F488226

General Info

Members Datasets Scaffolds Average Seq Length
1014 477 1005 204

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0215774|Ga0496106_0215774_149_865
Length 238
Sequence MADEKAGGKSGKGAKGGTATAAPPKGGSQPQGKGKDKSPAGAVDHTPKAQEGKPRLLDYYEKTIRSRLAKEFGLKNPNQVPRLVKIVLNIGMGDAGKNPKQLEAAVEELGLITGQKAVVTRAKKAIANFGLRAGMPVGATVTLRGARMYEFLDRFINLAVPRIRDFRGLPSRSFDGRGNYTFGIKEQMIFPEIDFDRVEKIHGMDITLVTSADRDDLAMGLLRELGWPFRGETPQRVA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
5 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
6 2885266251 Ralstonia sp. SET104 Isolate Nodule
7 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
8 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
9 2928058823 Ralstonia sp. 1138 Isolate Unclassified
10 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
11 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
12 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
13 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
14 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
15 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
16 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
17 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
22 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
23 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
24 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
28 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
29 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
30 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
31 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
153 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
154 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
155 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
156 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
157 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
173 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
261 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
262 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
263 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
264 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
265 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
266 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
267 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
268 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
269 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
272 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
273 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
274 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
275 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
276 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
279 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
280 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
281 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
282 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
283 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
284 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
285 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
286 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
287 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
288 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
289 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
290 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
291 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
292 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
293 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
294 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
296 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
297 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
298 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
299 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
300 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
301 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
302 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
303 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
304 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
305 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
306 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
307 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
308 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
309 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
310 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
311 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
312 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
313 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
314 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
315 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
316 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
317 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
318 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
319 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
320 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
321 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
325 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
332 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
333 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
334 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
335 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
340 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
341 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
346 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
347 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
348 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
349 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
350 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
351 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
352 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
353 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
354 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
355 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
356 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
357 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
358 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
359 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
360 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
361 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
362 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
363 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
364 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
365 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
366 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
367 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
368 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
369 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
370 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
371 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
372 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
373 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
374 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
375 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
376 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
377 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
378 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
379 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
380 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
381 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
382 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
383 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
384 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
388 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
389 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
392 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
393 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
394 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
395 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
396 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
397 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
398 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
399 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
400 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
401 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
413 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
414 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
415 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
416 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
417 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
418 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
419 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
420 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
421 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
422 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
423 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
424 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
425 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
426 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
427 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
428 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
429 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
430 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
431 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
432 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
433 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
434 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
435 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
436 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
438 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
439 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
446 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
447 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
448 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
449 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
450 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
451 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
452 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
453 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
454 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
455 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
456 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
457 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
458 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
459 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
460 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
461 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
462 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
463 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
464 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
465 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
466 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
467 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
476 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
477 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 0.89
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0.39
Rhizoplane 5.92
Rhizosphere 89.94
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214775776 2209111006 Bacteria 2582
2 ARcpr5oldR_c000035 3300000041 Bacteria 26838
3 ARSoilYngRDRAFT_c00061 3300000042 Bacteria 17682
4 ARcpr5yngRDRAFT_c000075 3300000043 Bacteria 16570
5 ARSoilOldRDRAFT_c000053 3300000044 Bacteria 23841
6 ARCol0oldRDRAFT_c01233 3300000045 Bacteria 1821
7 ARCol0yngRDRAFT_1000025 3300000652 Bacteria 26845
8 JGI24752J21851_1002479 3300001976 Bacteria 2458
9 JGI24746J21847_1000313 3300001977 Bacteria 6996
10 JGI24740J21852_10029468 3300001979 Bacteria 1802
11 JGI24739J22299_10001271 3300001989 Bacteria 9474
12 JGI24739J22299_10006089 3300001989 Bacteria 4558
13 JGI24739J22299_10076202 3300001989 Bacteria 1036
14 JGI24737J22298_10005496 3300001990 Bacteria 4373
15 JGI24737J22298_10007426 3300001990 Bacteria 3701
16 JGI24743J22301_10008078 3300001991 Bacteria 1838
17 JGI24743J22301_10041313 3300001991 Bacteria 926
18 JGI24750J21931_1000691 3300002070 Bacteria 4880
19 JGI24745J21846_1000034 3300002073 Bacteria 9049
20 JGI24748J21848_1002810 3300002074 Bacteria 1980
21 JGI24748J21848_1013980 3300002074 Bacteria 951
22 JGI24738J21930_10001067 3300002075 Bacteria 7782
23 JGI24749J21850_1001313 3300002076 Bacteria 3522
24 JGI24749J21850_1019286 3300002076 Bacteria 964
25 JGI24744J21845_10026642 3300002077 Bacteria 1121
26 JGI24035J26624_1000089 3300002126 Bacteria 7679
27 JGI24035J26624_1000142 3300002126 Bacteria 6397
28 JGI24034J26672_10000419 3300002239 Bacteria 5507
29 JGI24034J26672_10000759 3300002239 Bacteria 4168
30 JGI24742J22300_10001913 3300002244 Bacteria 3311
31 JGI24751J29686_10007231 3300002459 Bacteria 2268
32 rootH1_10113446 3300003316 Bacteria 1183
33 JGI26129J50193_1002889 3300003349 Bacteria 1209
34 Ga0055537_1009925 3300003773 Bacteria 2053
35 Ga0055524_1018915 3300003775 Bacteria 2373
36 Ga0055536_1000296 3300003781 Bacteria 37428
37 Ga0065716_1001741 3300005277 Bacteria 3669
38 Ga0065704_10143315 3300005289 Bacteria 1492
39 Ga0065712_10145928 3300005290 Bacteria 1409
40 Ga0065712_10165564 3300005290 Bacteria 1275
41 Ga0065715_10001888 3300005293 Bacteria 5622
42 Ga0065715_10002477 3300005293 Bacteria 7875
43 Ga0065707_10005566 3300005295 Bacteria 3127
44 Ga0065707_10107090 3300005295 Bacteria 2569
45 Ga0070676_10085171 3300005328 Bacteria 1925
46 Ga0070683_100100106 3300005329 Bacteria 2728
47 Ga0070690_100020637 3300005330 Bacteria 4015
48 Ga0070690_100076604 3300005330 Bacteria 2182
49 Ga0070690_100188793 3300005330 Bacteria 1428
50 Ga0070690_100301780 3300005330 Bacteria 1149
51 Ga0070670_100006103 3300005331 Bacteria 10185
52 Ga0070670_100063491 3300005331 Bacteria 3170
53 Ga0070670_100301041 3300005331 Bacteria 1403
54 Ga0070677_10006617 3300005333 Bacteria 3852
55 Ga0068869_100000755 3300005334 Bacteria 18338
56 Ga0068869_100061324 3300005334 Bacteria 2758
57 Ga0070666_10023127 3300005335 Bacteria 4042
58 Ga0070680_100026487 3300005336 Bacteria 4638
59 Ga0070680_100045978 3300005336 Bacteria 3550
60 Ga0070680_100156350 3300005336 Bacteria 1916
61 Ga0070680_100174605 3300005336 Bacteria 1809
62 Ga0070682_100000693 3300005337 Bacteria 20306
63 Ga0070682_100045774 3300005337 Bacteria 2713
64 Ga0068868_100006260 3300005338 Bacteria 8418
65 Ga0070660_100192040 3300005339 Bacteria 1654
66 Ga0070689_100016123 3300005340 Bacteria 5464
67 Ga0070689_100053325 3300005340 Bacteria 3129
68 Ga0070689_100313380 3300005340 Bacteria 1308
69 Ga0070691_10002710 3300005341 Bacteria 7884
70 Ga0070691_10040483 3300005341 Bacteria 2202
71 Ga0070687_100001952 3300005343 Bacteria 7531
72 Ga0070687_100006904 3300005343 Bacteria 4689
73 Ga0070687_100109341 3300005343 Bacteria 1562
74 Ga0070661_100062742 3300005344 Bacteria 2728
75 Ga0070661_100207864 3300005344 Bacteria 1497
76 Ga0070661_100359199 3300005344 Bacteria 1144
77 Ga0070692_10008004 3300005345 Bacteria 4690
78 Ga0070692_10102861 3300005345 Bacteria 1568
79 Ga0070668_100002043 3300005347 Bacteria 14764
80 Ga0070669_100023313 3300005353 Bacteria 4432
81 Ga0070669_100023519 3300005353 Bacteria 4411
82 Ga0070675_100055612 3300005354 Bacteria 3258
83 Ga0070675_100231381 3300005354 Bacteria 1612
84 Ga0070671_100045038 3300005355 Bacteria 3667
85 Ga0070671_100202293 3300005355 Bacteria 1684
86 Ga0070674_100001294 3300005356 Bacteria 13164
87 Ga0070674_100389058 3300005356 Bacteria 1136
88 Ga0070673_100024964 3300005364 Bacteria 4391
89 Ga0070673_100044532 3300005364 Bacteria 3437
90 Ga0070673_100076697 3300005364 Bacteria 2700
91 Ga0070673_100327518 3300005364 Bacteria 1354
92 Ga0070688_100007596 3300005365 Bacteria 5852
93 Ga0070688_100013675 3300005365 Bacteria 4583
94 Ga0070688_100464201 3300005365 Bacteria 949
95 Ga0070659_100023740 3300005366 Bacteria 4695
96 Ga0070659_100075380 3300005366 Bacteria 2689
97 Ga0070659_100170238 3300005366 Bacteria 1784
98 Ga0070667_100068731 3300005367 Bacteria 3014
99 Ga0070703_10006226 3300005406 Bacteria 3340
100 Ga0070714_100071630 3300005435 Bacteria 2998
101 Ga0070713_100331543 3300005436 Bacteria 1408
102 Ga0070701_10111750 3300005438 Bacteria 1527
103 Ga0070701_10210353 3300005438 Bacteria 1154
104 Ga0070701_10268425 3300005438 Bacteria 1037
105 Ga0070711_100054156 3300005439 Bacteria 2768
106 Ga0070711_100213541 3300005439 Bacteria 1496
107 Ga0070705_100001981 3300005440 Bacteria 10455
108 Ga0070705_100003631 3300005440 Bacteria 7551
109 Ga0070705_100025279 3300005440 Bacteria 3218
110 Ga0070705_100146786 3300005440 Bacteria 1560
111 Ga0070705_100244685 3300005440 Bacteria 1255
112 Ga0070700_100031838 3300005441 Bacteria 3164
113 Ga0070700_100161591 3300005441 Bacteria 1542
114 Ga0070694_100011413 3300005444 Bacteria 5502
115 Ga0070694_100043378 3300005444 Bacteria 3007
116 Ga0070694_100056701 3300005444 Bacteria 2661
117 Ga0070694_100140371 3300005444 Bacteria 1754
118 Ga0070708_100021258 3300005445 Bacteria 5484
119 Ga0070708_100034355 3300005445 Bacteria 4411
120 Ga0070708_100080585 3300005445 Bacteria 2946
121 Ga0070708_100541924 3300005445 Bacteria 1098
122 Ga0070663_100017366 3300005455 Bacteria 4695
123 Ga0070663_100203182 3300005455 Bacteria 1547
124 Ga0070663_100460742 3300005455 Bacteria 1049
125 Ga0070678_100004700 3300005456 Bacteria 7775
126 Ga0070678_100267516 3300005456 Bacteria 1440
127 Ga0070662_100021397 3300005457 Bacteria 4415
128 Ga0070662_100050107 3300005457 Bacteria 3012
129 Ga0070681_10171228 3300005458 Bacteria 2093
130 Ga0070681_10662882 3300005458 Bacteria 958
131 Ga0068867_100003543 3300005459 Bacteria 10976
132 Ga0068867_100365205 3300005459 Bacteria 1208
133 Ga0070685_10011173 3300005466 Bacteria 4695
134 Ga0070685_10012732 3300005466 Bacteria 4425
135 Ga0070685_10121347 3300005466 Bacteria 1623
136 Ga0070706_100723219 3300005467 Bacteria 923
137 Ga0070706_100724527 3300005467 Bacteria 922
138 Ga0070707_100033640 3300005468 Bacteria 4887
139 Ga0070707_100108544 3300005468 Bacteria 2692
140 Ga0070707_100239655 3300005468 Bacteria 1765
141 Ga0070698_100005769 3300005471 Bacteria 13540
142 Ga0070698_100014490 3300005471 Bacteria 8325
143 Ga0070699_100018182 3300005518 Bacteria 6039
144 Ga0070699_100029175 3300005518 Bacteria 4757
145 Ga0070699_100312259 3300005518 Bacteria 1411
146 Ga0070699_100352582 3300005518 Bacteria 1326
147 Ga0070679_100039101 3300005530 Bacteria 4715
148 Ga0070679_100293724 3300005530 Bacteria 1576
149 Ga0070684_100071626 3300005535 Bacteria 3050
150 Ga0070684_100073460 3300005535 Bacteria 3013
151 Ga0070684_100543750 3300005535 Bacteria 1078
152 Ga0070697_100078379 3300005536 Bacteria 2719
153 Ga0070697_100102122 3300005536 Bacteria 2383
154 Ga0070697_100247992 3300005536 Bacteria 1522
155 Ga0070697_100701654 3300005536 Bacteria 893
156 Ga0068853_100002095 3300005539 Bacteria 14797
157 Ga0070672_100029753 3300005543 Bacteria 4098
158 Ga0070672_100075788 3300005543 Bacteria 2686
159 Ga0070672_100164101 3300005543 Bacteria 1845
160 Ga0070672_100335644 3300005543 Bacteria 1286
161 Ga0070686_100013389 3300005544 Bacteria 4695
162 Ga0070686_100026380 3300005544 Bacteria 3507
163 Ga0070686_100088535 3300005544 Bacteria 2066
164 Ga0070686_100349625 3300005544 Bacteria 1110
165 Ga0070695_100009721 3300005545 Bacteria 5729
166 Ga0070695_100040449 3300005545 Bacteria 2951
167 Ga0070695_100154109 3300005545 Bacteria 1606
168 Ga0070696_100001655 3300005546 Bacteria 14605
169 Ga0070696_100023729 3300005546 Bacteria 4170
170 Ga0070696_100074654 3300005546 Bacteria 2391
171 Ga0070696_100222829 3300005546 Bacteria 1416
172 Ga0070693_100003889 3300005547 Bacteria 7006
173 Ga0070693_100030086 3300005547 Bacteria 2966
174 Ga0070665_100367848 3300005548 Bacteria 1444
175 Ga0070704_100016233 3300005549 Bacteria 4702
176 Ga0070704_100047686 3300005549 Bacteria 2996
177 Ga0070704_100204957 3300005549 Bacteria 1594
178 Ga0070704_100482524 3300005549 Bacteria 1073
179 Ga0070704_100589626 3300005549 Bacteria 976
180 Ga0070704_101259384 3300005549 Bacteria 676
181 Ga0068855_100113736 3300005563 Bacteria 3104
182 Ga0068855_100324265 3300005563 Bacteria 1701
183 Ga0068855_100715308 3300005563 Bacteria 1070
184 Ga0070664_100085232 3300005564 Bacteria 2728
185 Ga0070664_100473386 3300005564 Bacteria 1152
186 Ga0068857_100006037 3300005577 Bacteria 10344
187 Ga0068857_100417472 3300005577 Bacteria 1250
188 Ga0068857_100813433 3300005577 Bacteria 893
189 Ga0068854_100006037 3300005578 Bacteria 7675
190 Ga0068854_100731027 3300005578 Bacteria 857
191 Ga0068856_100386693 3300005614 Bacteria 1419
192 Ga0070702_100000378 3300005615 Bacteria 15718
193 Ga0070702_100042751 3300005615 Bacteria 2549
194 Ga0068852_100031220 3300005616 Bacteria 4393
195 Ga0068859_100046039 3300005617 Bacteria 4382
196 Ga0068859_100120929 3300005617 Bacteria 2685
197 Ga0068859_100353461 3300005617 Bacteria 1564
198 Ga0068864_100000595 3300005618 Bacteria 30701
199 Ga0068864_100165590 3300005618 Bacteria 2012
200 Ga0068866_10000834 3300005718 Bacteria 13673
201 Ga0068866_10072780 3300005718 Bacteria 1822
202 Ga0068866_10270379 3300005718 Bacteria 1048
203 Ga0068861_100233415 3300005719 Bacteria 1561
204 Ga0068861_100277598 3300005719 Bacteria 1441
205 Ga0068861_100311382 3300005719 Bacteria 1368
206 Ga0068861_100428333 3300005719 Bacteria 1180
207 Ga0068870_10000216 3300005840 Bacteria 20877
208 Ga0068870_10015701 3300005840 Bacteria 3600
209 Ga0068863_100008669 3300005841 Bacteria 9938
210 Ga0068863_100012849 3300005841 Bacteria 8075
211 Ga0068863_100031970 3300005841 Bacteria 5019
212 Ga0068863_100106457 3300005841 Bacteria 2668
213 Ga0068858_100247493 3300005842 Bacteria 1693
214 Ga0068858_100286789 3300005842 Bacteria 1568
215 Ga0068858_100288277 3300005842 Bacteria 1564
216 Ga0068860_100000220 3300005843 Bacteria 89460
217 Ga0068860_100036168 3300005843 Bacteria 4733
218 Ga0068860_100092223 3300005843 Bacteria 2886
219 Ga0068860_100250986 3300005843 Bacteria 1723
220 Ga0068862_100066335 3300005844 Bacteria 3110
221 Ga0068862_100193511 3300005844 Bacteria 1831
222 Ga0068862_100273868 3300005844 Bacteria 1545
223 Ga0068862_100303899 3300005844 Bacteria 1468
224 Ga0068862_100412676 3300005844 Bacteria 1265
225 Ga0081455_10065534 3300005937 Bacteria 3038
226 Ga0081538_10030674 3300005981 Bacteria 3644
227 Ga0075365_10177533 3300006038 Bacteria 1488
228 Ga0075365_10599477 3300006038 Bacteria 779
229 Ga0075368_10009694 3300006042 Bacteria 3468
230 Ga0075368_10204930 3300006042 Bacteria 835
231 Ga0075363_100100732 3300006048 Bacteria 1598
232 Ga0070716_100533435 3300006173 Bacteria 872
233 Ga0070712_100141516 3300006175 Bacteria 1836
234 Ga0075367_10122911 3300006178 Bacteria 1600
235 Ga0075369_10241386 3300006186 Bacteria 838
236 Ga0075366_10271348 3300006195 Bacteria 1036
237 Ga0097621_100000600 3300006237 Bacteria 25393
238 Ga0097621_100372179 3300006237 Bacteria 1275
239 Ga0075370_10074572 3300006353 Bacteria 1944
240 Ga0068871_100000118 3300006358 Bacteria 49211
241 Ga0068871_100077944 3300006358 Bacteria 2739
242 Ga0075428_100061239 3300006844 Bacteria 4121
243 Ga0075428_100071069 3300006844 Bacteria 3804
244 Ga0075428_100101121 3300006844 Bacteria 3143
245 Ga0075430_100002159 3300006846 Bacteria 16284
246 Ga0075431_100018917 3300006847 Bacteria 7017
247 Ga0075431_100060059 3300006847 Bacteria 3924
248 Ga0075431_100118944 3300006847 Bacteria 2726
249 Ga0075431_100287972 3300006847 Bacteria 1662
250 Ga0075433_10000942 3300006852 Bacteria 20529
251 Ga0075433_10030828 3300006852 Bacteria 4579
252 Ga0075433_10035758 3300006852 Bacteria 4275
253 Ga0075433_10047049 3300006852 Bacteria 3752
254 Ga0075433_10394272 3300006852 Bacteria 1221
255 Ga0075434_100015284 3300006871 Bacteria 7357
256 Ga0075434_100018939 3300006871 Bacteria 6653
257 Ga0075434_100162986 3300006871 Bacteria 2249
258 Ga0075434_100352625 3300006871 Bacteria 1492
259 Ga0075434_100356991 3300006871 Bacteria 1483
260 Ga0075434_100602663 3300006871 Bacteria 1117
261 Ga0075429_100062025 3300006880 Bacteria 3257
262 Ga0075429_100147777 3300006880 Bacteria 2057
263 Ga0068865_100019301 3300006881 Bacteria 4411
264 Ga0068865_100057755 3300006881 Bacteria 2708
265 Ga0068865_100437687 3300006881 Bacteria 1078
266 Ga0075436_100005801 3300006914 Bacteria 8479
267 Ga0075436_100411709 3300006914 Bacteria 981
268 Ga0075436_100524819 3300006914 Bacteria 868
269 Ga0097620_100046036 3300006931 Bacteria 4382
270 Ga0097620_100120929 3300006931 Bacteria 2685
271 Ga0097620_100353469 3300006931 Bacteria 1564
272 Ga0075435_100012698 3300007076 Bacteria 6239
273 Ga0075435_100023920 3300007076 Bacteria 4733
274 Ga0075435_100254935 3300007076 Bacteria 1494
275 Ga0099794_10038488 3300007265 Bacteria 2266
276 Ga0099794_10045960 3300007265 Bacteria 2090
277 Ga0099794_10077416 3300007265 Bacteria 1636
278 Ga0105250_10022913 3300009092 Bacteria 2516
279 Ga0105240_10222694 3300009093 Bacteria 2197
280 Ga0111539_10041411 3300009094 Bacteria 5538
281 Ga0111539_10055701 3300009094 Bacteria 4701
282 Ga0111539_10065259 3300009094 Bacteria 4303
283 Ga0111539_10470861 3300009094 Bacteria 1463
284 Ga0111539_11288572 3300009094 Bacteria 848
285 Ga0105245_10020560 3300009098 Bacteria 5789
286 Ga0105245_10205279 3300009098 Bacteria 1894
287 Ga0105247_10129917 3300009101 Bacteria 1641
288 Ga0105247_10133613 3300009101 Bacteria 1619
289 Ga0105247_10196341 3300009101 Bacteria 1353
290 Ga0114129_10005890 3300009147 Bacteria 17359
291 Ga0114129_10017633 3300009147 Bacteria 10165
292 Ga0114129_10035427 3300009147 Bacteria 7051
293 Ga0114129_10113339 3300009147 Bacteria 3739
294 Ga0114129_10194135 3300009147 Bacteria 2755
295 Ga0114129_10198299 3300009147 Bacteria 2721
296 Ga0114129_10229113 3300009147 Bacteria 2503
297 Ga0114129_10957088 3300009147 Bacteria 1081
298 Ga0114129_10964978 3300009147 Bacteria 1076
299 Ga0114129_11025285 3300009147 Bacteria 1038
300 Ga0105243_10009714 3300009148 Bacteria 7327
301 Ga0105243_10013879 3300009148 Bacteria 6099
302 Ga0105243_10921354 3300009148 Bacteria 871
303 Ga0105241_10114705 3300009174 Bacteria 2161
304 Ga0105241_10163780 3300009174 Bacteria 1830
305 Ga0105241_10267822 3300009174 Bacteria 1454
306 Ga0105242_10026750 3300009176 Bacteria 4575
307 Ga0105242_10035447 3300009176 Bacteria 4001
308 Ga0105242_10144535 3300009176 Bacteria 2068
309 Ga0105248_10206586 3300009177 Bacteria 2213
310 Ga0105248_10266968 3300009177 Bacteria 1927
311 Ga0105248_11200461 3300009177 Bacteria 858
312 Ga0105237_10670542 3300009545 Bacteria 1044
313 Ga0105238_10637049 3300009551 Bacteria 1075
314 Ga0105249_10032777 3300009553 Bacteria 4701
315 Ga0105249_10048120 3300009553 Bacteria 3888
316 Ga0105249_10173804 3300009553 Bacteria 2091
317 Ga0105249_10210176 3300009553 Bacteria 1909
318 Ga0105239_10053808 3300010375 Bacteria 4414
319 Ga0105239_10269246 3300010375 Bacteria 1916
320 Ga0105246_10002558 3300011119 Bacteria 10995
321 Ga0105246_10040974 3300011119 Bacteria 3129
322 Ga0157325_1000571 3300012485 Bacteria 1508
323 Ga0157323_1000357 3300012495 Bacteria 2012
324 Ga0157347_1012454 3300012502 Bacteria 918
325 Ga0157339_1003317 3300012505 Bacteria 1154
326 Ga0157342_1002329 3300012507 Bacteria 1532
327 Ga0157326_1003916 3300012513 Bacteria 1565
328 Ga0157371_10023400 3300013102 Bacteria 4517
329 Ga0157371_10199288 3300013102 Bacteria 1435
330 Ga0157374_10021639 3300013296 Bacteria 5726
331 Ga0157374_10472525 3300013296 Bacteria 1256
332 Ga0157378_10095871 3300013297 Bacteria 2702
333 Ga0157378_10162599 3300013297 Bacteria 2089
334 Ga0163162_10112570 3300013306 Bacteria 2820
335 Ga0163162_10368202 3300013306 Bacteria 1570
336 Ga0163162_10468616 3300013306 Bacteria 1391
337 Ga0163162_10679264 3300013306 Bacteria 1152
338 Ga0157372_10195142 3300013307 Bacteria 2345
339 Ga0157375_10007178 3300013308 Bacteria 9737
340 Ga0157375_10169864 3300013308 Bacteria 2328
341 Ga0157375_10830601 3300013308 Bacteria 1071
342 Ga0163163_10009943 3300014325 Bacteria 8530
343 Ga0163163_10126652 3300014325 Bacteria 2592
344 Ga0163163_10178021 3300014325 Bacteria 2174
345 Ga0157380_10037923 3300014326 Bacteria 3739
346 Ga0157380_10131899 3300014326 Bacteria 2133
347 Ga0157377_10000628 3300014745 Bacteria 14665
348 Ga0157377_10047905 3300014745 Bacteria 2396
349 Ga0157377_10265366 3300014745 Bacteria 1119
350 Ga0157376_10063679 3300014969 Bacteria 3107
351 Ga0157376_10099574 3300014969 Bacteria 2537
352 Ga0157376_10535079 3300014969 Bacteria 1157
353 Ga0163161_10000415 3300017792 Bacteria 35797
354 Ga0163161_10050412 3300017792 Bacteria 3012
355 Ga0163161_10071821 3300017792 Bacteria 2533
356 Ga0209565_1001322 3300025263 Bacteria 11369
357 Ga0207666_1000185 3300025271 Bacteria 9376
358 Ga0207666_1000473 3300025271 Bacteria 5114
359 Ga0209673_1014116 3300025273 Bacteria 3109
360 Ga0207673_1000115 3300025290 Bacteria 7456
361 Ga0209675_1003392 3300025291 Bacteria 7591
362 Ga0209676_1000331 3300025292 Bacteria 90857
363 Ga0209025_1024137 3300025294 Bacteria 3151
364 Ga0209025_1042411 3300025294 Bacteria 1933
365 Ga0209025_1068664 3300025294 Bacteria 1272
366 Ga0209758_1019600 3300025297 Bacteria 3253
367 Ga0209256_1011073 3300025299 Bacteria 3664
368 Ga0209051_1086221 3300025303 Bacteria 888
369 Ga0207697_10006788 3300025315 Bacteria 5147
370 Ga0207697_10104371 3300025315 Bacteria 1210
371 Ga0207696_1040744 3300025711 Bacteria 1359
372 Ga0207653_10009209 3300025885 Bacteria 3078
373 Ga0207653_10088983 3300025885 Bacteria 1079
374 Ga0207682_10000350 3300025893 Bacteria 21096
375 Ga0207692_10008210 3300025898 Bacteria 4316
376 Ga0207642_10001478 3300025899 Bacteria 7266
377 Ga0207642_10226043 3300025899 Bacteria 1049
378 Ga0207710_10016235 3300025900 Bacteria 3149
379 Ga0207710_10175460 3300025900 Bacteria 1049
380 Ga0207688_10000001 3300025901 Bacteria 107505
381 Ga0207688_10002321 3300025901 Bacteria 10228
382 Ga0207688_10033396 3300025901 Bacteria 2846
383 Ga0207680_10063616 3300025903 Bacteria 2259
384 Ga0207680_10196784 3300025903 Bacteria 1371
385 Ga0207647_10034185 3300025904 Bacteria 3248
386 Ga0207647_10174606 3300025904 Bacteria 1250
387 Ga0207647_10174831 3300025904 Bacteria 1249
388 Ga0207699_10210533 3300025906 Bacteria 1322
389 Ga0207645_10000222 3300025907 Bacteria 47139
390 Ga0207645_10016093 3300025907 Bacteria 4952
391 Ga0207643_10000009 3300025908 Bacteria 160496
392 Ga0207643_10002622 3300025908 Bacteria 9735
393 Ga0207643_10295507 3300025908 Bacteria 1007
394 Ga0207705_10056065 3300025909 Bacteria 2841
395 Ga0207684_10026777 3300025910 Bacteria 4916
396 Ga0207654_10028853 3300025911 Bacteria 3029
397 Ga0207654_10154824 3300025911 Bacteria 1475
398 Ga0207707_10006091 3300025912 Bacteria 10552
399 Ga0207707_10283406 3300025912 Bacteria 1435
400 Ga0207707_10460715 3300025912 Bacteria 1087
401 Ga0207707_10506677 3300025912 Bacteria 1029
402 Ga0207671_10179689 3300025914 Bacteria 1646
403 Ga0207693_10023533 3300025915 Bacteria 4890
404 Ga0207693_10238778 3300025915 Bacteria 1427
405 Ga0207663_10090962 3300025916 Bacteria 2025
406 Ga0207663_10377456 3300025916 Bacteria 1079
407 Ga0207663_10514483 3300025916 Bacteria 931
408 Ga0207660_10000197 3300025917 Bacteria 38486
409 Ga0207660_10043689 3300025917 Bacteria 3149
410 Ga0207662_10000745 3300025918 Bacteria 14909
411 Ga0207662_10210387 3300025918 Bacteria 1262
412 Ga0207662_10224236 3300025918 Bacteria 1225
413 Ga0207662_10617807 3300025918 Bacteria 755
414 Ga0207657_10026404 3300025919 Bacteria 5339
415 Ga0207657_10301020 3300025919 Bacteria 1270
416 Ga0207657_10304387 3300025919 Bacteria 1262
417 Ga0207649_10000052 3300025920 Bacteria 106800
418 Ga0207649_10144224 3300025920 Bacteria 1633
419 Ga0207649_10387161 3300025920 Bacteria 1043
420 Ga0207652_10001438 3300025921 Bacteria 21098
421 Ga0207652_10127325 3300025921 Bacteria 2269
422 Ga0207652_10379596 3300025921 Bacteria 1276
423 Ga0207652_10434128 3300025921 Bacteria 1184
424 Ga0207646_10036746 3300025922 Bacteria 4421
425 Ga0207646_10063438 3300025922 Bacteria 3299
426 Ga0207646_10071164 3300025922 Bacteria 3106
427 Ga0207646_10087238 3300025922 Bacteria 2792
428 Ga0207646_10128156 3300025922 Bacteria 2283
429 Ga0207646_10202508 3300025922 Bacteria 1793
430 Ga0207681_10001135 3300025923 Bacteria 17191
431 Ga0207681_10026657 3300025923 Bacteria 3730
432 Ga0207681_10253810 3300025923 Bacteria 1374
433 Ga0207694_10225637 3300025924 Bacteria 1529
434 Ga0207694_10243400 3300025924 Bacteria 1470
435 Ga0207650_10002693 3300025925 Bacteria 12270
436 Ga0207659_10000132 3300025926 Bacteria 43798
437 Ga0207659_10029115 3300025926 Bacteria 3761
438 Ga0207659_10164796 3300025926 Bacteria 1743
439 Ga0207659_10326288 3300025926 Bacteria 1268
440 Ga0207659_10436942 3300025926 Bacteria 1100
441 Ga0207687_10000174 3300025927 Bacteria 42351
442 Ga0207687_10399804 3300025927 Bacteria 1130
443 Ga0207700_10086561 3300025928 Bacteria 2462
444 Ga0207700_10353072 3300025928 Bacteria 1281
445 Ga0207664_10006275 3300025929 Bacteria 8170
446 Ga0207664_10027963 3300025929 Bacteria 4281
447 Ga0207664_10432149 3300025929 Bacteria 1174
448 Ga0207644_10000212 3300025931 Bacteria 40175
449 Ga0207644_10033728 3300025931 Bacteria 3580
450 Ga0207644_10102661 3300025931 Bacteria 2151
451 Ga0207690_10001288 3300025932 Bacteria 15841
452 Ga0207690_10012426 3300025932 Bacteria 5092
453 Ga0207690_10029346 3300025932 Bacteria 3496
454 Ga0207706_10002966 3300025933 Bacteria 16372
455 Ga0207706_10112438 3300025933 Bacteria 2396
456 Ga0207706_10133993 3300025933 Bacteria 2179
457 Ga0207706_10229074 3300025933 Bacteria 1626
458 Ga0207706_10270755 3300025933 Bacteria 1482
459 Ga0207686_10021579 3300025934 Bacteria 3698
460 Ga0207686_10027772 3300025934 Bacteria 3317
461 Ga0207709_10000530 3300025935 Bacteria 33097
462 Ga0207709_10003379 3300025935 Bacteria 9533
463 Ga0207709_10111220 3300025935 Bacteria 1832
464 Ga0207670_10000523 3300025936 Bacteria 21171
465 Ga0207670_10028318 3300025936 Bacteria 3555
466 Ga0207670_10153078 3300025936 Bacteria 1713
467 Ga0207669_10000235 3300025937 Bacteria 25138
468 Ga0207669_10034696 3300025937 Bacteria 2861
469 Ga0207669_10171542 3300025937 Bacteria 1544
470 Ga0207704_10000198 3300025938 Bacteria 31182
471 Ga0207704_10000286 3300025938 Bacteria 23986
472 Ga0207704_10275115 3300025938 Bacteria 1277
473 Ga0207704_10637110 3300025938 Bacteria 876
474 Ga0207691_10023983 3300025940 Bacteria 5739
475 Ga0207691_10371561 3300025940 Bacteria 1221
476 Ga0207711_10006368 3300025941 Bacteria 9949
477 Ga0207689_10000031 3300025942 Bacteria 97131
478 Ga0207689_10059736 3300025942 Bacteria 3136
479 Ga0207661_10001228 3300025944 Bacteria 17172
480 Ga0207661_10160105 3300025944 Bacteria 1953
481 Ga0207661_10344571 3300025944 Bacteria 1343
482 Ga0207679_10000183 3300025945 Bacteria 51645
483 Ga0207679_10050493 3300025945 Bacteria 3040
484 Ga0207679_10056825 3300025945 Bacteria 2891
485 Ga0207667_10064461 3300025949 Bacteria 3825
486 Ga0207667_10112179 3300025949 Bacteria 2812
487 Ga0207667_10543606 3300025949 Bacteria 1175
488 Ga0207667_10551587 3300025949 Bacteria 1166
489 Ga0207667_10646078 3300025949 Bacteria 1064
490 Ga0207651_10000051 3300025960 Bacteria 54163
491 Ga0207651_10022102 3300025960 Bacteria 3881
492 Ga0207712_10001703 3300025961 Bacteria 14771
493 Ga0207712_10019046 3300025961 Bacteria 4478
494 Ga0207712_10029987 3300025961 Bacteria 3654
495 Ga0207712_10135389 3300025961 Bacteria 1883
496 Ga0207668_10000664 3300025972 Bacteria 21087
497 Ga0207668_10017224 3300025972 Bacteria 4523
498 Ga0207640_10000343 3300025981 Bacteria 30767
499 Ga0207640_10390665 3300025981 Bacteria 1130
500 Ga0207658_10000064 3300025986 Bacteria 117779
501 Ga0207658_10121938 3300025986 Bacteria 2080
502 Ga0207658_10289290 3300025986 Bacteria 1407
503 Ga0207677_10003168 3300026023 Bacteria 8684
504 Ga0207677_10458961 3300026023 Bacteria 1093
505 Ga0207703_10069812 3300026035 Bacteria 2899
506 Ga0207703_10107818 3300026035 Bacteria 2371
507 Ga0207703_10421025 3300026035 Bacteria 1243
508 Ga0207639_10016448 3300026041 Bacteria 5234
509 Ga0207678_10007497 3300026067 Bacteria 9645
510 Ga0207678_10103624 3300026067 Bacteria 2429
511 Ga0207678_10107739 3300026067 Bacteria 2377
512 Ga0207678_10369882 3300026067 Bacteria 1238
513 Ga0207678_10370474 3300026067 Bacteria 1237
514 Ga0207708_10003609 3300026075 Bacteria 11405
515 Ga0207708_10013133 3300026075 Bacteria 6181
516 Ga0207708_10014559 3300026075 Bacteria 5885
517 Ga0207708_10026728 3300026075 Bacteria 4369
518 Ga0207708_10385232 3300026075 Bacteria 1157
519 Ga0207702_10070805 3300026078 Bacteria 3000
520 Ga0207641_10001831 3300026088 Bacteria 20447
521 Ga0207641_10003244 3300026088 Bacteria 14521
522 Ga0207641_10050032 3300026088 Bacteria 3534
523 Ga0207641_10585882 3300026088 Bacteria 1091
524 Ga0207648_10005395 3300026089 Bacteria 12892
525 Ga0207648_10005612 3300026089 Bacteria 12612
526 Ga0207648_10396214 3300026089 Bacteria 1250
527 Ga0207676_10000124 3300026095 Bacteria 67747
528 Ga0207676_10114286 3300026095 Bacteria 2264
529 Ga0207674_10062426 3300026116 Bacteria 3763
530 Ga0207674_10129547 3300026116 Bacteria 2487
531 Ga0207674_10604650 3300026116 Bacteria 1059
532 Ga0207675_100007008 3300026118 Bacteria 10659
533 Ga0207675_100027633 3300026118 Bacteria 5284
534 Ga0207675_100875409 3300026118 Bacteria 914
535 Ga0207683_10000242 3300026121 Bacteria 48576
536 Ga0207683_10010766 3300026121 Bacteria 7798
537 Ga0207698_10023331 3300026142 Bacteria 4320
538 Ga0207698_10146240 3300026142 Bacteria 2044
539 Ga0207698_11602233 3300026142 Bacteria 666
540 Ga0209973_1000799 3300027252 Bacteria 2533
541 Ga0209969_1005910 3300027360 Bacteria 1722
542 Ga0209984_1011359 3300027424 Bacteria 1153
543 Ga0209995_1004561 3300027471 Bacteria 2216
544 Ga0209968_1001085 3300027526 Bacteria 4150
545 Ga0210002_1002000 3300027617 Bacteria 2932
546 Ga0209983_1006615 3300027665 Bacteria 2378
547 Ga0209588_1006440 3300027671 Bacteria 3412
548 Ga0209966_1000641 3300027695 Bacteria 7848
549 Ga0209998_10008003 3300027717 Bacteria 2193
550 Ga0209998_10021146 3300027717 Bacteria 1396
551 Ga0209974_10005603 3300027876 Bacteria 4408
552 Ga0209974_10075719 3300027876 Bacteria 1152
553 Ga0209974_10167800 3300027876 Bacteria 799
554 Ga0207428_10000037 3300027907 Bacteria 218857
555 Ga0207428_10030716 3300027907 Bacteria 4439
556 Ga0207428_10204997 3300027907 Bacteria 1483
557 Ga0207428_10469935 3300027907 Bacteria 916
558 Ga0268266_10074281 3300028379 Bacteria 2952
559 Ga0268265_10003320 3300028380 Bacteria 11642
560 Ga0268265_10086615 3300028380 Bacteria 2490
561 Ga0268265_10272456 3300028380 Bacteria 1510
562 Ga0268264_10000277 3300028381 Bacteria 86740
563 Ga0268264_10420674 3300028381 Bacteria 1288
564 Ga0268264_10588476 3300028381 Bacteria 1095
565 Ga0265762_1031130 3300030760 Bacteria 1014
566 Ga0265340_10036269 3300031247 Bacteria 2444
567 Ga0265339_10004825 3300031249 Bacteria 9117
568 Ga0265316_10195630 3300031344 Bacteria 1501
569 Ga0307408_100011260 3300031548 Bacteria 5907
570 Ga0307408_100018807 3300031548 Bacteria 4643
571 Ga0307408_100258848 3300031548 Bacteria 1439
572 Ga0265313_10006102 3300031595 Bacteria 8671
573 Ga0265313_10037034 3300031595 Bacteria 2444
574 Ga0316575_10014672 3300031665 Bacteria 2945
575 Ga0265314_10004990 3300031711 Bacteria 12094
576 Ga0307405_10003907 3300031731 Bacteria 6958
577 Ga0307413_10001530 3300031824 Bacteria 8875
578 Ga0307413_10139468 3300031824 Bacteria 1673
579 Ga0307410_10000285 3300031852 Bacteria 19565
580 Ga0307410_10004966 3300031852 Bacteria 6971
581 Ga0307410_10027373 3300031852 Bacteria 3603
582 Ga0307410_10382599 3300031852 Bacteria 1133
583 Ga0307406_10004231 3300031901 Bacteria 7805
584 Ga0307406_10009039 3300031901 Bacteria 5572
585 Ga0307406_10082357 3300031901 Bacteria 2142
586 Ga0307407_10001057 3300031903 Bacteria 9539
587 Ga0307407_10058334 3300031903 Bacteria 2243
588 Ga0307407_10066342 3300031903 Bacteria 2128
589 Ga0307407_10225944 3300031903 Bacteria 1268
590 Ga0307412_10067354 3300031911 Bacteria 2431
591 Ga0307412_10106910 3300031911 Bacteria 1990
592 Ga0307412_10427986 3300031911 Bacteria 1084
593 Ga0307412_10732829 3300031911 Bacteria 852
594 Ga0307409_100000501 3300031995 Bacteria 16895
595 Ga0307409_100063049 3300031995 Bacteria 2905
596 Ga0307409_100154690 3300031995 Bacteria 1996
597 Ga0307416_100003220 3300032002 Bacteria 9563
598 Ga0307416_100003682 3300032002 Bacteria 9079
599 Ga0307416_100010520 3300032002 Bacteria 6115
600 Ga0307416_100089622 3300032002 Bacteria 2634
601 Ga0307416_100277730 3300032002 Bacteria 1649
602 Ga0307416_100595964 3300032002 Bacteria 1184
603 Ga0307414_10212142 3300032004 Bacteria 1583
604 Ga0307414_10428524 3300032004 Bacteria 1155
605 Ga0307411_10001075 3300032005 Bacteria 10594
606 Ga0307411_10665778 3300032005 Bacteria 903
607 Ga0307415_100004272 3300032126 Bacteria 7389
608 Ga0307415_100023019 3300032126 Bacteria 3858
609 Ga0307415_100238454 3300032126 Bacteria 1469
610 Ga0307415_100366390 3300032126 Bacteria 1218
611 Ga0307415_100373659 3300032126 Bacteria 1208
612 Ga0316583_10016566 3300032133 Bacteria 2652
613 Ga0373930_0000191 3300034816 Bacteria 7407
614 Ga0373930_0006543 3300034816 Bacteria 1975
615 Ga0373948_0002325 3300034817 Bacteria 2793
616 Ga0373950_0015306 3300034818 Bacteria 1299
617 Ga0373958_0002981 3300034819 Bacteria 2419
618 Ga0373959_0001384 3300034820 Bacteria 3879
619 Ga0373959_0015275 3300034820 Bacteria 1408
620 Ga0373938_0000013 3300034957 Bacteria 24269
621 Ga0373926_0010463 3300035083 Bacteria 3111
622 Ga0373928_0000255 3300035084 Bacteria 10564
623 Ga0373929_0003185 3300035085 Bacteria 2974
624 Ga0373929_0034068 3300035085 Bacteria 1103
625 Ga0373929_0054210 3300035085 Bacteria 924
626 Ga0373940_0001317 3300035088 Bacteria 4421
627 Ga0373944_0021548 3300035089 Bacteria 1866
628 Ga0373944_0028895 3300035089 Bacteria 1653
629 Ga0373949_0013466 3300035090 Bacteria 1813
630 Ga0373951_0000552 3300035091 Bacteria 10501
631 Ga0373951_0020969 3300035091 Bacteria 1499
632 Ga0373952_0000182 3300035092 Bacteria 9790
633 Ga0373932_0000252 3300035112 Bacteria 16339
634 Ga0373932_0012999 3300035112 Bacteria 2061
635 Ga0373936_0164348 3300035113 Bacteria 968
636 Ga0373939_0007484 3300035114 Bacteria 2654
637 Ga0373939_0029054 3300035114 Bacteria 1578
638 Ga0373945_0004201 3300035116 Bacteria 4567
639 Ga0373960_0000068 3300035121 Bacteria 14664
640 Ga0373960_0002169 3300035121 Bacteria 4416
641 Ga0373960_0007261 3300035121 Bacteria 2622
642 Ga0373960_0040532 3300035121 Bacteria 1345
643 Ga0373943_0056727 3300035170 Bacteria 1944
644 Ga0373943_0236963 3300035170 Bacteria 1021
645 Ga0373946_0014684 3300035171 Bacteria 2956
646 Ga0373946_0025094 3300035171 Bacteria 2342
647 Ga0373942_0001815 3300035207 Bacteria 5399
648 Ga0373961_0003115 3300035241 Bacteria 4156
649 Ga0373961_0032972 3300035241 Bacteria 1456
650 Ga0373961_0065415 3300035241 Bacteria 1113
651 Ga0373962_0000112 3300035242 Bacteria 16939
652 Ga0373962_0043496 3300035242 Bacteria 1273
653 Ga0316574_0022880 3300035398 Bacteria 3726
654 Ga0316574_0076966 3300035398 Bacteria 2114
655 Ga0373924_0093750 3300035410 Bacteria 1286
656 Ga0373931_0000305 3300035691 Bacteria 20657
657 Ga0373931_0001634 3300035691 Bacteria 9691
658 Ga0373931_0010148 3300035691 Bacteria 4521
659 Ga0373931_0212100 3300035691 Bacteria 1162
660 Ga0373935_0042487 3300035692 Bacteria 2859
661 Ga0373927_0001782 3300035695 Bacteria 16060
662 Ga0373927_0218680 3300035695 Bacteria 1251
663 Ga0373927_0262594 3300035695 Bacteria 1135
664 Ga0373947_0017628 3300035725 Bacteria 4108
665 Ga0373947_0046144 3300035725 Bacteria 2608
666 Ga0316582_0067485 3300036647 Bacteria 2308
667 Ga0316584_0059029 3300036712 Bacteria 2873
668 Ga0373925_0000994 3300037068 Bacteria 25755
669 Ga0373925_0002218 3300037068 Bacteria 15763
670 Ga0373925_0048113 3300037068 Bacteria 3176
671 Ga0316581_0028179 3300037588 Bacteria 1682
672 Ga0242420_022030 3300038996 Bacteria 1144
673 Ga0436360_0355744 3300039438 Bacteria 1182
674 Ga0436362_0986484 3300039453 Bacteria 591
675 Ga0439441_032657 3300042001 Bacteria 1015
676 Ga0439456_033005 3300042013 Bacteria 1113
677 Ga0439460_0108195 3300042461 Bacteria 899
678 Ga0451577_0053816 3300042876 Bacteria 3593
679 Ga0451577_0112665 3300042876 Bacteria 2435
680 Ga0451577_0112731 3300042876 Bacteria 2434
681 Ga0451577_0424995 3300042876 Bacteria 1207
682 Ga0453683_0014110 3300044673 Bacteria 5194
683 Ga0453683_0027180 3300044673 Bacteria 3632
684 Ga0453683_0036857 3300044673 Bacteria 3077
685 Ga0466963_0000055 3300044694 Bacteria 37968
686 Ga0453684_0000295 3300044712 Bacteria 211570
687 Ga0453684_0157702 3300044712 Bacteria 2689
688 Ga0466957_0029951 3300044842 Bacteria 3248
689 Ga0451576_0000359 3300045051 Bacteria 109461
690 Ga0451576_0081297 3300045051 Bacteria 3369
691 Ga0451576_0154638 3300045051 Bacteria 2392
692 Ga0451576_0205880 3300045051 Bacteria 2054
693 Ga0466958_0013846 3300045836 Bacteria 4599
694 Ga0466967_0002348 3300045976 Bacteria 11708
695 Ga0466967_0662699 3300045976 Bacteria 1032
696 Ga0495617_010759 3300046452 Bacteria 3132
697 Ga0495603_0013329 3300046455 Bacteria 4972
698 Ga0495603_0024811 3300046455 Bacteria 3627
699 Ga0495603_0481232 3300046455 Bacteria 711
700 Ga0495641_0003735 3300046461 Bacteria 11202
701 Ga0495641_0085416 3300046461 Bacteria 1412
702 Ga0495653_0026259 3300046463 Bacteria 4673
703 Ga0495580_0000020 3300046472 Bacteria 91314
704 Ga0495580_0009973 3300046472 Bacteria 7427
705 Ga0495580_0113006 3300046472 Bacteria 1886
706 Ga0495582_0001703 3300046473 Bacteria 12403
707 Ga0495582_0010538 3300046473 Bacteria 5085
708 Ga0495582_0365046 3300046473 Bacteria 832
709 Ga0495639_0000828 3300046475 Bacteria 14100
710 Ga0495639_0024994 3300046475 Bacteria 2632
711 Ga0495662_0002737 3300046476 Bacteria 8908
712 Ga0495662_0025652 3300046476 Bacteria 2846
713 Ga0495662_0047488 3300046476 Bacteria 2072
714 Ga0495664_0018869 3300046477 Bacteria 3958
715 Ga0495584_0013349 3300046491 Bacteria 4194
716 Ga0495584_0035185 3300046491 Bacteria 2532
717 Ga0495584_0168878 3300046491 Bacteria 1112
718 Ga0495585_0001730 3300046492 Bacteria 16612
719 Ga0495594_0030366 3300046499 Bacteria 2923
720 Ga0495594_0064727 3300046499 Bacteria 2027
721 Ga0495607_0005316 3300046501 Bacteria 9259
722 Ga0495608_0076168 3300046511 Bacteria 2186
723 Ga0495616_0106023 3300046513 Bacteria 1311
724 Ga0495616_0145054 3300046513 Bacteria 1078
725 Ga0495618_0010074 3300046514 Bacteria 5714
726 Ga0495628_0037042 3300046516 Bacteria 3911
727 Ga0495630_0018065 3300046517 Bacteria 5175
728 Ga0495644_0002586 3300046523 Bacteria 7194
729 Ga0495644_0069438 3300046523 Bacteria 1324
730 Ga0495644_0081446 3300046523 Bacteria 1220
731 Ga0495663_0017834 3300046525 Bacteria 2018
732 Ga0495666_0000309 3300046526 Bacteria 21203
733 Ga0495642_0029511 3300046528 Bacteria 2190
734 Ga0495652_0005095 3300046529 Bacteria 12426
735 Ga0495665_0003045 3300046531 Bacteria 9054
736 Ga0495640_0016017 3300046533 Bacteria 5621
737 Ga0495640_0060453 3300046533 Bacteria 2577
738 Ga0495586_0009993 3300046535 Bacteria 5056
739 Ga0495587_0218275 3300046536 Bacteria 1076
740 Ga0495598_0000729 3300046537 Bacteria 6257
741 Ga0495598_0012975 3300046537 Bacteria 2056
742 Ga0495609_0155331 3300046538 Bacteria 972
743 Ga0495609_0188540 3300046538 Bacteria 866
744 Ga0495621_0092546 3300046539 Bacteria 1141
745 Ga0495597_0093982 3300046542 Bacteria 1270
746 Ga0495645_0039870 3300046543 Bacteria 3425
747 Ga0495633_0000941 3300046558 Bacteria 24412
748 Ga0495656_0000589 3300046615 Bacteria 11760
749 Ga0495656_0057048 3300046615 Bacteria 1689
750 Ga0495656_0375727 3300046615 Bacteria 740
751 Ga0495634_0004455 3300046642 Bacteria 10990
752 Ga0495611_0001648 3300046648 Bacteria 10831
753 Ga0495611_0039725 3300046648 Bacteria 2096
754 Ga0495635_0105560 3300046663 Bacteria 1924
755 Ga0495659_0003901 3300046664 Bacteria 4728
756 Ga0495659_0019311 3300046664 Bacteria 2280
757 Ga0495659_0116432 3300046664 Bacteria 1048
758 Ga0495588_0018801 3300046674 Bacteria 3375
759 Ga0495588_0109580 3300046674 Bacteria 1454
760 Ga0495657_0026518 3300046675 Bacteria 4103
761 Ga0495646_0016747 3300046680 Bacteria 4654
762 Ga0495646_0304320 3300046680 Bacteria 843
763 Ga0495647_0004236 3300046681 Bacteria 4644
764 Ga0495658_0000498 3300046683 Bacteria 21575
765 Ga0495658_0273776 3300046683 Bacteria 1064
766 Ga0495669_0015480 3300046684 Bacteria 3267
767 Ga0495669_0019842 3300046684 Bacteria 2904
768 Ga0495613_0213996 3300046689 Bacteria 1354
769 Ga0495624_0009825 3300046690 Bacteria 6618
770 Ga0495670_0007523 3300046691 Bacteria 5355
771 Ga0495670_0009268 3300046691 Bacteria 4842
772 Ga0495589_0044804 3300046794 Bacteria 2199
773 Ga0495589_0083171 3300046794 Bacteria 1556
774 Ga0495581_0017975 3300047315 Bacteria 4108
775 Ga0495581_0563997 3300047315 Bacteria 660
776 Ga0495674_0007325 3300047319 Bacteria 10549
777 Ga0495674_0781823 3300047319 Bacteria 744
778 Ga0495672_0171419 3300047320 Bacteria 1107
779 Ga0495676_0036425 3300047321 Bacteria 4108
780 Ga0495680_0005229 3300047322 Bacteria 12252
781 Ga0495680_0155051 3300047322 Bacteria 1667
782 Ga0495677_0058593 3300047445 Bacteria 1425
783 Ga0495679_007990 3300047446 Bacteria 4349
784 Ga0495684_0108121 3300047471 Bacteria 2100
785 Ga0495684_0147363 3300047471 Bacteria 1762
786 Ga0495593_0001256 3300047673 Bacteria 14872
787 Ga0496100_0000345 3300048903 Bacteria 22686
788 Ga0496100_0000735 3300048903 Bacteria 15630
789 Ga0496100_0373692 3300048903 Bacteria 1081
790 Ga0496101_0000969 3300048904 Bacteria 16936
791 Ga0496101_0001765 3300048904 Bacteria 12976
792 Ga0496102_0004376 3300048905 Bacteria 11928
793 Ga0496102_0006229 3300048905 Bacteria 10171
794 Ga0496102_0088835 3300048905 Bacteria 2858
795 Ga0496102_0089827 3300048905 Bacteria 2842
796 Ga0496102_0093207 3300048905 Bacteria 2790
797 Ga0496103_0000427 3300048906 Bacteria 36647
798 Ga0496103_0001732 3300048906 Bacteria 14251
799 Ga0496104_0044781 3300048907 Bacteria 4158
800 Ga0496104_0081866 3300048907 Bacteria 3079
801 Ga0496104_0130156 3300048907 Bacteria 2417
802 Ga0496104_0561999 3300048907 Bacteria 1051
803 Ga0496105_0079353 3300048908 Bacteria 2710
804 Ga0496105_0161832 3300048908 Bacteria 1837
805 Ga0496106_0018993 3300048909 Bacteria 5094
806 Ga0496106_0075150 3300048909 Bacteria 2587
807 Ga0496106_0109289 3300048909 Bacteria 2151
808 Ga0496106_0215774 3300048909 Bacteria 1529
809 Ga0496107_0005598 3300048910 Bacteria 8604
810 Ga0496107_0011572 3300048910 Bacteria 6148
811 Ga0496107_0340545 3300048910 Bacteria 1116
812 Ga0496108_0012348 3300048911 Bacteria 6950
813 Ga0496108_0031377 3300048911 Bacteria 4409
814 Ga0496108_0058890 3300048911 Bacteria 3230
815 Ga0496108_0076691 3300048911 Bacteria 2825
816 Ga0496108_0254694 3300048911 Bacteria 1527
817 Ga0496108_0380158 3300048911 Bacteria 1233
818 Ga0496109_0005949 3300048912 Bacteria 10237
819 Ga0496109_0181400 3300048912 Bacteria 1977
820 Ga0496109_0414621 3300048912 Bacteria 1272
821 Ga0496109_0474967 3300048912 Bacteria 1181
822 Ga0496110_0100320 3300048913 Bacteria 2595
823 Ga0496110_0149875 3300048913 Bacteria 2111
824 Ga0496110_0322776 3300048913 Bacteria 1406
825 Ga0496110_0400144 3300048913 Bacteria 1252
826 Ga0496110_1173831 3300048913 Bacteria 676
827 Ga0496111_0052074 3300048914 Bacteria 2955
828 Ga0496111_0086316 3300048914 Bacteria 2296
829 Ga0496111_0144950 3300048914 Bacteria 1760
830 Ga0496111_0352853 3300048914 Bacteria 1089
831 Ga0496112_0053839 3300048915 Bacteria 3953
832 Ga0496112_0095542 3300048915 Bacteria 2942
833 Ga0496112_0150977 3300048915 Bacteria 2290
834 Ga0496112_0410025 3300048915 Bacteria 1294
835 Ga0496113_0063896 3300048916 Bacteria 2782
836 Ga0496113_0105218 3300048916 Bacteria 2191
837 Ga0496113_0356457 3300048916 Bacteria 1173
838 Ga0496114_0001861 3300048917 Bacteria 15984
839 Ga0496114_0002647 3300048917 Bacteria 13668
840 Ga0496114_0026853 3300048917 Bacteria 4717
841 Ga0496114_0110408 3300048917 Bacteria 2356
842 Ga0496114_0313744 3300048917 Bacteria 1385
843 Ga0496115_0001915 3300048918 Bacteria 14859
844 Ga0496115_0007035 3300048918 Bacteria 8266
845 Ga0496115_0233730 3300048918 Bacteria 1515
846 Ga0501298_011404 3300049521 Bacteria 1543
847 Ga0501031_0160042 3300049568 Bacteria 1472
848 Ga0501032_0107281 3300049569 Bacteria 1850
849 Ga0501033_0124456 3300049570 Bacteria 1870
850 Ga0501036_0044877 3300049572 Bacteria 3745
851 Ga0501036_0258463 3300049572 Bacteria 1459
852 Ga0501037_0072122 3300049573 Bacteria 2512
853 Ga0501037_0300062 3300049573 Bacteria 1116
854 Ga0501038_0112160 3300049574 Bacteria 2258
855 Ga0501038_0275060 3300049574 Bacteria 1327
856 Ga0501039_0199763 3300049575 Bacteria 1572
857 Ga0501039_0401144 3300049575 Bacteria 1077
858 Ga0501040_0047193 3300049576 Bacteria 2941
859 Ga0501040_0055045 3300049576 Bacteria 2728
860 Ga0501040_0080718 3300049576 Bacteria 2253
861 Ga0501040_0136293 3300049576 Bacteria 1728
862 Ga0501040_0179547 3300049576 Bacteria 1500
863 Ga0501040_0249342 3300049576 Bacteria 1266
864 Ga0501040_0509296 3300049576 Bacteria 868
865 Ga0501041_0047899 3300049577 Bacteria 2603
866 Ga0501041_0168203 3300049577 Bacteria 1371
867 Ga0501041_0185306 3300049577 Bacteria 1303
868 Ga0501042_0009210 3300049578 Bacteria 6570
869 Ga0501042_0109415 3300049578 Bacteria 1990
870 Ga0501042_0128552 3300049578 Bacteria 1825
871 Ga0501048_0007522 3300049582 Bacteria 8255
872 Ga0501048_0254908 3300049582 Bacteria 1246
873 Ga0501067_0142852 3300049583 Bacteria 1333
874 Ga0501067_0393106 3300049583 Bacteria 773
875 Ga0501068_0035130 3300049584 Bacteria 2991
876 Ga0501068_0129934 3300049584 Bacteria 1575
877 Ga0501069_0085016 3300049585 Bacteria 1785
878 Ga0501069_0374917 3300049585 Bacteria 840
879 Ga0501070_0108402 3300049586 Bacteria 2295
880 Ga0501071_0030822 3300049587 Bacteria 3795
881 Ga0501071_0045651 3300049587 Bacteria 3145
882 Ga0501071_0084366 3300049587 Bacteria 2328
883 Ga0501072_0093892 3300049588 Bacteria 2383
884 Ga0501072_0135380 3300049588 Bacteria 1964
885 Ga0501072_0179850 3300049588 Bacteria 1687
886 Ga0501073_0318813 3300049589 Bacteria 1073
887 Ga0501075_0006835 3300049591 Bacteria 7875
888 Ga0501075_0043196 3300049591 Bacteria 3380
889 Ga0501075_0170493 3300049591 Bacteria 1661
890 Ga0501075_0228188 3300049591 Bacteria 1420
891 Ga0501076_0028793 3300049592 Bacteria 4316
892 Ga0501076_0047582 3300049592 Bacteria 3391
893 Ga0501076_0106110 3300049592 Bacteria 2267
894 Ga0501076_0257319 3300049592 Bacteria 1429
895 Ga0501076_0263785 3300049592 Bacteria 1410
896 Ga0501076_0351716 3300049592 Bacteria 1210
897 Ga0501077_0008210 3300049593 Bacteria 6455
898 Ga0501077_0165265 3300049593 Bacteria 1406
899 Ga0501202_060777 3300049652 Bacteria 854
900 Ga0501217_005170 3300049661 Bacteria 2717
901 Ga0501233_004036 3300049668 Bacteria 2668
902 Ga0501247_001365 3300049677 Bacteria 2328
903 Ga0501219_002023 3300049703 Bacteria 1661
904 Ga0501225_0027274 3300049705 Bacteria 1571
905 Ga0501079_0025157 3300049741 Bacteria 4566
906 Ga0501079_0035117 3300049741 Bacteria 3858
907 Ga0501079_0110880 3300049741 Bacteria 2132
908 Ga0501080_0015571 3300049742 Bacteria 7013
909 Ga0501080_0017337 3300049742 Bacteria 6658
910 Ga0501080_0051733 3300049742 Bacteria 3823
911 Ga0501080_0177120 3300049742 Bacteria 1964
912 Ga0501081_0012727 3300049743 Bacteria 5534
913 Ga0501081_0173575 3300049743 Bacteria 1557
914 Ga0501081_0405298 3300049743 Bacteria 1010
915 Ga0501081_0434115 3300049743 Bacteria 974
916 Ga0501083_0157277 3300049744 Bacteria 1487
917 Ga0501083_0262638 3300049744 Bacteria 1123
918 Ga0501263_000777 3300049760 Bacteria 2683
919 Ga0501268_000281 3300049765 Bacteria 5208
920 Ga0501270_012548 3300049767 Bacteria 1158
921 Ga0501273_010847 3300049770 Bacteria 1126
922 Ga0501035_0065562 3300049822 Bacteria 3225
923 Ga0501035_0292692 3300049822 Bacteria 1374
924 Ga0501204_003963 3300049850 Bacteria 1578
925 Ga0501212_005413 3300049851 Bacteria 1684
926 nmdc:mga0k408_67480_c1 3300050493 Bacteria 2084
927 nmdc:mga05p37_101915_c1 3300050507 Bacteria 3535
928 nmdc:mga05p37_122064_c2 3300050507 Bacteria 1189
929 nmdc:mga05p37_158178_c1 3300050507 Bacteria 2768
930 nmdc:mga05p37_1773_c1 3300050507 Bacteria 25196
931 nmdc:mga05p37_210959_c1 3300050507 Bacteria 2348
932 nmdc:mga05p37_589855_c1 3300050507 Bacteria 1257
933 nmdc:mga09592_132575_c1 3300050508 Bacteria 2145
934 nmdc:mga09592_17095_c1 3300050508 Bacteria 5938
935 nmdc:mga09592_26571_c1 3300050508 Bacteria 4798
936 nmdc:mga09592_416483_c1 3300050508 Bacteria 1161
937 nmdc:mga09592_73465_c1 3300050508 Bacteria 2906
938 nmdc:mga0qj67_403481_c1 3300050509 Bacteria 1103
939 nmdc:mga0qj67_414935_c1 3300050509 Bacteria 1086
940 nmdc:mga0qj67_66080_c1 3300050509 Bacteria 2880
941 nmdc:mga06r32_150921_c1 3300050510 Bacteria 2302
942 nmdc:mga06r32_197607_c1 3300050510 Bacteria 1998
943 nmdc:mga06r32_215006_c1 3300050510 Bacteria 1910
944 nmdc:mga06r32_253763_c1 3300050510 Bacteria 1746
945 nmdc:mga06r32_286452_c1 3300050510 Bacteria 1634
946 nmdc:mga06r32_52016_c1 3300050510 Bacteria 3922
947 nmdc:mga06r32_8063_c1 3300050510 Bacteria 9478
948 nmdc:mga06r32_93321_c1 3300050510 Bacteria 2944
949 nmdc:mga08y16_16604_c1 3300050511 Bacteria 7743
950 nmdc:mga08y16_3117_c1 3300050511 Bacteria 17166
951 nmdc:mga08y16_333_c1 3300050511 Bacteria 42807
952 nmdc:mga0n895_1174_c1 3300050512 Bacteria 19193
953 nmdc:mga0n895_13026_c1 3300050512 Bacteria 7481
954 nmdc:mga0n895_17413_c1 3300050512 Bacteria 6621
955 nmdc:mga0n895_352386_c1 3300050512 Bacteria 1491
956 nmdc:mga0n895_44735_c1 3300050512 Bacteria 4317
957 nmdc:mga0n895_500058_c1 3300050512 Bacteria 1225
958 nmdc:mga0n895_77155_c1 3300050512 Bacteria 3314
959 nmdc:mga0rr50_202666_c1 3300050513 Bacteria 1631
960 nmdc:mga0rr50_232744_c1 3300050513 Bacteria 1525
961 nmdc:mga0rr50_4985_c1 3300050513 Bacteria 7863
962 nmdc:mga0rr50_61694_c1 3300050513 Bacteria 2825
963 nmdc:mga08x19_204996_c1 3300050514 Bacteria 1352
964 nmdc:mga08x19_287479_c1 3300050514 Bacteria 1140
965 nmdc:mga08x19_798869_c1 3300050514 Bacteria 670
966 nmdc:mga0a205_11705_c1 3300050515 Bacteria 8091
967 nmdc:mga0a205_2218_c1 3300050515 Bacteria 17084
968 nmdc:mga0a205_54866_c1 3300050515 Bacteria 3848
969 nmdc:mga0a205_6917_c1 3300050515 Bacteria 10255
970 Ga0495612_0039191 3300053078 Bacteria 1926
971 Ga0495612_0088504 3300053078 Bacteria 1308
972 Ga0495655_0039155 3300053083 Bacteria 1200
973 Ga0495595_0035073 3300053084 Bacteria 2272
974 Ga0495619_0007707 3300053085 Bacteria 6815
975 Ga0495619_0713408 3300053085 Bacteria 681
976 Ga0500643_001596 3300053087 Bacteria 12817
977 Ga0500644_0001281 3300053088 Bacteria 6847
978 Ga0500651_0066405 3300053093 Bacteria 2246
979 Ga0500566_0070333 3300053094 Bacteria 1965
980 Ga0500641_0007663 3300053096 Bacteria 3847
981 Ga0500650_0088338 3300053098 Bacteria 1451
982 Ga0500595_000016 3300053119 Bacteria 211397
983 Ga0500597_090681 3300053120 Bacteria 1328
984 Ga0500652_001803 3300053131 Bacteria 6489
985 Ga0500616_0000006 3300053153 Bacteria 944738
986 Ga0500645_001772 3300053730 Bacteria 10420
987 Ga0501084_0004051 3300054114 Bacteria 11934
988 Ga0501084_0021009 3300054114 Bacteria 5445
989 Ga0501084_0062068 3300054114 Bacteria 3129
990 Ga0501084_0375339 3300054114 Bacteria 1202
991 Ga0590071_003007 3300059421 Bacteria 4185
992 Ga0590071_003425 3300059421 Bacteria 3897
993 Ga0590075_021012 3300059424 Bacteria 1626
994 Ga0590075_039106 3300059424 Bacteria 1210
995 Ga0587066_061401 3300059490 Bacteria 768
996 Ga0587085_006926 3300059506 Bacteria 1396
997 Ga0587086_002901 3300059507 Bacteria 1678
998 Ga0587092_013766 3300059512 Bacteria 1161
999 Ga0587101_025717 3300059623 Bacteria 884
1000 Ga0587109_017716 3300059624 Bacteria 1236
1001 Ga0587062_002920 3300059639 Bacteria 1679
1002 Ga0587069_029564 3300059642 Bacteria 877
1003 Ga0501082_0047119 3300060353 Bacteria 3715
1004 Ga0501082_0120716 3300060353 Bacteria 2272
1005 Ga0530510_0006450 3300061734 Bacteria 8169

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035085 Ga0373929_0054210 Ga0373929_0054210_344_907 163
2 3300039453 Ga0436362_0986484 Ga0436362_0986484_10_501 163
3 3300049822 Ga0501035_0065562 Ga0501035_0065562_14_505 163
4 3300035085 Ga0373929_0034068 Ga0373929_0034068_547_1077 176
5 iso_pu_bacteria 2513237150 2513956738 176
6 iso_pu_bacteria 2513237165 2514044433 176
7 iso_pu_bacteria 2596583598 2597031647 176
8 iso_pu_bacteria 2599185178 2599448112 176
9 iso_pu_bacteria 2885266251 2885269529 176
10 iso_pu_bacteria 2900577576 2900580348 176
11 iso_pu_bacteria 2901300506 2901304173 176
12 iso_pu_bacteria 2928058823 2928063728 176
13 iso_pu_bacteria 644736347 644749248 176
14 3300044673 Ga0453683_0014110 Ga0453683_0014110_1596_2135 179
15 3300044712 Ga0453684_0000295 Ga0453684_0000295_106840_107379 179
16 3300045051 Ga0451576_0000359 Ga0451576_0000359_106859_107398 179
17 3300003773 Ga0055537_1009925 Ga0055537_10099252 180
18 3300003775 Ga0055524_1018915 Ga0055524_10189155 180
19 3300003781 Ga0055536_1000296 Ga0055536_100029620 180
20 3300025263 Ga0209565_1001322 Ga0209565_100132215 180
21 3300025273 Ga0209673_1014116 Ga0209673_10141166 180
22 3300025291 Ga0209675_1003392 Ga0209675_10033929 180
23 3300025292 Ga0209676_1000331 Ga0209676_100033120 180
24 3300025294 Ga0209025_1024137 Ga0209025_10241377 180
25 3300025294 Ga0209025_1042411 Ga0209025_10424111 180
26 3300025294 Ga0209025_1068664 Ga0209025_10686642 180
27 3300025297 Ga0209758_1019600 Ga0209758_10196004 180
28 3300025299 Ga0209256_1011073 Ga0209256_10110735 180
29 3300025303 Ga0209051_1086221 Ga0209051_10862212 180
30 3300053088 Ga0500644_0001281 Ga0500644_0001281_3280_3930 180
31 3300053153 Ga0500616_0000006 Ga0500616_0000006_569629_570279 180
32 3300059506 Ga0587085_006926 Ga0587085_006926_224_766 180
33 3300059507 Ga0587086_002901 Ga0587086_002901_914_1456 180
34 3300059512 Ga0587092_013766 Ga0587092_013766_516_1058 180
35 3300059623 Ga0587101_025717 Ga0587101_025717_224_766 180
36 3300059624 Ga0587109_017716 Ga0587109_017716_404_946 180
37 3300059639 Ga0587062_002920 Ga0587062_002920_915_1457 180
38 3300059642 Ga0587069_029564 Ga0587069_029564_222_764 180
39 3300042876 Ga0451577_0112665 Ga0451577_0112665_389_1108 181
40 3300031665 Ga0316575_10014672 Ga0316575_100146725 183
41 3300032133 Ga0316583_10016566 Ga0316583_100165662 183
42 3300035398 Ga0316574_0022880 Ga0316574_0022880_1543_2172 183
43 3300036647 Ga0316582_0067485 Ga0316582_0067485_372_1001 183
44 3300036712 Ga0316584_0059029 Ga0316584_0059029_1726_2355 183
45 3300037588 Ga0316581_0028179 Ga0316581_0028179_738_1367 183
46 3300005343 Ga0070687_100001952 Ga0070687_1000019522 184
47 3300005343 Ga0070687_100109341 Ga0070687_1001093413 184
48 3300005364 Ga0070673_100044532 Ga0070673_1000445327 184
49 3300005365 Ga0070688_100464201 Ga0070688_1004642012 184
50 3300005366 Ga0070659_100170238 Ga0070659_1001702381 184
51 3300005444 Ga0070694_100140371 Ga0070694_1001403712 184
52 3300005719 Ga0068861_100428333 Ga0068861_1004283332 184
53 3300005841 Ga0068863_100008669 Ga0068863_10000866913 184
54 3300005843 Ga0068860_100000220 Ga0068860_10000022026 184
55 3300007076 Ga0075435_100254935 Ga0075435_1002549353 184
56 3300009174 Ga0105241_10163780 Ga0105241_101637802 184
57 3300009174 Ga0105241_10267822 Ga0105241_102678222 184
58 3300009551 Ga0105238_10637049 Ga0105238_106370492 184
59 3300013307 Ga0157372_10195142 Ga0157372_101951422 184
60 3300017792 Ga0163161_10050412 Ga0163161_100504124 184
61 3300025903 Ga0207680_10196784 Ga0207680_101967842 184
62 3300025918 Ga0207662_10000745 Ga0207662_100007452 184
63 3300025986 Ga0207658_10000064 Ga0207658_1000006449 184
64 3300026088 Ga0207641_10003244 Ga0207641_1000324410 184
65 3300026118 Ga0207675_100007008 Ga0207675_1000070084 184
66 3300028381 Ga0268264_10000277 Ga0268264_1000027793 184
67 3300049573 Ga0501037_0300062 Ga0501037_0300062_292_867 184
68 3300050513 nmdc:mga0rr50_61694_c1 nmdc:mga0rr50_61694_c1_677_1474 184
69 3300009098 Ga0105245_10020560 Ga0105245_100205606 185
70 3300013102 Ga0157371_10199288 Ga0157371_101992883 185
71 3300025912 Ga0207707_10283406 Ga0207707_102834062 185
72 3300025918 Ga0207662_10617807 Ga0207662_106178072 185
73 3300025922 Ga0207646_10128156 Ga0207646_101281566 185
74 3300025935 Ga0207709_10111220 Ga0207709_101112202 185
75 3300028381 Ga0268264_10588476 Ga0268264_105884761 185
76 3300046455 Ga0495603_0481232 Ga0495603_0481232_47_649 185
77 3300048903 Ga0496100_0373692 Ga0496100_0373692_21_611 185
78 3300048913 Ga0496110_1173831 Ga0496110_1173831_73_663 185
79 3300048917 Ga0496114_0026853 Ga0496114_0026853_3641_4330 185
80 3300059490 Ga0587066_061401 Ga0587066_061401_139_723 185
81 3300005549 Ga0070704_101259384 Ga0070704_1012593841 186
82 3300005718 Ga0068866_10072780 Ga0068866_100727803 186
83 3300006914 Ga0075436_100411709 Ga0075436_1004117091 186
84 3300009101 Ga0105247_10133613 Ga0105247_101336134 186
85 3300009177 Ga0105248_10206586 Ga0105248_102065862 186
86 3300009553 Ga0105249_10210176 Ga0105249_102101762 186
87 3300010375 Ga0105239_10269246 Ga0105239_102692464 186
88 3300013296 Ga0157374_10472525 Ga0157374_104725253 186
89 3300025900 Ga0207710_10175460 Ga0207710_101754601 186
90 3300025909 Ga0207705_10056065 Ga0207705_100560653 186
91 3300025929 Ga0207664_10027963 Ga0207664_100279639 186
92 3300025949 Ga0207667_10543606 Ga0207667_105436061 186
93 3300026035 Ga0207703_10421025 Ga0207703_104210253 186
94 3300046473 Ga0495582_0365046 Ga0495582_0365046_36_611 186
95 3300046476 Ga0495662_0047488 Ga0495662_0047488_216_791 186
96 3300046511 Ga0495608_0076168 Ga0495608_0076168_243_818 186
97 3300046523 Ga0495644_0069438 Ga0495644_0069438_614_1192 186
98 3300046533 Ga0495640_0060453 Ga0495640_0060453_641_1216 186
99 3300046615 Ga0495656_0375727 Ga0495656_0375727_122_700 186
100 3300046675 Ga0495657_0026518 Ga0495657_0026518_1103_1678 186
101 3300046680 Ga0495646_0304320 Ga0495646_0304320_65_640 186
102 3300047322 Ga0495680_0155051 Ga0495680_0155051_20_595 186
103 3300047471 Ga0495684_0147363 Ga0495684_0147363_1120_1695 186
104 3300048905 Ga0496102_0093207 Ga0496102_0093207_265_840 186
105 3300048907 Ga0496104_0044781 Ga0496104_0044781_999_1577 186
106 3300048910 Ga0496107_0340545 Ga0496107_0340545_55_633 186
107 3300048911 Ga0496108_0058890 Ga0496108_0058890_1502_2080 186
108 3300048914 Ga0496111_0086316 Ga0496111_0086316_1222_1800 186
109 3300048916 Ga0496113_0105218 Ga0496113_0105218_1153_1731 186
110 3300048917 Ga0496114_0313744 Ga0496114_0313744_312_890 186
111 3300049575 Ga0501039_0401144 Ga0501039_0401144_85_660 186
112 3300049578 Ga0501042_0109415 Ga0501042_0109415_1228_1803 186
113 3300049591 Ga0501075_0228188 Ga0501075_0228188_668_1243 186
114 3300049592 Ga0501076_0351716 Ga0501076_0351716_499_1074 186
115 3300049743 Ga0501081_0173575 Ga0501081_0173575_478_1053 186
116 3300050514 nmdc:mga08x19_798869_c1 nmdc:mga08x19_798869_c1_26_601 186
117 3300053078 Ga0495612_0088504 Ga0495612_0088504_355_930 186
118 3300053084 Ga0495595_0035073 Ga0495595_0035073_183_758 186
119 3300009094 Ga0111539_10470861 Ga0111539_104708612 187
120 3300009147 Ga0114129_10035427 Ga0114129_100354278 187
121 3300012502 Ga0157347_1012454 Ga0157347_10124542 187
122 3300035089 Ga0373944_0028895 Ga0373944_0028895_463_1047 187
123 3300035113 Ga0373936_0164348 Ga0373936_0164348_110_694 187
124 3300035170 Ga0373943_0056727 Ga0373943_0056727_1118_1702 187
125 3300035171 Ga0373946_0014684 Ga0373946_0014684_2141_2725 187
126 3300035410 Ga0373924_0093750 Ga0373924_0093750_391_975 187
127 3300035695 Ga0373927_0218680 Ga0373927_0218680_525_1109 187
128 3300035725 Ga0373947_0017628 Ga0373947_0017628_610_1194 187
129 3300037068 Ga0373925_0002218 Ga0373925_0002218_3336_3920 187
130 3300044694 Ga0466963_0000055 Ga0466963_0000055_36776_37357 187
131 3300044842 Ga0466957_0029951 Ga0466957_0029951_997_1578 187
132 3300045836 Ga0466958_0013846 Ga0466958_0013846_1789_2370 187
133 3300045976 Ga0466967_0002348 Ga0466967_0002348_4355_4936 187
134 3300045976 Ga0466967_0662699 Ga0466967_0662699_115_696 187
135 3300046461 Ga0495641_0003735 Ga0495641_0003735_6326_6910 187
136 3300046463 Ga0495653_0026259 Ga0495653_0026259_966_1550 187
137 3300046472 Ga0495580_0009973 Ga0495580_0009973_2790_3374 187
138 3300046473 Ga0495582_0001703 Ga0495582_0001703_7040_7624 187
139 3300046475 Ga0495639_0000828 Ga0495639_0000828_8794_9378 187
140 3300046476 Ga0495662_0002737 Ga0495662_0002737_2787_3371 187
141 3300046477 Ga0495664_0018869 Ga0495664_0018869_2340_2924 187
142 3300046514 Ga0495618_0010074 Ga0495618_0010074_2340_2924 187
143 3300046516 Ga0495628_0037042 Ga0495628_0037042_3180_3764 187
144 3300046517 Ga0495630_0018065 Ga0495630_0018065_1470_2054 187
145 3300046526 Ga0495666_0000309 Ga0495666_0000309_5907_6491 187
146 3300046529 Ga0495652_0005095 Ga0495652_0005095_3651_4235 187
147 3300046531 Ga0495665_0003045 Ga0495665_0003045_4352_4936 187
148 3300046533 Ga0495640_0016017 Ga0495640_0016017_3124_3708 187
149 3300046535 Ga0495586_0009993 Ga0495586_0009993_4119_4703 187
150 3300046543 Ga0495645_0039870 Ga0495645_0039870_1810_2394 187
151 3300046642 Ga0495634_0004455 Ga0495634_0004455_4585_5169 187
152 3300046663 Ga0495635_0105560 Ga0495635_0105560_166_750 187
153 3300046674 Ga0495588_0109580 Ga0495588_0109580_729_1307 187
154 3300046680 Ga0495646_0016747 Ga0495646_0016747_2883_3467 187
155 3300046681 Ga0495647_0004236 Ga0495647_0004236_1072_1656 187
156 3300046683 Ga0495658_0000498 Ga0495658_0000498_4573_5157 187
157 3300046689 Ga0495613_0213996 Ga0495613_0213996_610_1194 187
158 3300046690 Ga0495624_0009825 Ga0495624_0009825_381_965 187
159 3300047315 Ga0495581_0017975 Ga0495581_0017975_2787_3371 187
160 3300047319 Ga0495674_0007325 Ga0495674_0007325_610_1194 187
161 3300047321 Ga0495676_0036425 Ga0495676_0036425_610_1194 187
162 3300047322 Ga0495680_0005229 Ga0495680_0005229_8777_9361 187
163 3300047471 Ga0495684_0108121 Ga0495684_0108121_1163_1747 187
164 3300047673 Ga0495593_0001256 Ga0495593_0001256_11397_11981 187
165 3300049582 Ga0501048_0254908 Ga0501048_0254908_203_790 187
166 3300049587 Ga0501071_0084366 Ga0501071_0084366_139_714 187
167 3300050507 nmdc:mga05p37_101915_c1 nmdc:mga05p37_101915_c1_1868_2446 187
168 3300053078 Ga0495612_0039191 Ga0495612_0039191_952_1536 187
169 3300053085 Ga0495619_0713408 Ga0495619_0713408_45_629 187
170 3300045051 Ga0451576_0154638 Ga0451576_0154638_1373_2083 188
171 3300005445 Ga0070708_100021258 Ga0070708_1000212587 189
172 3300005467 Ga0070706_100724527 Ga0070706_1007245271 189
173 3300005468 Ga0070707_100108544 Ga0070707_1001085444 189
174 3300005471 Ga0070698_100005769 Ga0070698_10000576914 189
175 3300005518 Ga0070699_100029175 Ga0070699_1000291753 189
176 3300025922 Ga0207646_10063438 Ga0207646_100634385 189
177 3300026142 Ga0207698_11602233 Ga0207698_116022331 189
178 3300030760 Ga0265762_1031130 Ga0265762_10311302 189
179 3300005549 Ga0070704_100482524 Ga0070704_1004825242 190
180 3300005937 Ga0081455_10065534 Ga0081455_100655347 190
181 3300006186 Ga0075369_10241386 Ga0075369_102413861 190
182 3300053120 Ga0500597_090681 Ga0500597_090681_321_968 190
183 3300005334 Ga0068869_100061324 Ga0068869_1000613246 191
184 3300005435 Ga0070714_100071630 Ga0070714_1000716302 191
185 3300009094 Ga0111539_10041411 Ga0111539_100414117 191
186 3300025929 Ga0207664_10432149 Ga0207664_104321492 191
187 3300031595 Ga0265313_10037034 Ga0265313_100370344 191
188 3300037068 Ga0373925_0048113 Ga0373925_0048113_1778_2503 191
189 3300046473 Ga0495582_0010538 Ga0495582_0010538_2162_2887 191
190 3300013306 Ga0163162_10112570 Ga0163162_101125706 192
191 3300025921 Ga0207652_10379596 Ga0207652_103795962 192
192 3300025933 Ga0207706_10229074 Ga0207706_102290742 192
193 3300026088 Ga0207641_10585882 Ga0207641_105858822 192
194 3300035089 Ga0373944_0021548 Ga0373944_0021548_545_1270 192
195 3300035116 Ga0373945_0004201 Ga0373945_0004201_1581_2306 192
196 3300035171 Ga0373946_0025094 Ga0373946_0025094_227_952 192
197 3300035695 Ga0373927_0262594 Ga0373927_0262594_56_781 192
198 3300042876 Ga0451577_0424995 Ga0451577_0424995_402_1127 192
199 3300046513 Ga0495616_0106023 Ga0495616_0106023_480_1160 192
200 3300046523 Ga0495644_0081446 Ga0495644_0081446_148_873 192
201 3300046537 Ga0495598_0012975 Ga0495598_0012975_822_1547 192
202 3300046538 Ga0495609_0188540 Ga0495609_0188540_92_817 192
203 3300046542 Ga0495597_0093982 Ga0495597_0093982_75_800 192
204 3300046615 Ga0495656_0057048 Ga0495656_0057048_344_1069 192
205 3300046664 Ga0495659_0003901 Ga0495659_0003901_2612_3337 192
206 3300046674 Ga0495588_0018801 Ga0495588_0018801_609_1334 192
207 3300046691 Ga0495670_0009268 Ga0495670_0009268_2558_3283 192
208 3300046794 Ga0495589_0083171 Ga0495589_0083171_590_1315 192
209 3300049583 Ga0501067_0142852 Ga0501067_0142852_356_1087 192
210 3300049585 Ga0501069_0374917 Ga0501069_0374917_73_804 192
211 3300049742 Ga0501080_0051733 Ga0501080_0051733_2922_3614 192
212 3300049770 Ga0501273_010847 Ga0501273_010847_100_819 192
213 3300050510 nmdc:mga06r32_286452_c1 nmdc:mga06r32_286452_c1_18_698 192
214 3300005455 Ga0070663_100460742 Ga0070663_1004607421 193
215 3300005577 Ga0068857_100813433 Ga0068857_1008134332 193
216 3300006178 Ga0075367_10122911 Ga0075367_101229113 193
217 3300014745 Ga0157377_10265366 Ga0157377_102653662 193
218 3300025945 Ga0207679_10056825 Ga0207679_100568252 193
219 3300031548 Ga0307408_100018807 Ga0307408_1000188074 193
220 3300031824 Ga0307413_10139468 Ga0307413_101394682 193
221 3300031852 Ga0307410_10000285 Ga0307410_100002858 193
222 3300031901 Ga0307406_10009039 Ga0307406_100090393 193
223 3300032002 Ga0307416_100003682 Ga0307416_1000036826 193
224 3300032002 Ga0307416_100089622 Ga0307416_1000896222 193
225 3300035725 Ga0373947_0046144 Ga0373947_0046144_355_1080 193
226 3300046455 Ga0495603_0024811 Ga0495603_0024811_2172_2897 193
227 3300046461 Ga0495641_0085416 Ga0495641_0085416_597_1322 193
228 3300046472 Ga0495580_0113006 Ga0495580_0113006_725_1450 193
229 3300046475 Ga0495639_0024994 Ga0495639_0024994_631_1356 193
230 3300046476 Ga0495662_0025652 Ga0495662_0025652_1376_2101 193
231 3300046499 Ga0495594_0030366 Ga0495594_0030366_1106_1831 193
232 3300046683 Ga0495658_0273776 Ga0495658_0273776_91_816 193
233 3300048914 Ga0496111_0144950 Ga0496111_0144950_80_784 193
234 3300049576 Ga0501040_0055045 Ga0501040_0055045_2038_2709 193
235 3300049652 Ga0501202_060777 Ga0501202_060777_86_784 193
236 3300002074 JGI24748J21848_1013980 JGI24748J21848_10139802 194
237 3300002077 JGI24744J21845_10026642 JGI24744J21845_100266421 194
238 3300002239 JGI24034J26672_10000759 JGI24034J26672_100007594 194
239 3300005295 Ga0065707_10005566 Ga0065707_100055667 194
240 3300005330 Ga0070690_100188793 Ga0070690_1001887932 194
241 3300005331 Ga0070670_100301041 Ga0070670_1003010413 194
242 3300005340 Ga0070689_100313380 Ga0070689_1003133802 194
243 3300005341 Ga0070691_10040483 Ga0070691_100404832 194
244 3300005344 Ga0070661_100207864 Ga0070661_1002078643 194
245 3300005356 Ga0070674_100389058 Ga0070674_1003890581 194
246 3300005364 Ga0070673_100327518 Ga0070673_1003275182 194
247 3300005438 Ga0070701_10210353 Ga0070701_102103532 194
248 3300005440 Ga0070705_100146786 Ga0070705_1001467862 194
249 3300005445 Ga0070708_100541924 Ga0070708_1005419242 194
250 3300005456 Ga0070678_100267516 Ga0070678_1002675162 194
251 3300005459 Ga0068867_100365205 Ga0068867_1003652052 194
252 3300005466 Ga0070685_10121347 Ga0070685_101213472 194
253 3300005467 Ga0070706_100723219 Ga0070706_1007232191 194
254 3300005468 Ga0070707_100033640 Ga0070707_1000336409 194
255 3300005535 Ga0070684_100543750 Ga0070684_1005437501 194
256 3300005536 Ga0070697_100701654 Ga0070697_1007016541 194
257 3300005543 Ga0070672_100029753 Ga0070672_1000297532 194
258 3300005544 Ga0070686_100088535 Ga0070686_1000885351 194
259 3300005547 Ga0070693_100030086 Ga0070693_1000300867 194
260 3300005548 Ga0070665_100367848 Ga0070665_1003678482 194
261 3300005563 Ga0068855_100324265 Ga0068855_1003242652 194
262 3300005577 Ga0068857_100417472 Ga0068857_1004174722 194
263 3300005614 Ga0068856_100386693 Ga0068856_1003866932 194
264 3300005615 Ga0070702_100042751 Ga0070702_1000427516 194
265 3300005719 Ga0068861_100277598 Ga0068861_1002775982 194
266 3300005840 Ga0068870_10015701 Ga0068870_100157012 194
267 3300005844 Ga0068862_100066335 Ga0068862_1000663353 194
268 3300005844 Ga0068862_100193511 Ga0068862_1001935113 194
269 3300006038 Ga0075365_10177533 Ga0075365_101775331 194
270 3300006042 Ga0075368_10009694 Ga0075368_100096948 194
271 3300006048 Ga0075363_100100732 Ga0075363_1001007323 194
272 3300006173 Ga0070716_100533435 Ga0070716_1005334352 194
273 3300006175 Ga0070712_100141516 Ga0070712_1001415163 194
274 3300006195 Ga0075366_10271348 Ga0075366_102713482 194
275 3300006237 Ga0097621_100372179 Ga0097621_1003721792 194
276 3300006353 Ga0075370_10074572 Ga0075370_100745724 194
277 3300006358 Ga0068871_100077944 Ga0068871_1000779446 194
278 3300006844 Ga0075428_100071069 Ga0075428_1000710697 194
279 3300006852 Ga0075433_10035758 Ga0075433_100357582 194
280 3300006871 Ga0075434_100602663 Ga0075434_1006026632 194
281 3300006880 Ga0075429_100062025 Ga0075429_1000620256 194
282 3300006881 Ga0068865_100057755 Ga0068865_1000577555 194
283 3300007265 Ga0099794_10038488 Ga0099794_100384882 194
284 3300009101 Ga0105247_10196341 Ga0105247_101963413 194
285 3300009147 Ga0114129_10005890 Ga0114129_1000589017 194
286 3300009147 Ga0114129_10194135 Ga0114129_101941356 194
287 3300009148 Ga0105243_10013879 Ga0105243_100138793 194
288 3300009176 Ga0105242_10144535 Ga0105242_101445356 194
289 3300009553 Ga0105249_10173804 Ga0105249_101738046 194
290 3300013297 Ga0157378_10162599 Ga0157378_101625993 194
291 3300013308 Ga0157375_10169864 Ga0157375_101698646 194
292 3300014326 Ga0157380_10037923 Ga0157380_100379235 194
293 3300014745 Ga0157377_10047905 Ga0157377_100479052 194
294 3300014969 Ga0157376_10099574 Ga0157376_100995742 194
295 3300017792 Ga0163161_10071821 Ga0163161_100718214 194
296 3300025885 Ga0207653_10088983 Ga0207653_100889831 194
297 3300025898 Ga0207692_10008210 Ga0207692_100082104 194
298 3300025901 Ga0207688_10002321 Ga0207688_1000232114 194
299 3300025901 Ga0207688_10033396 Ga0207688_100333965 194
300 3300025904 Ga0207647_10034185 Ga0207647_100341856 194
301 3300025907 Ga0207645_10016093 Ga0207645_100160939 194
302 3300025908 Ga0207643_10002622 Ga0207643_1000262213 194
303 3300025911 Ga0207654_10028853 Ga0207654_100288536 194
304 3300025911 Ga0207654_10154824 Ga0207654_101548241 194
305 3300025914 Ga0207671_10179689 Ga0207671_101796892 194
306 3300025915 Ga0207693_10023533 Ga0207693_100235337 194
307 3300025916 Ga0207663_10377456 Ga0207663_103774562 194
308 3300025919 Ga0207657_10026404 Ga0207657_100264049 194
309 3300025920 Ga0207649_10387161 Ga0207649_103871612 194
310 3300025921 Ga0207652_10434128 Ga0207652_104341282 194
311 3300025922 Ga0207646_10036746 Ga0207646_100367464 194
312 3300025924 Ga0207694_10225637 Ga0207694_102256374 194
313 3300025924 Ga0207694_10243400 Ga0207694_102434002 194
314 3300025926 Ga0207659_10164796 Ga0207659_101647963 194
315 3300025926 Ga0207659_10436942 Ga0207659_104369422 194
316 3300025927 Ga0207687_10399804 Ga0207687_103998042 194
317 3300025928 Ga0207700_10086561 Ga0207700_100865615 194
318 3300025931 Ga0207644_10102661 Ga0207644_101026613 194
319 3300025932 Ga0207690_10012426 Ga0207690_100124268 194
320 3300025933 Ga0207706_10002966 Ga0207706_1000296611 194
321 3300025933 Ga0207706_10112438 Ga0207706_101124384 194
322 3300025934 Ga0207686_10027772 Ga0207686_100277723 194
323 3300025935 Ga0207709_10003379 Ga0207709_1000337910 194
324 3300025936 Ga0207670_10153078 Ga0207670_101530783 194
325 3300025937 Ga0207669_10034696 Ga0207669_100346966 194
326 3300025937 Ga0207669_10171542 Ga0207669_101715422 194
327 3300025938 Ga0207704_10000286 Ga0207704_1000028621 194
328 3300025940 Ga0207691_10023983 Ga0207691_100239836 194
329 3300025942 Ga0207689_10059736 Ga0207689_100597363 194
330 3300025944 Ga0207661_10160105 Ga0207661_101601052 194
331 3300025949 Ga0207667_10112179 Ga0207667_101121795 194
332 3300025949 Ga0207667_10646078 Ga0207667_106460782 194
333 3300025961 Ga0207712_10019046 Ga0207712_100190468 194
334 3300025961 Ga0207712_10135389 Ga0207712_101353893 194
335 3300025972 Ga0207668_10017224 Ga0207668_100172246 194
336 3300025986 Ga0207658_10121938 Ga0207658_101219384 194
337 3300026023 Ga0207677_10458961 Ga0207677_104589613 194
338 3300026035 Ga0207703_10107818 Ga0207703_101078183 194
339 3300026041 Ga0207639_10016448 Ga0207639_100164487 194
340 3300026067 Ga0207678_10007497 Ga0207678_1000749712 194
341 3300026067 Ga0207678_10107739 Ga0207678_101077394 194
342 3300026075 Ga0207708_10003609 Ga0207708_1000360915 194
343 3300026075 Ga0207708_10013133 Ga0207708_100131334 194
344 3300026078 Ga0207702_10070805 Ga0207702_100708055 194
345 3300026089 Ga0207648_10005395 Ga0207648_100053957 194
346 3300026089 Ga0207648_10005612 Ga0207648_1000561214 194
347 3300026095 Ga0207676_10114286 Ga0207676_101142862 194
348 3300026116 Ga0207674_10062426 Ga0207674_100624267 194
349 3300026118 Ga0207675_100027633 Ga0207675_1000276333 194
350 3300026118 Ga0207675_100875409 Ga0207675_1008754092 194
351 3300026121 Ga0207683_10010766 Ga0207683_100107668 194
352 3300026142 Ga0207698_10146240 Ga0207698_101462404 194
353 3300027671 Ga0209588_1006440 Ga0209588_10064407 194
354 3300028379 Ga0268266_10074281 Ga0268266_100742814 194
355 3300028380 Ga0268265_10086615 Ga0268265_100866156 194
356 3300031903 Ga0307407_10225944 Ga0307407_102259443 194
357 3300031911 Ga0307412_10067354 Ga0307412_100673543 194
358 3300031995 Ga0307409_100154690 Ga0307409_1001546901 194
359 3300032126 Ga0307415_100238454 Ga0307415_1002384543 194
360 3300035121 Ga0373960_0040532 Ga0373960_0040532_507_1232 194
361 3300044673 Ga0453683_0036857 Ga0453683_0036857_21_797 194
362 3300046455 Ga0495603_0013329 Ga0495603_0013329_1135_1740 194
363 3300046491 Ga0495584_0035185 Ga0495584_0035185_1774_2379 194
364 3300046499 Ga0495594_0064727 Ga0495594_0064727_1334_1939 194
365 3300046525 Ga0495663_0017834 Ga0495663_0017834_659_1384 194
366 3300046536 Ga0495587_0218275 Ga0495587_0218275_135_860 194
367 3300046538 Ga0495609_0155331 Ga0495609_0155331_187_792 194
368 3300046648 Ga0495611_0039725 Ga0495611_0039725_454_1059 194
369 3300046664 Ga0495659_0116432 Ga0495659_0116432_164_769 194
370 3300047315 Ga0495581_0563997 Ga0495581_0563997_18_623 194
371 3300047319 Ga0495674_0781823 Ga0495674_0781823_25_630 194
372 3300047320 Ga0495672_0171419 Ga0495672_0171419_351_1076 194
373 3300047445 Ga0495677_0058593 Ga0495677_0058593_186_911 194
374 3300048903 Ga0496100_0000735 Ga0496100_0000735_9875_10480 194
375 3300048904 Ga0496101_0001765 Ga0496101_0001765_12285_12890 194
376 3300048905 Ga0496102_0006229 Ga0496102_0006229_419_1024 194
377 3300048906 Ga0496103_0000427 Ga0496103_0000427_31161_31766 194
378 3300048907 Ga0496104_0130156 Ga0496104_0130156_741_1346 194
379 3300048907 Ga0496104_0561999 Ga0496104_0561999_69_767 194
380 3300048908 Ga0496105_0079353 Ga0496105_0079353_313_1038 194
381 3300048908 Ga0496105_0161832 Ga0496105_0161832_244_849 194
382 3300048909 Ga0496106_0018993 Ga0496106_0018993_4132_4737 194
383 3300048909 Ga0496106_0109289 Ga0496106_0109289_503_1228 194
384 3300048910 Ga0496107_0011572 Ga0496107_0011572_2729_3334 194
385 3300048912 Ga0496109_0181400 Ga0496109_0181400_1340_1945 194
386 3300048913 Ga0496110_0322776 Ga0496110_0322776_618_1343 194
387 3300048914 Ga0496111_0052074 Ga0496111_0052074_1020_1745 194
388 3300048914 Ga0496111_0352853 Ga0496111_0352853_157_762 194
389 3300048915 Ga0496112_0095542 Ga0496112_0095542_1467_2072 194
390 3300048917 Ga0496114_0001861 Ga0496114_0001861_8413_9018 194
391 3300048917 Ga0496114_0110408 Ga0496114_0110408_839_1537 194
392 3300048918 Ga0496115_0001915 Ga0496115_0001915_5107_5712 194
393 3300048918 Ga0496115_0233730 Ga0496115_0233730_405_1130 194
394 3300049583 Ga0501067_0393106 Ga0501067_0393106_12_626 194
395 3300050507 nmdc:mga05p37_122064_c2 nmdc:mga05p37_122064_c2_392_1084 194
396 3300050507 nmdc:mga05p37_1773_c1 nmdc:mga05p37_1773_c1_11902_12603 194
397 3300050508 nmdc:mga09592_132575_c1 nmdc:mga09592_132575_c1_1287_1979 194
398 3300050510 nmdc:mga06r32_197607_c1 nmdc:mga06r32_197607_c1_814_1500 194
399 3300050511 nmdc:mga08y16_16604_c1 nmdc:mga08y16_16604_c1_2013_2705 194
400 3300050512 nmdc:mga0n895_500058_c1 nmdc:mga0n895_500058_c1_275_967 194
401 3300053085 Ga0495619_0007707 Ga0495619_0007707_3978_4700 194
402 3300005331 Ga0070670_100063491 Ga0070670_1000634916 195
403 3300005564 Ga0070664_100473386 Ga0070664_1004733862 195
404 3300006852 Ga0075433_10030828 Ga0075433_1003082810 195
405 3300006852 Ga0075433_10047049 Ga0075433_100470499 195
406 3300006871 Ga0075434_100356991 Ga0075434_1003569913 195
407 3300006914 Ga0075436_100005801 Ga0075436_1000058015 195
408 3300025920 Ga0207649_10144224 Ga0207649_101442244 195
409 3300025926 Ga0207659_10029115 Ga0207659_100291155 195
410 3300025945 Ga0207679_10050493 Ga0207679_100504933 195
411 3300031548 Ga0307408_100011260 Ga0307408_1000112609 195
412 3300031731 Ga0307405_10003907 Ga0307405_100039079 195
413 3300031824 Ga0307413_10001530 Ga0307413_100015309 195
414 3300031852 Ga0307410_10004966 Ga0307410_1000496610 195
415 3300031901 Ga0307406_10004231 Ga0307406_1000423111 195
416 3300031903 Ga0307407_10001057 Ga0307407_1000105711 195
417 3300031911 Ga0307412_10106910 Ga0307412_101069103 195
418 3300031911 Ga0307412_10732829 Ga0307412_107328291 195
419 3300031995 Ga0307409_100000501 Ga0307409_10000050116 195
420 3300032002 Ga0307416_100003220 Ga0307416_1000032202 195
421 3300032005 Ga0307411_10001075 Ga0307411_1000107510 195
422 3300032005 Ga0307411_10665778 Ga0307411_106657781 195
423 3300032126 Ga0307415_100004272 Ga0307415_10000427210 195
424 3300032126 Ga0307415_100366390 Ga0307415_1003663903 195
425 3300048911 Ga0496108_0380158 Ga0496108_0380158_348_1046 195
426 3300049521 Ga0501298_011404 Ga0501298_011404_203_922 195
427 3300049570 Ga0501033_0124456 Ga0501033_0124456_368_1057 195
428 3300049576 Ga0501040_0249342 Ga0501040_0249342_96_767 195
429 3300049577 Ga0501041_0047899 Ga0501041_0047899_1475_2146 195
430 3300049588 Ga0501072_0135380 Ga0501072_0135380_273_944 195
431 3300049592 Ga0501076_0106110 Ga0501076_0106110_974_1645 195
432 3300049661 Ga0501217_005170 Ga0501217_005170_823_1542 195
433 3300049668 Ga0501233_004036 Ga0501233_004036_1709_2428 195
434 3300049677 Ga0501247_001365 Ga0501247_001365_140_859 195
435 3300049703 Ga0501219_002023 Ga0501219_002023_448_1167 195
436 3300049705 Ga0501225_0027274 Ga0501225_0027274_612_1331 195
437 3300049741 Ga0501079_0110880 Ga0501079_0110880_218_889 195
438 3300049760 Ga0501263_000777 Ga0501263_000777_790_1509 195
439 3300049765 Ga0501268_000281 Ga0501268_000281_3508_4227 195
440 3300049767 Ga0501270_012548 Ga0501270_012548_392_1111 195
441 3300049850 Ga0501204_003963 Ga0501204_003963_747_1466 195
442 3300049851 Ga0501212_005413 Ga0501212_005413_887_1606 195
443 3300050512 nmdc:mga0n895_352386_c1 nmdc:mga0n895_352386_c1_403_1128 195
444 3300050512 nmdc:mga0n895_44735_c1 nmdc:mga0n895_44735_c1_2169_2900 195
445 3300050515 nmdc:mga0a205_11705_c1 nmdc:mga0a205_11705_c1_4852_5583 195
446 3300053083 Ga0495655_0039155 Ga0495655_0039155_17_721 195
447 3300054114 Ga0501084_0375339 Ga0501084_0375339_58_744 195
448 3300060353 Ga0501082_0047119 Ga0501082_0047119_2547_3218 195
449 3300061734 Ga0530510_0006450 Ga0530510_0006450_1246_1917 195
450 3300005336 Ga0070680_100174605 Ga0070680_1001746052 196
451 3300005981 Ga0081538_10030674 Ga0081538_100306741 196
452 3300009094 Ga0111539_11288572 Ga0111539_112885721 196
453 3300025922 Ga0207646_10087238 Ga0207646_100872383 196
454 3300031711 Ga0265314_10004990 Ga0265314_100049907 196
455 3300031852 Ga0307410_10027373 Ga0307410_100273731 196
456 3300031901 Ga0307406_10082357 Ga0307406_100823574 196
457 3300031903 Ga0307407_10058334 Ga0307407_100583342 196
458 3300031903 Ga0307407_10066342 Ga0307407_100663424 196
459 3300031911 Ga0307412_10427986 Ga0307412_104279861 196
460 3300031995 Ga0307409_100063049 Ga0307409_1000630497 196
461 3300032002 Ga0307416_100010520 Ga0307416_1000105207 196
462 3300032002 Ga0307416_100277730 Ga0307416_1002777302 196
463 3300032004 Ga0307414_10212142 Ga0307414_102121423 196
464 3300032126 Ga0307415_100023019 Ga0307415_1000230193 196
465 3300053131 Ga0500652_001803 Ga0500652_001803_4920_5570 196
466 3300053730 Ga0500645_001772 Ga0500645_001772_3969_4619 196
467 3300005439 Ga0070711_100213541 Ga0070711_1002135412 197
468 3300005440 Ga0070705_100003631 Ga0070705_1000036316 197
469 3300005549 Ga0070704_100589626 Ga0070704_1005896262 197
470 3300006038 Ga0075365_10599477 Ga0075365_105994771 197
471 3300025916 Ga0207663_10514483 Ga0207663_105144832 197
472 3300026075 Ga0207708_10014559 Ga0207708_1001455910 197
473 3300035691 Ga0373931_0212100 Ga0373931_0212100_408_1118 197
474 3300049572 Ga0501036_0044877 Ga0501036_0044877_199_903 197
475 3300049574 Ga0501038_0275060 Ga0501038_0275060_207_911 197
476 3300049578 Ga0501042_0009210 Ga0501042_0009210_2375_3079 197
477 3300049584 Ga0501068_0035130 Ga0501068_0035130_1173_1877 197
478 3300049587 Ga0501071_0045651 Ga0501071_0045651_574_1278 197
479 3300049588 Ga0501072_0093892 Ga0501072_0093892_316_1020 197
480 3300049591 Ga0501075_0043196 Ga0501075_0043196_1966_2670 197
481 3300049592 Ga0501076_0028793 Ga0501076_0028793_568_1272 197
482 3300049741 Ga0501079_0035117 Ga0501079_0035117_761_1465 197
483 3300049742 Ga0501080_0015571 Ga0501080_0015571_2613_3317 197
484 3300049743 Ga0501081_0012727 Ga0501081_0012727_984_1688 197
485 3300049744 Ga0501083_0262638 Ga0501083_0262638_236_940 197
486 3300049822 Ga0501035_0292692 Ga0501035_0292692_367_1071 197
487 3300050509 nmdc:mga0qj67_403481_c1 nmdc:mga0qj67_403481_c1_180_896 197
488 3300054114 Ga0501084_0004051 Ga0501084_0004051_10708_11412 197
489 3300005468 Ga0070707_100239655 Ga0070707_1002396552 198
490 3300005536 Ga0070697_100102122 Ga0070697_1001021221 198
491 3300005546 Ga0070696_100222829 Ga0070696_1002228292 198
492 3300006847 Ga0075431_100287972 Ga0075431_1002879723 198
493 3300006852 Ga0075433_10000942 Ga0075433_1000094228 198
494 3300006871 Ga0075434_100015284 Ga0075434_1000152843 198
495 3300006880 Ga0075429_100147777 Ga0075429_1001477773 198
496 3300007076 Ga0075435_100023920 Ga0075435_10002392010 198
497 3300009147 Ga0114129_10229113 Ga0114129_102291133 198
498 3300025910 Ga0207684_10026777 Ga0207684_100267776 198
499 3300025912 Ga0207707_10460715 Ga0207707_104607152 198
500 3300025922 Ga0207646_10071164 Ga0207646_100711644 198
501 3300026116 Ga0207674_10604650 Ga0207674_106046502 198
502 3300035242 Ga0373962_0043496 Ga0373962_0043496_179_859 198
503 3300042876 Ga0451577_0053816 Ga0451577_0053816_1377_2057 198
504 3300044673 Ga0453683_0027180 Ga0453683_0027180_1290_2021 198
505 3300045051 Ga0451576_0081297 Ga0451576_0081297_293_973 198
506 3300049744 Ga0501083_0157277 Ga0501083_0157277_854_1450 198
507 3300050507 nmdc:mga05p37_589855_c1 nmdc:mga05p37_589855_c1_206_898 198
508 3300050508 nmdc:mga09592_73465_c1 nmdc:mga09592_73465_c1_1857_2549 198
509 3300050510 nmdc:mga06r32_150921_c1 nmdc:mga06r32_150921_c1_529_1221 198
510 3300050512 nmdc:mga0n895_17413_c1 nmdc:mga0n895_17413_c1_5491_6183 198
511 3300050513 nmdc:mga0rr50_4985_c1 nmdc:mga0rr50_4985_c1_4162_4854 198
512 3300050515 nmdc:mga0a205_2218_c1 nmdc:mga0a205_2218_c1_10348_11040 198
513 3300003316 rootH1_10113446 rootH1_101134462 199
514 3300005330 Ga0070690_100301780 Ga0070690_1003017801 199
515 3300005337 Ga0070682_100045774 Ga0070682_1000457742 199
516 3300005366 Ga0070659_100075380 Ga0070659_1000753806 199
517 3300005440 Ga0070705_100025279 Ga0070705_1000252796 199
518 3300005444 Ga0070694_100011413 Ga0070694_1000114139 199
519 3300005549 Ga0070704_100047686 Ga0070704_1000476862 199
520 3300005549 Ga0070704_100204957 Ga0070704_1002049573 199
521 3300005719 Ga0068861_100311382 Ga0068861_1003113821 199
522 3300005844 Ga0068862_100273868 Ga0068862_1002738683 199
523 3300011119 Ga0105246_10040974 Ga0105246_100409746 199
524 3300013297 Ga0157378_10095871 Ga0157378_100958717 199
525 3300013306 Ga0163162_10679264 Ga0163162_106792642 199
526 3300014969 Ga0157376_10535079 Ga0157376_105350793 199
527 3300025923 Ga0207681_10253810 Ga0207681_102538103 199
528 3300025981 Ga0207640_10390665 Ga0207640_103906651 199
529 3300026067 Ga0207678_10103624 Ga0207678_101036241 199
530 3300027907 Ga0207428_10204997 Ga0207428_102049973 199
531 3300031249 Ga0265339_10004825 Ga0265339_1000482513 199
532 3300031595 Ga0265313_10006102 Ga0265313_1000610210 199
533 3300031852 Ga0307410_10382599 Ga0307410_103825992 199
534 3300032002 Ga0307416_100595964 Ga0307416_1005959641 199
535 3300032004 Ga0307414_10428524 Ga0307414_104285241 199
536 3300046472 Ga0495580_0000020 Ga0495580_0000020_84678_85358 199
537 3300046528 Ga0495642_0029511 Ga0495642_0029511_323_1003 199
538 3300046684 Ga0495669_0019842 Ga0495669_0019842_2036_2716 199
539 3300048911 Ga0496108_0254694 Ga0496108_0254694_316_1017 199
540 3300048913 Ga0496110_0400144 Ga0496110_0400144_44_745 199
541 3300049568 Ga0501031_0160042 Ga0501031_0160042_313_1017 199
542 3300049576 Ga0501040_0047193 Ga0501040_0047193_2151_2855 199
543 3300049576 Ga0501040_0136293 Ga0501040_0136293_39_722 199
544 3300049577 Ga0501041_0185306 Ga0501041_0185306_35_736 199
545 3300049592 Ga0501076_0263785 Ga0501076_0263785_166_870 199
546 3300050512 nmdc:mga0n895_77155_c1 nmdc:mga0n895_77155_c1_2262_2942 199
547 3300050513 nmdc:mga0rr50_232744_c1 nmdc:mga0rr50_232744_c1_44_724 199
548 3300053087 Ga0500643_001596 Ga0500643_001596_7270_7920 199
549 3300053094 Ga0500566_0070333 Ga0500566_0070333_629_1279 199
550 3300053119 Ga0500595_000016 Ga0500595_000016_150779_151429 199
551 3300005336 Ga0070680_100156350 Ga0070680_1001563503 200
552 3300005445 Ga0070708_100034355 Ga0070708_1000343554 200
553 3300005471 Ga0070698_100014490 Ga0070698_1000144905 200
554 3300005518 Ga0070699_100352582 Ga0070699_1003525822 200
555 3300005617 Ga0068859_100120929 Ga0068859_1001209296 200
556 3300005618 Ga0068864_100165590 Ga0068864_1001655904 200
557 3300005841 Ga0068863_100106457 Ga0068863_1001064572 200
558 3300006844 Ga0075428_100061239 Ga0075428_1000612395 200
559 3300006846 Ga0075430_100002159 Ga0075430_1000021594 200
560 3300006847 Ga0075431_100060059 Ga0075431_1000600592 200
561 3300006931 Ga0097620_100120929 Ga0097620_1001209296 200
562 3300009147 Ga0114129_10113339 Ga0114129_101133396 200
563 3300009147 Ga0114129_10198299 Ga0114129_101982993 200
564 3300009147 Ga0114129_11025285 Ga0114129_110252852 200
565 3300009176 Ga0105242_10026750 Ga0105242_100267509 200
566 3300014325 Ga0163163_10178021 Ga0163163_101780214 200
567 3300025921 Ga0207652_10127325 Ga0207652_101273253 200
568 3300025938 Ga0207704_10637110 Ga0207704_106371101 200
569 3300034816 Ga0373930_0006543 Ga0373930_0006543_524_1228 200
570 3300035398 Ga0316574_0076966 Ga0316574_0076966_89_778 200
571 3300038996 Ga0242420_022030 Ga0242420_022030_335_1039 200
572 3300048907 Ga0496104_0081866 Ga0496104_0081866_1372_2076 200
573 3300048911 Ga0496108_0012348 Ga0496108_0012348_5823_6527 200
574 3300048911 Ga0496108_0076691 Ga0496108_0076691_1933_2637 200
575 3300048912 Ga0496109_0474967 Ga0496109_0474967_34_738 200
576 3300048913 Ga0496110_0149875 Ga0496110_0149875_140_844 200
577 3300048915 Ga0496112_0053839 Ga0496112_0053839_2957_3661 200
578 3300048915 Ga0496112_0150977 Ga0496112_0150977_1104_1808 200
579 3300048916 Ga0496113_0063896 Ga0496113_0063896_429_1133 200
580 3300048916 Ga0496113_0356457 Ga0496113_0356457_407_1111 200
581 3300049569 Ga0501032_0107281 Ga0501032_0107281_820_1524 200
582 3300049572 Ga0501036_0258463 Ga0501036_0258463_703_1407 200
583 3300049573 Ga0501037_0072122 Ga0501037_0072122_1431_2135 200
584 3300049574 Ga0501038_0112160 Ga0501038_0112160_314_1018 200
585 3300049575 Ga0501039_0199763 Ga0501039_0199763_326_1030 200
586 3300049576 Ga0501040_0080718 Ga0501040_0080718_177_881 200
587 3300049576 Ga0501040_0509296 Ga0501040_0509296_71_766 200
588 3300049577 Ga0501041_0168203 Ga0501041_0168203_489_1193 200
589 3300049578 Ga0501042_0128552 Ga0501042_0128552_1041_1745 200
590 3300049582 Ga0501048_0007522 Ga0501048_0007522_2638_3342 200
591 3300049584 Ga0501068_0129934 Ga0501068_0129934_110_814 200
592 3300049585 Ga0501069_0085016 Ga0501069_0085016_634_1332 200
593 3300049586 Ga0501070_0108402 Ga0501070_0108402_432_1136 200
594 3300049587 Ga0501071_0030822 Ga0501071_0030822_1990_2694 200
595 3300049588 Ga0501072_0179850 Ga0501072_0179850_866_1570 200
596 3300049589 Ga0501073_0318813 Ga0501073_0318813_103_807 200
597 3300049591 Ga0501075_0006835 Ga0501075_0006835_5386_6090 200
598 3300049592 Ga0501076_0047582 Ga0501076_0047582_2305_3009 200
599 3300049593 Ga0501077_0008210 Ga0501077_0008210_4967_5671 200
600 3300049593 Ga0501077_0165265 Ga0501077_0165265_254_940 200
601 3300049741 Ga0501079_0025157 Ga0501079_0025157_1220_1924 200
602 3300049742 Ga0501080_0017337 Ga0501080_0017337_19_678 200
603 3300049742 Ga0501080_0177120 Ga0501080_0177120_13_675 200
604 3300049743 Ga0501081_0405298 Ga0501081_0405298_216_911 200
605 3300049743 Ga0501081_0434115 Ga0501081_0434115_58_735 200
606 3300050507 nmdc:mga05p37_158178_c1 nmdc:mga05p37_158178_c1_1566_2282 200
607 3300050508 nmdc:mga09592_26571_c1 nmdc:mga09592_26571_c1_333_1028 200
608 3300050510 nmdc:mga06r32_215006_c1 nmdc:mga06r32_215006_c1_795_1481 200
609 3300050510 nmdc:mga06r32_8063_c1 nmdc:mga06r32_8063_c1_4569_5264 200
610 3300053093 Ga0500651_0066405 Ga0500651_0066405_291_941 200
611 3300053096 Ga0500641_0007663 Ga0500641_0007663_385_1032 200
612 3300053098 Ga0500650_0088338 Ga0500650_0088338_472_1116 200
613 3300054114 Ga0501084_0021009 Ga0501084_0021009_2916_3620 200
614 3300059421 Ga0590071_003007 Ga0590071_003007_2740_3441 200
615 3300059421 Ga0590071_003425 Ga0590071_003425_2254_2946 200
616 3300059424 Ga0590075_021012 Ga0590075_021012_103_795 200
617 3300005518 Ga0070699_100018182 Ga0070699_1000181824 201
618 3300005545 Ga0070695_100009721 Ga0070695_1000097219 201
619 3300005546 Ga0070696_100001655 Ga0070696_10000165513 201
620 3300006847 Ga0075431_100018917 Ga0075431_1000189177 201
621 3300009147 Ga0114129_10964978 Ga0114129_109649782 201
622 3300025916 Ga0207663_10090962 Ga0207663_100909623 201
623 3300031247 Ga0265340_10036269 Ga0265340_100362696 201
624 3300032126 Ga0307415_100373659 Ga0307415_1003736591 201
625 3300035083 Ga0373926_0010463 Ga0373926_0010463_929_1663 201
626 3300035114 Ga0373939_0007484 Ga0373939_0007484_527_1261 201
627 3300035121 Ga0373960_0007261 Ga0373960_0007261_871_1605 201
628 3300035170 Ga0373943_0236963 Ga0373943_0236963_72_806 201
629 3300035241 Ga0373961_0065415 Ga0373961_0065415_267_1001 201
630 3300035691 Ga0373931_0010148 Ga0373931_0010148_3080_3814 201
631 3300035692 Ga0373935_0042487 Ga0373935_0042487_322_1056 201
632 3300035695 Ga0373927_0001782 Ga0373927_0001782_6388_7122 201
633 3300037068 Ga0373925_0000994 Ga0373925_0000994_4410_5144 201
634 3300048905 Ga0496102_0088835 Ga0496102_0088835_971_1702 201
635 3300050508 nmdc:mga09592_17095_c1 nmdc:mga09592_17095_c1_5071_5811 201
636 3300050509 nmdc:mga0qj67_414935_c1 nmdc:mga0qj67_414935_c1_96_797 201
637 3300050509 nmdc:mga0qj67_66080_c1 nmdc:mga0qj67_66080_c1_1383_2138 201
638 3300050510 nmdc:mga06r32_253763_c1 nmdc:mga06r32_253763_c1_293_1033 201
639 3300050510 nmdc:mga06r32_52016_c1 nmdc:mga06r32_52016_c1_1717_2472 201
640 3300005544 Ga0070686_100349625 Ga0070686_1003496252 202
641 3300014325 Ga0163163_10126652 Ga0163163_101266525 202
642 3300025922 Ga0207646_10202508 Ga0207646_102025083 202
643 3300031548 Ga0307408_100258848 Ga0307408_1002588482 202
644 3300042461 Ga0439460_0108195 Ga0439460_0108195_74_763 202
645 3300005355 Ga0070671_100045038 Ga0070671_1000450382 203
646 3300005364 Ga0070673_100076697 Ga0070673_1000766973 203
647 3300005438 Ga0070701_10268425 Ga0070701_102684251 203
648 3300005543 Ga0070672_100164101 Ga0070672_1001641013 203
649 3300005578 Ga0068854_100731027 Ga0068854_1007310272 203
650 3300006871 Ga0075434_100162986 Ga0075434_1001629864 203
651 3300009147 Ga0114129_10017633 Ga0114129_100176336 203
652 3300025931 Ga0207644_10033728 Ga0207644_100337282 203
653 3300025960 Ga0207651_10022102 Ga0207651_100221026 203
654 3300049576 Ga0501040_0179547 Ga0501040_0179547_366_1055 203
655 3300049591 Ga0501075_0170493 Ga0501075_0170493_522_1211 203
656 3300050507 nmdc:mga05p37_210959_c1 nmdc:mga05p37_210959_c1_868_1587 203
657 3300050512 nmdc:mga0n895_13026_c1 nmdc:mga0n895_13026_c1_3777_4496 203
658 3300050514 nmdc:mga08x19_204996_c1 nmdc:mga08x19_204996_c1_399_1118 203
659 3300050515 nmdc:mga0a205_54866_c1 nmdc:mga0a205_54866_c1_3077_3796 203
660 3300005841 Ga0068863_100031970 Ga0068863_1000319709 204
661 3300005842 Ga0068858_100247493 Ga0068858_1002474932 204
662 3300005843 Ga0068860_100250986 Ga0068860_1002509862 204
663 3300014325 Ga0163163_10009943 Ga0163163_1000994315 204
664 3300026088 Ga0207641_10050032 Ga0207641_100500322 204
665 3300046452 Ga0495617_010759 Ga0495617_010759_914_1603 204
666 3300046491 Ga0495584_0013349 Ga0495584_0013349_1249_1938 204
667 3300046492 Ga0495585_0001730 Ga0495585_0001730_15610_16299 204
668 3300046523 Ga0495644_0002586 Ga0495644_0002586_5169_5858 204
669 3300046537 Ga0495598_0000729 Ga0495598_0000729_3221_3910 204
670 3300046539 Ga0495621_0092546 Ga0495621_0092546_270_959 204
671 3300046648 Ga0495611_0001648 Ga0495611_0001648_5419_6108 204
672 3300046664 Ga0495659_0019311 Ga0495659_0019311_1232_1921 204
673 3300046691 Ga0495670_0007523 Ga0495670_0007523_4353_5042 204
674 3300046794 Ga0495589_0044804 Ga0495589_0044804_456_1145 204
675 3300047446 Ga0495679_007990 Ga0495679_007990_3603_4292 204
676 3300048909 Ga0496106_0215774 Ga0496106_0215774_149_865 204
677 3300059424 Ga0590075_039106 Ga0590075_039106_367_1077 204
678 3300005436 Ga0070713_100331543 Ga0070713_1003315432 205
679 3300009148 Ga0105243_10921354 Ga0105243_109213542 205
680 3300025906 Ga0207699_10210533 Ga0207699_102105332 205
681 3300025915 Ga0207693_10238778 Ga0207693_102387782 205
682 3300025928 Ga0207700_10353072 Ga0207700_103530722 205
683 3300025929 Ga0207664_10006275 Ga0207664_1000627513 205
684 3300046501 Ga0495607_0005316 Ga0495607_0005316_4079_4768 205
685 3300046558 Ga0495633_0000941 Ga0495633_0000941_3114_3803 205
686 3300046615 Ga0495656_0000589 Ga0495656_0000589_3434_4123 205
687 3300005439 Ga0070711_100054156 Ga0070711_1000541565 207
688 3300007265 Ga0099794_10045960 Ga0099794_100459602 207
689 3300039438 Ga0436360_0355744 Ga0436360_0355744_315_1028 207
690 3300046513 Ga0495616_0145054 Ga0495616_0145054_158_847 207
691 2209111006 2214775776 2213796843 208
692 3300000041 ARcpr5oldR_c000035 ARcpr5oldR_00003524 208
693 3300000042 ARSoilYngRDRAFT_c00061 ARSoilYngRDRAFT_0006117 208
694 3300000043 ARcpr5yngRDRAFT_c000075 ARcpr5yngRDRAFT_00007510 208
695 3300000044 ARSoilOldRDRAFT_c000053 ARSoilOldRDRAFT_00005310 208
696 3300000045 ARCol0oldRDRAFT_c01233 ARCol0oldRDRAFT_012332 208
697 3300000652 ARCol0yngRDRAFT_1000025 ARCol0yngRDRAFT_100002514 208
698 3300001976 JGI24752J21851_1002479 JGI24752J21851_10024792 208
699 3300001977 JGI24746J21847_1000313 JGI24746J21847_100031313 208
700 3300001979 JGI24740J21852_10029468 JGI24740J21852_100294683 208
701 3300001989 JGI24739J22299_10001271 JGI24739J22299_1000127116 208
702 3300001989 JGI24739J22299_10006089 JGI24739J22299_100060898 208
703 3300001989 JGI24739J22299_10076202 JGI24739J22299_100762022 208
704 3300001990 JGI24737J22298_10005496 JGI24737J22298_100054968 208
705 3300001990 JGI24737J22298_10007426 JGI24737J22298_100074262 208
706 3300001991 JGI24743J22301_10008078 JGI24743J22301_100080781 208
707 3300001991 JGI24743J22301_10041313 JGI24743J22301_100413132 208
708 3300002070 JGI24750J21931_1000691 JGI24750J21931_10006915 208
709 3300002073 JGI24745J21846_1000034 JGI24745J21846_100003414 208
710 3300002074 JGI24748J21848_1002810 JGI24748J21848_10028102 208
711 3300002075 JGI24738J21930_10001067 JGI24738J21930_1000106712 208
712 3300002076 JGI24749J21850_1001313 JGI24749J21850_10013136 208
713 3300002076 JGI24749J21850_1019286 JGI24749J21850_10192862 208
714 3300002126 JGI24035J26624_1000089 JGI24035J26624_10000894 208
715 3300002126 JGI24035J26624_1000142 JGI24035J26624_10001428 208
716 3300002239 JGI24034J26672_10000419 JGI24034J26672_1000041911 208
717 3300002244 JGI24742J22300_10001913 JGI24742J22300_100019134 208
718 3300002459 JGI24751J29686_10007231 JGI24751J29686_100072313 208
719 3300003349 JGI26129J50193_1002889 JGI26129J50193_10028893 208
720 3300005277 Ga0065716_1001741 Ga0065716_10017414 208
721 3300005289 Ga0065704_10143315 Ga0065704_101433152 208
722 3300005290 Ga0065712_10145928 Ga0065712_101459281 208
723 3300005290 Ga0065712_10165564 Ga0065712_101655642 208
724 3300005293 Ga0065715_10001888 Ga0065715_100018889 208
725 3300005293 Ga0065715_10002477 Ga0065715_1000247712 208
726 3300005295 Ga0065707_10107090 Ga0065707_101070902 208
727 3300005328 Ga0070676_10085171 Ga0070676_100851713 208
728 3300005329 Ga0070683_100100106 Ga0070683_1001001065 208
729 3300005330 Ga0070690_100020637 Ga0070690_1000206373 208
730 3300005330 Ga0070690_100076604 Ga0070690_1000766045 208
731 3300005331 Ga0070670_100006103 Ga0070670_1000061039 208
732 3300005333 Ga0070677_10006617 Ga0070677_100066176 208
733 3300005334 Ga0068869_100000755 Ga0068869_10000075518 208
734 3300005335 Ga0070666_10023127 Ga0070666_100231276 208
735 3300005336 Ga0070680_100026487 Ga0070680_1000264878 208
736 3300005336 Ga0070680_100045978 Ga0070680_1000459786 208
737 3300005337 Ga0070682_100000693 Ga0070682_10000069321 208
738 3300005338 Ga0068868_100006260 Ga0068868_1000062605 208
739 3300005339 Ga0070660_100192040 Ga0070660_1001920402 208
740 3300005340 Ga0070689_100016123 Ga0070689_1000161233 208
741 3300005340 Ga0070689_100053325 Ga0070689_1000533252 208
742 3300005341 Ga0070691_10002710 Ga0070691_1000271012 208
743 3300005343 Ga0070687_100006904 Ga0070687_1000069048 208
744 3300005344 Ga0070661_100062742 Ga0070661_1000627422 208
745 3300005344 Ga0070661_100359199 Ga0070661_1003591991 208
746 3300005345 Ga0070692_10008004 Ga0070692_100080048 208
747 3300005345 Ga0070692_10102861 Ga0070692_101028613 208
748 3300005347 Ga0070668_100002043 Ga0070668_1000020438 208
749 3300005353 Ga0070669_100023313 Ga0070669_1000233132 208
750 3300005353 Ga0070669_100023519 Ga0070669_1000235192 208
751 3300005354 Ga0070675_100055612 Ga0070675_1000556122 208
752 3300005354 Ga0070675_100231381 Ga0070675_1002313812 208
753 3300005355 Ga0070671_100202293 Ga0070671_1002022932 208
754 3300005356 Ga0070674_100001294 Ga0070674_1000012943 208
755 3300005364 Ga0070673_100024964 Ga0070673_1000249642 208
756 3300005365 Ga0070688_100007596 Ga0070688_10000759612 208
757 3300005365 Ga0070688_100013675 Ga0070688_1000136758 208
758 3300005366 Ga0070659_100023740 Ga0070659_1000237408 208
759 3300005367 Ga0070667_100068731 Ga0070667_1000687315 208
760 3300005406 Ga0070703_10006226 Ga0070703_100062262 208
761 3300005438 Ga0070701_10111750 Ga0070701_101117503 208
762 3300005440 Ga0070705_100001981 Ga0070705_1000019813 208
763 3300005440 Ga0070705_100244685 Ga0070705_1002446852 208
764 3300005441 Ga0070700_100031838 Ga0070700_1000318385 208
765 3300005441 Ga0070700_100161591 Ga0070700_1001615912 208
766 3300005444 Ga0070694_100043378 Ga0070694_1000433783 208
767 3300005444 Ga0070694_100056701 Ga0070694_1000567015 208
768 3300005445 Ga0070708_100080585 Ga0070708_1000805855 208
769 3300005455 Ga0070663_100017366 Ga0070663_1000173663 208
770 3300005455 Ga0070663_100203182 Ga0070663_1002031823 208
771 3300005456 Ga0070678_100004700 Ga0070678_10000470014 208
772 3300005457 Ga0070662_100021397 Ga0070662_1000213972 208
773 3300005457 Ga0070662_100050107 Ga0070662_1000501075 208
774 3300005458 Ga0070681_10171228 Ga0070681_101712283 208
775 3300005458 Ga0070681_10662882 Ga0070681_106628821 208
776 3300005459 Ga0068867_100003543 Ga0068867_10000354315 208
777 3300005466 Ga0070685_10011173 Ga0070685_100111738 208
778 3300005466 Ga0070685_10012732 Ga0070685_100127328 208
779 3300005518 Ga0070699_100312259 Ga0070699_1003122592 208
780 3300005530 Ga0070679_100039101 Ga0070679_1000391018 208
781 3300005530 Ga0070679_100293724 Ga0070679_1002937242 208
782 3300005535 Ga0070684_100071626 Ga0070684_1000716263 208
783 3300005535 Ga0070684_100073460 Ga0070684_1000734605 208
784 3300005536 Ga0070697_100078379 Ga0070697_1000783791 208
785 3300005536 Ga0070697_100247992 Ga0070697_1002479922 208
786 3300005539 Ga0068853_100002095 Ga0068853_10000209519 208
787 3300005543 Ga0070672_100075788 Ga0070672_1000757882 208
788 3300005543 Ga0070672_100335644 Ga0070672_1003356442 208
789 3300005544 Ga0070686_100013389 Ga0070686_1000133893 208
790 3300005544 Ga0070686_100026380 Ga0070686_1000263802 208
791 3300005545 Ga0070695_100040449 Ga0070695_1000404495 208
792 3300005545 Ga0070695_100154109 Ga0070695_1001541092 208
793 3300005546 Ga0070696_100023729 Ga0070696_1000237298 208
794 3300005546 Ga0070696_100074654 Ga0070696_1000746544 208
795 3300005547 Ga0070693_100003889 Ga0070693_1000038893 208
796 3300005549 Ga0070704_100016233 Ga0070704_1000162333 208
797 3300005563 Ga0068855_100113736 Ga0068855_1001137363 208
798 3300005563 Ga0068855_100715308 Ga0068855_1007153082 208
799 3300005564 Ga0070664_100085232 Ga0070664_1000852322 208
800 3300005577 Ga0068857_100006037 Ga0068857_10000603715 208
801 3300005578 Ga0068854_100006037 Ga0068854_10000603713 208
802 3300005615 Ga0070702_100000378 Ga0070702_10000037820 208
803 3300005616 Ga0068852_100031220 Ga0068852_1000312202 208
804 3300005617 Ga0068859_100046039 Ga0068859_1000460398 208
805 3300005617 Ga0068859_100353461 Ga0068859_1003534612 208
806 3300005618 Ga0068864_100000595 Ga0068864_10000059524 208
807 3300005718 Ga0068866_10000834 Ga0068866_1000083414 208
808 3300005718 Ga0068866_10270379 Ga0068866_102703792 208
809 3300005719 Ga0068861_100233415 Ga0068861_1002334153 208
810 3300005840 Ga0068870_10000216 Ga0068870_1000021621 208
811 3300005841 Ga0068863_100012849 Ga0068863_10001284913 208
812 3300005842 Ga0068858_100286789 Ga0068858_1002867892 208
813 3300005842 Ga0068858_100288277 Ga0068858_1002882773 208
814 3300005843 Ga0068860_100036168 Ga0068860_1000361683 208
815 3300005843 Ga0068860_100092223 Ga0068860_1000922235 208
816 3300005844 Ga0068862_100303899 Ga0068862_1003038991 208
817 3300005844 Ga0068862_100412676 Ga0068862_1004126762 208
818 3300006042 Ga0075368_10204930 Ga0075368_102049301 208
819 3300006237 Ga0097621_100000600 Ga0097621_10000060018 208
820 3300006358 Ga0068871_100000118 Ga0068871_10000011814 208
821 3300006844 Ga0075428_100101121 Ga0075428_1001011211 208
822 3300006847 Ga0075431_100118944 Ga0075431_1001189446 208
823 3300006852 Ga0075433_10394272 Ga0075433_103942722 208
824 3300006871 Ga0075434_100018939 Ga0075434_1000189399 208
825 3300006871 Ga0075434_100352625 Ga0075434_1003526253 208
826 3300006881 Ga0068865_100019301 Ga0068865_1000193012 208
827 3300006881 Ga0068865_100437687 Ga0068865_1004376872 208
828 3300006914 Ga0075436_100524819 Ga0075436_1005248192 208
829 3300006931 Ga0097620_100046036 Ga0097620_1000460368 208
830 3300006931 Ga0097620_100353469 Ga0097620_1003534692 208
831 3300007076 Ga0075435_100012698 Ga0075435_1000126985 208
832 3300007265 Ga0099794_10077416 Ga0099794_100774162 208
833 3300009092 Ga0105250_10022913 Ga0105250_100229135 208
834 3300009093 Ga0105240_10222694 Ga0105240_102226946 208
835 3300009094 Ga0111539_10055701 Ga0111539_100557013 208
836 3300009094 Ga0111539_10065259 Ga0111539_100652598 208
837 3300009098 Ga0105245_10205279 Ga0105245_102052793 208
838 3300009101 Ga0105247_10129917 Ga0105247_101299173 208
839 3300009147 Ga0114129_10957088 Ga0114129_109570882 208
840 3300009148 Ga0105243_10009714 Ga0105243_1000971410 208
841 3300009174 Ga0105241_10114705 Ga0105241_101147052 208
842 3300009176 Ga0105242_10035447 Ga0105242_100354478 208
843 3300009177 Ga0105248_10266968 Ga0105248_102669683 208
844 3300009177 Ga0105248_11200461 Ga0105248_112004612 208
845 3300009545 Ga0105237_10670542 Ga0105237_106705422 208
846 3300009553 Ga0105249_10032777 Ga0105249_100327773 208
847 3300009553 Ga0105249_10048120 Ga0105249_100481203 208
848 3300010375 Ga0105239_10053808 Ga0105239_100538082 208
849 3300011119 Ga0105246_10002558 Ga0105246_1000255817 208
850 3300012485 Ga0157325_1000571 Ga0157325_10005713 208
851 3300012495 Ga0157323_1000357 Ga0157323_10003574 208
852 3300012505 Ga0157339_1003317 Ga0157339_10033173 208
853 3300012507 Ga0157342_1002329 Ga0157342_10023292 208
854 3300012513 Ga0157326_1003916 Ga0157326_10039162 208
855 3300013102 Ga0157371_10023400 Ga0157371_100234003 208
856 3300013296 Ga0157374_10021639 Ga0157374_1002163912 208
857 3300013306 Ga0163162_10368202 Ga0163162_103682022 208
858 3300013306 Ga0163162_10468616 Ga0163162_104686163 208
859 3300013308 Ga0157375_10007178 Ga0157375_100071782 208
860 3300013308 Ga0157375_10830601 Ga0157375_108306011 208
861 3300014326 Ga0157380_10131899 Ga0157380_101318993 208
862 3300014745 Ga0157377_10000628 Ga0157377_1000062819 208
863 3300014969 Ga0157376_10063679 Ga0157376_100636796 208
864 3300017792 Ga0163161_10000415 Ga0163161_100004159 208
865 3300025271 Ga0207666_1000185 Ga0207666_10001852 208
866 3300025271 Ga0207666_1000473 Ga0207666_10004732 208
867 3300025290 Ga0207673_1000115 Ga0207673_100011512 208
868 3300025315 Ga0207697_10006788 Ga0207697_100067882 208
869 3300025315 Ga0207697_10104371 Ga0207697_101043712 208
870 3300025711 Ga0207696_1040744 Ga0207696_10407443 208
871 3300025885 Ga0207653_10009209 Ga0207653_100092092 208
872 3300025893 Ga0207682_10000350 Ga0207682_1000035015 208
873 3300025899 Ga0207642_10001478 Ga0207642_1000147813 208
874 3300025899 Ga0207642_10226043 Ga0207642_102260432 208
875 3300025900 Ga0207710_10016235 Ga0207710_100162356 208
876 3300025901 Ga0207688_10000001 Ga0207688_10000001118 208
877 3300025903 Ga0207680_10063616 Ga0207680_100636162 208
878 3300025904 Ga0207647_10174606 Ga0207647_101746062 208
879 3300025904 Ga0207647_10174831 Ga0207647_101748312 208
880 3300025907 Ga0207645_10000222 Ga0207645_1000022251 208
881 3300025908 Ga0207643_10000009 Ga0207643_1000000919 208
882 3300025908 Ga0207643_10295507 Ga0207643_102955072 208
883 3300025912 Ga0207707_10006091 Ga0207707_1000609116 208
884 3300025912 Ga0207707_10506677 Ga0207707_105066772 208
885 3300025917 Ga0207660_10000197 Ga0207660_1000019733 208
886 3300025917 Ga0207660_10043689 Ga0207660_100436893 208
887 3300025918 Ga0207662_10210387 Ga0207662_102103872 208
888 3300025918 Ga0207662_10224236 Ga0207662_102242362 208
889 3300025919 Ga0207657_10301020 Ga0207657_103010202 208
890 3300025919 Ga0207657_10304387 Ga0207657_103043872 208
891 3300025920 Ga0207649_10000052 Ga0207649_10000052111 208
892 3300025921 Ga0207652_10001438 Ga0207652_100014382 208
893 3300025923 Ga0207681_10001135 Ga0207681_100011358 208
894 3300025923 Ga0207681_10026657 Ga0207681_100266573 208
895 3300025925 Ga0207650_10002693 Ga0207650_1000269315 208
896 3300025926 Ga0207659_10000132 Ga0207659_100001323 208
897 3300025926 Ga0207659_10326288 Ga0207659_103262882 208
898 3300025927 Ga0207687_10000174 Ga0207687_100001742 208
899 3300025931 Ga0207644_10000212 Ga0207644_1000021233 208
900 3300025932 Ga0207690_10001288 Ga0207690_1000128812 208
901 3300025932 Ga0207690_10029346 Ga0207690_100293467 208
902 3300025933 Ga0207706_10133993 Ga0207706_101339932 208
903 3300025933 Ga0207706_10270755 Ga0207706_102707553 208
904 3300025934 Ga0207686_10021579 Ga0207686_100215798 208
905 3300025935 Ga0207709_10000530 Ga0207709_1000053028 208
906 3300025936 Ga0207670_10000523 Ga0207670_100005233 208
907 3300025936 Ga0207670_10028318 Ga0207670_100283185 208
908 3300025937 Ga0207669_10000235 Ga0207669_1000023519 208
909 3300025938 Ga0207704_10000198 Ga0207704_1000019818 208
910 3300025938 Ga0207704_10275115 Ga0207704_102751152 208
911 3300025940 Ga0207691_10371561 Ga0207691_103715612 208
912 3300025941 Ga0207711_10006368 Ga0207711_100063687 208
913 3300025942 Ga0207689_10000031 Ga0207689_1000003197 208
914 3300025944 Ga0207661_10001228 Ga0207661_1000122823 208
915 3300025944 Ga0207661_10344571 Ga0207661_103445711 208
916 3300025945 Ga0207679_10000183 Ga0207679_1000018346 208
917 3300025949 Ga0207667_10064461 Ga0207667_100644616 208
918 3300025949 Ga0207667_10551587 Ga0207667_105515872 208
919 3300025960 Ga0207651_10000051 Ga0207651_1000005120 208
920 3300025961 Ga0207712_10001703 Ga0207712_1000170318 208
921 3300025961 Ga0207712_10029987 Ga0207712_100299877 208
922 3300025972 Ga0207668_10000664 Ga0207668_100006642 208
923 3300025981 Ga0207640_10000343 Ga0207640_1000034319 208
924 3300025986 Ga0207658_10289290 Ga0207658_102892901 208
925 3300026023 Ga0207677_10003168 Ga0207677_100031688 208
926 3300026035 Ga0207703_10069812 Ga0207703_100698126 208
927 3300026067 Ga0207678_10369882 Ga0207678_103698822 208
928 3300026067 Ga0207678_10370474 Ga0207678_103704742 208
929 3300026075 Ga0207708_10026728 Ga0207708_100267288 208
930 3300026075 Ga0207708_10385232 Ga0207708_103852322 208
931 3300026088 Ga0207641_10001831 Ga0207641_1000183115 208
932 3300026089 Ga0207648_10396214 Ga0207648_103962142 208
933 3300026095 Ga0207676_10000124 Ga0207676_1000012463 208
934 3300026116 Ga0207674_10129547 Ga0207674_101295475 208
935 3300026121 Ga0207683_10000242 Ga0207683_1000024214 208
936 3300026142 Ga0207698_10023331 Ga0207698_100233312 208
937 3300027252 Ga0209973_1000799 Ga0209973_10007993 208
938 3300027360 Ga0209969_1005910 Ga0209969_10059104 208
939 3300027424 Ga0209984_1011359 Ga0209984_10113592 208
940 3300027471 Ga0209995_1004561 Ga0209995_10045613 208
941 3300027526 Ga0209968_1001085 Ga0209968_10010855 208
942 3300027617 Ga0210002_1002000 Ga0210002_10020005 208
943 3300027665 Ga0209983_1006615 Ga0209983_10066155 208
944 3300027695 Ga0209966_1000641 Ga0209966_100064112 208
945 3300027717 Ga0209998_10008003 Ga0209998_100080032 208
946 3300027717 Ga0209998_10021146 Ga0209998_100211461 208
947 3300027876 Ga0209974_10005603 Ga0209974_100056036 208
948 3300027876 Ga0209974_10075719 Ga0209974_100757191 208
949 3300027876 Ga0209974_10167800 Ga0209974_101678001 208
950 3300027907 Ga0207428_10000037 Ga0207428_10000037212 208
951 3300027907 Ga0207428_10030716 Ga0207428_100307163 208
952 3300027907 Ga0207428_10469935 Ga0207428_104699352 208
953 3300028380 Ga0268265_10003320 Ga0268265_1000332011 208
954 3300028380 Ga0268265_10272456 Ga0268265_102724563 208
955 3300028381 Ga0268264_10420674 Ga0268264_104206742 208
956 3300031344 Ga0265316_10195630 Ga0265316_101956303 208
957 3300034816 Ga0373930_0000191 Ga0373930_0000191_3312_3986 208
958 3300034817 Ga0373948_0002325 Ga0373948_0002325_825_1499 208
959 3300034818 Ga0373950_0015306 Ga0373950_0015306_250_924 208
960 3300034819 Ga0373958_0002981 Ga0373958_0002981_1299_1973 208
961 3300034820 Ga0373959_0001384 Ga0373959_0001384_807_1481 208
962 3300034820 Ga0373959_0015275 Ga0373959_0015275_327_1001 208
963 3300034957 Ga0373938_0000013 Ga0373938_0000013_2448_3122 208
964 3300035084 Ga0373928_0000255 Ga0373928_0000255_8803_9477 208
965 3300035085 Ga0373929_0003185 Ga0373929_0003185_1021_1695 208
966 3300035088 Ga0373940_0001317 Ga0373940_0001317_3318_3992 208
967 3300035090 Ga0373949_0013466 Ga0373949_0013466_873_1547 208
968 3300035091 Ga0373951_0000552 Ga0373951_0000552_3939_4613 208
969 3300035091 Ga0373951_0020969 Ga0373951_0020969_223_897 208
970 3300035092 Ga0373952_0000182 Ga0373952_0000182_1289_1963 208
971 3300035112 Ga0373932_0000252 Ga0373932_0000252_703_1377 208
972 3300035112 Ga0373932_0012999 Ga0373932_0012999_1050_1724 208
973 3300035114 Ga0373939_0029054 Ga0373939_0029054_562_1236 208
974 3300035121 Ga0373960_0000068 Ga0373960_0000068_9809_10483 208
975 3300035121 Ga0373960_0002169 Ga0373960_0002169_3358_4032 208
976 3300035207 Ga0373942_0001815 Ga0373942_0001815_2446_3120 208
977 3300035241 Ga0373961_0003115 Ga0373961_0003115_3120_3794 208
978 3300035241 Ga0373961_0032972 Ga0373961_0032972_302_976 208
979 3300035242 Ga0373962_0000112 Ga0373962_0000112_11147_11821 208
980 3300035691 Ga0373931_0000305 Ga0373931_0000305_8572_9246 208
981 3300035691 Ga0373931_0001634 Ga0373931_0001634_2996_3670 208
982 3300042001 Ga0439441_032657 Ga0439441_032657_83_757 208
983 3300042013 Ga0439456_033005 Ga0439456_033005_278_952 208
984 3300042876 Ga0451577_0112731 Ga0451577_0112731_711_1385 208
985 3300044712 Ga0453684_0157702 Ga0453684_0157702_1651_2325 208
986 3300045051 Ga0451576_0205880 Ga0451576_0205880_429_1103 208
987 3300046491 Ga0495584_0168878 Ga0495584_0168878_369_1043 208
988 3300046684 Ga0495669_0015480 Ga0495669_0015480_1967_2641 208
989 3300048903 Ga0496100_0000345 Ga0496100_0000345_17152_17826 208
990 3300048904 Ga0496101_0000969 Ga0496101_0000969_13213_13887 208
991 3300048905 Ga0496102_0004376 Ga0496102_0004376_1803_2477 208
992 3300048905 Ga0496102_0089827 Ga0496102_0089827_1570_2244 208
993 3300048906 Ga0496103_0001732 Ga0496103_0001732_70_744 208
994 3300048909 Ga0496106_0075150 Ga0496106_0075150_1242_1916 208
995 3300048910 Ga0496107_0005598 Ga0496107_0005598_6257_6931 208
996 3300048911 Ga0496108_0031377 Ga0496108_0031377_1124_1798 208
997 3300048912 Ga0496109_0005949 Ga0496109_0005949_3363_4037 208
998 3300048912 Ga0496109_0414621 Ga0496109_0414621_376_1050 208
999 3300048913 Ga0496110_0100320 Ga0496110_0100320_1097_1771 208
1000 3300048915 Ga0496112_0410025 Ga0496112_0410025_405_1079 208
1001 3300048917 Ga0496114_0002647 Ga0496114_0002647_5061_5735 208
1002 3300048918 Ga0496115_0007035 Ga0496115_0007035_3209_3883 208
1003 3300049592 Ga0501076_0257319 Ga0501076_0257319_182_856 208
1004 3300050493 nmdc:mga0k408_67480_c1 nmdc:mga0k408_67480_c1_179_853 208
1005 3300050508 nmdc:mga09592_416483_c1 nmdc:mga09592_416483_c1_94_789 208
1006 3300050510 nmdc:mga06r32_93321_c1 nmdc:mga06r32_93321_c1_1760_2455 208
1007 3300050511 nmdc:mga08y16_3117_c1 nmdc:mga08y16_3117_c1_4181_4855 208
1008 3300050511 nmdc:mga08y16_333_c1 nmdc:mga08y16_333_c1_951_1625 208
1009 3300050512 nmdc:mga0n895_1174_c1 nmdc:mga0n895_1174_c1_2083_2757 208
1010 3300050513 nmdc:mga0rr50_202666_c1 nmdc:mga0rr50_202666_c1_270_944 208
1011 3300050514 nmdc:mga08x19_287479_c1 nmdc:mga08x19_287479_c1_154_828 208
1012 3300050515 nmdc:mga0a205_6917_c1 nmdc:mga0a205_6917_c1_7509_8183 208
1013 3300054114 Ga0501084_0062068 Ga0501084_0062068_966_1640 208
1014 3300060353 Ga0501082_0120716 Ga0501082_0120716_813_1487 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

76

132

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

136

229

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ore-assembly1.cif.gz_E release complex 70s 0.9748 31 207
8a63-assembly1.cif.gz_J cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9741 32 205
7azo-assembly1.cif.gz_L5A 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 0.9735 29 208
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.973 28 208
8crx-assembly1.cif.gz_f cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.9719 29 207
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9744 31 207 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9691 31 207 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9236 51 207 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9218 51 208 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8953 51 207 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A1F4J1V4-F1-model_v4 deleted 0.9974 95 208
AF-A0A2N3AXD5-F1-model_v4 Large ribosomal subunit protein uL5 0.9943 42 208 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3S1SWG3-F1-model_v4 deleted 0.9941 91 208
AF-A0A351A0X8-F1-model_v4 50S ribosomal protein L5 0.9937 91 208 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A520A9X5-F1-model_v4 Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL24; Large ribosomal subunit protein uL5] 0.9934 79 206 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
76.56 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map