
| 144 | Ga0070699_100029175 | 3300005518 | Bacteria | 4757 |
| 145 | Ga0070699_100312259 | 3300005518 | Bacteria | 1411 |
| 146 | Ga0070699_100352582 | 3300005518 | Bacteria | 1326 |
| 147 | Ga0070679_100039101 | 3300005530 | Bacteria | 4715 |
| 148 | Ga0070679_100293724 | 3300005530 | Bacteria | 1576 |
| 149 | Ga0070684_100071626 | 3300005535 | Bacteria | 3050 |
| 150 | Ga0070684_100073460 | 3300005535 | Bacteria | 3013 |
| 151 | Ga0070684_100543750 | 3300005535 | Bacteria | 1078 |
| 152 | Ga0070697_100078379 | 3300005536 | Bacteria | 2719 |
| 153 | Ga0070697_100102122 | 3300005536 | Bacteria | 2383 |
| 154 | Ga0070697_100247992 | 3300005536 | Bacteria | 1522 |
| 155 | Ga0070697_100701654 | 3300005536 | Bacteria | 893 |
| 156 | Ga0068853_100002095 | 3300005539 | Bacteria | 14797 |
| 157 | Ga0070672_100029753 | 3300005543 | Bacteria | 4098 |
| 158 | Ga0070672_100075788 | 3300005543 | Bacteria | 2686 |
| 159 | Ga0070672_100164101 | 3300005543 | Bacteria | 1845 |
| 160 | Ga0070672_100335644 | 3300005543 | Bacteria | 1286 |
| 161 | Ga0070686_100013389 | 3300005544 | Bacteria | 4695 |
| 162 | Ga0070686_100026380 | 3300005544 | Bacteria | 3507 |
| 163 | Ga0070686_100088535 | 3300005544 | Bacteria | 2066 |
| 164 | Ga0070686_100349625 | 3300005544 | Bacteria | 1110 |
| 165 | Ga0070695_100009721 | 3300005545 | Bacteria | 5729 |
| 166 | Ga0070695_100040449 | 3300005545 | Bacteria | 2951 |
| 167 | Ga0070695_100154109 | 3300005545 | Bacteria | 1606 |
| 168 | Ga0070696_100001655 | 3300005546 | Bacteria | 14605 |
| 169 | Ga0070696_100023729 | 3300005546 | Bacteria | 4170 |
| 170 | Ga0070696_100074654 | 3300005546 | Bacteria | 2391 |
| 171 | Ga0070696_100222829 | 3300005546 | Bacteria | 1416 |
| 172 | Ga0070693_100003889 | 3300005547 | Bacteria | 7006 |
| 173 | Ga0070693_100030086 | 3300005547 | Bacteria | 2966 |
| 174 | Ga0070665_100367848 | 3300005548 | Bacteria | 1444 |
| 175 | Ga0070704_100016233 | 3300005549 | Bacteria | 4702 |
| 176 | Ga0070704_100047686 | 3300005549 | Bacteria | 2996 |
| 177 | Ga0070704_100204957 | 3300005549 | Bacteria | 1594 |
| 178 | Ga0070704_100482524 | 3300005549 | Bacteria | 1073 |
| 179 | Ga0070704_100589626 | 3300005549 | Bacteria | 976 |
| 180 | Ga0070704_101259384 | 3300005549 | Bacteria | 676 |
| 181 | Ga0068855_100113736 | 3300005563 | Bacteria | 3104 |
| 182 | Ga0068855_100324265 | 3300005563 | Bacteria | 1701 |
| 183 | Ga0068855_100715308 | 3300005563 | Bacteria | 1070 |
| 184 | Ga0070664_100085232 | 3300005564 | Bacteria | 2728 |
| 185 | Ga0070664_100473386 | 3300005564 | Bacteria | 1152 |
| 186 | Ga0068857_100006037 | 3300005577 | Bacteria | 10344 |
| 187 | Ga0068857_100417472 | 3300005577 | Bacteria | 1250 |
| 188 | Ga0068857_100813433 | 3300005577 | Bacteria | 893 |
| 189 | Ga0068854_100006037 | 3300005578 | Bacteria | 7675 |
| 190 | Ga0068854_100731027 | 3300005578 | Bacteria | 857 |
| 191 | Ga0068856_100386693 | 3300005614 | Bacteria | 1419 |
| 192 | Ga0070702_100000378 | 3300005615 | Bacteria | 15718 |
| 193 | Ga0070702_100042751 | 3300005615 | Bacteria | 2549 |
| 194 | Ga0068852_100031220 | 3300005616 | Bacteria | 4393 |
| 195 | Ga0068859_100046039 | 3300005617 | Bacteria | 4382 |
| 196 | Ga0068859_100120929 | 3300005617 | Bacteria | 2685 |
| 197 | Ga0068859_100353461 | 3300005617 | Bacteria | 1564 |
| 198 | Ga0068864_100000595 | 3300005618 | Bacteria | 30701 |
| 199 | Ga0068864_100165590 | 3300005618 | Bacteria | 2012 |
| 200 | Ga0068866_10000834 | 3300005718 | Bacteria | 13673 |
| 201 | Ga0068866_10072780 | 3300005718 | Bacteria | 1822 |
| 202 | Ga0068866_10270379 | 3300005718 | Bacteria | 1048 |
| 203 | Ga0068861_100233415 | 3300005719 | Bacteria | 1561 |
| 204 | Ga0068861_100277598 | 3300005719 | Bacteria | 1441 |
| 205 | Ga0068861_100311382 | 3300005719 | Bacteria | 1368 |
| 206 | Ga0068861_100428333 | 3300005719 | Bacteria | 1180 |
| 207 | Ga0068870_10000216 | 3300005840 | Bacteria | 20877 |
| 208 | Ga0068870_10015701 | 3300005840 | Bacteria | 3600 |
| 209 | Ga0068863_100008669 | 3300005841 | Bacteria | 9938 |
| 210 | Ga0068863_100012849 | 3300005841 | Bacteria | 8075 |
| 211 | Ga0068863_100031970 | 3300005841 | Bacteria | 5019 |
| 212 | Ga0068863_100106457 | 3300005841 | Bacteria | 2668 |
| 213 | Ga0068858_100247493 | 3300005842 | Bacteria | 1693 |
| 214 | Ga0068858_100286789 | 3300005842 | Bacteria | 1568 |
| 215 | Ga0068858_100288277 | 3300005842 | Bacteria | 1564 |
| 216 | Ga0068860_100000220 | 3300005843 | Bacteria | 89460 |
| 217 | Ga0068860_100036168 | 3300005843 | Bacteria | 4733 |
| 218 | Ga0068860_100092223 | 3300005843 | Bacteria | 2886 |
| 219 | Ga0068860_100250986 | 3300005843 | Bacteria | 1723 |
| 220 | Ga0068862_100066335 | 3300005844 | Bacteria | 3110 |
| 221 | Ga0068862_100193511 | 3300005844 | Bacteria | 1831 |
| 222 | Ga0068862_100273868 | 3300005844 | Bacteria | 1545 |
| 223 | Ga0068862_100303899 | 3300005844 | Bacteria | 1468 |
| 224 | Ga0068862_100412676 | 3300005844 | Bacteria | 1265 |
| 225 | Ga0081455_10065534 | 3300005937 | Bacteria | 3038 |
| 226 | Ga0081538_10030674 | 3300005981 | Bacteria | 3644 |
| 227 | Ga0075365_10177533 | 3300006038 | Bacteria | 1488 |
| 228 | Ga0075365_10599477 | 3300006038 | Bacteria | 779 |
| 229 | Ga0075368_10009694 | 3300006042 | Bacteria | 3468 |
| 230 | Ga0075368_10204930 | 3300006042 | Bacteria | 835 |
| 231 | Ga0075363_100100732 | 3300006048 | Bacteria | 1598 |
| 232 | Ga0070716_100533435 | 3300006173 | Bacteria | 872 |
| 233 | Ga0070712_100141516 | 3300006175 | Bacteria | 1836 |
| 234 | Ga0075367_10122911 | 3300006178 | Bacteria | 1600 |
| 235 | Ga0075369_10241386 | 3300006186 | Bacteria | 838 |
| 236 | Ga0075366_10271348 | 3300006195 | Bacteria | 1036 |
| 237 | Ga0097621_100000600 | 3300006237 | Bacteria | 25393 |
| 238 | Ga0097621_100372179 | 3300006237 | Bacteria | 1275 |
| 239 | Ga0075370_10074572 | 3300006353 | Bacteria | 1944 |
| 240 | Ga0068871_100000118 | 3300006358 | Bacteria | 49211 |
| 241 | Ga0068871_100077944 | 3300006358 | Bacteria | 2739 |
| 242 | Ga0075428_100061239 | 3300006844 | Bacteria | 4121 |
| 243 | Ga0075428_100071069 | 3300006844 | Bacteria | 3804 |
| 244 | Ga0075428_100101121 | 3300006844 | Bacteria | 3143 |
| 245 | Ga0075430_100002159 | 3300006846 | Bacteria | 16284 |
| 246 | Ga0075431_100018917 | 3300006847 | Bacteria | 7017 |
| 247 | Ga0075431_100060059 | 3300006847 | Bacteria | 3924 |
| 248 | Ga0075431_100118944 | 3300006847 | Bacteria | 2726 |
| 249 | Ga0075431_100287972 | 3300006847 | Bacteria | 1662 |
| 250 | Ga0075433_10000942 | 3300006852 | Bacteria | 20529 |
| 251 | Ga0075433_10030828 | 3300006852 | Bacteria | 4579 |
| 252 | Ga0075433_10035758 | 3300006852 | Bacteria | 4275 |
| 253 | Ga0075433_10047049 | 3300006852 | Bacteria | 3752 |
| 254 | Ga0075433_10394272 | 3300006852 | Bacteria | 1221 |
| 255 | Ga0075434_100015284 | 3300006871 | Bacteria | 7357 |
| 256 | Ga0075434_100018939 | 3300006871 | Bacteria | 6653 |
| 257 | Ga0075434_100162986 | 3300006871 | Bacteria | 2249 |
| 258 | Ga0075434_100352625 | 3300006871 | Bacteria | 1492 |
| 259 | Ga0075434_100356991 | 3300006871 | Bacteria | 1483 |
| 260 | Ga0075434_100602663 | 3300006871 | Bacteria | 1117 |
| 261 | Ga0075429_100062025 | 3300006880 | Bacteria | 3257 |
| 262 | Ga0075429_100147777 | 3300006880 | Bacteria | 2057 |
| 263 | Ga0068865_100019301 | 3300006881 | Bacteria | 4411 |
| 264 | Ga0068865_100057755 | 3300006881 | Bacteria | 2708 |
| 265 | Ga0068865_100437687 | 3300006881 | Bacteria | 1078 |
| 266 | Ga0075436_100005801 | 3300006914 | Bacteria | 8479 |
| 267 | Ga0075436_100411709 | 3300006914 | Bacteria | 981 |
| 268 | Ga0075436_100524819 | 3300006914 | Bacteria | 868 |
| 269 | Ga0097620_100046036 | 3300006931 | Bacteria | 4382 |
| 270 | Ga0097620_100120929 | 3300006931 | Bacteria | 2685 |
| 271 | Ga0097620_100353469 | 3300006931 | Bacteria | 1564 |
| 272 | Ga0075435_100012698 | 3300007076 | Bacteria | 6239 |
| 273 | Ga0075435_100023920 | 3300007076 | Bacteria | 4733 |
| 274 | Ga0075435_100254935 | 3300007076 | Bacteria | 1494 |
| 275 | Ga0099794_10038488 | 3300007265 | Bacteria | 2266 |
| 276 | Ga0099794_10045960 | 3300007265 | Bacteria | 2090 |
| 277 | Ga0099794_10077416 | 3300007265 | Bacteria | 1636 |
| 278 | Ga0105250_10022913 | 3300009092 | Bacteria | 2516 |
| 279 | Ga0105240_10222694 | 3300009093 | Bacteria | 2197 |
| 280 | Ga0111539_10041411 | 3300009094 | Bacteria | 5538 |
| 281 | Ga0111539_10055701 | 3300009094 | Bacteria | 4701 |
| 282 | Ga0111539_10065259 | 3300009094 | Bacteria | 4303 |
| 283 | Ga0111539_10470861 | 3300009094 | Bacteria | 1463 |
| 284 | Ga0111539_11288572 | 3300009094 | Bacteria | 848 |
| 285 | Ga0105245_10020560 | 3300009098 | Bacteria | 5789 |
| 286 | Ga0105245_10205279 | 3300009098 | Bacteria | 1894 |
| 287 | Ga0105247_10129917 | 3300009101 | Bacteria | 1641 |
| 288 | Ga0105247_10133613 | 3300009101 | Bacteria | 1619 |
| 289 | Ga0105247_10196341 | 3300009101 | Bacteria | 1353 |
| 290 | Ga0114129_10005890 | 3300009147 | Bacteria | 17359 |
| 291 | Ga0114129_10017633 | 3300009147 | Bacteria | 10165 |
| 292 | Ga0114129_10035427 | 3300009147 | Bacteria | 7051 |
| 293 | Ga0114129_10113339 | 3300009147 | Bacteria | 3739 |
| 294 | Ga0114129_10194135 | 3300009147 | Bacteria | 2755 |
| 295 | Ga0114129_10198299 | 3300009147 | Bacteria | 2721 |
| 296 | Ga0114129_10229113 | 3300009147 | Bacteria | 2503 |
| 297 | Ga0114129_10957088 | 3300009147 | Bacteria | 1081 |
| 298 | Ga0114129_10964978 | 3300009147 | Bacteria | 1076 |
| 299 | Ga0114129_11025285 | 3300009147 | Bacteria | 1038 |
| 300 | Ga0105243_10009714 | 3300009148 | Bacteria | 7327 |
| 301 | Ga0105243_10013879 | 3300009148 | Bacteria | 6099 |
| 302 | Ga0105243_10921354 | 3300009148 | Bacteria | 871 |
| 303 | Ga0105241_10114705 | 3300009174 | Bacteria | 2161 |
| 304 | Ga0105241_10163780 | 3300009174 | Bacteria | 1830 |
| 305 | Ga0105241_10267822 | 3300009174 | Bacteria | 1454 |
| 306 | Ga0105242_10026750 | 3300009176 | Bacteria | 4575 |
| 307 | Ga0105242_10035447 | 3300009176 | Bacteria | 4001 |
| 308 | Ga0105242_10144535 | 3300009176 | Bacteria | 2068 |
| 309 | Ga0105248_10206586 | 3300009177 | Bacteria | 2213 |
| 310 | Ga0105248_10266968 | 3300009177 | Bacteria | 1927 |
| 311 | Ga0105248_11200461 | 3300009177 | Bacteria | 858 |
| 312 | Ga0105237_10670542 | 3300009545 | Bacteria | 1044 |
| 313 | Ga0105238_10637049 | 3300009551 | Bacteria | 1075 |
| 314 | Ga0105249_10032777 | 3300009553 | Bacteria | 4701 |
| 315 | Ga0105249_10048120 | 3300009553 | Bacteria | 3888 |
| 316 | Ga0105249_10173804 | 3300009553 | Bacteria | 2091 |
| 317 | Ga0105249_10210176 | 3300009553 | Bacteria | 1909 |
| 318 | Ga0105239_10053808 | 3300010375 | Bacteria | 4414 |
| 319 | Ga0105239_10269246 | 3300010375 | Bacteria | 1916 |
| 320 | Ga0105246_10002558 | 3300011119 | Bacteria | 10995 |
| 321 | Ga0105246_10040974 | 3300011119 | Bacteria | 3129 |
| 322 | Ga0157325_1000571 | 3300012485 | Bacteria | 1508 |
| 323 | Ga0157323_1000357 | 3300012495 | Bacteria | 2012 |
| 324 | Ga0157347_1012454 | 3300012502 | Bacteria | 918 |
| 325 | Ga0157339_1003317 | 3300012505 | Bacteria | 1154 |
| 326 | Ga0157342_1002329 | 3300012507 | Bacteria | 1532 |
| 327 | Ga0157326_1003916 | 3300012513 | Bacteria | 1565 |
| 328 | Ga0157371_10023400 | 3300013102 | Bacteria | 4517 |
| 329 | Ga0157371_10199288 | 3300013102 | Bacteria | 1435 |
| 330 | Ga0157374_10021639 | 3300013296 | Bacteria | 5726 |
| 331 | Ga0157374_10472525 | 3300013296 | Bacteria | 1256 |
| 332 | Ga0157378_10095871 | 3300013297 | Bacteria | 2702 |
| 333 | Ga0157378_10162599 | 3300013297 | Bacteria | 2089 |
| 334 | Ga0163162_10112570 | 3300013306 | Bacteria | 2820 |
| 335 | Ga0163162_10368202 | 3300013306 | Bacteria | 1570 |
| 336 | Ga0163162_10468616 | 3300013306 | Bacteria | 1391 |
| 337 | Ga0163162_10679264 | 3300013306 | Bacteria | 1152 |
| 338 | Ga0157372_10195142 | 3300013307 | Bacteria | 2345 |
| 339 | Ga0157375_10007178 | 3300013308 | Bacteria | 9737 |
| 340 | Ga0157375_10169864 | 3300013308 | Bacteria | 2328 |
| 341 | Ga0157375_10830601 | 3300013308 | Bacteria | 1071 |
| 342 | Ga0163163_10009943 | 3300014325 | Bacteria | 8530 |
| 343 | Ga0163163_10126652 | 3300014325 | Bacteria | 2592 |
| 344 | Ga0163163_10178021 | 3300014325 | Bacteria | 2174 |
| 345 | Ga0157380_10037923 | 3300014326 | Bacteria | 3739 |
| 346 | Ga0157380_10131899 | 3300014326 | Bacteria | 2133 |
| 347 | Ga0157377_10000628 | 3300014745 | Bacteria | 14665 |
| 348 | Ga0157377_10047905 | 3300014745 | Bacteria | 2396 |
| 349 | Ga0157377_10265366 | 3300014745 | Bacteria | 1119 |
| 350 | Ga0157376_10063679 | 3300014969 | Bacteria | 3107 |
| 351 | Ga0157376_10099574 | 3300014969 | Bacteria | 2537 |
| 352 | Ga0157376_10535079 | 3300014969 | Bacteria | 1157 |
| 353 | Ga0163161_10000415 | 3300017792 | Bacteria | 35797 |
| 354 | Ga0163161_10050412 | 3300017792 | Bacteria | 3012 |
| 355 | Ga0163161_10071821 | 3300017792 | Bacteria | 2533 |
| 356 | Ga0209565_1001322 | 3300025263 | Bacteria | 11369 |
| 357 | Ga0207666_1000185 | 3300025271 | Bacteria | 9376 |
| 358 | Ga0207666_1000473 | 3300025271 | Bacteria | 5114 |
| 359 | Ga0209673_1014116 | 3300025273 | Bacteria | 3109 |
| 360 | Ga0207673_1000115 | 3300025290 | Bacteria | 7456 |
| 361 | Ga0209675_1003392 | 3300025291 | Bacteria | 7591 |
| 362 | Ga0209676_1000331 | 3300025292 | Bacteria | 90857 |
| 363 | Ga0209025_1024137 | 3300025294 | Bacteria | 3151 |
| 364 | Ga0209025_1042411 | 3300025294 | Bacteria | 1933 |
| 365 | Ga0209025_1068664 | 3300025294 | Bacteria | 1272 |
| 366 | Ga0209758_1019600 | 3300025297 | Bacteria | 3253 |
| 367 | Ga0209256_1011073 | 3300025299 | Bacteria | 3664 |
| 368 | Ga0209051_1086221 | 3300025303 | Bacteria | 888 |
| 369 | Ga0207697_10006788 | 3300025315 | Bacteria | 5147 |
| 370 | Ga0207697_10104371 | 3300025315 | Bacteria | 1210 |
| 371 | Ga0207696_1040744 | 3300025711 | Bacteria | 1359 |
| 372 | Ga0207653_10009209 | 3300025885 | Bacteria | 3078 |
| 373 | Ga0207653_10088983 | 3300025885 | Bacteria | 1079 |
| 374 | Ga0207682_10000350 | 3300025893 | Bacteria | 21096 |
| 375 | Ga0207692_10008210 | 3300025898 | Bacteria | 4316 |
| 376 | Ga0207642_10001478 | 3300025899 | Bacteria | 7266 |
| 377 | Ga0207642_10226043 | 3300025899 | Bacteria | 1049 |
| 378 | Ga0207710_10016235 | 3300025900 | Bacteria | 3149 |
| 379 | Ga0207710_10175460 | 3300025900 | Bacteria | 1049 |
| 380 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 381 | Ga0207688_10002321 | 3300025901 | Bacteria | 10228 |
| 382 | Ga0207688_10033396 | 3300025901 | Bacteria | 2846 |
| 383 | Ga0207680_10063616 | 3300025903 | Bacteria | 2259 |
| 384 | Ga0207680_10196784 | 3300025903 | Bacteria | 1371 |
| 385 | Ga0207647_10034185 | 3300025904 | Bacteria | 3248 |
| 386 | Ga0207647_10174606 | 3300025904 | Bacteria | 1250 |
| 387 | Ga0207647_10174831 | 3300025904 | Bacteria | 1249 |
| 388 | Ga0207699_10210533 | 3300025906 | Bacteria | 1322 |
| 389 | Ga0207645_10000222 | 3300025907 | Bacteria | 47139 |
| 390 | Ga0207645_10016093 | 3300025907 | Bacteria | 4952 |
| 391 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 392 | Ga0207643_10002622 | 3300025908 | Bacteria | 9735 |
| 393 | Ga0207643_10295507 | 3300025908 | Bacteria | 1007 |
| 394 | Ga0207705_10056065 | 3300025909 | Bacteria | 2841 |
| 395 | Ga0207684_10026777 | 3300025910 | Bacteria | 4916 |
| 396 | Ga0207654_10028853 | 3300025911 | Bacteria | 3029 |
| 397 | Ga0207654_10154824 | 3300025911 | Bacteria | 1475 |
| 398 | Ga0207707_10006091 | 3300025912 | Bacteria | 10552 |
| 399 | Ga0207707_10283406 | 3300025912 | Bacteria | 1435 |
| 400 | Ga0207707_10460715 | 3300025912 | Bacteria | 1087 |
| 401 | Ga0207707_10506677 | 3300025912 | Bacteria | 1029 |
| 402 | Ga0207671_10179689 | 3300025914 | Bacteria | 1646 |
| 403 | Ga0207693_10023533 | 3300025915 | Bacteria | 4890 |
| 404 | Ga0207693_10238778 | 3300025915 | Bacteria | 1427 |
| 405 | Ga0207663_10090962 | 3300025916 | Bacteria | 2025 |
| 406 | Ga0207663_10377456 | 3300025916 | Bacteria | 1079 |
| 407 | Ga0207663_10514483 | 3300025916 | Bacteria | 931 |
| 408 | Ga0207660_10000197 | 3300025917 | Bacteria | 38486 |
| 409 | Ga0207660_10043689 | 3300025917 | Bacteria | 3149 |
| 410 | Ga0207662_10000745 | 3300025918 | Bacteria | 14909 |
| 411 | Ga0207662_10210387 | 3300025918 | Bacteria | 1262 |
| 412 | Ga0207662_10224236 | 3300025918 | Bacteria | 1225 |
| 413 | Ga0207662_10617807 | 3300025918 | Bacteria | 755 |
| 414 | Ga0207657_10026404 | 3300025919 | Bacteria | 5339 |
| 415 | Ga0207657_10301020 | 3300025919 | Bacteria | 1270 |
| 416 | Ga0207657_10304387 | 3300025919 | Bacteria | 1262 |
| 417 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 418 | Ga0207649_10144224 | 3300025920 | Bacteria | 1633 |
| 419 | Ga0207649_10387161 | 3300025920 | Bacteria | 1043 |
| 420 | Ga0207652_10001438 | 3300025921 | Bacteria | 21098 |
| 421 | Ga0207652_10127325 | 3300025921 | Bacteria | 2269 |
| 422 | Ga0207652_10379596 | 3300025921 | Bacteria | 1276 |
| 423 | Ga0207652_10434128 | 3300025921 | Bacteria | 1184 |
| 424 | Ga0207646_10036746 | 3300025922 | Bacteria | 4421 |
| 425 | Ga0207646_10063438 | 3300025922 | Bacteria | 3299 |
| 426 | Ga0207646_10071164 | 3300025922 | Bacteria | 3106 |
| 427 | Ga0207646_10087238 | 3300025922 | Bacteria | 2792 |
| 428 | Ga0207646_10128156 | 3300025922 | Bacteria | 2283 |
| 429 | Ga0207646_10202508 | 3300025922 | Bacteria | 1793 |
| 430 | Ga0207681_10001135 | 3300025923 | Bacteria | 17191 |
| 431 | Ga0207681_10026657 | 3300025923 | Bacteria | 3730 |
| 432 | Ga0207681_10253810 | 3300025923 | Bacteria | 1374 |
| 433 | Ga0207694_10225637 | 3300025924 | Bacteria | 1529 |
| 434 | Ga0207694_10243400 | 3300025924 | Bacteria | 1470 |
| 435 | Ga0207650_10002693 | 3300025925 | Bacteria | 12270 |
| 436 | Ga0207659_10000132 | 3300025926 | Bacteria | 43798 |
| 437 | Ga0207659_10029115 | 3300025926 | Bacteria | 3761 |
| 438 | Ga0207659_10164796 | 3300025926 | Bacteria | 1743 |
| 439 | Ga0207659_10326288 | 3300025926 | Bacteria | 1268 |
| 440 | Ga0207659_10436942 | 3300025926 | Bacteria | 1100 |
| 441 | Ga0207687_10000174 | 3300025927 | Bacteria | 42351 |
| 442 | Ga0207687_10399804 | 3300025927 | Bacteria | 1130 |
| 443 | Ga0207700_10086561 | 3300025928 | Bacteria | 2462 |
| 444 | Ga0207700_10353072 | 3300025928 | Bacteria | 1281 |
| 445 | Ga0207664_10006275 | 3300025929 | Bacteria | 8170 |
| 446 | Ga0207664_10027963 | 3300025929 | Bacteria | 4281 |
| 447 | Ga0207664_10432149 | 3300025929 | Bacteria | 1174 |
| 448 | Ga0207644_10000212 | 3300025931 | Bacteria | 40175 |
| 449 | Ga0207644_10033728 | 3300025931 | Bacteria | 3580 |
| 450 | Ga0207644_10102661 | 3300025931 | Bacteria | 2151 |
| 451 | Ga0207690_10001288 | 3300025932 | Bacteria | 15841 |
| 452 | Ga0207690_10012426 | 3300025932 | Bacteria | 5092 |
| 453 | Ga0207690_10029346 | 3300025932 | Bacteria | 3496 |
| 454 | Ga0207706_10002966 | 3300025933 | Bacteria | 16372 |
| 455 | Ga0207706_10112438 | 3300025933 | Bacteria | 2396 |
| 456 | Ga0207706_10133993 | 3300025933 | Bacteria | 2179 |
| 457 | Ga0207706_10229074 | 3300025933 | Bacteria | 1626 |
| 458 | Ga0207706_10270755 | 3300025933 | Bacteria | 1482 |
| 459 | Ga0207686_10021579 | 3300025934 | Bacteria | 3698 |
| 460 | Ga0207686_10027772 | 3300025934 | Bacteria | 3317 |
| 461 | Ga0207709_10000530 | 3300025935 | Bacteria | 33097 |
| 462 | Ga0207709_10003379 | 3300025935 | Bacteria | 9533 |
| 463 | Ga0207709_10111220 | 3300025935 | Bacteria | 1832 |
| 464 | Ga0207670_10000523 | 3300025936 | Bacteria | 21171 |
| 465 | Ga0207670_10028318 | 3300025936 | Bacteria | 3555 |
| 466 | Ga0207670_10153078 | 3300025936 | Bacteria | 1713 |
| 467 | Ga0207669_10000235 | 3300025937 | Bacteria | 25138 |
| 468 | Ga0207669_10034696 | 3300025937 | Bacteria | 2861 |
| 469 | Ga0207669_10171542 | 3300025937 | Bacteria | 1544 |
| 470 | Ga0207704_10000198 | 3300025938 | Bacteria | 31182 |
| 471 | Ga0207704_10000286 | 3300025938 | Bacteria | 23986 |
| 472 | Ga0207704_10275115 | 3300025938 | Bacteria | 1277 |
| 473 | Ga0207704_10637110 | 3300025938 | Bacteria | 876 |
| 474 | Ga0207691_10023983 | 3300025940 | Bacteria | 5739 |
| 475 | Ga0207691_10371561 | 3300025940 | Bacteria | 1221 |
| 476 | Ga0207711_10006368 | 3300025941 | Bacteria | 9949 |
| 477 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 478 | Ga0207689_10059736 | 3300025942 | Bacteria | 3136 |
| 479 | Ga0207661_10001228 | 3300025944 | Bacteria | 17172 |
| 480 | Ga0207661_10160105 | 3300025944 | Bacteria | 1953 |
| 481 | Ga0207661_10344571 | 3300025944 | Bacteria | 1343 |
| 482 | Ga0207679_10000183 | 3300025945 | Bacteria | 51645 |
| 483 | Ga0207679_10050493 | 3300025945 | Bacteria | 3040 |
| 484 | Ga0207679_10056825 | 3300025945 | Bacteria | 2891 |
| 485 | Ga0207667_10064461 | 3300025949 | Bacteria | 3825 |
| 486 | Ga0207667_10112179 | 3300025949 | Bacteria | 2812 |
| 487 | Ga0207667_10543606 | 3300025949 | Bacteria | 1175 |
| 488 | Ga0207667_10551587 | 3300025949 | Bacteria | 1166 |
| 489 | Ga0207667_10646078 | 3300025949 | Bacteria | 1064 |
| 490 | Ga0207651_10000051 | 3300025960 | Bacteria | 54163 |
| 491 | Ga0207651_10022102 | 3300025960 | Bacteria | 3881 |
| 492 | Ga0207712_10001703 | 3300025961 | Bacteria | 14771 |
| 493 | Ga0207712_10019046 | 3300025961 | Bacteria | 4478 |
| 494 | Ga0207712_10029987 | 3300025961 | Bacteria | 3654 |
| 495 | Ga0207712_10135389 | 3300025961 | Bacteria | 1883 |
| 496 | Ga0207668_10000664 | 3300025972 | Bacteria | 21087 |
| 497 | Ga0207668_10017224 | 3300025972 | Bacteria | 4523 |
| 498 | Ga0207640_10000343 | 3300025981 | Bacteria | 30767 |
| 499 | Ga0207640_10390665 | 3300025981 | Bacteria | 1130 |
| 500 | Ga0207658_10000064 | 3300025986 | Bacteria | 117779 |
| 501 | Ga0207658_10121938 | 3300025986 | Bacteria | 2080 |
| 502 | Ga0207658_10289290 | 3300025986 | Bacteria | 1407 |
| 503 | Ga0207677_10003168 | 3300026023 | Bacteria | 8684 |
| 504 | Ga0207677_10458961 | 3300026023 | Bacteria | 1093 |
| 505 | Ga0207703_10069812 | 3300026035 | Bacteria | 2899 |
| 506 | Ga0207703_10107818 | 3300026035 | Bacteria | 2371 |
| 507 | Ga0207703_10421025 | 3300026035 | Bacteria | 1243 |
| 508 | Ga0207639_10016448 | 3300026041 | Bacteria | 5234 |
| 509 | Ga0207678_10007497 | 3300026067 | Bacteria | 9645 |
| 510 | Ga0207678_10103624 | 3300026067 | Bacteria | 2429 |
| 511 | Ga0207678_10107739 | 3300026067 | Bacteria | 2377 |
| 512 | Ga0207678_10369882 | 3300026067 | Bacteria | 1238 |
| 513 | Ga0207678_10370474 | 3300026067 | Bacteria | 1237 |
| 514 | Ga0207708_10003609 | 3300026075 | Bacteria | 11405 |
| 515 | Ga0207708_10013133 | 3300026075 | Bacteria | 6181 |
| 516 | Ga0207708_10014559 | 3300026075 | Bacteria | 5885 |
| 517 | Ga0207708_10026728 | 3300026075 | Bacteria | 4369 |
| 518 | Ga0207708_10385232 | 3300026075 | Bacteria | 1157 |
| 519 | Ga0207702_10070805 | 3300026078 | Bacteria | 3000 |
| 520 | Ga0207641_10001831 | 3300026088 | Bacteria | 20447 |
| 521 | Ga0207641_10003244 | 3300026088 | Bacteria | 14521 |
| 522 | Ga0207641_10050032 | 3300026088 | Bacteria | 3534 |
| 523 | Ga0207641_10585882 | 3300026088 | Bacteria | 1091 |
| 524 | Ga0207648_10005395 | 3300026089 | Bacteria | 12892 |
| 525 | Ga0207648_10005612 | 3300026089 | Bacteria | 12612 |
| 526 | Ga0207648_10396214 | 3300026089 | Bacteria | 1250 |
| 527 | Ga0207676_10000124 | 3300026095 | Bacteria | 67747 |
| 528 | Ga0207676_10114286 | 3300026095 | Bacteria | 2264 |
| 529 | Ga0207674_10062426 | 3300026116 | Bacteria | 3763 |
| 530 | Ga0207674_10129547 | 3300026116 | Bacteria | 2487 |
| 531 | Ga0207674_10604650 | 3300026116 | Bacteria | 1059 |
| 532 | Ga0207675_100007008 | 3300026118 | Bacteria | 10659 |
| 533 | Ga0207675_100027633 | 3300026118 | Bacteria | 5284 |
| 534 | Ga0207675_100875409 | 3300026118 | Bacteria | 914 |
| 535 | Ga0207683_10000242 | 3300026121 | Bacteria | 48576 |
| 536 | Ga0207683_10010766 | 3300026121 | Bacteria | 7798 |
| 537 | Ga0207698_10023331 | 3300026142 | Bacteria | 4320 |
| 538 | Ga0207698_10146240 | 3300026142 | Bacteria | 2044 |
| 539 | Ga0207698_11602233 | 3300026142 | Bacteria | 666 |
| 540 | Ga0209973_1000799 | 3300027252 | Bacteria | 2533 |
| 541 | Ga0209969_1005910 | 3300027360 | Bacteria | 1722 |
| 542 | Ga0209984_1011359 | 3300027424 | Bacteria | 1153 |
| 543 | Ga0209995_1004561 | 3300027471 | Bacteria | 2216 |
| 544 | Ga0209968_1001085 | 3300027526 | Bacteria | 4150 |
| 545 | Ga0210002_1002000 | 3300027617 | Bacteria | 2932 |
| 546 | Ga0209983_1006615 | 3300027665 | Bacteria | 2378 |
| 547 | Ga0209588_1006440 | 3300027671 | Bacteria | 3412 |
| 548 | Ga0209966_1000641 | 3300027695 | Bacteria | 7848 |
| 549 | Ga0209998_10008003 | 3300027717 | Bacteria | 2193 |
| 550 | Ga0209998_10021146 | 3300027717 | Bacteria | 1396 |
| 551 | Ga0209974_10005603 | 3300027876 | Bacteria | 4408 |
| 552 | Ga0209974_10075719 | 3300027876 | Bacteria | 1152 |
| 553 | Ga0209974_10167800 | 3300027876 | Bacteria | 799 |
| 554 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 555 | Ga0207428_10030716 | 3300027907 | Bacteria | 4439 |
| 556 | Ga0207428_10204997 | 3300027907 | Bacteria | 1483 |
| 557 | Ga0207428_10469935 | 3300027907 | Bacteria | 916 |
| 558 | Ga0268266_10074281 | 3300028379 | Bacteria | 2952 |
| 559 | Ga0268265_10003320 | 3300028380 | Bacteria | 11642 |
| 560 | Ga0268265_10086615 | 3300028380 | Bacteria | 2490 |
| 561 | Ga0268265_10272456 | 3300028380 | Bacteria | 1510 |
| 562 | Ga0268264_10000277 | 3300028381 | Bacteria | 86740 |
| 563 | Ga0268264_10420674 | 3300028381 | Bacteria | 1288 |
| 564 | Ga0268264_10588476 | 3300028381 | Bacteria | 1095 |
| 565 | Ga0265762_1031130 | 3300030760 | Bacteria | 1014 |
| 566 | Ga0265340_10036269 | 3300031247 | Bacteria | 2444 |
| 567 | Ga0265339_10004825 | 3300031249 | Bacteria | 9117 |
| 568 | Ga0265316_10195630 | 3300031344 | Bacteria | 1501 |
| 569 | Ga0307408_100011260 | 3300031548 | Bacteria | 5907 |
| 570 | Ga0307408_100018807 | 3300031548 | Bacteria | 4643 |
| 571 | Ga0307408_100258848 | 3300031548 | Bacteria | 1439 |
| 572 | Ga0265313_10006102 | 3300031595 | Bacteria | 8671 |
| 573 | Ga0265313_10037034 | 3300031595 | Bacteria | 2444 |
| 574 | Ga0316575_10014672 | 3300031665 | Bacteria | 2945 |
| 575 | Ga0265314_10004990 | 3300031711 | Bacteria | 12094 |
| 576 | Ga0307405_10003907 | 3300031731 | Bacteria | 6958 |
| 577 | Ga0307413_10001530 | 3300031824 | Bacteria | 8875 |
| 578 | Ga0307413_10139468 | 3300031824 | Bacteria | 1673 |
| 579 | Ga0307410_10000285 | 3300031852 | Bacteria | 19565 |
| 580 | Ga0307410_10004966 | 3300031852 | Bacteria | 6971 |
| 581 | Ga0307410_10027373 | 3300031852 | Bacteria | 3603 |
| 582 | Ga0307410_10382599 | 3300031852 | Bacteria | 1133 |
| 583 | Ga0307406_10004231 | 3300031901 | Bacteria | 7805 |
| 584 | Ga0307406_10009039 | 3300031901 | Bacteria | 5572 |
| 585 | Ga0307406_10082357 | 3300031901 | Bacteria | 2142 |
| 586 | Ga0307407_10001057 | 3300031903 | Bacteria | 9539 |
| 587 | Ga0307407_10058334 | 3300031903 | Bacteria | 2243 |
| 588 | Ga0307407_10066342 | 3300031903 | Bacteria | 2128 |
| 589 | Ga0307407_10225944 | 3300031903 | Bacteria | 1268 |
| 590 | Ga0307412_10067354 | 3300031911 | Bacteria | 2431 |
| 591 | Ga0307412_10106910 | 3300031911 | Bacteria | 1990 |
| 592 | Ga0307412_10427986 | 3300031911 | Bacteria | 1084 |
| 593 | Ga0307412_10732829 | 3300031911 | Bacteria | 852 |
| 594 | Ga0307409_100000501 | 3300031995 | Bacteria | 16895 |
| 595 | Ga0307409_100063049 | 3300031995 | Bacteria | 2905 |
| 596 | Ga0307409_100154690 | 3300031995 | Bacteria | 1996 |
| 597 | Ga0307416_100003220 | 3300032002 | Bacteria | 9563 |
| 598 | Ga0307416_100003682 | 3300032002 | Bacteria | 9079 |
| 599 | Ga0307416_100010520 | 3300032002 | Bacteria | 6115 |
| 600 | Ga0307416_100089622 | 3300032002 | Bacteria | 2634 |
| 601 | Ga0307416_100277730 | 3300032002 | Bacteria | 1649 |
| 602 | Ga0307416_100595964 | 3300032002 | Bacteria | 1184 |
| 603 | Ga0307414_10212142 | 3300032004 | Bacteria | 1583 |
| 604 | Ga0307414_10428524 | 3300032004 | Bacteria | 1155 |
| 605 | Ga0307411_10001075 | 3300032005 | Bacteria | 10594 |
| 606 | Ga0307411_10665778 | 3300032005 | Bacteria | 903 |
| 607 | Ga0307415_100004272 | 3300032126 | Bacteria | 7389 |
| 608 | Ga0307415_100023019 | 3300032126 | Bacteria | 3858 |
| 609 | Ga0307415_100238454 | 3300032126 | Bacteria | 1469 |
| 610 | Ga0307415_100366390 | 3300032126 | Bacteria | 1218 |
| 611 | Ga0307415_100373659 | 3300032126 | Bacteria | 1208 |
| 612 | Ga0316583_10016566 | 3300032133 | Bacteria | 2652 |
| 613 | Ga0373930_0000191 | 3300034816 | Bacteria | 7407 |
| 614 | Ga0373930_0006543 | 3300034816 | Bacteria | 1975 |
| 615 | Ga0373948_0002325 | 3300034817 | Bacteria | 2793 |
| 616 | Ga0373950_0015306 | 3300034818 | Bacteria | 1299 |
| 617 | Ga0373958_0002981 | 3300034819 | Bacteria | 2419 |
| 618 | Ga0373959_0001384 | 3300034820 | Bacteria | 3879 |
| 619 | Ga0373959_0015275 | 3300034820 | Bacteria | 1408 |
| 620 | Ga0373938_0000013 | 3300034957 | Bacteria | 24269 |
| 621 | Ga0373926_0010463 | 3300035083 | Bacteria | 3111 |
| 622 | Ga0373928_0000255 | 3300035084 | Bacteria | 10564 |
| 623 | Ga0373929_0003185 | 3300035085 | Bacteria | 2974 |
| 624 | Ga0373929_0034068 | 3300035085 | Bacteria | 1103 |
| 625 | Ga0373929_0054210 | 3300035085 | Bacteria | 924 |
| 626 | Ga0373940_0001317 | 3300035088 | Bacteria | 4421 |
| 627 | Ga0373944_0021548 | 3300035089 | Bacteria | 1866 |
| 628 | Ga0373944_0028895 | 3300035089 | Bacteria | 1653 |
| 629 | Ga0373949_0013466 | 3300035090 | Bacteria | 1813 |
| 630 | Ga0373951_0000552 | 3300035091 | Bacteria | 10501 |
| 631 | Ga0373951_0020969 | 3300035091 | Bacteria | 1499 |
| 632 | Ga0373952_0000182 | 3300035092 | Bacteria | 9790 |
| 633 | Ga0373932_0000252 | 3300035112 | Bacteria | 16339 |
| 634 | Ga0373932_0012999 | 3300035112 | Bacteria | 2061 |
| 635 | Ga0373936_0164348 | 3300035113 | Bacteria | 968 |
| 636 | Ga0373939_0007484 | 3300035114 | Bacteria | 2654 |
| 637 | Ga0373939_0029054 | 3300035114 | Bacteria | 1578 |
| 638 | Ga0373945_0004201 | 3300035116 | Bacteria | 4567 |
| 639 | Ga0373960_0000068 | 3300035121 | Bacteria | 14664 |
| 640 | Ga0373960_0002169 | 3300035121 | Bacteria | 4416 |
| 641 | Ga0373960_0007261 | 3300035121 | Bacteria | 2622 |
| 642 | Ga0373960_0040532 | 3300035121 | Bacteria | 1345 |
| 643 | Ga0373943_0056727 | 3300035170 | Bacteria | 1944 |
| 644 | Ga0373943_0236963 | 3300035170 | Bacteria | 1021 |
| 645 | Ga0373946_0014684 | 3300035171 | Bacteria | 2956 |
| 646 | Ga0373946_0025094 | 3300035171 | Bacteria | 2342 |
| 647 | Ga0373942_0001815 | 3300035207 | Bacteria | 5399 |
| 648 | Ga0373961_0003115 | 3300035241 | Bacteria | 4156 |
| 649 | Ga0373961_0032972 | 3300035241 | Bacteria | 1456 |
| 650 | Ga0373961_0065415 | 3300035241 | Bacteria | 1113 |
| 651 | Ga0373962_0000112 | 3300035242 | Bacteria | 16939 |
| 652 | Ga0373962_0043496 | 3300035242 | Bacteria | 1273 |
| 653 | Ga0316574_0022880 | 3300035398 | Bacteria | 3726 |
| 654 | Ga0316574_0076966 | 3300035398 | Bacteria | 2114 |
| 655 | Ga0373924_0093750 | 3300035410 | Bacteria | 1286 |
| 656 | Ga0373931_0000305 | 3300035691 | Bacteria | 20657 |
| 657 | Ga0373931_0001634 | 3300035691 | Bacteria | 9691 |
| 658 | Ga0373931_0010148 | 3300035691 | Bacteria | 4521 |
| 659 | Ga0373931_0212100 | 3300035691 | Bacteria | 1162 |
| 660 | Ga0373935_0042487 | 3300035692 | Bacteria | 2859 |
| 661 | Ga0373927_0001782 | 3300035695 | Bacteria | 16060 |
| 662 | Ga0373927_0218680 | 3300035695 | Bacteria | 1251 |
| 663 | Ga0373927_0262594 | 3300035695 | Bacteria | 1135 |
| 664 | Ga0373947_0017628 | 3300035725 | Bacteria | 4108 |
| 665 | Ga0373947_0046144 | 3300035725 | Bacteria | 2608 |
| 666 | Ga0316582_0067485 | 3300036647 | Bacteria | 2308 |
| 667 | Ga0316584_0059029 | 3300036712 | Bacteria | 2873 |
| 668 | Ga0373925_0000994 | 3300037068 | Bacteria | 25755 |
| 669 | Ga0373925_0002218 | 3300037068 | Bacteria | 15763 |
| 670 | Ga0373925_0048113 | 3300037068 | Bacteria | 3176 |
| 671 | Ga0316581_0028179 | 3300037588 | Bacteria | 1682 |
| 672 | Ga0242420_022030 | 3300038996 | Bacteria | 1144 |
| 673 | Ga0436360_0355744 | 3300039438 | Bacteria | 1182 |
| 674 | Ga0436362_0986484 | 3300039453 | Bacteria | 591 |
| 675 | Ga0439441_032657 | 3300042001 | Bacteria | 1015 |
| 676 | Ga0439456_033005 | 3300042013 | Bacteria | 1113 |
| 677 | Ga0439460_0108195 | 3300042461 | Bacteria | 899 |
| 678 | Ga0451577_0053816 | 3300042876 | Bacteria | 3593 |
| 679 | Ga0451577_0112665 | 3300042876 | Bacteria | 2435 |
| 680 | Ga0451577_0112731 | 3300042876 | Bacteria | 2434 |
| 681 | Ga0451577_0424995 | 3300042876 | Bacteria | 1207 |
| 682 | Ga0453683_0014110 | 3300044673 | Bacteria | 5194 |
| 683 | Ga0453683_0027180 | 3300044673 | Bacteria | 3632 |
| 684 | Ga0453683_0036857 | 3300044673 | Bacteria | 3077 |
| 685 | Ga0466963_0000055 | 3300044694 | Bacteria | 37968 |
| 686 | Ga0453684_0000295 | 3300044712 | Bacteria | 211570 |
| 687 | Ga0453684_0157702 | 3300044712 | Bacteria | 2689 |
| 688 | Ga0466957_0029951 | 3300044842 | Bacteria | 3248 |
| 689 | Ga0451576_0000359 | 3300045051 | Bacteria | 109461 |
| 690 | Ga0451576_0081297 | 3300045051 | Bacteria | 3369 |
| 691 | Ga0451576_0154638 | 3300045051 | Bacteria | 2392 |
| 692 | Ga0451576_0205880 | 3300045051 | Bacteria | 2054 |
| 693 | Ga0466958_0013846 | 3300045836 | Bacteria | 4599 |
| 694 | Ga0466967_0002348 | 3300045976 | Bacteria | 11708 |
| 695 | Ga0466967_0662699 | 3300045976 | Bacteria | 1032 |
| 696 | Ga0495617_010759 | 3300046452 | Bacteria | 3132 |
| 697 | Ga0495603_0013329 | 3300046455 | Bacteria | 4972 |
| 698 | Ga0495603_0024811 | 3300046455 | Bacteria | 3627 |
| 699 | Ga0495603_0481232 | 3300046455 | Bacteria | 711 |
| 700 | Ga0495641_0003735 | 3300046461 | Bacteria | 11202 |
| 701 | Ga0495641_0085416 | 3300046461 | Bacteria | 1412 |
| 702 | Ga0495653_0026259 | 3300046463 | Bacteria | 4673 |
| 703 | Ga0495580_0000020 | 3300046472 | Bacteria | 91314 |
| 704 | Ga0495580_0009973 | 3300046472 | Bacteria | 7427 |
| 705 | Ga0495580_0113006 | 3300046472 | Bacteria | 1886 |
| 706 | Ga0495582_0001703 | 3300046473 | Bacteria | 12403 |
| 707 | Ga0495582_0010538 | 3300046473 | Bacteria | 5085 |
| 708 | Ga0495582_0365046 | 3300046473 | Bacteria | 832 |
| 709 | Ga0495639_0000828 | 3300046475 | Bacteria | 14100 |
| 710 | Ga0495639_0024994 | 3300046475 | Bacteria | 2632 |
| 711 | Ga0495662_0002737 | 3300046476 | Bacteria | 8908 |
| 712 | Ga0495662_0025652 | 3300046476 | Bacteria | 2846 |
| 713 | Ga0495662_0047488 | 3300046476 | Bacteria | 2072 |
| 714 | Ga0495664_0018869 | 3300046477 | Bacteria | 3958 |
| 715 | Ga0495584_0013349 | 3300046491 | Bacteria | 4194 |
| 716 | Ga0495584_0035185 | 3300046491 | Bacteria | 2532 |
| 717 | Ga0495584_0168878 | 3300046491 | Bacteria | 1112 |
| 718 | Ga0495585_0001730 | 3300046492 | Bacteria | 16612 |
| 719 | Ga0495594_0030366 | 3300046499 | Bacteria | 2923 |
| 720 | Ga0495594_0064727 | 3300046499 | Bacteria | 2027 |
| 721 | Ga0495607_0005316 | 3300046501 | Bacteria | 9259 |
| 722 | Ga0495608_0076168 | 3300046511 | Bacteria | 2186 |
| 723 | Ga0495616_0106023 | 3300046513 | Bacteria | 1311 |
| 724 | Ga0495616_0145054 | 3300046513 | Bacteria | 1078 |
| 725 | Ga0495618_0010074 | 3300046514 | Bacteria | 5714 |
| 726 | Ga0495628_0037042 | 3300046516 | Bacteria | 3911 |
| 727 | Ga0495630_0018065 | 3300046517 | Bacteria | 5175 |
| 728 | Ga0495644_0002586 | 3300046523 | Bacteria | 7194 |
| 729 | Ga0495644_0069438 | 3300046523 | Bacteria | 1324 |
| 730 | Ga0495644_0081446 | 3300046523 | Bacteria | 1220 |
| 731 | Ga0495663_0017834 | 3300046525 | Bacteria | 2018 |
| 732 | Ga0495666_0000309 | 3300046526 | Bacteria | 21203 |
| 733 | Ga0495642_0029511 | 3300046528 | Bacteria | 2190 |
| 734 | Ga0495652_0005095 | 3300046529 | Bacteria | 12426 |
| 735 | Ga0495665_0003045 | 3300046531 | Bacteria | 9054 |
| 736 | Ga0495640_0016017 | 3300046533 | Bacteria | 5621 |
| 737 | Ga0495640_0060453 | 3300046533 | Bacteria | 2577 |
| 738 | Ga0495586_0009993 | 3300046535 | Bacteria | 5056 |
| 739 | Ga0495587_0218275 | 3300046536 | Bacteria | 1076 |
| 740 | Ga0495598_0000729 | 3300046537 | Bacteria | 6257 |
| 741 | Ga0495598_0012975 | 3300046537 | Bacteria | 2056 |
| 742 | Ga0495609_0155331 | 3300046538 | Bacteria | 972 |
| 743 | Ga0495609_0188540 | 3300046538 | Bacteria | 866 |
| 744 | Ga0495621_0092546 | 3300046539 | Bacteria | 1141 |
| 745 | Ga0495597_0093982 | 3300046542 | Bacteria | 1270 |
| 746 | Ga0495645_0039870 | 3300046543 | Bacteria | 3425 |
| 747 | Ga0495633_0000941 | 3300046558 | Bacteria | 24412 |
| 748 | Ga0495656_0000589 | 3300046615 | Bacteria | 11760 |
| 749 | Ga0495656_0057048 | 3300046615 | Bacteria | 1689 |
| 750 | Ga0495656_0375727 | 3300046615 | Bacteria | 740 |
| 751 | Ga0495634_0004455 | 3300046642 | Bacteria | 10990 |
| 752 | Ga0495611_0001648 | 3300046648 | Bacteria | 10831 |
| 753 | Ga0495611_0039725 | 3300046648 | Bacteria | 2096 |
| 754 | Ga0495635_0105560 | 3300046663 | Bacteria | 1924 |
| 755 | Ga0495659_0003901 | 3300046664 | Bacteria | 4728 |
| 756 | Ga0495659_0019311 | 3300046664 | Bacteria | 2280 |
| 757 | Ga0495659_0116432 | 3300046664 | Bacteria | 1048 |
| 758 | Ga0495588_0018801 | 3300046674 | Bacteria | 3375 |
| 759 | Ga0495588_0109580 | 3300046674 | Bacteria | 1454 |
| 760 | Ga0495657_0026518 | 3300046675 | Bacteria | 4103 |
| 761 | Ga0495646_0016747 | 3300046680 | Bacteria | 4654 |
| 762 | Ga0495646_0304320 | 3300046680 | Bacteria | 843 |
| 763 | Ga0495647_0004236 | 3300046681 | Bacteria | 4644 |
| 764 | Ga0495658_0000498 | 3300046683 | Bacteria | 21575 |
| 765 | Ga0495658_0273776 | 3300046683 | Bacteria | 1064 |
| 766 | Ga0495669_0015480 | 3300046684 | Bacteria | 3267 |
| 767 | Ga0495669_0019842 | 3300046684 | Bacteria | 2904 |
| 768 | Ga0495613_0213996 | 3300046689 | Bacteria | 1354 |
| 769 | Ga0495624_0009825 | 3300046690 | Bacteria | 6618 |
| 770 | Ga0495670_0007523 | 3300046691 | Bacteria | 5355 |
| 771 | Ga0495670_0009268 | 3300046691 | Bacteria | 4842 |
| 772 | Ga0495589_0044804 | 3300046794 | Bacteria | 2199 |
| 773 | Ga0495589_0083171 | 3300046794 | Bacteria | 1556 |
| 774 | Ga0495581_0017975 | 3300047315 | Bacteria | 4108 |
| 775 | Ga0495581_0563997 | 3300047315 | Bacteria | 660 |
| 776 | Ga0495674_0007325 | 3300047319 | Bacteria | 10549 |
| 777 | Ga0495674_0781823 | 3300047319 | Bacteria | 744 |
| 778 | Ga0495672_0171419 | 3300047320 | Bacteria | 1107 |
| 779 | Ga0495676_0036425 | 3300047321 | Bacteria | 4108 |
| 780 | Ga0495680_0005229 | 3300047322 | Bacteria | 12252 |
| 781 | Ga0495680_0155051 | 3300047322 | Bacteria | 1667 |
| 782 | Ga0495677_0058593 | 3300047445 | Bacteria | 1425 |
| 783 | Ga0495679_007990 | 3300047446 | Bacteria | 4349 |
| 784 | Ga0495684_0108121 | 3300047471 | Bacteria | 2100 |
| 785 | Ga0495684_0147363 | 3300047471 | Bacteria | 1762 |
| 786 | Ga0495593_0001256 | 3300047673 | Bacteria | 14872 |
| 787 | Ga0496100_0000345 | 3300048903 | Bacteria | 22686 |
| 788 | Ga0496100_0000735 | 3300048903 | Bacteria | 15630 |
| 789 | Ga0496100_0373692 | 3300048903 | Bacteria | 1081 |
| 790 | Ga0496101_0000969 | 3300048904 | Bacteria | 16936 |
| 791 | Ga0496101_0001765 | 3300048904 | Bacteria | 12976 |
| 792 | Ga0496102_0004376 | 3300048905 | Bacteria | 11928 |
| 793 | Ga0496102_0006229 | 3300048905 | Bacteria | 10171 |
| 794 | Ga0496102_0088835 | 3300048905 | Bacteria | 2858 |
| 795 | Ga0496102_0089827 | 3300048905 | Bacteria | 2842 |
| 796 | Ga0496102_0093207 | 3300048905 | Bacteria | 2790 |
| 797 | Ga0496103_0000427 | 3300048906 | Bacteria | 36647 |
| 798 | Ga0496103_0001732 | 3300048906 | Bacteria | 14251 |
| 799 | Ga0496104_0044781 | 3300048907 | Bacteria | 4158 |
| 800 | Ga0496104_0081866 | 3300048907 | Bacteria | 3079 |
| 801 | Ga0496104_0130156 | 3300048907 | Bacteria | 2417 |
| 802 | Ga0496104_0561999 | 3300048907 | Bacteria | 1051 |
| 803 | Ga0496105_0079353 | 3300048908 | Bacteria | 2710 |
| 804 | Ga0496105_0161832 | 3300048908 | Bacteria | 1837 |
| 805 | Ga0496106_0018993 | 3300048909 | Bacteria | 5094 |
| 806 | Ga0496106_0075150 | 3300048909 | Bacteria | 2587 |
| 807 | Ga0496106_0109289 | 3300048909 | Bacteria | 2151 |
| 808 | Ga0496106_0215774 | 3300048909 | Bacteria | 1529 |
| 809 | Ga0496107_0005598 | 3300048910 | Bacteria | 8604 |
| 810 | Ga0496107_0011572 | 3300048910 | Bacteria | 6148 |
| 811 | Ga0496107_0340545 | 3300048910 | Bacteria | 1116 |
| 812 | Ga0496108_0012348 | 3300048911 | Bacteria | 6950 |
| 813 | Ga0496108_0031377 | 3300048911 | Bacteria | 4409 |
| 814 | Ga0496108_0058890 | 3300048911 | Bacteria | 3230 |
| 815 | Ga0496108_0076691 | 3300048911 | Bacteria | 2825 |
| 816 | Ga0496108_0254694 | 3300048911 | Bacteria | 1527 |
| 817 | Ga0496108_0380158 | 3300048911 | Bacteria | 1233 |
| 818 | Ga0496109_0005949 | 3300048912 | Bacteria | 10237 |
| 819 | Ga0496109_0181400 | 3300048912 | Bacteria | 1977 |
| 820 | Ga0496109_0414621 | 3300048912 | Bacteria | 1272 |
| 821 | Ga0496109_0474967 | 3300048912 | Bacteria | 1181 |
| 822 | Ga0496110_0100320 | 3300048913 | Bacteria | 2595 |
| 823 | Ga0496110_0149875 | 3300048913 | Bacteria | 2111 |
| 824 | Ga0496110_0322776 | 3300048913 | Bacteria | 1406 |
| 825 | Ga0496110_0400144 | 3300048913 | Bacteria | 1252 |
| 826 | Ga0496110_1173831 | 3300048913 | Bacteria | 676 |
| 827 | Ga0496111_0052074 | 3300048914 | Bacteria | 2955 |
| 828 | Ga0496111_0086316 | 3300048914 | Bacteria | 2296 |
| 829 | Ga0496111_0144950 | 3300048914 | Bacteria | 1760 |
| 830 | Ga0496111_0352853 | 3300048914 | Bacteria | 1089 |
| 831 | Ga0496112_0053839 | 3300048915 | Bacteria | 3953 |
| 832 | Ga0496112_0095542 | 3300048915 | Bacteria | 2942 |
| 833 | Ga0496112_0150977 | 3300048915 | Bacteria | 2290 |
| 834 | Ga0496112_0410025 | 3300048915 | Bacteria | 1294 |
| 835 | Ga0496113_0063896 | 3300048916 | Bacteria | 2782 |
| 836 | Ga0496113_0105218 | 3300048916 | Bacteria | 2191 |
| 837 | Ga0496113_0356457 | 3300048916 | Bacteria | 1173 |
| 838 | Ga0496114_0001861 | 3300048917 | Bacteria | 15984 |
| 839 | Ga0496114_0002647 | 3300048917 | Bacteria | 13668 |
| 840 | Ga0496114_0026853 | 3300048917 | Bacteria | 4717 |
| 841 | Ga0496114_0110408 | 3300048917 | Bacteria | 2356 |
| 842 | Ga0496114_0313744 | 3300048917 | Bacteria | 1385 |
| 843 | Ga0496115_0001915 | 3300048918 | Bacteria | 14859 |
| 844 | Ga0496115_0007035 | 3300048918 | Bacteria | 8266 |
| 845 | Ga0496115_0233730 | 3300048918 | Bacteria | 1515 |
| 846 | Ga0501298_011404 | 3300049521 | Bacteria | 1543 |
| 847 | Ga0501031_0160042 | 3300049568 | Bacteria | 1472 |
| 848 | Ga0501032_0107281 | 3300049569 | Bacteria | 1850 |
| 849 | Ga0501033_0124456 | 3300049570 | Bacteria | 1870 |
| 850 | Ga0501036_0044877 | 3300049572 | Bacteria | 3745 |
| 851 | Ga0501036_0258463 | 3300049572 | Bacteria | 1459 |
| 852 | Ga0501037_0072122 | 3300049573 | Bacteria | 2512 |
| 853 | Ga0501037_0300062 | 3300049573 | Bacteria | 1116 |
| 854 | Ga0501038_0112160 | 3300049574 | Bacteria | 2258 |
| 855 | Ga0501038_0275060 | 3300049574 | Bacteria | 1327 |
| 856 | Ga0501039_0199763 | 3300049575 | Bacteria | 1572 |
| 857 | Ga0501039_0401144 | 3300049575 | Bacteria | 1077 |
| 858 | Ga0501040_0047193 | 3300049576 | Bacteria | 2941 |
| 859 | Ga0501040_0055045 | 3300049576 | Bacteria | 2728 |
| 860 | Ga0501040_0080718 | 3300049576 | Bacteria | 2253 |
| 861 | Ga0501040_0136293 | 3300049576 | Bacteria | 1728 |
| 862 | Ga0501040_0179547 | 3300049576 | Bacteria | 1500 |
| 863 | Ga0501040_0249342 | 3300049576 | Bacteria | 1266 |
| 864 | Ga0501040_0509296 | 3300049576 | Bacteria | 868 |
| 865 | Ga0501041_0047899 | 3300049577 | Bacteria | 2603 |
| 866 | Ga0501041_0168203 | 3300049577 | Bacteria | 1371 |
| 867 | Ga0501041_0185306 | 3300049577 | Bacteria | 1303 |
| 868 | Ga0501042_0009210 | 3300049578 | Bacteria | 6570 |
| 869 | Ga0501042_0109415 | 3300049578 | Bacteria | 1990 |
| 870 | Ga0501042_0128552 | 3300049578 | Bacteria | 1825 |
| 871 | Ga0501048_0007522 | 3300049582 | Bacteria | 8255 |
| 872 | Ga0501048_0254908 | 3300049582 | Bacteria | 1246 |
| 873 | Ga0501067_0142852 | 3300049583 | Bacteria | 1333 |
| 874 | Ga0501067_0393106 | 3300049583 | Bacteria | 773 |
| 875 | Ga0501068_0035130 | 3300049584 | Bacteria | 2991 |
| 876 | Ga0501068_0129934 | 3300049584 | Bacteria | 1575 |
| 877 | Ga0501069_0085016 | 3300049585 | Bacteria | 1785 |
| 878 | Ga0501069_0374917 | 3300049585 | Bacteria | 840 |
| 879 | Ga0501070_0108402 | 3300049586 | Bacteria | 2295 |
| 880 | Ga0501071_0030822 | 3300049587 | Bacteria | 3795 |
| 881 | Ga0501071_0045651 | 3300049587 | Bacteria | 3145 |
| 882 | Ga0501071_0084366 | 3300049587 | Bacteria | 2328 |
| 883 | Ga0501072_0093892 | 3300049588 | Bacteria | 2383 |
| 884 | Ga0501072_0135380 | 3300049588 | Bacteria | 1964 |
| 885 | Ga0501072_0179850 | 3300049588 | Bacteria | 1687 |
| 886 | Ga0501073_0318813 | 3300049589 | Bacteria | 1073 |
| 887 | Ga0501075_0006835 | 3300049591 | Bacteria | 7875 |
| 888 | Ga0501075_0043196 | 3300049591 | Bacteria | 3380 |
| 889 | Ga0501075_0170493 | 3300049591 | Bacteria | 1661 |
| 890 | Ga0501075_0228188 | 3300049591 | Bacteria | 1420 |
| 891 | Ga0501076_0028793 | 3300049592 | Bacteria | 4316 |
| 892 | Ga0501076_0047582 | 3300049592 | Bacteria | 3391 |
| 893 | Ga0501076_0106110 | 3300049592 | Bacteria | 2267 |
| 894 | Ga0501076_0257319 | 3300049592 | Bacteria | 1429 |
| 895 | Ga0501076_0263785 | 3300049592 | Bacteria | 1410 |
| 896 | Ga0501076_0351716 | 3300049592 | Bacteria | 1210 |
| 897 | Ga0501077_0008210 | 3300049593 | Bacteria | 6455 |
| 898 | Ga0501077_0165265 | 3300049593 | Bacteria | 1406 |
| 899 | Ga0501202_060777 | 3300049652 | Bacteria | 854 |
| 900 | Ga0501217_005170 | 3300049661 | Bacteria | 2717 |
| 901 | Ga0501233_004036 | 3300049668 | Bacteria | 2668 |
| 902 | Ga0501247_001365 | 3300049677 | Bacteria | 2328 |
| 903 | Ga0501219_002023 | 3300049703 | Bacteria | 1661 |
| 904 | Ga0501225_0027274 | 3300049705 | Bacteria | 1571 |
| 905 | Ga0501079_0025157 | 3300049741 | Bacteria | 4566 |
| 906 | Ga0501079_0035117 | 3300049741 | Bacteria | 3858 |
| 907 | Ga0501079_0110880 | 3300049741 | Bacteria | 2132 |
| 908 | Ga0501080_0015571 | 3300049742 | Bacteria | 7013 |
| 909 | Ga0501080_0017337 | 3300049742 | Bacteria | 6658 |
| 910 | Ga0501080_0051733 | 3300049742 | Bacteria | 3823 |
| 911 | Ga0501080_0177120 | 3300049742 | Bacteria | 1964 |
| 912 | Ga0501081_0012727 | 3300049743 | Bacteria | 5534 |
| 913 | Ga0501081_0173575 | 3300049743 | Bacteria | 1557 |
| 914 | Ga0501081_0405298 | 3300049743 | Bacteria | 1010 |
| 915 | Ga0501081_0434115 | 3300049743 | Bacteria | 974 |
| 916 | Ga0501083_0157277 | 3300049744 | Bacteria | 1487 |
| 917 | Ga0501083_0262638 | 3300049744 | Bacteria | 1123 |
| 918 | Ga0501263_000777 | 3300049760 | Bacteria | 2683 |
| 919 | Ga0501268_000281 | 3300049765 | Bacteria | 5208 |
| 920 | Ga0501270_012548 | 3300049767 | Bacteria | 1158 |
| 921 | Ga0501273_010847 | 3300049770 | Bacteria | 1126 |
| 922 | Ga0501035_0065562 | 3300049822 | Bacteria | 3225 |
| 923 | Ga0501035_0292692 | 3300049822 | Bacteria | 1374 |
| 924 | Ga0501204_003963 | 3300049850 | Bacteria | 1578 |
| 925 | Ga0501212_005413 | 3300049851 | Bacteria | 1684 |
| 926 | nmdc:mga0k408_67480_c1 | 3300050493 | Bacteria | 2084 |
| 927 | nmdc:mga05p37_101915_c1 | 3300050507 | Bacteria | 3535 |
| 928 | nmdc:mga05p37_122064_c2 | 3300050507 | Bacteria | 1189 |
| 929 | nmdc:mga05p37_158178_c1 | 3300050507 | Bacteria | 2768 |
| 930 | nmdc:mga05p37_1773_c1 | 3300050507 | Bacteria | 25196 |
| 931 | nmdc:mga05p37_210959_c1 | 3300050507 | Bacteria | 2348 |
| 932 | nmdc:mga05p37_589855_c1 | 3300050507 | Bacteria | 1257 |
| 933 | nmdc:mga09592_132575_c1 | 3300050508 | Bacteria | 2145 |
| 934 | nmdc:mga09592_17095_c1 | 3300050508 | Bacteria | 5938 |
| 935 | nmdc:mga09592_26571_c1 | 3300050508 | Bacteria | 4798 |
| 936 | nmdc:mga09592_416483_c1 | 3300050508 | Bacteria | 1161 |
| 937 | nmdc:mga09592_73465_c1 | 3300050508 | Bacteria | 2906 |
| 938 | nmdc:mga0qj67_403481_c1 | 3300050509 | Bacteria | 1103 |
| 939 | nmdc:mga0qj67_414935_c1 | 3300050509 | Bacteria | 1086 |
| 940 | nmdc:mga0qj67_66080_c1 | 3300050509 | Bacteria | 2880 |
| 941 | nmdc:mga06r32_150921_c1 | 3300050510 | Bacteria | 2302 |
| 942 | nmdc:mga06r32_197607_c1 | 3300050510 | Bacteria | 1998 |
| 943 | nmdc:mga06r32_215006_c1 | 3300050510 | Bacteria | 1910 |
| 944 | nmdc:mga06r32_253763_c1 | 3300050510 | Bacteria | 1746 |
| 945 | nmdc:mga06r32_286452_c1 | 3300050510 | Bacteria | 1634 |
| 946 | nmdc:mga06r32_52016_c1 | 3300050510 | Bacteria | 3922 |
| 947 | nmdc:mga06r32_8063_c1 | 3300050510 | Bacteria | 9478 |
| 948 | nmdc:mga06r32_93321_c1 | 3300050510 | Bacteria | 2944 |
| 949 | nmdc:mga08y16_16604_c1 | 3300050511 | Bacteria | 7743 |
| 950 | nmdc:mga08y16_3117_c1 | 3300050511 | Bacteria | 17166 |
| 951 | nmdc:mga08y16_333_c1 | 3300050511 | Bacteria | 42807 |
| 952 | nmdc:mga0n895_1174_c1 | 3300050512 | Bacteria | 19193 |
| 953 | nmdc:mga0n895_13026_c1 | 3300050512 | Bacteria | 7481 |
| 954 | nmdc:mga0n895_17413_c1 | 3300050512 | Bacteria | 6621 |
| 955 | nmdc:mga0n895_352386_c1 | 3300050512 | Bacteria | 1491 |
| 956 | nmdc:mga0n895_44735_c1 | 3300050512 | Bacteria | 4317 |
| 957 | nmdc:mga0n895_500058_c1 | 3300050512 | Bacteria | 1225 |
| 958 | nmdc:mga0n895_77155_c1 | 3300050512 | Bacteria | 3314 |
| 959 | nmdc:mga0rr50_202666_c1 | 3300050513 | Bacteria | 1631 |
| 960 | nmdc:mga0rr50_232744_c1 | 3300050513 | Bacteria | 1525 |
| 961 | nmdc:mga0rr50_4985_c1 | 3300050513 | Bacteria | 7863 |
| 962 | nmdc:mga0rr50_61694_c1 | 3300050513 | Bacteria | 2825 |
| 963 | nmdc:mga08x19_204996_c1 | 3300050514 | Bacteria | 1352 |
| 964 | nmdc:mga08x19_287479_c1 | 3300050514 | Bacteria | 1140 |
| 965 | nmdc:mga08x19_798869_c1 | 3300050514 | Bacteria | 670 |
| 966 | nmdc:mga0a205_11705_c1 | 3300050515 | Bacteria | 8091 |
| 967 | nmdc:mga0a205_2218_c1 | 3300050515 | Bacteria | 17084 |
| 968 | nmdc:mga0a205_54866_c1 | 3300050515 | Bacteria | 3848 |
| 969 | nmdc:mga0a205_6917_c1 | 3300050515 | Bacteria | 10255 |
| 970 | Ga0495612_0039191 | 3300053078 | Bacteria | 1926 |
| 971 | Ga0495612_0088504 | 3300053078 | Bacteria | 1308 |
| 972 | Ga0495655_0039155 | 3300053083 | Bacteria | 1200 |
| 973 | Ga0495595_0035073 | 3300053084 | Bacteria | 2272 |
| 974 | Ga0495619_0007707 | 3300053085 | Bacteria | 6815 |
| 975 | Ga0495619_0713408 | 3300053085 | Bacteria | 681 |
| 976 | Ga0500643_001596 | 3300053087 | Bacteria | 12817 |
| 977 | Ga0500644_0001281 | 3300053088 | Bacteria | 6847 |
| 978 | Ga0500651_0066405 | 3300053093 | Bacteria | 2246 |
| 979 | Ga0500566_0070333 | 3300053094 | Bacteria | 1965 |
| 980 | Ga0500641_0007663 | 3300053096 | Bacteria | 3847 |
| 981 | Ga0500650_0088338 | 3300053098 | Bacteria | 1451 |
| 982 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 983 | Ga0500597_090681 | 3300053120 | Bacteria | 1328 |
| 984 | Ga0500652_001803 | 3300053131 | Bacteria | 6489 |
| 985 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 986 | Ga0500645_001772 | 3300053730 | Bacteria | 10420 |
| 987 | Ga0501084_0004051 | 3300054114 | Bacteria | 11934 |
| 988 | Ga0501084_0021009 | 3300054114 | Bacteria | 5445 |
| 989 | Ga0501084_0062068 | 3300054114 | Bacteria | 3129 |
| 990 | Ga0501084_0375339 | 3300054114 | Bacteria | 1202 |
| 991 | Ga0590071_003007 | 3300059421 | Bacteria | 4185 |
| 992 | Ga0590071_003425 | 3300059421 | Bacteria | 3897 |
| 993 | Ga0590075_021012 | 3300059424 | Bacteria | 1626 |
| 994 | Ga0590075_039106 | 3300059424 | Bacteria | 1210 |
| 995 | Ga0587066_061401 | 3300059490 | Bacteria | 768 |
| 996 | Ga0587085_006926 | 3300059506 | Bacteria | 1396 |
| 997 | Ga0587086_002901 | 3300059507 | Bacteria | 1678 |
| 998 | Ga0587092_013766 | 3300059512 | Bacteria | 1161 |
| 999 | Ga0587101_025717 | 3300059623 | Bacteria | 884 |
| 1000 | Ga0587109_017716 | 3300059624 | Bacteria | 1236 |
| 1001 | Ga0587062_002920 | 3300059639 | Bacteria | 1679 |
| 1002 | Ga0587069_029564 | 3300059642 | Bacteria | 877 |
| 1003 | Ga0501082_0047119 | 3300060353 | Bacteria | 3715 |
| 1004 | Ga0501082_0120716 | 3300060353 | Bacteria | 2272 |
| 1005 | Ga0530510_0006450 | 3300061734 | Bacteria | 8169 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035085 | Ga0373929_0054210 | Ga0373929_0054210_344_907 | 163 |
| 2 | 3300039453 | Ga0436362_0986484 | Ga0436362_0986484_10_501 | 163 |
| 3 | 3300049822 | Ga0501035_0065562 | Ga0501035_0065562_14_505 | 163 |
| 4 | 3300035085 | Ga0373929_0034068 | Ga0373929_0034068_547_1077 | 176 |
| 5 | iso_pu_bacteria | 2513237150 | 2513956738 | 176 |
| 6 | iso_pu_bacteria | 2513237165 | 2514044433 | 176 |
| 7 | iso_pu_bacteria | 2596583598 | 2597031647 | 176 |
| 8 | iso_pu_bacteria | 2599185178 | 2599448112 | 176 |
| 9 | iso_pu_bacteria | 2885266251 | 2885269529 | 176 |
| 10 | iso_pu_bacteria | 2900577576 | 2900580348 | 176 |
| 11 | iso_pu_bacteria | 2901300506 | 2901304173 | 176 |
| 12 | iso_pu_bacteria | 2928058823 | 2928063728 | 176 |
| 13 | iso_pu_bacteria | 644736347 | 644749248 | 176 |
| 14 | 3300044673 | Ga0453683_0014110 | Ga0453683_0014110_1596_2135 | 179 |
| 15 | 3300044712 | Ga0453684_0000295 | Ga0453684_0000295_106840_107379 | 179 |
| 16 | 3300045051 | Ga0451576_0000359 | Ga0451576_0000359_106859_107398 | 179 |
| 17 | 3300003773 | Ga0055537_1009925 | Ga0055537_10099252 | 180 |
| 18 | 3300003775 | Ga0055524_1018915 | Ga0055524_10189155 | 180 |
| 19 | 3300003781 | Ga0055536_1000296 | Ga0055536_100029620 | 180 |
| 20 | 3300025263 | Ga0209565_1001322 | Ga0209565_100132215 | 180 |
| 21 | 3300025273 | Ga0209673_1014116 | Ga0209673_10141166 | 180 |
| 22 | 3300025291 | Ga0209675_1003392 | Ga0209675_10033929 | 180 |
| 23 | 3300025292 | Ga0209676_1000331 | Ga0209676_100033120 | 180 |
| 24 | 3300025294 | Ga0209025_1024137 | Ga0209025_10241377 | 180 |
| 25 | 3300025294 | Ga0209025_1042411 | Ga0209025_10424111 | 180 |
| 26 | 3300025294 | Ga0209025_1068664 | Ga0209025_10686642 | 180 |
| 27 | 3300025297 | Ga0209758_1019600 | Ga0209758_10196004 | 180 |
| 28 | 3300025299 | Ga0209256_1011073 | Ga0209256_10110735 | 180 |
| 29 | 3300025303 | Ga0209051_1086221 | Ga0209051_10862212 | 180 |
| 30 | 3300053088 | Ga0500644_0001281 | Ga0500644_0001281_3280_3930 | 180 |
| 31 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_569629_570279 | 180 |
| 32 | 3300059506 | Ga0587085_006926 | Ga0587085_006926_224_766 | 180 |
| 33 | 3300059507 | Ga0587086_002901 | Ga0587086_002901_914_1456 | 180 |
| 34 | 3300059512 | Ga0587092_013766 | Ga0587092_013766_516_1058 | 180 |
| 35 | 3300059623 | Ga0587101_025717 | Ga0587101_025717_224_766 | 180 |
| 36 | 3300059624 | Ga0587109_017716 | Ga0587109_017716_404_946 | 180 |
| 37 | 3300059639 | Ga0587062_002920 | Ga0587062_002920_915_1457 | 180 |
| 38 | 3300059642 | Ga0587069_029564 | Ga0587069_029564_222_764 | 180 |
| 39 | 3300042876 | Ga0451577_0112665 | Ga0451577_0112665_389_1108 | 181 |
| 40 | 3300031665 | Ga0316575_10014672 | Ga0316575_100146725 | 183 |
| 41 | 3300032133 | Ga0316583_10016566 | Ga0316583_100165662 | 183 |
| 42 | 3300035398 | Ga0316574_0022880 | Ga0316574_0022880_1543_2172 | 183 |
| 43 | 3300036647 | Ga0316582_0067485 | Ga0316582_0067485_372_1001 | 183 |
| 44 | 3300036712 | Ga0316584_0059029 | Ga0316584_0059029_1726_2355 | 183 |
| 45 | 3300037588 | Ga0316581_0028179 | Ga0316581_0028179_738_1367 | 183 |
| 46 | 3300005343 | Ga0070687_100001952 | Ga0070687_1000019522 | 184 |
| 47 | 3300005343 | Ga0070687_100109341 | Ga0070687_1001093413 | 184 |
| 48 | 3300005364 | Ga0070673_100044532 | Ga0070673_1000445327 | 184 |
| 49 | 3300005365 | Ga0070688_100464201 | Ga0070688_1004642012 | 184 |
| 50 | 3300005366 | Ga0070659_100170238 | Ga0070659_1001702381 | 184 |
| 51 | 3300005444 | Ga0070694_100140371 | Ga0070694_1001403712 | 184 |
| 52 | 3300005719 | Ga0068861_100428333 | Ga0068861_1004283332 | 184 |
| 53 | 3300005841 | Ga0068863_100008669 | Ga0068863_10000866913 | 184 |
| 54 | 3300005843 | Ga0068860_100000220 | Ga0068860_10000022026 | 184 |
| 55 | 3300007076 | Ga0075435_100254935 | Ga0075435_1002549353 | 184 |
| 56 | 3300009174 | Ga0105241_10163780 | Ga0105241_101637802 | 184 |
| 57 | 3300009174 | Ga0105241_10267822 | Ga0105241_102678222 | 184 |
| 58 | 3300009551 | Ga0105238_10637049 | Ga0105238_106370492 | 184 |
| 59 | 3300013307 | Ga0157372_10195142 | Ga0157372_101951422 | 184 |
| 60 | 3300017792 | Ga0163161_10050412 | Ga0163161_100504124 | 184 |
| 61 | 3300025903 | Ga0207680_10196784 | Ga0207680_101967842 | 184 |
| 62 | 3300025918 | Ga0207662_10000745 | Ga0207662_100007452 | 184 |
| 63 | 3300025986 | Ga0207658_10000064 | Ga0207658_1000006449 | 184 |
| 64 | 3300026088 | Ga0207641_10003244 | Ga0207641_1000324410 | 184 |
| 65 | 3300026118 | Ga0207675_100007008 | Ga0207675_1000070084 | 184 |
| 66 | 3300028381 | Ga0268264_10000277 | Ga0268264_1000027793 | 184 |
| 67 | 3300049573 | Ga0501037_0300062 | Ga0501037_0300062_292_867 | 184 |
| 68 | 3300050513 | nmdc:mga0rr50_61694_c1 | nmdc:mga0rr50_61694_c1_677_1474 | 184 |
| 69 | 3300009098 | Ga0105245_10020560 | Ga0105245_100205606 | 185 |
| 70 | 3300013102 | Ga0157371_10199288 | Ga0157371_101992883 | 185 |
| 71 | 3300025912 | Ga0207707_10283406 | Ga0207707_102834062 | 185 |
| 72 | 3300025918 | Ga0207662_10617807 | Ga0207662_106178072 | 185 |
| 73 | 3300025922 | Ga0207646_10128156 | Ga0207646_101281566 | 185 |
| 74 | 3300025935 | Ga0207709_10111220 | Ga0207709_101112202 | 185 |
| 75 | 3300028381 | Ga0268264_10588476 | Ga0268264_105884761 | 185 |
| 76 | 3300046455 | Ga0495603_0481232 | Ga0495603_0481232_47_649 | 185 |
| 77 | 3300048903 | Ga0496100_0373692 | Ga0496100_0373692_21_611 | 185 |
| 78 | 3300048913 | Ga0496110_1173831 | Ga0496110_1173831_73_663 | 185 |
| 79 | 3300048917 | Ga0496114_0026853 | Ga0496114_0026853_3641_4330 | 185 |
| 80 | 3300059490 | Ga0587066_061401 | Ga0587066_061401_139_723 | 185 |
| 81 | 3300005549 | Ga0070704_101259384 | Ga0070704_1012593841 | 186 |
| 82 | 3300005718 | Ga0068866_10072780 | Ga0068866_100727803 | 186 |
| 83 | 3300006914 | Ga0075436_100411709 | Ga0075436_1004117091 | 186 |
| 84 | 3300009101 | Ga0105247_10133613 | Ga0105247_101336134 | 186 |
| 85 | 3300009177 | Ga0105248_10206586 | Ga0105248_102065862 | 186 |
| 86 | 3300009553 | Ga0105249_10210176 | Ga0105249_102101762 | 186 |
| 87 | 3300010375 | Ga0105239_10269246 | Ga0105239_102692464 | 186 |
| 88 | 3300013296 | Ga0157374_10472525 | Ga0157374_104725253 | 186 |
| 89 | 3300025900 | Ga0207710_10175460 | Ga0207710_101754601 | 186 |
| 90 | 3300025909 | Ga0207705_10056065 | Ga0207705_100560653 | 186 |
| 91 | 3300025929 | Ga0207664_10027963 | Ga0207664_100279639 | 186 |
| 92 | 3300025949 | Ga0207667_10543606 | Ga0207667_105436061 | 186 |
| 93 | 3300026035 | Ga0207703_10421025 | Ga0207703_104210253 | 186 |
| 94 | 3300046473 | Ga0495582_0365046 | Ga0495582_0365046_36_611 | 186 |
| 95 | 3300046476 | Ga0495662_0047488 | Ga0495662_0047488_216_791 | 186 |
| 96 | 3300046511 | Ga0495608_0076168 | Ga0495608_0076168_243_818 | 186 |
| 97 | 3300046523 | Ga0495644_0069438 | Ga0495644_0069438_614_1192 | 186 |
| 98 | 3300046533 | Ga0495640_0060453 | Ga0495640_0060453_641_1216 | 186 |
| 99 | 3300046615 | Ga0495656_0375727 | Ga0495656_0375727_122_700 | 186 |
| 100 | 3300046675 | Ga0495657_0026518 | Ga0495657_0026518_1103_1678 | 186 |
| 101 | 3300046680 | Ga0495646_0304320 | Ga0495646_0304320_65_640 | 186 |
| 102 | 3300047322 | Ga0495680_0155051 | Ga0495680_0155051_20_595 | 186 |
| 103 | 3300047471 | Ga0495684_0147363 | Ga0495684_0147363_1120_1695 | 186 |
| 104 | 3300048905 | Ga0496102_0093207 | Ga0496102_0093207_265_840 | 186 |
| 105 | 3300048907 | Ga0496104_0044781 | Ga0496104_0044781_999_1577 | 186 |
| 106 | 3300048910 | Ga0496107_0340545 | Ga0496107_0340545_55_633 | 186 |
| 107 | 3300048911 | Ga0496108_0058890 | Ga0496108_0058890_1502_2080 | 186 |
| 108 | 3300048914 | Ga0496111_0086316 | Ga0496111_0086316_1222_1800 | 186 |
| 109 | 3300048916 | Ga0496113_0105218 | Ga0496113_0105218_1153_1731 | 186 |
| 110 | 3300048917 | Ga0496114_0313744 | Ga0496114_0313744_312_890 | 186 |
| 111 | 3300049575 | Ga0501039_0401144 | Ga0501039_0401144_85_660 | 186 |
| 112 | 3300049578 | Ga0501042_0109415 | Ga0501042_0109415_1228_1803 | 186 |
| 113 | 3300049591 | Ga0501075_0228188 | Ga0501075_0228188_668_1243 | 186 |
| 114 | 3300049592 | Ga0501076_0351716 | Ga0501076_0351716_499_1074 | 186 |
| 115 | 3300049743 | Ga0501081_0173575 | Ga0501081_0173575_478_1053 | 186 |
| 116 | 3300050514 | nmdc:mga08x19_798869_c1 | nmdc:mga08x19_798869_c1_26_601 | 186 |
| 117 | 3300053078 | Ga0495612_0088504 | Ga0495612_0088504_355_930 | 186 |
| 118 | 3300053084 | Ga0495595_0035073 | Ga0495595_0035073_183_758 | 186 |
| 119 | 3300009094 | Ga0111539_10470861 | Ga0111539_104708612 | 187 |
| 120 | 3300009147 | Ga0114129_10035427 | Ga0114129_100354278 | 187 |
| 121 | 3300012502 | Ga0157347_1012454 | Ga0157347_10124542 | 187 |
| 122 | 3300035089 | Ga0373944_0028895 | Ga0373944_0028895_463_1047 | 187 |
| 123 | 3300035113 | Ga0373936_0164348 | Ga0373936_0164348_110_694 | 187 |
| 124 | 3300035170 | Ga0373943_0056727 | Ga0373943_0056727_1118_1702 | 187 |
| 125 | 3300035171 | Ga0373946_0014684 | Ga0373946_0014684_2141_2725 | 187 |
| 126 | 3300035410 | Ga0373924_0093750 | Ga0373924_0093750_391_975 | 187 |
| 127 | 3300035695 | Ga0373927_0218680 | Ga0373927_0218680_525_1109 | 187 |
| 128 | 3300035725 | Ga0373947_0017628 | Ga0373947_0017628_610_1194 | 187 |
| 129 | 3300037068 | Ga0373925_0002218 | Ga0373925_0002218_3336_3920 | 187 |
| 130 | 3300044694 | Ga0466963_0000055 | Ga0466963_0000055_36776_37357 | 187 |
| 131 | 3300044842 | Ga0466957_0029951 | Ga0466957_0029951_997_1578 | 187 |
| 132 | 3300045836 | Ga0466958_0013846 | Ga0466958_0013846_1789_2370 | 187 |
| 133 | 3300045976 | Ga0466967_0002348 | Ga0466967_0002348_4355_4936 | 187 |
| 134 | 3300045976 | Ga0466967_0662699 | Ga0466967_0662699_115_696 | 187 |
| 135 | 3300046461 | Ga0495641_0003735 | Ga0495641_0003735_6326_6910 | 187 |
| 136 | 3300046463 | Ga0495653_0026259 | Ga0495653_0026259_966_1550 | 187 |
| 137 | 3300046472 | Ga0495580_0009973 | Ga0495580_0009973_2790_3374 | 187 |
| 138 | 3300046473 | Ga0495582_0001703 | Ga0495582_0001703_7040_7624 | 187 |
| 139 | 3300046475 | Ga0495639_0000828 | Ga0495639_0000828_8794_9378 | 187 |
| 140 | 3300046476 | Ga0495662_0002737 | Ga0495662_0002737_2787_3371 | 187 |
| 141 | 3300046477 | Ga0495664_0018869 | Ga0495664_0018869_2340_2924 | 187 |
| 142 | 3300046514 | Ga0495618_0010074 | Ga0495618_0010074_2340_2924 | 187 |
| 143 | 3300046516 | Ga0495628_0037042 | Ga0495628_0037042_3180_3764 | 187 |
| 144 | 3300046517 | Ga0495630_0018065 | Ga0495630_0018065_1470_2054 | 187 |
| 145 | 3300046526 | Ga0495666_0000309 | Ga0495666_0000309_5907_6491 | 187 |
| 146 | 3300046529 | Ga0495652_0005095 | Ga0495652_0005095_3651_4235 | 187 |
| 147 | 3300046531 | Ga0495665_0003045 | Ga0495665_0003045_4352_4936 | 187 |
| 148 | 3300046533 | Ga0495640_0016017 | Ga0495640_0016017_3124_3708 | 187 |
| 149 | 3300046535 | Ga0495586_0009993 | Ga0495586_0009993_4119_4703 | 187 |
| 150 | 3300046543 | Ga0495645_0039870 | Ga0495645_0039870_1810_2394 | 187 |
| 151 | 3300046642 | Ga0495634_0004455 | Ga0495634_0004455_4585_5169 | 187 |
| 152 | 3300046663 | Ga0495635_0105560 | Ga0495635_0105560_166_750 | 187 |
| 153 | 3300046674 | Ga0495588_0109580 | Ga0495588_0109580_729_1307 | 187 |
| 154 | 3300046680 | Ga0495646_0016747 | Ga0495646_0016747_2883_3467 | 187 |
| 155 | 3300046681 | Ga0495647_0004236 | Ga0495647_0004236_1072_1656 | 187 |
| 156 | 3300046683 | Ga0495658_0000498 | Ga0495658_0000498_4573_5157 | 187 |
| 157 | 3300046689 | Ga0495613_0213996 | Ga0495613_0213996_610_1194 | 187 |
| 158 | 3300046690 | Ga0495624_0009825 | Ga0495624_0009825_381_965 | 187 |
| 159 | 3300047315 | Ga0495581_0017975 | Ga0495581_0017975_2787_3371 | 187 |
| 160 | 3300047319 | Ga0495674_0007325 | Ga0495674_0007325_610_1194 | 187 |
| 161 | 3300047321 | Ga0495676_0036425 | Ga0495676_0036425_610_1194 | 187 |
| 162 | 3300047322 | Ga0495680_0005229 | Ga0495680_0005229_8777_9361 | 187 |
| 163 | 3300047471 | Ga0495684_0108121 | Ga0495684_0108121_1163_1747 | 187 |
| 164 | 3300047673 | Ga0495593_0001256 | Ga0495593_0001256_11397_11981 | 187 |
| 165 | 3300049582 | Ga0501048_0254908 | Ga0501048_0254908_203_790 | 187 |
| 166 | 3300049587 | Ga0501071_0084366 | Ga0501071_0084366_139_714 | 187 |
| 167 | 3300050507 | nmdc:mga05p37_101915_c1 | nmdc:mga05p37_101915_c1_1868_2446 | 187 |
| 168 | 3300053078 | Ga0495612_0039191 | Ga0495612_0039191_952_1536 | 187 |
| 169 | 3300053085 | Ga0495619_0713408 | Ga0495619_0713408_45_629 | 187 |
| 170 | 3300045051 | Ga0451576_0154638 | Ga0451576_0154638_1373_2083 | 188 |
| 171 | 3300005445 | Ga0070708_100021258 | Ga0070708_1000212587 | 189 |
| 172 | 3300005467 | Ga0070706_100724527 | Ga0070706_1007245271 | 189 |
| 173 | 3300005468 | Ga0070707_100108544 | Ga0070707_1001085444 | 189 |
| 174 | 3300005471 | Ga0070698_100005769 | Ga0070698_10000576914 | 189 |
| 175 | 3300005518 | Ga0070699_100029175 | Ga0070699_1000291753 | 189 |
| 176 | 3300025922 | Ga0207646_10063438 | Ga0207646_100634385 | 189 |
| 177 | 3300026142 | Ga0207698_11602233 | Ga0207698_116022331 | 189 |
| 178 | 3300030760 | Ga0265762_1031130 | Ga0265762_10311302 | 189 |
| 179 | 3300005549 | Ga0070704_100482524 | Ga0070704_1004825242 | 190 |
| 180 | 3300005937 | Ga0081455_10065534 | Ga0081455_100655347 | 190 |
| 181 | 3300006186 | Ga0075369_10241386 | Ga0075369_102413861 | 190 |
| 182 | 3300053120 | Ga0500597_090681 | Ga0500597_090681_321_968 | 190 |
| 183 | 3300005334 | Ga0068869_100061324 | Ga0068869_1000613246 | 191 |
| 184 | 3300005435 | Ga0070714_100071630 | Ga0070714_1000716302 | 191 |
| 185 | 3300009094 | Ga0111539_10041411 | Ga0111539_100414117 | 191 |
| 186 | 3300025929 | Ga0207664_10432149 | Ga0207664_104321492 | 191 |
| 187 | 3300031595 | Ga0265313_10037034 | Ga0265313_100370344 | 191 |
| 188 | 3300037068 | Ga0373925_0048113 | Ga0373925_0048113_1778_2503 | 191 |
| 189 | 3300046473 | Ga0495582_0010538 | Ga0495582_0010538_2162_2887 | 191 |
| 190 | 3300013306 | Ga0163162_10112570 | Ga0163162_101125706 | 192 |
| 191 | 3300025921 | Ga0207652_10379596 | Ga0207652_103795962 | 192 |
| 192 | 3300025933 | Ga0207706_10229074 | Ga0207706_102290742 | 192 |
| 193 | 3300026088 | Ga0207641_10585882 | Ga0207641_105858822 | 192 |
| 194 | 3300035089 | Ga0373944_0021548 | Ga0373944_0021548_545_1270 | 192 |
| 195 | 3300035116 | Ga0373945_0004201 | Ga0373945_0004201_1581_2306 | 192 |
| 196 | 3300035171 | Ga0373946_0025094 | Ga0373946_0025094_227_952 | 192 |
| 197 | 3300035695 | Ga0373927_0262594 | Ga0373927_0262594_56_781 | 192 |
| 198 | 3300042876 | Ga0451577_0424995 | Ga0451577_0424995_402_1127 | 192 |
| 199 | 3300046513 | Ga0495616_0106023 | Ga0495616_0106023_480_1160 | 192 |
| 200 | 3300046523 | Ga0495644_0081446 | Ga0495644_0081446_148_873 | 192 |
| 201 | 3300046537 | Ga0495598_0012975 | Ga0495598_0012975_822_1547 | 192 |
| 202 | 3300046538 | Ga0495609_0188540 | Ga0495609_0188540_92_817 | 192 |
| 203 | 3300046542 | Ga0495597_0093982 | Ga0495597_0093982_75_800 | 192 |
| 204 | 3300046615 | Ga0495656_0057048 | Ga0495656_0057048_344_1069 | 192 |
| 205 | 3300046664 | Ga0495659_0003901 | Ga0495659_0003901_2612_3337 | 192 |
| 206 | 3300046674 | Ga0495588_0018801 | Ga0495588_0018801_609_1334 | 192 |
| 207 | 3300046691 | Ga0495670_0009268 | Ga0495670_0009268_2558_3283 | 192 |
| 208 | 3300046794 | Ga0495589_0083171 | Ga0495589_0083171_590_1315 | 192 |
| 209 | 3300049583 | Ga0501067_0142852 | Ga0501067_0142852_356_1087 | 192 |
| 210 | 3300049585 | Ga0501069_0374917 | Ga0501069_0374917_73_804 | 192 |
| 211 | 3300049742 | Ga0501080_0051733 | Ga0501080_0051733_2922_3614 | 192 |
| 212 | 3300049770 | Ga0501273_010847 | Ga0501273_010847_100_819 | 192 |
| 213 | 3300050510 | nmdc:mga06r32_286452_c1 | nmdc:mga06r32_286452_c1_18_698 | 192 |
| 214 | 3300005455 | Ga0070663_100460742 | Ga0070663_1004607421 | 193 |
| 215 | 3300005577 | Ga0068857_100813433 | Ga0068857_1008134332 | 193 |
| 216 | 3300006178 | Ga0075367_10122911 | Ga0075367_101229113 | 193 |
| 217 | 3300014745 | Ga0157377_10265366 | Ga0157377_102653662 | 193 |
| 218 | 3300025945 | Ga0207679_10056825 | Ga0207679_100568252 | 193 |
| 219 | 3300031548 | Ga0307408_100018807 | Ga0307408_1000188074 | 193 |
| 220 | 3300031824 | Ga0307413_10139468 | Ga0307413_101394682 | 193 |
| 221 | 3300031852 | Ga0307410_10000285 | Ga0307410_100002858 | 193 |
| 222 | 3300031901 | Ga0307406_10009039 | Ga0307406_100090393 | 193 |
| 223 | 3300032002 | Ga0307416_100003682 | Ga0307416_1000036826 | 193 |
| 224 | 3300032002 | Ga0307416_100089622 | Ga0307416_1000896222 | 193 |
| 225 | 3300035725 | Ga0373947_0046144 | Ga0373947_0046144_355_1080 | 193 |
| 226 | 3300046455 | Ga0495603_0024811 | Ga0495603_0024811_2172_2897 | 193 |
| 227 | 3300046461 | Ga0495641_0085416 | Ga0495641_0085416_597_1322 | 193 |
| 228 | 3300046472 | Ga0495580_0113006 | Ga0495580_0113006_725_1450 | 193 |
| 229 | 3300046475 | Ga0495639_0024994 | Ga0495639_0024994_631_1356 | 193 |
| 230 | 3300046476 | Ga0495662_0025652 | Ga0495662_0025652_1376_2101 | 193 |
| 231 | 3300046499 | Ga0495594_0030366 | Ga0495594_0030366_1106_1831 | 193 |
| 232 | 3300046683 | Ga0495658_0273776 | Ga0495658_0273776_91_816 | 193 |
| 233 | 3300048914 | Ga0496111_0144950 | Ga0496111_0144950_80_784 | 193 |
| 234 | 3300049576 | Ga0501040_0055045 | Ga0501040_0055045_2038_2709 | 193 |
| 235 | 3300049652 | Ga0501202_060777 | Ga0501202_060777_86_784 | 193 |
| 236 | 3300002074 | JGI24748J21848_1013980 | JGI24748J21848_10139802 | 194 |
| 237 | 3300002077 | JGI24744J21845_10026642 | JGI24744J21845_100266421 | 194 |
| 238 | 3300002239 | JGI24034J26672_10000759 | JGI24034J26672_100007594 | 194 |
| 239 | 3300005295 | Ga0065707_10005566 | Ga0065707_100055667 | 194 |
| 240 | 3300005330 | Ga0070690_100188793 | Ga0070690_1001887932 | 194 |
| 241 | 3300005331 | Ga0070670_100301041 | Ga0070670_1003010413 | 194 |
| 242 | 3300005340 | Ga0070689_100313380 | Ga0070689_1003133802 | 194 |
| 243 | 3300005341 | Ga0070691_10040483 | Ga0070691_100404832 | 194 |
| 244 | 3300005344 | Ga0070661_100207864 | Ga0070661_1002078643 | 194 |
| 245 | 3300005356 | Ga0070674_100389058 | Ga0070674_1003890581 | 194 |
| 246 | 3300005364 | Ga0070673_100327518 | Ga0070673_1003275182 | 194 |
| 247 | 3300005438 | Ga0070701_10210353 | Ga0070701_102103532 | 194 |
| 248 | 3300005440 | Ga0070705_100146786 | Ga0070705_1001467862 | 194 |
| 249 | 3300005445 | Ga0070708_100541924 | Ga0070708_1005419242 | 194 |
| 250 | 3300005456 | Ga0070678_100267516 | Ga0070678_1002675162 | 194 |
| 251 | 3300005459 | Ga0068867_100365205 | Ga0068867_1003652052 | 194 |
| 252 | 3300005466 | Ga0070685_10121347 | Ga0070685_101213472 | 194 |
| 253 | 3300005467 | Ga0070706_100723219 | Ga0070706_1007232191 | 194 |
| 254 | 3300005468 | Ga0070707_100033640 | Ga0070707_1000336409 | 194 |
| 255 | 3300005535 | Ga0070684_100543750 | Ga0070684_1005437501 | 194 |
| 256 | 3300005536 | Ga0070697_100701654 | Ga0070697_1007016541 | 194 |
| 257 | 3300005543 | Ga0070672_100029753 | Ga0070672_1000297532 | 194 |
| 258 | 3300005544 | Ga0070686_100088535 | Ga0070686_1000885351 | 194 |
| 259 | 3300005547 | Ga0070693_100030086 | Ga0070693_1000300867 | 194 |
| 260 | 3300005548 | Ga0070665_100367848 | Ga0070665_1003678482 | 194 |
| 261 | 3300005563 | Ga0068855_100324265 | Ga0068855_1003242652 | 194 |
| 262 | 3300005577 | Ga0068857_100417472 | Ga0068857_1004174722 | 194 |
| 263 | 3300005614 | Ga0068856_100386693 | Ga0068856_1003866932 | 194 |
| 264 | 3300005615 | Ga0070702_100042751 | Ga0070702_1000427516 | 194 |
| 265 | 3300005719 | Ga0068861_100277598 | Ga0068861_1002775982 | 194 |
| 266 | 3300005840 | Ga0068870_10015701 | Ga0068870_100157012 | 194 |
| 267 | 3300005844 | Ga0068862_100066335 | Ga0068862_1000663353 | 194 |
| 268 | 3300005844 | Ga0068862_100193511 | Ga0068862_1001935113 | 194 |
| 269 | 3300006038 | Ga0075365_10177533 | Ga0075365_101775331 | 194 |
| 270 | 3300006042 | Ga0075368_10009694 | Ga0075368_100096948 | 194 |
| 271 | 3300006048 | Ga0075363_100100732 | Ga0075363_1001007323 | 194 |
| 272 | 3300006173 | Ga0070716_100533435 | Ga0070716_1005334352 | 194 |
| 273 | 3300006175 | Ga0070712_100141516 | Ga0070712_1001415163 | 194 |
| 274 | 3300006195 | Ga0075366_10271348 | Ga0075366_102713482 | 194 |
| 275 | 3300006237 | Ga0097621_100372179 | Ga0097621_1003721792 | 194 |
| 276 | 3300006353 | Ga0075370_10074572 | Ga0075370_100745724 | 194 |
| 277 | 3300006358 | Ga0068871_100077944 | Ga0068871_1000779446 | 194 |
| 278 | 3300006844 | Ga0075428_100071069 | Ga0075428_1000710697 | 194 |
| 279 | 3300006852 | Ga0075433_10035758 | Ga0075433_100357582 | 194 |
| 280 | 3300006871 | Ga0075434_100602663 | Ga0075434_1006026632 | 194 |
| 281 | 3300006880 | Ga0075429_100062025 | Ga0075429_1000620256 | 194 |
| 282 | 3300006881 | Ga0068865_100057755 | Ga0068865_1000577555 | 194 |
| 283 | 3300007265 | Ga0099794_10038488 | Ga0099794_100384882 | 194 |
| 284 | 3300009101 | Ga0105247_10196341 | Ga0105247_101963413 | 194 |
| 285 | 3300009147 | Ga0114129_10005890 | Ga0114129_1000589017 | 194 |
| 286 | 3300009147 | Ga0114129_10194135 | Ga0114129_101941356 | 194 |
| 287 | 3300009148 | Ga0105243_10013879 | Ga0105243_100138793 | 194 |
| 288 | 3300009176 | Ga0105242_10144535 | Ga0105242_101445356 | 194 |
| 289 | 3300009553 | Ga0105249_10173804 | Ga0105249_101738046 | 194 |
| 290 | 3300013297 | Ga0157378_10162599 | Ga0157378_101625993 | 194 |
| 291 | 3300013308 | Ga0157375_10169864 | Ga0157375_101698646 | 194 |
| 292 | 3300014326 | Ga0157380_10037923 | Ga0157380_100379235 | 194 |
| 293 | 3300014745 | Ga0157377_10047905 | Ga0157377_100479052 | 194 |
| 294 | 3300014969 | Ga0157376_10099574 | Ga0157376_100995742 | 194 |
| 295 | 3300017792 | Ga0163161_10071821 | Ga0163161_100718214 | 194 |
| 296 | 3300025885 | Ga0207653_10088983 | Ga0207653_100889831 | 194 |
| 297 | 3300025898 | Ga0207692_10008210 | Ga0207692_100082104 | 194 |
| 298 | 3300025901 | Ga0207688_10002321 | Ga0207688_1000232114 | 194 |
| 299 | 3300025901 | Ga0207688_10033396 | Ga0207688_100333965 | 194 |
| 300 | 3300025904 | Ga0207647_10034185 | Ga0207647_100341856 | 194 |
| 301 | 3300025907 | Ga0207645_10016093 | Ga0207645_100160939 | 194 |
| 302 | 3300025908 | Ga0207643_10002622 | Ga0207643_1000262213 | 194 |
| 303 | 3300025911 | Ga0207654_10028853 | Ga0207654_100288536 | 194 |
| 304 | 3300025911 | Ga0207654_10154824 | Ga0207654_101548241 | 194 |
| 305 | 3300025914 | Ga0207671_10179689 | Ga0207671_101796892 | 194 |
| 306 | 3300025915 | Ga0207693_10023533 | Ga0207693_100235337 | 194 |
| 307 | 3300025916 | Ga0207663_10377456 | Ga0207663_103774562 | 194 |
| 308 | 3300025919 | Ga0207657_10026404 | Ga0207657_100264049 | 194 |
| 309 | 3300025920 | Ga0207649_10387161 | Ga0207649_103871612 | 194 |
| 310 | 3300025921 | Ga0207652_10434128 | Ga0207652_104341282 | 194 |
| 311 | 3300025922 | Ga0207646_10036746 | Ga0207646_100367464 | 194 |
| 312 | 3300025924 | Ga0207694_10225637 | Ga0207694_102256374 | 194 |
| 313 | 3300025924 | Ga0207694_10243400 | Ga0207694_102434002 | 194 |
| 314 | 3300025926 | Ga0207659_10164796 | Ga0207659_101647963 | 194 |
| 315 | 3300025926 | Ga0207659_10436942 | Ga0207659_104369422 | 194 |
| 316 | 3300025927 | Ga0207687_10399804 | Ga0207687_103998042 | 194 |
| 317 | 3300025928 | Ga0207700_10086561 | Ga0207700_100865615 | 194 |
| 318 | 3300025931 | Ga0207644_10102661 | Ga0207644_101026613 | 194 |
| 319 | 3300025932 | Ga0207690_10012426 | Ga0207690_100124268 | 194 |
| 320 | 3300025933 | Ga0207706_10002966 | Ga0207706_1000296611 | 194 |
| 321 | 3300025933 | Ga0207706_10112438 | Ga0207706_101124384 | 194 |
| 322 | 3300025934 | Ga0207686_10027772 | Ga0207686_100277723 | 194 |
| 323 | 3300025935 | Ga0207709_10003379 | Ga0207709_1000337910 | 194 |
| 324 | 3300025936 | Ga0207670_10153078 | Ga0207670_101530783 | 194 |
| 325 | 3300025937 | Ga0207669_10034696 | Ga0207669_100346966 | 194 |
| 326 | 3300025937 | Ga0207669_10171542 | Ga0207669_101715422 | 194 |
| 327 | 3300025938 | Ga0207704_10000286 | Ga0207704_1000028621 | 194 |
| 328 | 3300025940 | Ga0207691_10023983 | Ga0207691_100239836 | 194 |
| 329 | 3300025942 | Ga0207689_10059736 | Ga0207689_100597363 | 194 |
| 330 | 3300025944 | Ga0207661_10160105 | Ga0207661_101601052 | 194 |
| 331 | 3300025949 | Ga0207667_10112179 | Ga0207667_101121795 | 194 |
| 332 | 3300025949 | Ga0207667_10646078 | Ga0207667_106460782 | 194 |
| 333 | 3300025961 | Ga0207712_10019046 | Ga0207712_100190468 | 194 |
| 334 | 3300025961 | Ga0207712_10135389 | Ga0207712_101353893 | 194 |
| 335 | 3300025972 | Ga0207668_10017224 | Ga0207668_100172246 | 194 |
| 336 | 3300025986 | Ga0207658_10121938 | Ga0207658_101219384 | 194 |
| 337 | 3300026023 | Ga0207677_10458961 | Ga0207677_104589613 | 194 |
| 338 | 3300026035 | Ga0207703_10107818 | Ga0207703_101078183 | 194 |
| 339 | 3300026041 | Ga0207639_10016448 | Ga0207639_100164487 | 194 |
| 340 | 3300026067 | Ga0207678_10007497 | Ga0207678_1000749712 | 194 |
| 341 | 3300026067 | Ga0207678_10107739 | Ga0207678_101077394 | 194 |
| 342 | 3300026075 | Ga0207708_10003609 | Ga0207708_1000360915 | 194 |
| 343 | 3300026075 | Ga0207708_10013133 | Ga0207708_100131334 | 194 |
| 344 | 3300026078 | Ga0207702_10070805 | Ga0207702_100708055 | 194 |
| 345 | 3300026089 | Ga0207648_10005395 | Ga0207648_100053957 | 194 |
| 346 | 3300026089 | Ga0207648_10005612 | Ga0207648_1000561214 | 194 |
| 347 | 3300026095 | Ga0207676_10114286 | Ga0207676_101142862 | 194 |
| 348 | 3300026116 | Ga0207674_10062426 | Ga0207674_100624267 | 194 |
| 349 | 3300026118 | Ga0207675_100027633 | Ga0207675_1000276333 | 194 |
| 350 | 3300026118 | Ga0207675_100875409 | Ga0207675_1008754092 | 194 |
| 351 | 3300026121 | Ga0207683_10010766 | Ga0207683_100107668 | 194 |
| 352 | 3300026142 | Ga0207698_10146240 | Ga0207698_101462404 | 194 |
| 353 | 3300027671 | Ga0209588_1006440 | Ga0209588_10064407 | 194 |
| 354 | 3300028379 | Ga0268266_10074281 | Ga0268266_100742814 | 194 |
| 355 | 3300028380 | Ga0268265_10086615 | Ga0268265_100866156 | 194 |
| 356 | 3300031903 | Ga0307407_10225944 | Ga0307407_102259443 | 194 |
| 357 | 3300031911 | Ga0307412_10067354 | Ga0307412_100673543 | 194 |
| 358 | 3300031995 | Ga0307409_100154690 | Ga0307409_1001546901 | 194 |
| 359 | 3300032126 | Ga0307415_100238454 | Ga0307415_1002384543 | 194 |
| 360 | 3300035121 | Ga0373960_0040532 | Ga0373960_0040532_507_1232 | 194 |
| 361 | 3300044673 | Ga0453683_0036857 | Ga0453683_0036857_21_797 | 194 |
| 362 | 3300046455 | Ga0495603_0013329 | Ga0495603_0013329_1135_1740 | 194 |
| 363 | 3300046491 | Ga0495584_0035185 | Ga0495584_0035185_1774_2379 | 194 |
| 364 | 3300046499 | Ga0495594_0064727 | Ga0495594_0064727_1334_1939 | 194 |
| 365 | 3300046525 | Ga0495663_0017834 | Ga0495663_0017834_659_1384 | 194 |
| 366 | 3300046536 | Ga0495587_0218275 | Ga0495587_0218275_135_860 | 194 |
| 367 | 3300046538 | Ga0495609_0155331 | Ga0495609_0155331_187_792 | 194 |
| 368 | 3300046648 | Ga0495611_0039725 | Ga0495611_0039725_454_1059 | 194 |
| 369 | 3300046664 | Ga0495659_0116432 | Ga0495659_0116432_164_769 | 194 |
| 370 | 3300047315 | Ga0495581_0563997 | Ga0495581_0563997_18_623 | 194 |
| 371 | 3300047319 | Ga0495674_0781823 | Ga0495674_0781823_25_630 | 194 |
| 372 | 3300047320 | Ga0495672_0171419 | Ga0495672_0171419_351_1076 | 194 |
| 373 | 3300047445 | Ga0495677_0058593 | Ga0495677_0058593_186_911 | 194 |
| 374 | 3300048903 | Ga0496100_0000735 | Ga0496100_0000735_9875_10480 | 194 |
| 375 | 3300048904 | Ga0496101_0001765 | Ga0496101_0001765_12285_12890 | 194 |
| 376 | 3300048905 | Ga0496102_0006229 | Ga0496102_0006229_419_1024 | 194 |
| 377 | 3300048906 | Ga0496103_0000427 | Ga0496103_0000427_31161_31766 | 194 |
| 378 | 3300048907 | Ga0496104_0130156 | Ga0496104_0130156_741_1346 | 194 |
| 379 | 3300048907 | Ga0496104_0561999 | Ga0496104_0561999_69_767 | 194 |
| 380 | 3300048908 | Ga0496105_0079353 | Ga0496105_0079353_313_1038 | 194 |
| 381 | 3300048908 | Ga0496105_0161832 | Ga0496105_0161832_244_849 | 194 |
| 382 | 3300048909 | Ga0496106_0018993 | Ga0496106_0018993_4132_4737 | 194 |
| 383 | 3300048909 | Ga0496106_0109289 | Ga0496106_0109289_503_1228 | 194 |
| 384 | 3300048910 | Ga0496107_0011572 | Ga0496107_0011572_2729_3334 | 194 |
| 385 | 3300048912 | Ga0496109_0181400 | Ga0496109_0181400_1340_1945 | 194 |
| 386 | 3300048913 | Ga0496110_0322776 | Ga0496110_0322776_618_1343 | 194 |
| 387 | 3300048914 | Ga0496111_0052074 | Ga0496111_0052074_1020_1745 | 194 |
| 388 | 3300048914 | Ga0496111_0352853 | Ga0496111_0352853_157_762 | 194 |
| 389 | 3300048915 | Ga0496112_0095542 | Ga0496112_0095542_1467_2072 | 194 |
| 390 | 3300048917 | Ga0496114_0001861 | Ga0496114_0001861_8413_9018 | 194 |
| 391 | 3300048917 | Ga0496114_0110408 | Ga0496114_0110408_839_1537 | 194 |
| 392 | 3300048918 | Ga0496115_0001915 | Ga0496115_0001915_5107_5712 | 194 |
| 393 | 3300048918 | Ga0496115_0233730 | Ga0496115_0233730_405_1130 | 194 |
| 394 | 3300049583 | Ga0501067_0393106 | Ga0501067_0393106_12_626 | 194 |
| 395 | 3300050507 | nmdc:mga05p37_122064_c2 | nmdc:mga05p37_122064_c2_392_1084 | 194 |
| 396 | 3300050507 | nmdc:mga05p37_1773_c1 | nmdc:mga05p37_1773_c1_11902_12603 | 194 |
| 397 | 3300050508 | nmdc:mga09592_132575_c1 | nmdc:mga09592_132575_c1_1287_1979 | 194 |
| 398 | 3300050510 | nmdc:mga06r32_197607_c1 | nmdc:mga06r32_197607_c1_814_1500 | 194 |
| 399 | 3300050511 | nmdc:mga08y16_16604_c1 | nmdc:mga08y16_16604_c1_2013_2705 | 194 |
| 400 | 3300050512 | nmdc:mga0n895_500058_c1 | nmdc:mga0n895_500058_c1_275_967 | 194 |
| 401 | 3300053085 | Ga0495619_0007707 | Ga0495619_0007707_3978_4700 | 194 |
| 402 | 3300005331 | Ga0070670_100063491 | Ga0070670_1000634916 | 195 |
| 403 | 3300005564 | Ga0070664_100473386 | Ga0070664_1004733862 | 195 |
| 404 | 3300006852 | Ga0075433_10030828 | Ga0075433_1003082810 | 195 |
| 405 | 3300006852 | Ga0075433_10047049 | Ga0075433_100470499 | 195 |
| 406 | 3300006871 | Ga0075434_100356991 | Ga0075434_1003569913 | 195 |
| 407 | 3300006914 | Ga0075436_100005801 | Ga0075436_1000058015 | 195 |
| 408 | 3300025920 | Ga0207649_10144224 | Ga0207649_101442244 | 195 |
| 409 | 3300025926 | Ga0207659_10029115 | Ga0207659_100291155 | 195 |
| 410 | 3300025945 | Ga0207679_10050493 | Ga0207679_100504933 | 195 |
| 411 | 3300031548 | Ga0307408_100011260 | Ga0307408_1000112609 | 195 |
| 412 | 3300031731 | Ga0307405_10003907 | Ga0307405_100039079 | 195 |
| 413 | 3300031824 | Ga0307413_10001530 | Ga0307413_100015309 | 195 |
| 414 | 3300031852 | Ga0307410_10004966 | Ga0307410_1000496610 | 195 |
| 415 | 3300031901 | Ga0307406_10004231 | Ga0307406_1000423111 | 195 |
| 416 | 3300031903 | Ga0307407_10001057 | Ga0307407_1000105711 | 195 |
| 417 | 3300031911 | Ga0307412_10106910 | Ga0307412_101069103 | 195 |
| 418 | 3300031911 | Ga0307412_10732829 | Ga0307412_107328291 | 195 |
| 419 | 3300031995 | Ga0307409_100000501 | Ga0307409_10000050116 | 195 |
| 420 | 3300032002 | Ga0307416_100003220 | Ga0307416_1000032202 | 195 |
| 421 | 3300032005 | Ga0307411_10001075 | Ga0307411_1000107510 | 195 |
| 422 | 3300032005 | Ga0307411_10665778 | Ga0307411_106657781 | 195 |
| 423 | 3300032126 | Ga0307415_100004272 | Ga0307415_10000427210 | 195 |
| 424 | 3300032126 | Ga0307415_100366390 | Ga0307415_1003663903 | 195 |
| 425 | 3300048911 | Ga0496108_0380158 | Ga0496108_0380158_348_1046 | 195 |
| 426 | 3300049521 | Ga0501298_011404 | Ga0501298_011404_203_922 | 195 |
| 427 | 3300049570 | Ga0501033_0124456 | Ga0501033_0124456_368_1057 | 195 |
| 428 | 3300049576 | Ga0501040_0249342 | Ga0501040_0249342_96_767 | 195 |
| 429 | 3300049577 | Ga0501041_0047899 | Ga0501041_0047899_1475_2146 | 195 |
| 430 | 3300049588 | Ga0501072_0135380 | Ga0501072_0135380_273_944 | 195 |
| 431 | 3300049592 | Ga0501076_0106110 | Ga0501076_0106110_974_1645 | 195 |
| 432 | 3300049661 | Ga0501217_005170 | Ga0501217_005170_823_1542 | 195 |
| 433 | 3300049668 | Ga0501233_004036 | Ga0501233_004036_1709_2428 | 195 |
| 434 | 3300049677 | Ga0501247_001365 | Ga0501247_001365_140_859 | 195 |
| 435 | 3300049703 | Ga0501219_002023 | Ga0501219_002023_448_1167 | 195 |
| 436 | 3300049705 | Ga0501225_0027274 | Ga0501225_0027274_612_1331 | 195 |
| 437 | 3300049741 | Ga0501079_0110880 | Ga0501079_0110880_218_889 | 195 |
| 438 | 3300049760 | Ga0501263_000777 | Ga0501263_000777_790_1509 | 195 |
| 439 | 3300049765 | Ga0501268_000281 | Ga0501268_000281_3508_4227 | 195 |
| 440 | 3300049767 | Ga0501270_012548 | Ga0501270_012548_392_1111 | 195 |
| 441 | 3300049850 | Ga0501204_003963 | Ga0501204_003963_747_1466 | 195 |
| 442 | 3300049851 | Ga0501212_005413 | Ga0501212_005413_887_1606 | 195 |
| 443 | 3300050512 | nmdc:mga0n895_352386_c1 | nmdc:mga0n895_352386_c1_403_1128 | 195 |
| 444 | 3300050512 | nmdc:mga0n895_44735_c1 | nmdc:mga0n895_44735_c1_2169_2900 | 195 |
| 445 | 3300050515 | nmdc:mga0a205_11705_c1 | nmdc:mga0a205_11705_c1_4852_5583 | 195 |
| 446 | 3300053083 | Ga0495655_0039155 | Ga0495655_0039155_17_721 | 195 |
| 447 | 3300054114 | Ga0501084_0375339 | Ga0501084_0375339_58_744 | 195 |
| 448 | 3300060353 | Ga0501082_0047119 | Ga0501082_0047119_2547_3218 | 195 |
| 449 | 3300061734 | Ga0530510_0006450 | Ga0530510_0006450_1246_1917 | 195 |
| 450 | 3300005336 | Ga0070680_100174605 | Ga0070680_1001746052 | 196 |
| 451 | 3300005981 | Ga0081538_10030674 | Ga0081538_100306741 | 196 |
| 452 | 3300009094 | Ga0111539_11288572 | Ga0111539_112885721 | 196 |
| 453 | 3300025922 | Ga0207646_10087238 | Ga0207646_100872383 | 196 |
| 454 | 3300031711 | Ga0265314_10004990 | Ga0265314_100049907 | 196 |
| 455 | 3300031852 | Ga0307410_10027373 | Ga0307410_100273731 | 196 |
| 456 | 3300031901 | Ga0307406_10082357 | Ga0307406_100823574 | 196 |
| 457 | 3300031903 | Ga0307407_10058334 | Ga0307407_100583342 | 196 |
| 458 | 3300031903 | Ga0307407_10066342 | Ga0307407_100663424 | 196 |
| 459 | 3300031911 | Ga0307412_10427986 | Ga0307412_104279861 | 196 |
| 460 | 3300031995 | Ga0307409_100063049 | Ga0307409_1000630497 | 196 |
| 461 | 3300032002 | Ga0307416_100010520 | Ga0307416_1000105207 | 196 |
| 462 | 3300032002 | Ga0307416_100277730 | Ga0307416_1002777302 | 196 |
| 463 | 3300032004 | Ga0307414_10212142 | Ga0307414_102121423 | 196 |
| 464 | 3300032126 | Ga0307415_100023019 | Ga0307415_1000230193 | 196 |
| 465 | 3300053131 | Ga0500652_001803 | Ga0500652_001803_4920_5570 | 196 |
| 466 | 3300053730 | Ga0500645_001772 | Ga0500645_001772_3969_4619 | 196 |
| 467 | 3300005439 | Ga0070711_100213541 | Ga0070711_1002135412 | 197 |
| 468 | 3300005440 | Ga0070705_100003631 | Ga0070705_1000036316 | 197 |
| 469 | 3300005549 | Ga0070704_100589626 | Ga0070704_1005896262 | 197 |
| 470 | 3300006038 | Ga0075365_10599477 | Ga0075365_105994771 | 197 |
| 471 | 3300025916 | Ga0207663_10514483 | Ga0207663_105144832 | 197 |
| 472 | 3300026075 | Ga0207708_10014559 | Ga0207708_1001455910 | 197 |
| 473 | 3300035691 | Ga0373931_0212100 | Ga0373931_0212100_408_1118 | 197 |
| 474 | 3300049572 | Ga0501036_0044877 | Ga0501036_0044877_199_903 | 197 |
| 475 | 3300049574 | Ga0501038_0275060 | Ga0501038_0275060_207_911 | 197 |
| 476 | 3300049578 | Ga0501042_0009210 | Ga0501042_0009210_2375_3079 | 197 |
| 477 | 3300049584 | Ga0501068_0035130 | Ga0501068_0035130_1173_1877 | 197 |
| 478 | 3300049587 | Ga0501071_0045651 | Ga0501071_0045651_574_1278 | 197 |
| 479 | 3300049588 | Ga0501072_0093892 | Ga0501072_0093892_316_1020 | 197 |
| 480 | 3300049591 | Ga0501075_0043196 | Ga0501075_0043196_1966_2670 | 197 |
| 481 | 3300049592 | Ga0501076_0028793 | Ga0501076_0028793_568_1272 | 197 |
| 482 | 3300049741 | Ga0501079_0035117 | Ga0501079_0035117_761_1465 | 197 |
| 483 | 3300049742 | Ga0501080_0015571 | Ga0501080_0015571_2613_3317 | 197 |
| 484 | 3300049743 | Ga0501081_0012727 | Ga0501081_0012727_984_1688 | 197 |
| 485 | 3300049744 | Ga0501083_0262638 | Ga0501083_0262638_236_940 | 197 |
| 486 | 3300049822 | Ga0501035_0292692 | Ga0501035_0292692_367_1071 | 197 |
| 487 | 3300050509 | nmdc:mga0qj67_403481_c1 | nmdc:mga0qj67_403481_c1_180_896 | 197 |
| 488 | 3300054114 | Ga0501084_0004051 | Ga0501084_0004051_10708_11412 | 197 |
| 489 | 3300005468 | Ga0070707_100239655 | Ga0070707_1002396552 | 198 |
| 490 | 3300005536 | Ga0070697_100102122 | Ga0070697_1001021221 | 198 |
| 491 | 3300005546 | Ga0070696_100222829 | Ga0070696_1002228292 | 198 |
| 492 | 3300006847 | Ga0075431_100287972 | Ga0075431_1002879723 | 198 |
| 493 | 3300006852 | Ga0075433_10000942 | Ga0075433_1000094228 | 198 |
| 494 | 3300006871 | Ga0075434_100015284 | Ga0075434_1000152843 | 198 |
| 495 | 3300006880 | Ga0075429_100147777 | Ga0075429_1001477773 | 198 |
| 496 | 3300007076 | Ga0075435_100023920 | Ga0075435_10002392010 | 198 |
| 497 | 3300009147 | Ga0114129_10229113 | Ga0114129_102291133 | 198 |
| 498 | 3300025910 | Ga0207684_10026777 | Ga0207684_100267776 | 198 |
| 499 | 3300025912 | Ga0207707_10460715 | Ga0207707_104607152 | 198 |
| 500 | 3300025922 | Ga0207646_10071164 | Ga0207646_100711644 | 198 |
| 501 | 3300026116 | Ga0207674_10604650 | Ga0207674_106046502 | 198 |
| 502 | 3300035242 | Ga0373962_0043496 | Ga0373962_0043496_179_859 | 198 |
| 503 | 3300042876 | Ga0451577_0053816 | Ga0451577_0053816_1377_2057 | 198 |
| 504 | 3300044673 | Ga0453683_0027180 | Ga0453683_0027180_1290_2021 | 198 |
| 505 | 3300045051 | Ga0451576_0081297 | Ga0451576_0081297_293_973 | 198 |
| 506 | 3300049744 | Ga0501083_0157277 | Ga0501083_0157277_854_1450 | 198 |
| 507 | 3300050507 | nmdc:mga05p37_589855_c1 | nmdc:mga05p37_589855_c1_206_898 | 198 |
| 508 | 3300050508 | nmdc:mga09592_73465_c1 | nmdc:mga09592_73465_c1_1857_2549 | 198 |
| 509 | 3300050510 | nmdc:mga06r32_150921_c1 | nmdc:mga06r32_150921_c1_529_1221 | 198 |
| 510 | 3300050512 | nmdc:mga0n895_17413_c1 | nmdc:mga0n895_17413_c1_5491_6183 | 198 |
| 511 | 3300050513 | nmdc:mga0rr50_4985_c1 | nmdc:mga0rr50_4985_c1_4162_4854 | 198 |
| 512 | 3300050515 | nmdc:mga0a205_2218_c1 | nmdc:mga0a205_2218_c1_10348_11040 | 198 |
| 513 | 3300003316 | rootH1_10113446 | rootH1_101134462 | 199 |
| 514 | 3300005330 | Ga0070690_100301780 | Ga0070690_1003017801 | 199 |
| 515 | 3300005337 | Ga0070682_100045774 | Ga0070682_1000457742 | 199 |
| 516 | 3300005366 | Ga0070659_100075380 | Ga0070659_1000753806 | 199 |
| 517 | 3300005440 | Ga0070705_100025279 | Ga0070705_1000252796 | 199 |
| 518 | 3300005444 | Ga0070694_100011413 | Ga0070694_1000114139 | 199 |
| 519 | 3300005549 | Ga0070704_100047686 | Ga0070704_1000476862 | 199 |
| 520 | 3300005549 | Ga0070704_100204957 | Ga0070704_1002049573 | 199 |
| 521 | 3300005719 | Ga0068861_100311382 | Ga0068861_1003113821 | 199 |
| 522 | 3300005844 | Ga0068862_100273868 | Ga0068862_1002738683 | 199 |
| 523 | 3300011119 | Ga0105246_10040974 | Ga0105246_100409746 | 199 |
| 524 | 3300013297 | Ga0157378_10095871 | Ga0157378_100958717 | 199 |
| 525 | 3300013306 | Ga0163162_10679264 | Ga0163162_106792642 | 199 |
| 526 | 3300014969 | Ga0157376_10535079 | Ga0157376_105350793 | 199 |
| 527 | 3300025923 | Ga0207681_10253810 | Ga0207681_102538103 | 199 |
| 528 | 3300025981 | Ga0207640_10390665 | Ga0207640_103906651 | 199 |
| 529 | 3300026067 | Ga0207678_10103624 | Ga0207678_101036241 | 199 |
| 530 | 3300027907 | Ga0207428_10204997 | Ga0207428_102049973 | 199 |
| 531 | 3300031249 | Ga0265339_10004825 | Ga0265339_1000482513 | 199 |
| 532 | 3300031595 | Ga0265313_10006102 | Ga0265313_1000610210 | 199 |
| 533 | 3300031852 | Ga0307410_10382599 | Ga0307410_103825992 | 199 |
| 534 | 3300032002 | Ga0307416_100595964 | Ga0307416_1005959641 | 199 |
| 535 | 3300032004 | Ga0307414_10428524 | Ga0307414_104285241 | 199 |
| 536 | 3300046472 | Ga0495580_0000020 | Ga0495580_0000020_84678_85358 | 199 |
| 537 | 3300046528 | Ga0495642_0029511 | Ga0495642_0029511_323_1003 | 199 |
| 538 | 3300046684 | Ga0495669_0019842 | Ga0495669_0019842_2036_2716 | 199 |
| 539 | 3300048911 | Ga0496108_0254694 | Ga0496108_0254694_316_1017 | 199 |
| 540 | 3300048913 | Ga0496110_0400144 | Ga0496110_0400144_44_745 | 199 |
| 541 | 3300049568 | Ga0501031_0160042 | Ga0501031_0160042_313_1017 | 199 |
| 542 | 3300049576 | Ga0501040_0047193 | Ga0501040_0047193_2151_2855 | 199 |
| 543 | 3300049576 | Ga0501040_0136293 | Ga0501040_0136293_39_722 | 199 |
| 544 | 3300049577 | Ga0501041_0185306 | Ga0501041_0185306_35_736 | 199 |
| 545 | 3300049592 | Ga0501076_0263785 | Ga0501076_0263785_166_870 | 199 |
| 546 | 3300050512 | nmdc:mga0n895_77155_c1 | nmdc:mga0n895_77155_c1_2262_2942 | 199 |
| 547 | 3300050513 | nmdc:mga0rr50_232744_c1 | nmdc:mga0rr50_232744_c1_44_724 | 199 |
| 548 | 3300053087 | Ga0500643_001596 | Ga0500643_001596_7270_7920 | 199 |
| 549 | 3300053094 | Ga0500566_0070333 | Ga0500566_0070333_629_1279 | 199 |
| 550 | 3300053119 | Ga0500595_000016 | Ga0500595_000016_150779_151429 | 199 |
| 551 | 3300005336 | Ga0070680_100156350 | Ga0070680_1001563503 | 200 |
| 552 | 3300005445 | Ga0070708_100034355 | Ga0070708_1000343554 | 200 |
| 553 | 3300005471 | Ga0070698_100014490 | Ga0070698_1000144905 | 200 |
| 554 | 3300005518 | Ga0070699_100352582 | Ga0070699_1003525822 | 200 |
| 555 | 3300005617 | Ga0068859_100120929 | Ga0068859_1001209296 | 200 |
| 556 | 3300005618 | Ga0068864_100165590 | Ga0068864_1001655904 | 200 |
| 557 | 3300005841 | Ga0068863_100106457 | Ga0068863_1001064572 | 200 |
| 558 | 3300006844 | Ga0075428_100061239 | Ga0075428_1000612395 | 200 |
| 559 | 3300006846 | Ga0075430_100002159 | Ga0075430_1000021594 | 200 |
| 560 | 3300006847 | Ga0075431_100060059 | Ga0075431_1000600592 | 200 |
| 561 | 3300006931 | Ga0097620_100120929 | Ga0097620_1001209296 | 200 |
| 562 | 3300009147 | Ga0114129_10113339 | Ga0114129_101133396 | 200 |
| 563 | 3300009147 | Ga0114129_10198299 | Ga0114129_101982993 | 200 |
| 564 | 3300009147 | Ga0114129_11025285 | Ga0114129_110252852 | 200 |
| 565 | 3300009176 | Ga0105242_10026750 | Ga0105242_100267509 | 200 |
| 566 | 3300014325 | Ga0163163_10178021 | Ga0163163_101780214 | 200 |
| 567 | 3300025921 | Ga0207652_10127325 | Ga0207652_101273253 | 200 |
| 568 | 3300025938 | Ga0207704_10637110 | Ga0207704_106371101 | 200 |
| 569 | 3300034816 | Ga0373930_0006543 | Ga0373930_0006543_524_1228 | 200 |
| 570 | 3300035398 | Ga0316574_0076966 | Ga0316574_0076966_89_778 | 200 |
| 571 | 3300038996 | Ga0242420_022030 | Ga0242420_022030_335_1039 | 200 |
| 572 | 3300048907 | Ga0496104_0081866 | Ga0496104_0081866_1372_2076 | 200 |
| 573 | 3300048911 | Ga0496108_0012348 | Ga0496108_0012348_5823_6527 | 200 |
| 574 | 3300048911 | Ga0496108_0076691 | Ga0496108_0076691_1933_2637 | 200 |
| 575 | 3300048912 | Ga0496109_0474967 | Ga0496109_0474967_34_738 | 200 |
| 576 | 3300048913 | Ga0496110_0149875 | Ga0496110_0149875_140_844 | 200 |
| 577 | 3300048915 | Ga0496112_0053839 | Ga0496112_0053839_2957_3661 | 200 |
| 578 | 3300048915 | Ga0496112_0150977 | Ga0496112_0150977_1104_1808 | 200 |
| 579 | 3300048916 | Ga0496113_0063896 | Ga0496113_0063896_429_1133 | 200 |
| 580 | 3300048916 | Ga0496113_0356457 | Ga0496113_0356457_407_1111 | 200 |
| 581 | 3300049569 | Ga0501032_0107281 | Ga0501032_0107281_820_1524 | 200 |
| 582 | 3300049572 | Ga0501036_0258463 | Ga0501036_0258463_703_1407 | 200 |
| 583 | 3300049573 | Ga0501037_0072122 | Ga0501037_0072122_1431_2135 | 200 |
| 584 | 3300049574 | Ga0501038_0112160 | Ga0501038_0112160_314_1018 | 200 |
| 585 | 3300049575 | Ga0501039_0199763 | Ga0501039_0199763_326_1030 | 200 |
| 586 | 3300049576 | Ga0501040_0080718 | Ga0501040_0080718_177_881 | 200 |
| 587 | 3300049576 | Ga0501040_0509296 | Ga0501040_0509296_71_766 | 200 |
| 588 | 3300049577 | Ga0501041_0168203 | Ga0501041_0168203_489_1193 | 200 |
| 589 | 3300049578 | Ga0501042_0128552 | Ga0501042_0128552_1041_1745 | 200 |
| 590 | 3300049582 | Ga0501048_0007522 | Ga0501048_0007522_2638_3342 | 200 |
| 591 | 3300049584 | Ga0501068_0129934 | Ga0501068_0129934_110_814 | 200 |
| 592 | 3300049585 | Ga0501069_0085016 | Ga0501069_0085016_634_1332 | 200 |
| 593 | 3300049586 | Ga0501070_0108402 | Ga0501070_0108402_432_1136 | 200 |
| 594 | 3300049587 | Ga0501071_0030822 | Ga0501071_0030822_1990_2694 | 200 |
| 595 | 3300049588 | Ga0501072_0179850 | Ga0501072_0179850_866_1570 | 200 |
| 596 | 3300049589 | Ga0501073_0318813 | Ga0501073_0318813_103_807 | 200 |
| 597 | 3300049591 | Ga0501075_0006835 | Ga0501075_0006835_5386_6090 | 200 |
| 598 | 3300049592 | Ga0501076_0047582 | Ga0501076_0047582_2305_3009 | 200 |
| 599 | 3300049593 | Ga0501077_0008210 | Ga0501077_0008210_4967_5671 | 200 |
| 600 | 3300049593 | Ga0501077_0165265 | Ga0501077_0165265_254_940 | 200 |
| 601 | 3300049741 | Ga0501079_0025157 | Ga0501079_0025157_1220_1924 | 200 |
| 602 | 3300049742 | Ga0501080_0017337 | Ga0501080_0017337_19_678 | 200 |
| 603 | 3300049742 | Ga0501080_0177120 | Ga0501080_0177120_13_675 | 200 |
| 604 | 3300049743 | Ga0501081_0405298 | Ga0501081_0405298_216_911 | 200 |
| 605 | 3300049743 | Ga0501081_0434115 | Ga0501081_0434115_58_735 | 200 |
| 606 | 3300050507 | nmdc:mga05p37_158178_c1 | nmdc:mga05p37_158178_c1_1566_2282 | 200 |
| 607 | 3300050508 | nmdc:mga09592_26571_c1 | nmdc:mga09592_26571_c1_333_1028 | 200 |
| 608 | 3300050510 | nmdc:mga06r32_215006_c1 | nmdc:mga06r32_215006_c1_795_1481 | 200 |
| 609 | 3300050510 | nmdc:mga06r32_8063_c1 | nmdc:mga06r32_8063_c1_4569_5264 | 200 |
| 610 | 3300053093 | Ga0500651_0066405 | Ga0500651_0066405_291_941 | 200 |
| 611 | 3300053096 | Ga0500641_0007663 | Ga0500641_0007663_385_1032 | 200 |
| 612 | 3300053098 | Ga0500650_0088338 | Ga0500650_0088338_472_1116 | 200 |
| 613 | 3300054114 | Ga0501084_0021009 | Ga0501084_0021009_2916_3620 | 200 |
| 614 | 3300059421 | Ga0590071_003007 | Ga0590071_003007_2740_3441 | 200 |
| 615 | 3300059421 | Ga0590071_003425 | Ga0590071_003425_2254_2946 | 200 |
| 616 | 3300059424 | Ga0590075_021012 | Ga0590075_021012_103_795 | 200 |
| 617 | 3300005518 | Ga0070699_100018182 | Ga0070699_1000181824 | 201 |
| 618 | 3300005545 | Ga0070695_100009721 | Ga0070695_1000097219 | 201 |
| 619 | 3300005546 | Ga0070696_100001655 | Ga0070696_10000165513 | 201 |
| 620 | 3300006847 | Ga0075431_100018917 | Ga0075431_1000189177 | 201 |
| 621 | 3300009147 | Ga0114129_10964978 | Ga0114129_109649782 | 201 |
| 622 | 3300025916 | Ga0207663_10090962 | Ga0207663_100909623 | 201 |
| 623 | 3300031247 | Ga0265340_10036269 | Ga0265340_100362696 | 201 |
| 624 | 3300032126 | Ga0307415_100373659 | Ga0307415_1003736591 | 201 |
| 625 | 3300035083 | Ga0373926_0010463 | Ga0373926_0010463_929_1663 | 201 |
| 626 | 3300035114 | Ga0373939_0007484 | Ga0373939_0007484_527_1261 | 201 |
| 627 | 3300035121 | Ga0373960_0007261 | Ga0373960_0007261_871_1605 | 201 |
| 628 | 3300035170 | Ga0373943_0236963 | Ga0373943_0236963_72_806 | 201 |
| 629 | 3300035241 | Ga0373961_0065415 | Ga0373961_0065415_267_1001 | 201 |
| 630 | 3300035691 | Ga0373931_0010148 | Ga0373931_0010148_3080_3814 | 201 |
| 631 | 3300035692 | Ga0373935_0042487 | Ga0373935_0042487_322_1056 | 201 |
| 632 | 3300035695 | Ga0373927_0001782 | Ga0373927_0001782_6388_7122 | 201 |
| 633 | 3300037068 | Ga0373925_0000994 | Ga0373925_0000994_4410_5144 | 201 |
| 634 | 3300048905 | Ga0496102_0088835 | Ga0496102_0088835_971_1702 | 201 |
| 635 | 3300050508 | nmdc:mga09592_17095_c1 | nmdc:mga09592_17095_c1_5071_5811 | 201 |
| 636 | 3300050509 | nmdc:mga0qj67_414935_c1 | nmdc:mga0qj67_414935_c1_96_797 | 201 |
| 637 | 3300050509 | nmdc:mga0qj67_66080_c1 | nmdc:mga0qj67_66080_c1_1383_2138 | 201 |
| 638 | 3300050510 | nmdc:mga06r32_253763_c1 | nmdc:mga06r32_253763_c1_293_1033 | 201 |
| 639 | 3300050510 | nmdc:mga06r32_52016_c1 | nmdc:mga06r32_52016_c1_1717_2472 | 201 |
| 640 | 3300005544 | Ga0070686_100349625 | Ga0070686_1003496252 | 202 |
| 641 | 3300014325 | Ga0163163_10126652 | Ga0163163_101266525 | 202 |
| 642 | 3300025922 | Ga0207646_10202508 | Ga0207646_102025083 | 202 |
| 643 | 3300031548 | Ga0307408_100258848 | Ga0307408_1002588482 | 202 |
| 644 | 3300042461 | Ga0439460_0108195 | Ga0439460_0108195_74_763 | 202 |
| 645 | 3300005355 | Ga0070671_100045038 | Ga0070671_1000450382 | 203 |
| 646 | 3300005364 | Ga0070673_100076697 | Ga0070673_1000766973 | 203 |
| 647 | 3300005438 | Ga0070701_10268425 | Ga0070701_102684251 | 203 |
| 648 | 3300005543 | Ga0070672_100164101 | Ga0070672_1001641013 | 203 |
| 649 | 3300005578 | Ga0068854_100731027 | Ga0068854_1007310272 | 203 |
| 650 | 3300006871 | Ga0075434_100162986 | Ga0075434_1001629864 | 203 |
| 651 | 3300009147 | Ga0114129_10017633 | Ga0114129_100176336 | 203 |
| 652 | 3300025931 | Ga0207644_10033728 | Ga0207644_100337282 | 203 |
| 653 | 3300025960 | Ga0207651_10022102 | Ga0207651_100221026 | 203 |
| 654 | 3300049576 | Ga0501040_0179547 | Ga0501040_0179547_366_1055 | 203 |
| 655 | 3300049591 | Ga0501075_0170493 | Ga0501075_0170493_522_1211 | 203 |
| 656 | 3300050507 | nmdc:mga05p37_210959_c1 | nmdc:mga05p37_210959_c1_868_1587 | 203 |
| 657 | 3300050512 | nmdc:mga0n895_13026_c1 | nmdc:mga0n895_13026_c1_3777_4496 | 203 |
| 658 | 3300050514 | nmdc:mga08x19_204996_c1 | nmdc:mga08x19_204996_c1_399_1118 | 203 |
| 659 | 3300050515 | nmdc:mga0a205_54866_c1 | nmdc:mga0a205_54866_c1_3077_3796 | 203 |
| 660 | 3300005841 | Ga0068863_100031970 | Ga0068863_1000319709 | 204 |
| 661 | 3300005842 | Ga0068858_100247493 | Ga0068858_1002474932 | 204 |
| 662 | 3300005843 | Ga0068860_100250986 | Ga0068860_1002509862 | 204 |
| 663 | 3300014325 | Ga0163163_10009943 | Ga0163163_1000994315 | 204 |
| 664 | 3300026088 | Ga0207641_10050032 | Ga0207641_100500322 | 204 |
| 665 | 3300046452 | Ga0495617_010759 | Ga0495617_010759_914_1603 | 204 |
| 666 | 3300046491 | Ga0495584_0013349 | Ga0495584_0013349_1249_1938 | 204 |
| 667 | 3300046492 | Ga0495585_0001730 | Ga0495585_0001730_15610_16299 | 204 |
| 668 | 3300046523 | Ga0495644_0002586 | Ga0495644_0002586_5169_5858 | 204 |
| 669 | 3300046537 | Ga0495598_0000729 | Ga0495598_0000729_3221_3910 | 204 |
| 670 | 3300046539 | Ga0495621_0092546 | Ga0495621_0092546_270_959 | 204 |
| 671 | 3300046648 | Ga0495611_0001648 | Ga0495611_0001648_5419_6108 | 204 |
| 672 | 3300046664 | Ga0495659_0019311 | Ga0495659_0019311_1232_1921 | 204 |
| 673 | 3300046691 | Ga0495670_0007523 | Ga0495670_0007523_4353_5042 | 204 |
| 674 | 3300046794 | Ga0495589_0044804 | Ga0495589_0044804_456_1145 | 204 |
| 675 | 3300047446 | Ga0495679_007990 | Ga0495679_007990_3603_4292 | 204 |
| 676 | 3300048909 | Ga0496106_0215774 | Ga0496106_0215774_149_865 | 204 |
| 677 | 3300059424 | Ga0590075_039106 | Ga0590075_039106_367_1077 | 204 |
| 678 | 3300005436 | Ga0070713_100331543 | Ga0070713_1003315432 | 205 |
| 679 | 3300009148 | Ga0105243_10921354 | Ga0105243_109213542 | 205 |
| 680 | 3300025906 | Ga0207699_10210533 | Ga0207699_102105332 | 205 |
| 681 | 3300025915 | Ga0207693_10238778 | Ga0207693_102387782 | 205 |
| 682 | 3300025928 | Ga0207700_10353072 | Ga0207700_103530722 | 205 |
| 683 | 3300025929 | Ga0207664_10006275 | Ga0207664_1000627513 | 205 |
| 684 | 3300046501 | Ga0495607_0005316 | Ga0495607_0005316_4079_4768 | 205 |
| 685 | 3300046558 | Ga0495633_0000941 | Ga0495633_0000941_3114_3803 | 205 |
| 686 | 3300046615 | Ga0495656_0000589 | Ga0495656_0000589_3434_4123 | 205 |
| 687 | 3300005439 | Ga0070711_100054156 | Ga0070711_1000541565 | 207 |
| 688 | 3300007265 | Ga0099794_10045960 | Ga0099794_100459602 | 207 |
| 689 | 3300039438 | Ga0436360_0355744 | Ga0436360_0355744_315_1028 | 207 |
| 690 | 3300046513 | Ga0495616_0145054 | Ga0495616_0145054_158_847 | 207 |
| 691 | 2209111006 | 2214775776 | 2213796843 | 208 |
| 692 | 3300000041 | ARcpr5oldR_c000035 | ARcpr5oldR_00003524 | 208 |
| 693 | 3300000042 | ARSoilYngRDRAFT_c00061 | ARSoilYngRDRAFT_0006117 | 208 |
| 694 | 3300000043 | ARcpr5yngRDRAFT_c000075 | ARcpr5yngRDRAFT_00007510 | 208 |
| 695 | 3300000044 | ARSoilOldRDRAFT_c000053 | ARSoilOldRDRAFT_00005310 | 208 |
| 696 | 3300000045 | ARCol0oldRDRAFT_c01233 | ARCol0oldRDRAFT_012332 | 208 |
| 697 | 3300000652 | ARCol0yngRDRAFT_1000025 | ARCol0yngRDRAFT_100002514 | 208 |
| 698 | 3300001976 | JGI24752J21851_1002479 | JGI24752J21851_10024792 | 208 |
| 699 | 3300001977 | JGI24746J21847_1000313 | JGI24746J21847_100031313 | 208 |
| 700 | 3300001979 | JGI24740J21852_10029468 | JGI24740J21852_100294683 | 208 |
| 701 | 3300001989 | JGI24739J22299_10001271 | JGI24739J22299_1000127116 | 208 |
| 702 | 3300001989 | JGI24739J22299_10006089 | JGI24739J22299_100060898 | 208 |
| 703 | 3300001989 | JGI24739J22299_10076202 | JGI24739J22299_100762022 | 208 |
| 704 | 3300001990 | JGI24737J22298_10005496 | JGI24737J22298_100054968 | 208 |
| 705 | 3300001990 | JGI24737J22298_10007426 | JGI24737J22298_100074262 | 208 |
| 706 | 3300001991 | JGI24743J22301_10008078 | JGI24743J22301_100080781 | 208 |
| 707 | 3300001991 | JGI24743J22301_10041313 | JGI24743J22301_100413132 | 208 |
| 708 | 3300002070 | JGI24750J21931_1000691 | JGI24750J21931_10006915 | 208 |
| 709 | 3300002073 | JGI24745J21846_1000034 | JGI24745J21846_100003414 | 208 |
| 710 | 3300002074 | JGI24748J21848_1002810 | JGI24748J21848_10028102 | 208 |
| 711 | 3300002075 | JGI24738J21930_10001067 | JGI24738J21930_1000106712 | 208 |
| 712 | 3300002076 | JGI24749J21850_1001313 | JGI24749J21850_10013136 | 208 |
| 713 | 3300002076 | JGI24749J21850_1019286 | JGI24749J21850_10192862 | 208 |
| 714 | 3300002126 | JGI24035J26624_1000089 | JGI24035J26624_10000894 | 208 |
| 715 | 3300002126 | JGI24035J26624_1000142 | JGI24035J26624_10001428 | 208 |
| 716 | 3300002239 | JGI24034J26672_10000419 | JGI24034J26672_1000041911 | 208 |
| 717 | 3300002244 | JGI24742J22300_10001913 | JGI24742J22300_100019134 | 208 |
| 718 | 3300002459 | JGI24751J29686_10007231 | JGI24751J29686_100072313 | 208 |
| 719 | 3300003349 | JGI26129J50193_1002889 | JGI26129J50193_10028893 | 208 |
| 720 | 3300005277 | Ga0065716_1001741 | Ga0065716_10017414 | 208 |
| 721 | 3300005289 | Ga0065704_10143315 | Ga0065704_101433152 | 208 |
| 722 | 3300005290 | Ga0065712_10145928 | Ga0065712_101459281 | 208 |
| 723 | 3300005290 | Ga0065712_10165564 | Ga0065712_101655642 | 208 |
| 724 | 3300005293 | Ga0065715_10001888 | Ga0065715_100018889 | 208 |
| 725 | 3300005293 | Ga0065715_10002477 | Ga0065715_1000247712 | 208 |
| 726 | 3300005295 | Ga0065707_10107090 | Ga0065707_101070902 | 208 |
| 727 | 3300005328 | Ga0070676_10085171 | Ga0070676_100851713 | 208 |
| 728 | 3300005329 | Ga0070683_100100106 | Ga0070683_1001001065 | 208 |
| 729 | 3300005330 | Ga0070690_100020637 | Ga0070690_1000206373 | 208 |
| 730 | 3300005330 | Ga0070690_100076604 | Ga0070690_1000766045 | 208 |
| 731 | 3300005331 | Ga0070670_100006103 | Ga0070670_1000061039 | 208 |
| 732 | 3300005333 | Ga0070677_10006617 | Ga0070677_100066176 | 208 |
| 733 | 3300005334 | Ga0068869_100000755 | Ga0068869_10000075518 | 208 |
| 734 | 3300005335 | Ga0070666_10023127 | Ga0070666_100231276 | 208 |
| 735 | 3300005336 | Ga0070680_100026487 | Ga0070680_1000264878 | 208 |
| 736 | 3300005336 | Ga0070680_100045978 | Ga0070680_1000459786 | 208 |
| 737 | 3300005337 | Ga0070682_100000693 | Ga0070682_10000069321 | 208 |
| 738 | 3300005338 | Ga0068868_100006260 | Ga0068868_1000062605 | 208 |
| 739 | 3300005339 | Ga0070660_100192040 | Ga0070660_1001920402 | 208 |
| 740 | 3300005340 | Ga0070689_100016123 | Ga0070689_1000161233 | 208 |
| 741 | 3300005340 | Ga0070689_100053325 | Ga0070689_1000533252 | 208 |
| 742 | 3300005341 | Ga0070691_10002710 | Ga0070691_1000271012 | 208 |
| 743 | 3300005343 | Ga0070687_100006904 | Ga0070687_1000069048 | 208 |
| 744 | 3300005344 | Ga0070661_100062742 | Ga0070661_1000627422 | 208 |
| 745 | 3300005344 | Ga0070661_100359199 | Ga0070661_1003591991 | 208 |
| 746 | 3300005345 | Ga0070692_10008004 | Ga0070692_100080048 | 208 |
| 747 | 3300005345 | Ga0070692_10102861 | Ga0070692_101028613 | 208 |
| 748 | 3300005347 | Ga0070668_100002043 | Ga0070668_1000020438 | 208 |
| 749 | 3300005353 | Ga0070669_100023313 | Ga0070669_1000233132 | 208 |
| 750 | 3300005353 | Ga0070669_100023519 | Ga0070669_1000235192 | 208 |
| 751 | 3300005354 | Ga0070675_100055612 | Ga0070675_1000556122 | 208 |
| 752 | 3300005354 | Ga0070675_100231381 | Ga0070675_1002313812 | 208 |
| 753 | 3300005355 | Ga0070671_100202293 | Ga0070671_1002022932 | 208 |
| 754 | 3300005356 | Ga0070674_100001294 | Ga0070674_1000012943 | 208 |
| 755 | 3300005364 | Ga0070673_100024964 | Ga0070673_1000249642 | 208 |
| 756 | 3300005365 | Ga0070688_100007596 | Ga0070688_10000759612 | 208 |
| 757 | 3300005365 | Ga0070688_100013675 | Ga0070688_1000136758 | 208 |
| 758 | 3300005366 | Ga0070659_100023740 | Ga0070659_1000237408 | 208 |
| 759 | 3300005367 | Ga0070667_100068731 | Ga0070667_1000687315 | 208 |
| 760 | 3300005406 | Ga0070703_10006226 | Ga0070703_100062262 | 208 |
| 761 | 3300005438 | Ga0070701_10111750 | Ga0070701_101117503 | 208 |
| 762 | 3300005440 | Ga0070705_100001981 | Ga0070705_1000019813 | 208 |
| 763 | 3300005440 | Ga0070705_100244685 | Ga0070705_1002446852 | 208 |
| 764 | 3300005441 | Ga0070700_100031838 | Ga0070700_1000318385 | 208 |
| 765 | 3300005441 | Ga0070700_100161591 | Ga0070700_1001615912 | 208 |
| 766 | 3300005444 | Ga0070694_100043378 | Ga0070694_1000433783 | 208 |
| 767 | 3300005444 | Ga0070694_100056701 | Ga0070694_1000567015 | 208 |
| 768 | 3300005445 | Ga0070708_100080585 | Ga0070708_1000805855 | 208 |
| 769 | 3300005455 | Ga0070663_100017366 | Ga0070663_1000173663 | 208 |
| 770 | 3300005455 | Ga0070663_100203182 | Ga0070663_1002031823 | 208 |
| 771 | 3300005456 | Ga0070678_100004700 | Ga0070678_10000470014 | 208 |
| 772 | 3300005457 | Ga0070662_100021397 | Ga0070662_1000213972 | 208 |
| 773 | 3300005457 | Ga0070662_100050107 | Ga0070662_1000501075 | 208 |
| 774 | 3300005458 | Ga0070681_10171228 | Ga0070681_101712283 | 208 |
| 775 | 3300005458 | Ga0070681_10662882 | Ga0070681_106628821 | 208 |
| 776 | 3300005459 | Ga0068867_100003543 | Ga0068867_10000354315 | 208 |
| 777 | 3300005466 | Ga0070685_10011173 | Ga0070685_100111738 | 208 |
| 778 | 3300005466 | Ga0070685_10012732 | Ga0070685_100127328 | 208 |
| 779 | 3300005518 | Ga0070699_100312259 | Ga0070699_1003122592 | 208 |
| 780 | 3300005530 | Ga0070679_100039101 | Ga0070679_1000391018 | 208 |
| 781 | 3300005530 | Ga0070679_100293724 | Ga0070679_1002937242 | 208 |
| 782 | 3300005535 | Ga0070684_100071626 | Ga0070684_1000716263 | 208 |
| 783 | 3300005535 | Ga0070684_100073460 | Ga0070684_1000734605 | 208 |
| 784 | 3300005536 | Ga0070697_100078379 | Ga0070697_1000783791 | 208 |
| 785 | 3300005536 | Ga0070697_100247992 | Ga0070697_1002479922 | 208 |
| 786 | 3300005539 | Ga0068853_100002095 | Ga0068853_10000209519 | 208 |
| 787 | 3300005543 | Ga0070672_100075788 | Ga0070672_1000757882 | 208 |
| 788 | 3300005543 | Ga0070672_100335644 | Ga0070672_1003356442 | 208 |
| 789 | 3300005544 | Ga0070686_100013389 | Ga0070686_1000133893 | 208 |
| 790 | 3300005544 | Ga0070686_100026380 | Ga0070686_1000263802 | 208 |
| 791 | 3300005545 | Ga0070695_100040449 | Ga0070695_1000404495 | 208 |
| 792 | 3300005545 | Ga0070695_100154109 | Ga0070695_1001541092 | 208 |
| 793 | 3300005546 | Ga0070696_100023729 | Ga0070696_1000237298 | 208 |
| 794 | 3300005546 | Ga0070696_100074654 | Ga0070696_1000746544 | 208 |
| 795 | 3300005547 | Ga0070693_100003889 | Ga0070693_1000038893 | 208 |
| 796 | 3300005549 | Ga0070704_100016233 | Ga0070704_1000162333 | 208 |
| 797 | 3300005563 | Ga0068855_100113736 | Ga0068855_1001137363 | 208 |
| 798 | 3300005563 | Ga0068855_100715308 | Ga0068855_1007153082 | 208 |
| 799 | 3300005564 | Ga0070664_100085232 | Ga0070664_1000852322 | 208 |
| 800 | 3300005577 | Ga0068857_100006037 | Ga0068857_10000603715 | 208 |
| 801 | 3300005578 | Ga0068854_100006037 | Ga0068854_10000603713 | 208 |
| 802 | 3300005615 | Ga0070702_100000378 | Ga0070702_10000037820 | 208 |
| 803 | 3300005616 | Ga0068852_100031220 | Ga0068852_1000312202 | 208 |
| 804 | 3300005617 | Ga0068859_100046039 | Ga0068859_1000460398 | 208 |
| 805 | 3300005617 | Ga0068859_100353461 | Ga0068859_1003534612 | 208 |
| 806 | 3300005618 | Ga0068864_100000595 | Ga0068864_10000059524 | 208 |
| 807 | 3300005718 | Ga0068866_10000834 | Ga0068866_1000083414 | 208 |
| 808 | 3300005718 | Ga0068866_10270379 | Ga0068866_102703792 | 208 |
| 809 | 3300005719 | Ga0068861_100233415 | Ga0068861_1002334153 | 208 |
| 810 | 3300005840 | Ga0068870_10000216 | Ga0068870_1000021621 | 208 |
| 811 | 3300005841 | Ga0068863_100012849 | Ga0068863_10001284913 | 208 |
| 812 | 3300005842 | Ga0068858_100286789 | Ga0068858_1002867892 | 208 |
| 813 | 3300005842 | Ga0068858_100288277 | Ga0068858_1002882773 | 208 |
| 814 | 3300005843 | Ga0068860_100036168 | Ga0068860_1000361683 | 208 |
| 815 | 3300005843 | Ga0068860_100092223 | Ga0068860_1000922235 | 208 |
| 816 | 3300005844 | Ga0068862_100303899 | Ga0068862_1003038991 | 208 |
| 817 | 3300005844 | Ga0068862_100412676 | Ga0068862_1004126762 | 208 |
| 818 | 3300006042 | Ga0075368_10204930 | Ga0075368_102049301 | 208 |
| 819 | 3300006237 | Ga0097621_100000600 | Ga0097621_10000060018 | 208 |
| 820 | 3300006358 | Ga0068871_100000118 | Ga0068871_10000011814 | 208 |
| 821 | 3300006844 | Ga0075428_100101121 | Ga0075428_1001011211 | 208 |
| 822 | 3300006847 | Ga0075431_100118944 | Ga0075431_1001189446 | 208 |
| 823 | 3300006852 | Ga0075433_10394272 | Ga0075433_103942722 | 208 |
| 824 | 3300006871 | Ga0075434_100018939 | Ga0075434_1000189399 | 208 |
| 825 | 3300006871 | Ga0075434_100352625 | Ga0075434_1003526253 | 208 |
| 826 | 3300006881 | Ga0068865_100019301 | Ga0068865_1000193012 | 208 |
| 827 | 3300006881 | Ga0068865_100437687 | Ga0068865_1004376872 | 208 |
| 828 | 3300006914 | Ga0075436_100524819 | Ga0075436_1005248192 | 208 |
| 829 | 3300006931 | Ga0097620_100046036 | Ga0097620_1000460368 | 208 |
| 830 | 3300006931 | Ga0097620_100353469 | Ga0097620_1003534692 | 208 |
| 831 | 3300007076 | Ga0075435_100012698 | Ga0075435_1000126985 | 208 |
| 832 | 3300007265 | Ga0099794_10077416 | Ga0099794_100774162 | 208 |
| 833 | 3300009092 | Ga0105250_10022913 | Ga0105250_100229135 | 208 |
| 834 | 3300009093 | Ga0105240_10222694 | Ga0105240_102226946 | 208 |
| 835 | 3300009094 | Ga0111539_10055701 | Ga0111539_100557013 | 208 |
| 836 | 3300009094 | Ga0111539_10065259 | Ga0111539_100652598 | 208 |
| 837 | 3300009098 | Ga0105245_10205279 | Ga0105245_102052793 | 208 |
| 838 | 3300009101 | Ga0105247_10129917 | Ga0105247_101299173 | 208 |
| 839 | 3300009147 | Ga0114129_10957088 | Ga0114129_109570882 | 208 |
| 840 | 3300009148 | Ga0105243_10009714 | Ga0105243_1000971410 | 208 |
| 841 | 3300009174 | Ga0105241_10114705 | Ga0105241_101147052 | 208 |
| 842 | 3300009176 | Ga0105242_10035447 | Ga0105242_100354478 | 208 |
| 843 | 3300009177 | Ga0105248_10266968 | Ga0105248_102669683 | 208 |
| 844 | 3300009177 | Ga0105248_11200461 | Ga0105248_112004612 | 208 |
| 845 | 3300009545 | Ga0105237_10670542 | Ga0105237_106705422 | 208 |
| 846 | 3300009553 | Ga0105249_10032777 | Ga0105249_100327773 | 208 |
| 847 | 3300009553 | Ga0105249_10048120 | Ga0105249_100481203 | 208 |
| 848 | 3300010375 | Ga0105239_10053808 | Ga0105239_100538082 | 208 |
| 849 | 3300011119 | Ga0105246_10002558 | Ga0105246_1000255817 | 208 |
| 850 | 3300012485 | Ga0157325_1000571 | Ga0157325_10005713 | 208 |
| 851 | 3300012495 | Ga0157323_1000357 | Ga0157323_10003574 | 208 |
| 852 | 3300012505 | Ga0157339_1003317 | Ga0157339_10033173 | 208 |
| 853 | 3300012507 | Ga0157342_1002329 | Ga0157342_10023292 | 208 |
| 854 | 3300012513 | Ga0157326_1003916 | Ga0157326_10039162 | 208 |
| 855 | 3300013102 | Ga0157371_10023400 | Ga0157371_100234003 | 208 |
| 856 | 3300013296 | Ga0157374_10021639 | Ga0157374_1002163912 | 208 |
| 857 | 3300013306 | Ga0163162_10368202 | Ga0163162_103682022 | 208 |
| 858 | 3300013306 | Ga0163162_10468616 | Ga0163162_104686163 | 208 |
| 859 | 3300013308 | Ga0157375_10007178 | Ga0157375_100071782 | 208 |
| 860 | 3300013308 | Ga0157375_10830601 | Ga0157375_108306011 | 208 |
| 861 | 3300014326 | Ga0157380_10131899 | Ga0157380_101318993 | 208 |
| 862 | 3300014745 | Ga0157377_10000628 | Ga0157377_1000062819 | 208 |
| 863 | 3300014969 | Ga0157376_10063679 | Ga0157376_100636796 | 208 |
| 864 | 3300017792 | Ga0163161_10000415 | Ga0163161_100004159 | 208 |
| 865 | 3300025271 | Ga0207666_1000185 | Ga0207666_10001852 | 208 |
| 866 | 3300025271 | Ga0207666_1000473 | Ga0207666_10004732 | 208 |
| 867 | 3300025290 | Ga0207673_1000115 | Ga0207673_100011512 | 208 |
| 868 | 3300025315 | Ga0207697_10006788 | Ga0207697_100067882 | 208 |
| 869 | 3300025315 | Ga0207697_10104371 | Ga0207697_101043712 | 208 |
| 870 | 3300025711 | Ga0207696_1040744 | Ga0207696_10407443 | 208 |
| 871 | 3300025885 | Ga0207653_10009209 | Ga0207653_100092092 | 208 |
| 872 | 3300025893 | Ga0207682_10000350 | Ga0207682_1000035015 | 208 |
| 873 | 3300025899 | Ga0207642_10001478 | Ga0207642_1000147813 | 208 |
| 874 | 3300025899 | Ga0207642_10226043 | Ga0207642_102260432 | 208 |
| 875 | 3300025900 | Ga0207710_10016235 | Ga0207710_100162356 | 208 |
| 876 | 3300025901 | Ga0207688_10000001 | Ga0207688_10000001118 | 208 |
| 877 | 3300025903 | Ga0207680_10063616 | Ga0207680_100636162 | 208 |
| 878 | 3300025904 | Ga0207647_10174606 | Ga0207647_101746062 | 208 |
| 879 | 3300025904 | Ga0207647_10174831 | Ga0207647_101748312 | 208 |
| 880 | 3300025907 | Ga0207645_10000222 | Ga0207645_1000022251 | 208 |
| 881 | 3300025908 | Ga0207643_10000009 | Ga0207643_1000000919 | 208 |
| 882 | 3300025908 | Ga0207643_10295507 | Ga0207643_102955072 | 208 |
| 883 | 3300025912 | Ga0207707_10006091 | Ga0207707_1000609116 | 208 |
| 884 | 3300025912 | Ga0207707_10506677 | Ga0207707_105066772 | 208 |
| 885 | 3300025917 | Ga0207660_10000197 | Ga0207660_1000019733 | 208 |
| 886 | 3300025917 | Ga0207660_10043689 | Ga0207660_100436893 | 208 |
| 887 | 3300025918 | Ga0207662_10210387 | Ga0207662_102103872 | 208 |
| 888 | 3300025918 | Ga0207662_10224236 | Ga0207662_102242362 | 208 |
| 889 | 3300025919 | Ga0207657_10301020 | Ga0207657_103010202 | 208 |
| 890 | 3300025919 | Ga0207657_10304387 | Ga0207657_103043872 | 208 |
| 891 | 3300025920 | Ga0207649_10000052 | Ga0207649_10000052111 | 208 |
| 892 | 3300025921 | Ga0207652_10001438 | Ga0207652_100014382 | 208 |
| 893 | 3300025923 | Ga0207681_10001135 | Ga0207681_100011358 | 208 |
| 894 | 3300025923 | Ga0207681_10026657 | Ga0207681_100266573 | 208 |
| 895 | 3300025925 | Ga0207650_10002693 | Ga0207650_1000269315 | 208 |
| 896 | 3300025926 | Ga0207659_10000132 | Ga0207659_100001323 | 208 |
| 897 | 3300025926 | Ga0207659_10326288 | Ga0207659_103262882 | 208 |
| 898 | 3300025927 | Ga0207687_10000174 | Ga0207687_100001742 | 208 |
| 899 | 3300025931 | Ga0207644_10000212 | Ga0207644_1000021233 | 208 |
| 900 | 3300025932 | Ga0207690_10001288 | Ga0207690_1000128812 | 208 |
| 901 | 3300025932 | Ga0207690_10029346 | Ga0207690_100293467 | 208 |
| 902 | 3300025933 | Ga0207706_10133993 | Ga0207706_101339932 | 208 |
| 903 | 3300025933 | Ga0207706_10270755 | Ga0207706_102707553 | 208 |
| 904 | 3300025934 | Ga0207686_10021579 | Ga0207686_100215798 | 208 |
| 905 | 3300025935 | Ga0207709_10000530 | Ga0207709_1000053028 | 208 |
| 906 | 3300025936 | Ga0207670_10000523 | Ga0207670_100005233 | 208 |
| 907 | 3300025936 | Ga0207670_10028318 | Ga0207670_100283185 | 208 |
| 908 | 3300025937 | Ga0207669_10000235 | Ga0207669_1000023519 | 208 |
| 909 | 3300025938 | Ga0207704_10000198 | Ga0207704_1000019818 | 208 |
| 910 | 3300025938 | Ga0207704_10275115 | Ga0207704_102751152 | 208 |
| 911 | 3300025940 | Ga0207691_10371561 | Ga0207691_103715612 | 208 |
| 912 | 3300025941 | Ga0207711_10006368 | Ga0207711_100063687 | 208 |
| 913 | 3300025942 | Ga0207689_10000031 | Ga0207689_1000003197 | 208 |
| 914 | 3300025944 | Ga0207661_10001228 | Ga0207661_1000122823 | 208 |
| 915 | 3300025944 | Ga0207661_10344571 | Ga0207661_103445711 | 208 |
| 916 | 3300025945 | Ga0207679_10000183 | Ga0207679_1000018346 | 208 |
| 917 | 3300025949 | Ga0207667_10064461 | Ga0207667_100644616 | 208 |
| 918 | 3300025949 | Ga0207667_10551587 | Ga0207667_105515872 | 208 |
| 919 | 3300025960 | Ga0207651_10000051 | Ga0207651_1000005120 | 208 |
| 920 | 3300025961 | Ga0207712_10001703 | Ga0207712_1000170318 | 208 |
| 921 | 3300025961 | Ga0207712_10029987 | Ga0207712_100299877 | 208 |
| 922 | 3300025972 | Ga0207668_10000664 | Ga0207668_100006642 | 208 |
| 923 | 3300025981 | Ga0207640_10000343 | Ga0207640_1000034319 | 208 |
| 924 | 3300025986 | Ga0207658_10289290 | Ga0207658_102892901 | 208 |
| 925 | 3300026023 | Ga0207677_10003168 | Ga0207677_100031688 | 208 |
| 926 | 3300026035 | Ga0207703_10069812 | Ga0207703_100698126 | 208 |
| 927 | 3300026067 | Ga0207678_10369882 | Ga0207678_103698822 | 208 |
| 928 | 3300026067 | Ga0207678_10370474 | Ga0207678_103704742 | 208 |
| 929 | 3300026075 | Ga0207708_10026728 | Ga0207708_100267288 | 208 |
| 930 | 3300026075 | Ga0207708_10385232 | Ga0207708_103852322 | 208 |
| 931 | 3300026088 | Ga0207641_10001831 | Ga0207641_1000183115 | 208 |
| 932 | 3300026089 | Ga0207648_10396214 | Ga0207648_103962142 | 208 |
| 933 | 3300026095 | Ga0207676_10000124 | Ga0207676_1000012463 | 208 |
| 934 | 3300026116 | Ga0207674_10129547 | Ga0207674_101295475 | 208 |
| 935 | 3300026121 | Ga0207683_10000242 | Ga0207683_1000024214 | 208 |
| 936 | 3300026142 | Ga0207698_10023331 | Ga0207698_100233312 | 208 |
| 937 | 3300027252 | Ga0209973_1000799 | Ga0209973_10007993 | 208 |
| 938 | 3300027360 | Ga0209969_1005910 | Ga0209969_10059104 | 208 |
| 939 | 3300027424 | Ga0209984_1011359 | Ga0209984_10113592 | 208 |
| 940 | 3300027471 | Ga0209995_1004561 | Ga0209995_10045613 | 208 |
| 941 | 3300027526 | Ga0209968_1001085 | Ga0209968_10010855 | 208 |
| 942 | 3300027617 | Ga0210002_1002000 | Ga0210002_10020005 | 208 |
| 943 | 3300027665 | Ga0209983_1006615 | Ga0209983_10066155 | 208 |
| 944 | 3300027695 | Ga0209966_1000641 | Ga0209966_100064112 | 208 |
| 945 | 3300027717 | Ga0209998_10008003 | Ga0209998_100080032 | 208 |
| 946 | 3300027717 | Ga0209998_10021146 | Ga0209998_100211461 | 208 |
| 947 | 3300027876 | Ga0209974_10005603 | Ga0209974_100056036 | 208 |
| 948 | 3300027876 | Ga0209974_10075719 | Ga0209974_100757191 | 208 |
| 949 | 3300027876 | Ga0209974_10167800 | Ga0209974_101678001 | 208 |
| 950 | 3300027907 | Ga0207428_10000037 | Ga0207428_10000037212 | 208 |
| 951 | 3300027907 | Ga0207428_10030716 | Ga0207428_100307163 | 208 |
| 952 | 3300027907 | Ga0207428_10469935 | Ga0207428_104699352 | 208 |
| 953 | 3300028380 | Ga0268265_10003320 | Ga0268265_1000332011 | 208 |
| 954 | 3300028380 | Ga0268265_10272456 | Ga0268265_102724563 | 208 |
| 955 | 3300028381 | Ga0268264_10420674 | Ga0268264_104206742 | 208 |
| 956 | 3300031344 | Ga0265316_10195630 | Ga0265316_101956303 | 208 |
| 957 | 3300034816 | Ga0373930_0000191 | Ga0373930_0000191_3312_3986 | 208 |
| 958 | 3300034817 | Ga0373948_0002325 | Ga0373948_0002325_825_1499 | 208 |
| 959 | 3300034818 | Ga0373950_0015306 | Ga0373950_0015306_250_924 | 208 |
| 960 | 3300034819 | Ga0373958_0002981 | Ga0373958_0002981_1299_1973 | 208 |
| 961 | 3300034820 | Ga0373959_0001384 | Ga0373959_0001384_807_1481 | 208 |
| 962 | 3300034820 | Ga0373959_0015275 | Ga0373959_0015275_327_1001 | 208 |
| 963 | 3300034957 | Ga0373938_0000013 | Ga0373938_0000013_2448_3122 | 208 |
| 964 | 3300035084 | Ga0373928_0000255 | Ga0373928_0000255_8803_9477 | 208 |
| 965 | 3300035085 | Ga0373929_0003185 | Ga0373929_0003185_1021_1695 | 208 |
| 966 | 3300035088 | Ga0373940_0001317 | Ga0373940_0001317_3318_3992 | 208 |
| 967 | 3300035090 | Ga0373949_0013466 | Ga0373949_0013466_873_1547 | 208 |
| 968 | 3300035091 | Ga0373951_0000552 | Ga0373951_0000552_3939_4613 | 208 |
| 969 | 3300035091 | Ga0373951_0020969 | Ga0373951_0020969_223_897 | 208 |
| 970 | 3300035092 | Ga0373952_0000182 | Ga0373952_0000182_1289_1963 | 208 |
| 971 | 3300035112 | Ga0373932_0000252 | Ga0373932_0000252_703_1377 | 208 |
| 972 | 3300035112 | Ga0373932_0012999 | Ga0373932_0012999_1050_1724 | 208 |
| 973 | 3300035114 | Ga0373939_0029054 | Ga0373939_0029054_562_1236 | 208 |
| 974 | 3300035121 | Ga0373960_0000068 | Ga0373960_0000068_9809_10483 | 208 |
| 975 | 3300035121 | Ga0373960_0002169 | Ga0373960_0002169_3358_4032 | 208 |
| 976 | 3300035207 | Ga0373942_0001815 | Ga0373942_0001815_2446_3120 | 208 |
| 977 | 3300035241 | Ga0373961_0003115 | Ga0373961_0003115_3120_3794 | 208 |
| 978 | 3300035241 | Ga0373961_0032972 | Ga0373961_0032972_302_976 | 208 |
| 979 | 3300035242 | Ga0373962_0000112 | Ga0373962_0000112_11147_11821 | 208 |
| 980 | 3300035691 | Ga0373931_0000305 | Ga0373931_0000305_8572_9246 | 208 |
| 981 | 3300035691 | Ga0373931_0001634 | Ga0373931_0001634_2996_3670 | 208 |
| 982 | 3300042001 | Ga0439441_032657 | Ga0439441_032657_83_757 | 208 |
| 983 | 3300042013 | Ga0439456_033005 | Ga0439456_033005_278_952 | 208 |
| 984 | 3300042876 | Ga0451577_0112731 | Ga0451577_0112731_711_1385 | 208 |
| 985 | 3300044712 | Ga0453684_0157702 | Ga0453684_0157702_1651_2325 | 208 |
| 986 | 3300045051 | Ga0451576_0205880 | Ga0451576_0205880_429_1103 | 208 |
| 987 | 3300046491 | Ga0495584_0168878 | Ga0495584_0168878_369_1043 | 208 |
| 988 | 3300046684 | Ga0495669_0015480 | Ga0495669_0015480_1967_2641 | 208 |
| 989 | 3300048903 | Ga0496100_0000345 | Ga0496100_0000345_17152_17826 | 208 |
| 990 | 3300048904 | Ga0496101_0000969 | Ga0496101_0000969_13213_13887 | 208 |
| 991 | 3300048905 | Ga0496102_0004376 | Ga0496102_0004376_1803_2477 | 208 |
| 992 | 3300048905 | Ga0496102_0089827 | Ga0496102_0089827_1570_2244 | 208 |
| 993 | 3300048906 | Ga0496103_0001732 | Ga0496103_0001732_70_744 | 208 |
| 994 | 3300048909 | Ga0496106_0075150 | Ga0496106_0075150_1242_1916 | 208 |
| 995 | 3300048910 | Ga0496107_0005598 | Ga0496107_0005598_6257_6931 | 208 |
| 996 | 3300048911 | Ga0496108_0031377 | Ga0496108_0031377_1124_1798 | 208 |
| 997 | 3300048912 | Ga0496109_0005949 | Ga0496109_0005949_3363_4037 | 208 |
| 998 | 3300048912 | Ga0496109_0414621 | Ga0496109_0414621_376_1050 | 208 |
| 999 | 3300048913 | Ga0496110_0100320 | Ga0496110_0100320_1097_1771 | 208 |
| 1000 | 3300048915 | Ga0496112_0410025 | Ga0496112_0410025_405_1079 | 208 |
| 1001 | 3300048917 | Ga0496114_0002647 | Ga0496114_0002647_5061_5735 | 208 |
| 1002 | 3300048918 | Ga0496115_0007035 | Ga0496115_0007035_3209_3883 | 208 |
| 1003 | 3300049592 | Ga0501076_0257319 | Ga0501076_0257319_182_856 | 208 |
| 1004 | 3300050493 | nmdc:mga0k408_67480_c1 | nmdc:mga0k408_67480_c1_179_853 | 208 |
| 1005 | 3300050508 | nmdc:mga09592_416483_c1 | nmdc:mga09592_416483_c1_94_789 | 208 |
| 1006 | 3300050510 | nmdc:mga06r32_93321_c1 | nmdc:mga06r32_93321_c1_1760_2455 | 208 |
| 1007 | 3300050511 | nmdc:mga08y16_3117_c1 | nmdc:mga08y16_3117_c1_4181_4855 | 208 |
| 1008 | 3300050511 | nmdc:mga08y16_333_c1 | nmdc:mga08y16_333_c1_951_1625 | 208 |
| 1009 | 3300050512 | nmdc:mga0n895_1174_c1 | nmdc:mga0n895_1174_c1_2083_2757 | 208 |
| 1010 | 3300050513 | nmdc:mga0rr50_202666_c1 | nmdc:mga0rr50_202666_c1_270_944 | 208 |
| 1011 | 3300050514 | nmdc:mga08x19_287479_c1 | nmdc:mga08x19_287479_c1_154_828 | 208 |
| 1012 | 3300050515 | nmdc:mga0a205_6917_c1 | nmdc:mga0a205_6917_c1_7509_8183 | 208 |
| 1013 | 3300054114 | Ga0501084_0062068 | Ga0501084_0062068_966_1640 | 208 |
| 1014 | 3300060353 | Ga0501082_0120716 | Ga0501082_0120716_813_1487 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ore-assembly1.cif.gz_E | release complex 70s | 0.9748 | 31 | 207 |
| 8a63-assembly1.cif.gz_J | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.9741 | 32 | 205 |
| 7azo-assembly1.cif.gz_L5A | 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 | 0.9735 | 29 | 208 |
| 8fn2-assembly1.cif.gz_G | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.973 | 28 | 208 |
| 8crx-assembly1.cif.gz_f | cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound | 0.9719 | 29 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9744 | 31 | 207 | 3.30.1440.10 |
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9691 | 31 | 207 | 3.30.1440.10 |
| af_P36519_120_288_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9236 | 51 | 207 | 3.30.1440.10 |
| af_A0A1D8PHY2_119_286_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9218 | 51 | 208 | 3.30.1440.10 |
| af_O14337_108_278_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8953 | 51 | 207 | 3.30.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4J1V4-F1-model_v4 | deleted | 0.9974 | 95 | 208 |
|
| AF-A0A2N3AXD5-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9943 | 42 | 208 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A3S1SWG3-F1-model_v4 | deleted | 0.9941 | 91 | 208 |
|
| AF-A0A351A0X8-F1-model_v4 | 50S ribosomal protein L5 | 0.9937 | 91 | 208 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A520A9X5-F1-model_v4 | Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL24; Large ribosomal subunit protein uL5] | 0.9934 | 79 | 206 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar