F488192
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1013 | 329 | 2026 | 705 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10001457|Ga0081455_1000145723 |
| Length | 742 |
| Sequence | VNRARVLLLNAALGPLDYRVDREHVVEPGSIVLAPLGPRQIAGVVWEPERMPSDAEVGDNRLRPLASVYDIPPIAAPLRRLIEWTADYYLAPPAAVLRMALASASALEERRSVIEYRVTGLVPDRLTPQRAQALERIGERQGLVRELAMIADVTDAVIRGLVKAGAIESVEVTIDDPFPVPDPDHAPPDLSPEQQTAAAVLVAAVGKNVPRRKLGSSSDLAPIGAFKSEDSMTGPRPSPGNKADIFLLDGVTGSGKTEVYFEAIAEAIRQERQALVLLPEIALTEPFLRRFEARFGHQPVAWHSDLRQSQRRRAWRAIATGEAKVVVGARSALFLPYRNLGLIVVDEAHEASFKQEDGVMYHARDVAVMRGHFEGCPVILASATPAIETQQQVTLGRYRELKLPRRFGAAVMPDIAAVDMLADPPPRGRWLAPSLVRAIEETLERKEQVLLFLNRRGYAPLTLCRHCGHRFQCPNCTAWMVEHRLTARLACPECGEAESLVACGPGVERIADEVAALFPDARRAIVTSDTIWSPARAADFVARMETGEIDIVIGTQLVTKGYHFPNLTLVGVVDADLGLQGGDLRAAERSFQQIAQVSGRAGRGVKKGHVLVQTHEPGAPVIKALVSGDAASFYAAETASRKSANAPPFGRYAAIIVSSEVLEEAVETARMIGRTAPKVEGMRVYGPAPAXLAMLRARHRQRLLVHARRALDVQDVIRDWIGALEWPRGVRVAVDVDPYSFL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 206 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 207 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 208 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 209 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 210 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 211 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 212 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 264 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 265 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 266 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 267 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 268 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 269 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 272 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 273 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 281 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 282 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 284 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 285 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 286 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 287 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 295 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 296 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 297 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 298 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 300 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 301 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 302 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 305 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 306 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 309 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 312 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 314 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 315 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 316 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 317 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 318 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 319 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 320 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 321 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 322 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 323 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 324 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 325 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 326 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 327 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 328 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 329 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.22 |
| Metatranscriptomes | 0.2 |
| Isolates | 1.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.49 |
| Bulb | 0 |
| Endosphere | 7.5 |
| Nodule | 0 |
| Rhizoplane | 3.46 |
| Rhizosphere | 84.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10001457 | 3300005937 | Bacteria | 29274 |
| 2 | JGI24736J21556_1000147 | 3300001904 | Bacteria | 12247 |
| 3 | JGI24752J21851_1001367 | 3300001976 | Bacteria | 3296 |
| 4 | JGI24740J21852_10002826 | 3300001979 | Bacteria | 7762 |
| 5 | JGI24737J22298_10000878 | 3300001990 | Bacteria | 10727 |
| 6 | JGI24737J22298_10009088 | 3300001990 | Bacteria | 3311 |
| 7 | JGI24735J21928_10001266 | 3300002067 | Bacteria | 8973 |
| 8 | JGI24735J21928_10004279 | 3300002067 | Bacteria | 4814 |
| 9 | JGI24748J21848_1000054 | 3300002074 | Bacteria | 49652 |
| 10 | JGI24738J21930_10000337 | 3300002075 | Bacteria | 12812 |
| 11 | JGI24738J21930_10001002 | 3300002075 | Bacteria | 8087 |
| 12 | JGI24749J21850_1000089 | 3300002076 | Bacteria | 16491 |
| 13 | JGI24034J26672_10000022 | 3300002239 | Bacteria | 116342 |
| 14 | JGI24034J26672_10000052 | 3300002239 | Bacteria | 49811 |
| 15 | JGI24751J29686_10000211 | 3300002459 | Bacteria | 24751 |
| 16 | JGI25150J39212_1000349 | 3300002774 | Bacteria | 22660 |
| 17 | JGI25151J46595_10010171 | 3300003187 | Bacteria | 4391 |
| 18 | JGI25165J46597_1000043 | 3300003214 | Bacteria | 264515 |
| 19 | JGI25165J46597_1000445 | 3300003214 | Bacteria | 41632 |
| 20 | JGI25153J46596_10000715 | 3300003215 | Bacteria | 20302 |
| 21 | Ga0055537_1003207 | 3300003773 | Bacteria | 5109 |
| 22 | Ga0055537_1004434 | 3300003773 | Bacteria | 4016 |
| 23 | Ga0055524_1000209 | 3300003775 | Bacteria | 62993 |
| 24 | Ga0055530_10000131 | 3300003791 | Bacteria | 65535 |
| 25 | Ga0055530_10005544 | 3300003791 | Bacteria | 5957 |
| 26 | Ga0055540_1000884 | 3300003792 | Bacteria | 19850 |
| 27 | Ga0055531_10000514 | 3300003794 | Bacteria | 34947 |
| 28 | Ga0055531_10001213 | 3300003794 | Bacteria | 19774 |
| 29 | Ga0055531_10012654 | 3300003794 | Bacteria | 3952 |
| 30 | Ga0055531_10012656 | 3300003794 | Bacteria | 3952 |
| 31 | Ga0065165_1001460 | 3300005262 | Bacteria | 25510 |
| 32 | Ga0065165_1002740 | 3300005262 | Bacteria | 14065 |
| 33 | Ga0065165_1005614 | 3300005262 | Bacteria | 6948 |
| 34 | Ga0065704_10072750 | 3300005289 | Bacteria | 8060 |
| 35 | Ga0065715_10090627 | 3300005293 | Bacteria | 6712 |
| 36 | Ga0065707_10084485 | 3300005295 | Bacteria | 7154 |
| 37 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 38 | Ga0070658_10001115 | 3300005327 | Bacteria | 22930 |
| 39 | Ga0070658_10001347 | 3300005327 | Bacteria | 20977 |
| 40 | Ga0070658_10004856 | 3300005327 | Bacteria | 10948 |
| 41 | Ga0070658_10006282 | 3300005327 | Bacteria | 9623 |
| 42 | Ga0070658_10009163 | 3300005327 | Bacteria | 7956 |
| 43 | Ga0070658_10009294 | 3300005327 | Bacteria | 7906 |
| 44 | Ga0070658_10014226 | 3300005327 | Bacteria | 6386 |
| 45 | Ga0070658_10024406 | 3300005327 | Bacteria | 4850 |
| 46 | Ga0070658_10036889 | 3300005327 | Bacteria | 3939 |
| 47 | Ga0070658_10056723 | 3300005327 | Bacteria | 3184 |
| 48 | Ga0070683_100049156 | 3300005329 | Bacteria | 3900 |
| 49 | Ga0070690_100000038 | 3300005330 | Bacteria | 60092 |
| 50 | Ga0070670_100000012 | 3300005331 | Bacteria | 256314 |
| 51 | Ga0070670_100000125 | 3300005331 | Bacteria | 71778 |
| 52 | Ga0070670_100000517 | 3300005331 | Bacteria | 30886 |
| 53 | Ga0070670_100001836 | 3300005331 | Bacteria | 17303 |
| 54 | Ga0070670_100003954 | 3300005331 | Bacteria | 12367 |
| 55 | Ga0070670_100006594 | 3300005331 | Bacteria | 9838 |
| 56 | Ga0070670_100007253 | 3300005331 | Bacteria | 9397 |
| 57 | Ga0070670_100007633 | 3300005331 | Bacteria | 9190 |
| 58 | Ga0070670_100011972 | 3300005331 | Bacteria | 7421 |
| 59 | Ga0070670_100024317 | 3300005331 | Bacteria | 5210 |
| 60 | Ga0070670_100056973 | 3300005331 | Bacteria | 3355 |
| 61 | Ga0070670_100075020 | 3300005331 | Bacteria | 2906 |
| 62 | Ga0070677_10002056 | 3300005333 | Bacteria | 6407 |
| 63 | Ga0070677_10007615 | 3300005333 | Bacteria | 3621 |
| 64 | Ga0070666_10000002 | 3300005335 | Bacteria | 478684 |
| 65 | Ga0070666_10001023 | 3300005335 | Bacteria | 17149 |
| 66 | Ga0070666_10010671 | 3300005335 | Bacteria | 5751 |
| 67 | Ga0070666_10012267 | 3300005335 | Bacteria | 5400 |
| 68 | Ga0070680_100004659 | 3300005336 | Bacteria | 10313 |
| 69 | Ga0070680_100011939 | 3300005336 | Bacteria | 6739 |
| 70 | Ga0070680_100018665 | 3300005336 | Bacteria | 5485 |
| 71 | Ga0070680_100045105 | 3300005336 | Bacteria | 3583 |
| 72 | Ga0068868_100000752 | 3300005338 | Bacteria | 21953 |
| 73 | Ga0068868_100001006 | 3300005338 | Bacteria | 19279 |
| 74 | Ga0068868_100006922 | 3300005338 | Bacteria | 8057 |
| 75 | Ga0070660_100000322 | 3300005339 | Bacteria | 31658 |
| 76 | Ga0070660_100000862 | 3300005339 | Bacteria | 20203 |
| 77 | Ga0070660_100001455 | 3300005339 | Bacteria | 16192 |
| 78 | Ga0070660_100002916 | 3300005339 | Bacteria | 11778 |
| 79 | Ga0070660_100004357 | 3300005339 | Bacteria | 9775 |
| 80 | Ga0070660_100005333 | 3300005339 | Bacteria | 8896 |
| 81 | Ga0070660_100009539 | 3300005339 | Bacteria | 6835 |
| 82 | Ga0070660_100026922 | 3300005339 | Bacteria | 4285 |
| 83 | Ga0070660_100044767 | 3300005339 | Bacteria | 3386 |
| 84 | Ga0070691_10005365 | 3300005341 | Bacteria | 5832 |
| 85 | Ga0070661_100000189 | 3300005344 | Bacteria | 51018 |
| 86 | Ga0070661_100016453 | 3300005344 | Bacteria | 5229 |
| 87 | Ga0070661_100033400 | 3300005344 | Bacteria | 3726 |
| 88 | Ga0070661_100040827 | 3300005344 | Bacteria | 3386 |
| 89 | Ga0070661_100043637 | 3300005344 | Bacteria | 3275 |
| 90 | Ga0070668_100000004 | 3300005347 | Bacteria | 189408 |
| 91 | Ga0070668_100001775 | 3300005347 | Bacteria | 15678 |
| 92 | Ga0070668_100003499 | 3300005347 | Bacteria | 11577 |
| 93 | Ga0070668_100008189 | 3300005347 | Bacteria | 7765 |
| 94 | Ga0070668_100009224 | 3300005347 | Bacteria | 7316 |
| 95 | Ga0070668_100018413 | 3300005347 | Bacteria | 5243 |
| 96 | Ga0070668_100051271 | 3300005347 | Bacteria | 3179 |
| 97 | Ga0070668_100075285 | 3300005347 | Bacteria | 2635 |
| 98 | Ga0070669_100000001 | 3300005353 | Bacteria | 537589 |
| 99 | Ga0070669_100000041 | 3300005353 | Bacteria | 127426 |
| 100 | Ga0070669_100000237 | 3300005353 | Bacteria | 45913 |
| 101 | Ga0070669_100004048 | 3300005353 | Bacteria | 10601 |
| 102 | Ga0070669_100051823 | 3300005353 | Bacteria | 3001 |
| 103 | Ga0070675_100000201 | 3300005354 | Bacteria | 37824 |
| 104 | Ga0070675_100001388 | 3300005354 | Bacteria | 17768 |
| 105 | Ga0070675_100014605 | 3300005354 | Bacteria | 6192 |
| 106 | Ga0070671_100000007 | 3300005355 | Bacteria | 250397 |
| 107 | Ga0070671_100000730 | 3300005355 | Bacteria | 23532 |
| 108 | Ga0070671_100000951 | 3300005355 | Bacteria | 21207 |
| 109 | Ga0070671_100001205 | 3300005355 | Bacteria | 19357 |
| 110 | Ga0070671_100005522 | 3300005355 | Bacteria | 10071 |
| 111 | Ga0070671_100007391 | 3300005355 | Bacteria | 8777 |
| 112 | Ga0070671_100008497 | 3300005355 | Bacteria | 8230 |
| 113 | Ga0070671_100024114 | 3300005355 | Bacteria | 4979 |
| 114 | Ga0070671_100064067 | 3300005355 | Bacteria | 3062 |
| 115 | Ga0070674_100007252 | 3300005356 | Bacteria | 6529 |
| 116 | Ga0070673_100000006 | 3300005364 | Bacteria | 184299 |
| 117 | Ga0070673_100010352 | 3300005364 | Bacteria | 6311 |
| 118 | Ga0070673_100030287 | 3300005364 | Bacteria | 4046 |
| 119 | Ga0070688_100001147 | 3300005365 | Bacteria | 13242 |
| 120 | Ga0070659_100000032 | 3300005366 | Bacteria | 120241 |
| 121 | Ga0070659_100001498 | 3300005366 | Bacteria | 16822 |
| 122 | Ga0070659_100007541 | 3300005366 | Bacteria | 7907 |
| 123 | Ga0070659_100019042 | 3300005366 | Bacteria | 5190 |
| 124 | Ga0070659_100073404 | 3300005366 | Bacteria | 2723 |
| 125 | Ga0070659_100075295 | 3300005366 | Bacteria | 2690 |
| 126 | Ga0070667_100000024 | 3300005367 | Bacteria | 191216 |
| 127 | Ga0070667_100000037 | 3300005367 | Bacteria | 172343 |
| 128 | Ga0070667_100000273 | 3300005367 | Bacteria | 58596 |
| 129 | Ga0070667_100000319 | 3300005367 | Bacteria | 53623 |
| 130 | Ga0070667_100000836 | 3300005367 | Bacteria | 28641 |
| 131 | Ga0070667_100001215 | 3300005367 | Bacteria | 23486 |
| 132 | Ga0070667_100001851 | 3300005367 | Bacteria | 18782 |
| 133 | Ga0070667_100005679 | 3300005367 | Bacteria | 10420 |
| 134 | Ga0070667_100006741 | 3300005367 | Bacteria | 9540 |
| 135 | Ga0070667_100022003 | 3300005367 | Bacteria | 5290 |
| 136 | Ga0070667_100023080 | 3300005367 | Bacteria | 5161 |
| 137 | Ga0070667_100023944 | 3300005367 | Bacteria | 5070 |
| 138 | Ga0070667_100031595 | 3300005367 | Bacteria | 4414 |
| 139 | Ga0070667_100048234 | 3300005367 | Bacteria | 3584 |
| 140 | Ga0070709_10014179 | 3300005434 | Bacteria | 4503 |
| 141 | Ga0070714_100007541 | 3300005435 | Bacteria | 8469 |
| 142 | Ga0070714_100044833 | 3300005435 | Bacteria | 3745 |
| 143 | Ga0070713_100005958 | 3300005436 | Bacteria | 8384 |
| 144 | Ga0070694_100005190 | 3300005444 | Bacteria | 7865 |
| 145 | Ga0070678_100002055 | 3300005456 | Bacteria | 10907 |
| 146 | Ga0070678_100006988 | 3300005456 | Bacteria | 6664 |
| 147 | Ga0070662_100000049 | 3300005457 | Bacteria | 64630 |
| 148 | Ga0070662_100002297 | 3300005457 | Bacteria | 11741 |
| 149 | Ga0070662_100007584 | 3300005457 | Bacteria | 7041 |
| 150 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 151 | Ga0068867_100012857 | 3300005459 | Bacteria | 5925 |
| 152 | Ga0070679_100000019 | 3300005530 | Bacteria | 127108 |
| 153 | Ga0070679_100046220 | 3300005530 | Bacteria | 4339 |
| 154 | Ga0070679_100077629 | 3300005530 | Bacteria | 3310 |
| 155 | Ga0070679_100094715 | 3300005530 | Bacteria | 2973 |
| 156 | Ga0070684_100007236 | 3300005535 | Bacteria | 8625 |
| 157 | Ga0070684_100009573 | 3300005535 | Bacteria | 7634 |
| 158 | Ga0068853_100008695 | 3300005539 | Bacteria | 8166 |
| 159 | Ga0068853_100079691 | 3300005539 | Bacteria | 2864 |
| 160 | Ga0068853_100090576 | 3300005539 | Bacteria | 2688 |
| 161 | Ga0070672_100003314 | 3300005543 | Bacteria | 10425 |
| 162 | Ga0070672_100004957 | 3300005543 | Bacteria | 8764 |
| 163 | Ga0070672_100010561 | 3300005543 | Bacteria | 6408 |
| 164 | Ga0070686_100000003 | 3300005544 | Bacteria | 308397 |
| 165 | Ga0070686_100000490 | 3300005544 | Bacteria | 23906 |
| 166 | Ga0070693_100045150 | 3300005547 | Bacteria | 2496 |
| 167 | Ga0070665_100000036 | 3300005548 | Bacteria | 314603 |
| 168 | Ga0070665_100000089 | 3300005548 | Bacteria | 177659 |
| 169 | Ga0070665_100001268 | 3300005548 | Bacteria | 30326 |
| 170 | Ga0070665_100001846 | 3300005548 | Bacteria | 24054 |
| 171 | Ga0070665_100028906 | 3300005548 | Bacteria | 5580 |
| 172 | Ga0070665_100087480 | 3300005548 | Bacteria | 3121 |
| 173 | Ga0068855_100000684 | 3300005563 | Bacteria | 41463 |
| 174 | Ga0068855_100006131 | 3300005563 | Bacteria | 14659 |
| 175 | Ga0068855_100006764 | 3300005563 | Bacteria | 13908 |
| 176 | Ga0068855_100015361 | 3300005563 | Bacteria | 9217 |
| 177 | Ga0068855_100059537 | 3300005563 | Bacteria | 4468 |
| 178 | Ga0068855_100069687 | 3300005563 | Bacteria | 4092 |
| 179 | Ga0070664_100000322 | 3300005564 | Bacteria | 34843 |
| 180 | Ga0070664_100001418 | 3300005564 | Bacteria | 19109 |
| 181 | Ga0070664_100006602 | 3300005564 | Bacteria | 9354 |
| 182 | Ga0070664_100012169 | 3300005564 | Bacteria | 6992 |
| 183 | Ga0070664_100090075 | 3300005564 | Bacteria | 2655 |
| 184 | Ga0068857_100004087 | 3300005577 | Bacteria | 12294 |
| 185 | Ga0068857_100006935 | 3300005577 | Bacteria | 9750 |
| 186 | Ga0068857_100013154 | 3300005577 | Bacteria | 7212 |
| 187 | Ga0068857_100023796 | 3300005577 | Bacteria | 5393 |
| 188 | Ga0068854_100000227 | 3300005578 | Bacteria | 38075 |
| 189 | Ga0068854_100005644 | 3300005578 | Bacteria | 7905 |
| 190 | Ga0068856_100000219 | 3300005614 | Bacteria | 61699 |
| 191 | Ga0068856_100005890 | 3300005614 | Bacteria | 12085 |
| 192 | Ga0068856_100026966 | 3300005614 | Bacteria | 5604 |
| 193 | Ga0068852_100000145 | 3300005616 | Bacteria | 47983 |
| 194 | Ga0068852_100001923 | 3300005616 | Bacteria | 14149 |
| 195 | Ga0068852_100008521 | 3300005616 | Bacteria | 7563 |
| 196 | Ga0068852_100022979 | 3300005616 | Bacteria | 5010 |
| 197 | Ga0068852_100054569 | 3300005616 | Bacteria | 3445 |
| 198 | Ga0068859_100000294 | 3300005617 | Bacteria | 49703 |
| 199 | Ga0068859_100004758 | 3300005617 | Bacteria | 13803 |
| 200 | Ga0068859_100008230 | 3300005617 | Bacteria | 10580 |
| 201 | Ga0068859_100016626 | 3300005617 | Bacteria | 7385 |
| 202 | Ga0068859_100050792 | 3300005617 | Bacteria | 4166 |
| 203 | Ga0068859_100066011 | 3300005617 | Bacteria | 3653 |
| 204 | Ga0068864_100000010 | 3300005618 | Bacteria | 358723 |
| 205 | Ga0068864_100000078 | 3300005618 | Bacteria | 103622 |
| 206 | Ga0068864_100000098 | 3300005618 | Bacteria | 85661 |
| 207 | Ga0068864_100009937 | 3300005618 | Bacteria | 7849 |
| 208 | Ga0068864_100011924 | 3300005618 | Bacteria | 7179 |
| 209 | Ga0068864_100022589 | 3300005618 | Bacteria | 5275 |
| 210 | Ga0068864_100031073 | 3300005618 | Bacteria | 4530 |
| 211 | Ga0068861_100018517 | 3300005719 | Bacteria | 4961 |
| 212 | Ga0068861_100039024 | 3300005719 | Bacteria | 3542 |
| 213 | Ga0068863_100000034 | 3300005841 | Bacteria | 168359 |
| 214 | Ga0068863_100000082 | 3300005841 | Bacteria | 105688 |
| 215 | Ga0068863_100000127 | 3300005841 | Bacteria | 80572 |
| 216 | Ga0068863_100000882 | 3300005841 | Bacteria | 30167 |
| 217 | Ga0068863_100002440 | 3300005841 | Bacteria | 18462 |
| 218 | Ga0068863_100002504 | 3300005841 | Bacteria | 18262 |
| 219 | Ga0068863_100007580 | 3300005841 | Bacteria | 10614 |
| 220 | Ga0068863_100013498 | 3300005841 | Bacteria | 7880 |
| 221 | Ga0068863_100071671 | 3300005841 | Bacteria | 3278 |
| 222 | Ga0068858_100000466 | 3300005842 | Bacteria | 42207 |
| 223 | Ga0068858_100002681 | 3300005842 | Bacteria | 17926 |
| 224 | Ga0068858_100002977 | 3300005842 | Bacteria | 17000 |
| 225 | Ga0068858_100008938 | 3300005842 | Bacteria | 9602 |
| 226 | Ga0068858_100012035 | 3300005842 | Bacteria | 8155 |
| 227 | Ga0068858_100018807 | 3300005842 | Bacteria | 6464 |
| 228 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 229 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 230 | Ga0068860_100000269 | 3300005843 | Bacteria | 76230 |
| 231 | Ga0068860_100000938 | 3300005843 | Bacteria | 32302 |
| 232 | Ga0068860_100002576 | 3300005843 | Bacteria | 18976 |
| 233 | Ga0068860_100003990 | 3300005843 | Bacteria | 15145 |
| 234 | Ga0068860_100017254 | 3300005843 | Bacteria | 7036 |
| 235 | Ga0068860_100020669 | 3300005843 | Bacteria | 6377 |
| 236 | Ga0068860_100031311 | 3300005843 | Bacteria | 5113 |
| 237 | Ga0068860_100042017 | 3300005843 | Bacteria | 4368 |
| 238 | Ga0068862_100000016 | 3300005844 | Bacteria | 250031 |
| 239 | Ga0068862_100000133 | 3300005844 | Bacteria | 86113 |
| 240 | Ga0068862_100000236 | 3300005844 | Bacteria | 61275 |
| 241 | Ga0068862_100000561 | 3300005844 | Bacteria | 38672 |
| 242 | Ga0068862_100000580 | 3300005844 | Bacteria | 38040 |
| 243 | Ga0068862_100000736 | 3300005844 | Bacteria | 32921 |
| 244 | Ga0068862_100085040 | 3300005844 | Bacteria | 2749 |
| 245 | Ga0081539_10009174 | 3300005985 | Bacteria | 8344 |
| 246 | Ga0081539_10024161 | 3300005985 | Bacteria | 3953 |
| 247 | Ga0070717_10006356 | 3300006028 | Bacteria | 8687 |
| 248 | Ga0070717_10023147 | 3300006028 | Bacteria | 4918 |
| 249 | Ga0075368_10000060 | 3300006042 | Bacteria | 26223 |
| 250 | Ga0070712_100049134 | 3300006175 | Bacteria | 2928 |
| 251 | Ga0097621_100020213 | 3300006237 | Bacteria | 5129 |
| 252 | Ga0068871_100006672 | 3300006358 | Bacteria | 8186 |
| 253 | Ga0075433_10021235 | 3300006852 | Bacteria | 5443 |
| 254 | Ga0068865_100000003 | 3300006881 | Bacteria | 231761 |
| 255 | Ga0097620_100000294 | 3300006931 | Bacteria | 49703 |
| 256 | Ga0097620_100004758 | 3300006931 | Bacteria | 13803 |
| 257 | Ga0097620_100008230 | 3300006931 | Bacteria | 10580 |
| 258 | Ga0097620_100016626 | 3300006931 | Bacteria | 7385 |
| 259 | Ga0097620_100044640 | 3300006931 | Bacteria | 4453 |
| 260 | Ga0097620_100050794 | 3300006931 | Bacteria | 4166 |
| 261 | Ga0097620_100066009 | 3300006931 | Bacteria | 3653 |
| 262 | Ga0105251_10000741 | 3300009011 | Bacteria | 29926 |
| 263 | Ga0105251_10016572 | 3300009011 | Bacteria | 3978 |
| 264 | Ga0105240_10004567 | 3300009093 | Bacteria | 20996 |
| 265 | Ga0105240_10010741 | 3300009093 | Bacteria | 12846 |
| 266 | Ga0105240_10018147 | 3300009093 | Bacteria | 9459 |
| 267 | Ga0105240_10022913 | 3300009093 | Bacteria | 8273 |
| 268 | Ga0105240_10079325 | 3300009093 | Bacteria | 4040 |
| 269 | Ga0105245_10054918 | 3300009098 | Bacteria | 3577 |
| 270 | Ga0105243_10001081 | 3300009148 | Bacteria | 24937 |
| 271 | Ga0105243_10048481 | 3300009148 | Bacteria | 3348 |
| 272 | Ga0105242_10002812 | 3300009176 | Bacteria | 13637 |
| 273 | Ga0105248_10000016 | 3300009177 | Bacteria | 308151 |
| 274 | Ga0105248_10000413 | 3300009177 | Bacteria | 49136 |
| 275 | Ga0105248_10001367 | 3300009177 | Bacteria | 27254 |
| 276 | Ga0105248_10002175 | 3300009177 | Bacteria | 21708 |
| 277 | Ga0105248_10004633 | 3300009177 | Bacteria | 15207 |
| 278 | Ga0105248_10007162 | 3300009177 | Bacteria | 12236 |
| 279 | Ga0105248_10010420 | 3300009177 | Bacteria | 10235 |
| 280 | Ga0105248_10037189 | 3300009177 | Bacteria | 5445 |
| 281 | Ga0105248_10122221 | 3300009177 | Bacteria | 2937 |
| 282 | Ga0105248_10142088 | 3300009177 | Bacteria | 2708 |
| 283 | Ga0105248_10156080 | 3300009177 | Bacteria | 2575 |
| 284 | Ga0105237_10034586 | 3300009545 | Bacteria | 5116 |
| 285 | Ga0105237_10054262 | 3300009545 | Bacteria | 4016 |
| 286 | Ga0105237_10104268 | 3300009545 | Bacteria | 2827 |
| 287 | Ga0105238_10050958 | 3300009551 | Bacteria | 4166 |
| 288 | Ga0105249_10000026 | 3300009553 | Bacteria | 232053 |
| 289 | Ga0105249_10000116 | 3300009553 | Bacteria | 108394 |
| 290 | Ga0105249_10000244 | 3300009553 | Bacteria | 60263 |
| 291 | Ga0105249_10003824 | 3300009553 | Bacteria | 12988 |
| 292 | Ga0105249_10081919 | 3300009553 | Bacteria | 3001 |
| 293 | Ga0105239_10000461 | 3300010375 | Bacteria | 59449 |
| 294 | Ga0157373_10027756 | 3300013100 | Bacteria | 4084 |
| 295 | Ga0157371_10003996 | 3300013102 | Bacteria | 13066 |
| 296 | Ga0157371_10011083 | 3300013102 | Bacteria | 6981 |
| 297 | Ga0157370_10000507 | 3300013104 | Bacteria | 48626 |
| 298 | Ga0157370_10001258 | 3300013104 | Bacteria | 31653 |
| 299 | Ga0157370_10014466 | 3300013104 | Bacteria | 8066 |
| 300 | Ga0157370_10030819 | 3300013104 | Bacteria | 5254 |
| 301 | Ga0157370_10042854 | 3300013104 | Bacteria | 4358 |
| 302 | Ga0157369_10002111 | 3300013105 | Bacteria | 23970 |
| 303 | Ga0157369_10002650 | 3300013105 | Bacteria | 21365 |
| 304 | Ga0157369_10003933 | 3300013105 | Bacteria | 17627 |
| 305 | Ga0157369_10012487 | 3300013105 | Bacteria | 9637 |
| 306 | Ga0157369_10033310 | 3300013105 | Bacteria | 5662 |
| 307 | Ga0157369_10086608 | 3300013105 | Bacteria | 3345 |
| 308 | Ga0157374_10002117 | 3300013296 | Bacteria | 16704 |
| 309 | Ga0157374_10008502 | 3300013296 | Bacteria | 8781 |
| 310 | Ga0163162_10014543 | 3300013306 | Bacteria | 7690 |
| 311 | Ga0163162_10081721 | 3300013306 | Bacteria | 3302 |
| 312 | Ga0157372_10006625 | 3300013307 | Bacteria | 12328 |
| 313 | Ga0157372_10050441 | 3300013307 | Bacteria | 4629 |
| 314 | Ga0157372_10064916 | 3300013307 | Bacteria | 4097 |
| 315 | Ga0157375_10002436 | 3300013308 | Bacteria | 16100 |
| 316 | Ga0157375_10006830 | 3300013308 | Bacteria | 9941 |
| 317 | Ga0157375_10009604 | 3300013308 | Bacteria | 8498 |
| 318 | Ga0163163_10000258 | 3300014325 | Bacteria | 53627 |
| 319 | Ga0163163_10000355 | 3300014325 | Bacteria | 44183 |
| 320 | Ga0163163_10043116 | 3300014325 | Bacteria | 4421 |
| 321 | Ga0157380_10000120 | 3300014326 | Bacteria | 43644 |
| 322 | Ga0157380_10000896 | 3300014326 | Bacteria | 18732 |
| 323 | Ga0157380_10033709 | 3300014326 | Bacteria | 3944 |
| 324 | Ga0157377_10025825 | 3300014745 | Bacteria | 3137 |
| 325 | Ga0157379_10004801 | 3300014968 | Bacteria | 11614 |
| 326 | Ga0183363_1002 | 3300015690 | Bacteria | 425040 |
| 327 | Ga0163161_10000008 | 3300017792 | Bacteria | 294642 |
| 328 | Ga0163161_10074097 | 3300017792 | Bacteria | 2496 |
| 329 | Ga0206356_10388316 | 3300020070 | Bacteria | 3652 |
| 330 | Ga0206354_10280634 | 3300020081 | Bacteria | 8484 |
| 331 | Ga0213873_10000007 | 3300021358 | Bacteria | 309961 |
| 332 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 333 | Ga0213876_10000332 | 3300021384 | Bacteria | 41214 |
| 334 | Ga0213876_10008814 | 3300021384 | Bacteria | 5446 |
| 335 | Ga0213875_10005221 | 3300021388 | Bacteria | 7011 |
| 336 | Ga0213875_10006567 | 3300021388 | Bacteria | 6087 |
| 337 | Ga0209147_101223 | 3300025229 | Bacteria | 10246 |
| 338 | Ga0207427_100449 | 3300025231 | Bacteria | 22786 |
| 339 | Ga0207425_1000094 | 3300025245 | Bacteria | 85629 |
| 340 | Ga0209026_1002660 | 3300025250 | Bacteria | 6490 |
| 341 | Ga0209148_1000117 | 3300025254 | Bacteria | 188938 |
| 342 | Ga0209233_1000079 | 3300025261 | Bacteria | 346944 |
| 343 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 344 | Ga0209565_1000386 | 3300025263 | Bacteria | 37364 |
| 345 | Ga0209455_1000579 | 3300025272 | Bacteria | 23844 |
| 346 | Ga0209673_1004883 | 3300025273 | Bacteria | 6993 |
| 347 | Ga0209673_1009923 | 3300025273 | Bacteria | 4067 |
| 348 | Ga0209676_1002762 | 3300025292 | Bacteria | 11741 |
| 349 | Ga0209025_1000727 | 3300025294 | Bacteria | 55857 |
| 350 | Ga0209564_1001341 | 3300025295 | Bacteria | 26209 |
| 351 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 352 | Ga0209758_1000108 | 3300025297 | Bacteria | 216541 |
| 353 | Ga0209758_1002726 | 3300025297 | Bacteria | 17387 |
| 354 | Ga0209050_1000342 | 3300025298 | Bacteria | 92644 |
| 355 | Ga0209050_1000347 | 3300025298 | Bacteria | 90767 |
| 356 | Ga0209050_1005484 | 3300025298 | Bacteria | 7943 |
| 357 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 358 | Ga0209051_1000226 | 3300025303 | Bacteria | 94990 |
| 359 | Ga0209257_1000371 | 3300025304 | Bacteria | 90767 |
| 360 | Ga0209257_1001924 | 3300025304 | Bacteria | 22420 |
| 361 | Ga0209257_1002720 | 3300025304 | Bacteria | 16819 |
| 362 | Ga0209257_1005943 | 3300025304 | Bacteria | 8199 |
| 363 | Ga0207697_10000041 | 3300025315 | Bacteria | 48652 |
| 364 | Ga0207697_10004435 | 3300025315 | Bacteria | 6708 |
| 365 | Ga0207713_1002691 | 3300025735 | Bacteria | 12708 |
| 366 | Ga0207682_10001142 | 3300025893 | Bacteria | 12295 |
| 367 | Ga0207682_10001680 | 3300025893 | Bacteria | 10144 |
| 368 | Ga0207682_10006199 | 3300025893 | Bacteria | 4833 |
| 369 | Ga0207682_10014465 | 3300025893 | Bacteria | 3074 |
| 370 | Ga0207688_10043279 | 3300025901 | Bacteria | 2507 |
| 371 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 372 | Ga0207680_10000377 | 3300025903 | Bacteria | 21333 |
| 373 | Ga0207680_10004847 | 3300025903 | Bacteria | 6400 |
| 374 | Ga0207680_10008148 | 3300025903 | Bacteria | 5134 |
| 375 | Ga0207647_10000746 | 3300025904 | Bacteria | 25516 |
| 376 | Ga0207647_10002493 | 3300025904 | Bacteria | 13942 |
| 377 | Ga0207647_10005416 | 3300025904 | Bacteria | 9361 |
| 378 | Ga0207647_10005436 | 3300025904 | Bacteria | 9336 |
| 379 | Ga0207647_10017017 | 3300025904 | Bacteria | 4950 |
| 380 | Ga0207647_10017332 | 3300025904 | Bacteria | 4897 |
| 381 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 382 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 383 | Ga0207705_10000076 | 3300025909 | Bacteria | 122975 |
| 384 | Ga0207705_10000689 | 3300025909 | Bacteria | 27957 |
| 385 | Ga0207705_10001091 | 3300025909 | Bacteria | 22077 |
| 386 | Ga0207705_10003708 | 3300025909 | Bacteria | 11630 |
| 387 | Ga0207705_10004401 | 3300025909 | Bacteria | 10644 |
| 388 | Ga0207705_10009167 | 3300025909 | Bacteria | 7209 |
| 389 | Ga0207705_10010637 | 3300025909 | Bacteria | 6683 |
| 390 | Ga0207705_10012868 | 3300025909 | Bacteria | 6040 |
| 391 | Ga0207705_10018123 | 3300025909 | Bacteria | 5034 |
| 392 | Ga0207705_10020071 | 3300025909 | Bacteria | 4778 |
| 393 | Ga0207705_10024959 | 3300025909 | Bacteria | 4266 |
| 394 | Ga0207705_10032478 | 3300025909 | Bacteria | 3730 |
| 395 | Ga0207707_10012625 | 3300025912 | Bacteria | 7340 |
| 396 | Ga0207695_10001501 | 3300025913 | Bacteria | 38827 |
| 397 | Ga0207695_10006489 | 3300025913 | Bacteria | 15170 |
| 398 | Ga0207695_10008479 | 3300025913 | Bacteria | 12860 |
| 399 | Ga0207695_10010486 | 3300025913 | Bacteria | 11335 |
| 400 | Ga0207695_10026200 | 3300025913 | Bacteria | 6509 |
| 401 | Ga0207695_10028820 | 3300025913 | Bacteria | 6147 |
| 402 | Ga0207671_10004616 | 3300025914 | Bacteria | 13070 |
| 403 | Ga0207693_10018427 | 3300025915 | Bacteria | 5562 |
| 404 | Ga0207660_10000211 | 3300025917 | Bacteria | 37354 |
| 405 | Ga0207660_10000241 | 3300025917 | Bacteria | 35515 |
| 406 | Ga0207660_10005125 | 3300025917 | Bacteria | 8525 |
| 407 | Ga0207660_10015903 | 3300025917 | Bacteria | 4974 |
| 408 | Ga0207657_10000601 | 3300025919 | Bacteria | 38257 |
| 409 | Ga0207657_10001227 | 3300025919 | Bacteria | 27358 |
| 410 | Ga0207657_10001234 | 3300025919 | Bacteria | 27316 |
| 411 | Ga0207657_10001913 | 3300025919 | Bacteria | 22483 |
| 412 | Ga0207657_10006863 | 3300025919 | Bacteria | 11745 |
| 413 | Ga0207657_10007072 | 3300025919 | Bacteria | 11529 |
| 414 | Ga0207657_10009429 | 3300025919 | Bacteria | 9811 |
| 415 | Ga0207657_10012931 | 3300025919 | Bacteria | 8207 |
| 416 | Ga0207657_10014626 | 3300025919 | Bacteria | 7646 |
| 417 | Ga0207657_10021003 | 3300025919 | Bacteria | 6156 |
| 418 | Ga0207657_10024364 | 3300025919 | Bacteria | 5607 |
| 419 | Ga0207657_10030124 | 3300025919 | Bacteria | 4930 |
| 420 | Ga0207657_10068378 | 3300025919 | Bacteria | 3017 |
| 421 | Ga0207649_10000055 | 3300025920 | Bacteria | 103054 |
| 422 | Ga0207649_10000418 | 3300025920 | Bacteria | 31286 |
| 423 | Ga0207649_10020495 | 3300025920 | Bacteria | 3793 |
| 424 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 425 | Ga0207652_10079482 | 3300025921 | Bacteria | 2865 |
| 426 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 427 | Ga0207681_10000013 | 3300025923 | Bacteria | 357411 |
| 428 | Ga0207681_10000280 | 3300025923 | Bacteria | 37943 |
| 429 | Ga0207681_10020642 | 3300025923 | Bacteria | 4177 |
| 430 | Ga0207681_10044129 | 3300025923 | Bacteria | 2987 |
| 431 | Ga0207694_10019525 | 3300025924 | Bacteria | 5124 |
| 432 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 433 | Ga0207650_10000683 | 3300025925 | Bacteria | 26649 |
| 434 | Ga0207650_10000903 | 3300025925 | Bacteria | 22419 |
| 435 | Ga0207650_10004449 | 3300025925 | Bacteria | 9574 |
| 436 | Ga0207650_10006316 | 3300025925 | Bacteria | 8077 |
| 437 | Ga0207650_10012542 | 3300025925 | Bacteria | 5848 |
| 438 | Ga0207650_10012626 | 3300025925 | Bacteria | 5830 |
| 439 | Ga0207650_10019150 | 3300025925 | Bacteria | 4809 |
| 440 | Ga0207659_10000886 | 3300025926 | Bacteria | 17785 |
| 441 | Ga0207659_10020367 | 3300025926 | Bacteria | 4383 |
| 442 | Ga0207659_10029898 | 3300025926 | Bacteria | 3717 |
| 443 | Ga0207700_10031014 | 3300025928 | Bacteria | 3793 |
| 444 | Ga0207664_10032056 | 3300025929 | Bacteria | 4026 |
| 445 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 446 | Ga0207644_10000303 | 3300025931 | Bacteria | 32025 |
| 447 | Ga0207644_10002544 | 3300025931 | Bacteria | 11738 |
| 448 | Ga0207644_10005983 | 3300025931 | Bacteria | 7929 |
| 449 | Ga0207644_10011588 | 3300025931 | Bacteria | 5837 |
| 450 | Ga0207644_10012507 | 3300025931 | Bacteria | 5639 |
| 451 | Ga0207644_10012633 | 3300025931 | Bacteria | 5613 |
| 452 | Ga0207644_10012933 | 3300025931 | Bacteria | 5550 |
| 453 | Ga0207644_10019287 | 3300025931 | Bacteria | 4624 |
| 454 | Ga0207644_10027046 | 3300025931 | Bacteria | 3960 |
| 455 | Ga0207644_10082304 | 3300025931 | Bacteria | 2381 |
| 456 | Ga0207690_10000001 | 3300025932 | Bacteria | 807539 |
| 457 | Ga0207690_10000045 | 3300025932 | Bacteria | 116965 |
| 458 | Ga0207690_10001086 | 3300025932 | Bacteria | 17355 |
| 459 | Ga0207690_10004589 | 3300025932 | Bacteria | 8164 |
| 460 | Ga0207690_10004904 | 3300025932 | Bacteria | 7894 |
| 461 | Ga0207690_10005587 | 3300025932 | Bacteria | 7429 |
| 462 | Ga0207690_10025976 | 3300025932 | Bacteria | 3685 |
| 463 | Ga0207690_10046506 | 3300025932 | Bacteria | 2875 |
| 464 | Ga0207690_10058939 | 3300025932 | Bacteria | 2599 |
| 465 | Ga0207706_10000920 | 3300025933 | Bacteria | 30195 |
| 466 | Ga0207706_10001540 | 3300025933 | Bacteria | 22831 |
| 467 | Ga0207706_10002229 | 3300025933 | Bacteria | 18927 |
| 468 | Ga0207706_10004181 | 3300025933 | Bacteria | 13592 |
| 469 | Ga0207706_10010819 | 3300025933 | Bacteria | 8324 |
| 470 | Ga0207706_10018434 | 3300025933 | Bacteria | 6281 |
| 471 | Ga0207706_10022102 | 3300025933 | Bacteria | 5709 |
| 472 | Ga0207706_10061164 | 3300025933 | Bacteria | 3316 |
| 473 | Ga0207706_10106973 | 3300025933 | Bacteria | 2461 |
| 474 | Ga0207709_10000392 | 3300025935 | Bacteria | 43462 |
| 475 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 476 | Ga0207691_10002062 | 3300025940 | Bacteria | 19627 |
| 477 | Ga0207691_10003851 | 3300025940 | Bacteria | 14559 |
| 478 | Ga0207691_10017400 | 3300025940 | Bacteria | 6818 |
| 479 | Ga0207691_10044981 | 3300025940 | Bacteria | 4061 |
| 480 | Ga0207691_10099946 | 3300025940 | Bacteria | 2590 |
| 481 | Ga0207711_10000022 | 3300025941 | Bacteria | 340441 |
| 482 | Ga0207711_10000218 | 3300025941 | Bacteria | 61467 |
| 483 | Ga0207711_10000534 | 3300025941 | Bacteria | 38916 |
| 484 | Ga0207711_10000982 | 3300025941 | Bacteria | 27350 |
| 485 | Ga0207711_10002001 | 3300025941 | Bacteria | 18440 |
| 486 | Ga0207711_10002022 | 3300025941 | Bacteria | 18348 |
| 487 | Ga0207711_10004208 | 3300025941 | Bacteria | 12318 |
| 488 | Ga0207711_10006099 | 3300025941 | Bacteria | 10177 |
| 489 | Ga0207711_10012933 | 3300025941 | Bacteria | 6932 |
| 490 | Ga0207711_10019686 | 3300025941 | Bacteria | 5619 |
| 491 | Ga0207711_10020799 | 3300025941 | Bacteria | 5475 |
| 492 | Ga0207711_10075997 | 3300025941 | Bacteria | 2924 |
| 493 | Ga0207689_10007603 | 3300025942 | Bacteria | 9493 |
| 494 | Ga0207689_10016912 | 3300025942 | Bacteria | 6171 |
| 495 | Ga0207661_10023087 | 3300025944 | Bacteria | 4696 |
| 496 | Ga0207679_10009693 | 3300025945 | Bacteria | 6174 |
| 497 | Ga0207679_10010537 | 3300025945 | Bacteria | 5957 |
| 498 | Ga0207679_10013391 | 3300025945 | Bacteria | 5376 |
| 499 | Ga0207667_10000013 | 3300025949 | Bacteria | 435875 |
| 500 | Ga0207667_10001563 | 3300025949 | Bacteria | 28840 |
| 501 | Ga0207667_10004518 | 3300025949 | Bacteria | 17046 |
| 502 | Ga0207667_10005688 | 3300025949 | Bacteria | 15201 |
| 503 | Ga0207667_10016822 | 3300025949 | Bacteria | 8250 |
| 504 | Ga0207667_10023253 | 3300025949 | Bacteria | 6825 |
| 505 | Ga0207667_10028992 | 3300025949 | Bacteria | 6008 |
| 506 | Ga0207667_10035980 | 3300025949 | Bacteria | 5309 |
| 507 | Ga0207667_10054784 | 3300025949 | Bacteria | 4194 |
| 508 | Ga0207667_10058642 | 3300025949 | Bacteria | 4036 |
| 509 | Ga0207667_10066158 | 3300025949 | Bacteria | 3768 |
| 510 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 511 | Ga0207651_10006617 | 3300025960 | Bacteria | 6089 |
| 512 | Ga0207651_10013669 | 3300025960 | Bacteria | 4655 |
| 513 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 514 | Ga0207712_10000149 | 3300025961 | Bacteria | 72521 |
| 515 | Ga0207712_10002657 | 3300025961 | Bacteria | 11439 |
| 516 | Ga0207712_10009217 | 3300025961 | Bacteria | 6250 |
| 517 | Ga0207668_10000021 | 3300025972 | Bacteria | 137592 |
| 518 | Ga0207668_10000122 | 3300025972 | Bacteria | 54614 |
| 519 | Ga0207668_10001573 | 3300025972 | Bacteria | 13356 |
| 520 | Ga0207668_10004332 | 3300025972 | Bacteria | 8331 |
| 521 | Ga0207668_10006879 | 3300025972 | Bacteria | 6749 |
| 522 | Ga0207640_10000226 | 3300025981 | Bacteria | 39673 |
| 523 | Ga0207640_10004019 | 3300025981 | Bacteria | 7949 |
| 524 | Ga0207640_10012794 | 3300025981 | Bacteria | 4792 |
| 525 | Ga0207640_10019698 | 3300025981 | Bacteria | 3991 |
| 526 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 527 | Ga0207658_10000022 | 3300025986 | Bacteria | 191235 |
| 528 | Ga0207658_10000143 | 3300025986 | Bacteria | 74612 |
| 529 | Ga0207658_10000338 | 3300025986 | Bacteria | 46920 |
| 530 | Ga0207658_10001244 | 3300025986 | Bacteria | 20133 |
| 531 | Ga0207658_10002864 | 3300025986 | Bacteria | 12353 |
| 532 | Ga0207658_10004687 | 3300025986 | Bacteria | 9475 |
| 533 | Ga0207658_10008551 | 3300025986 | Bacteria | 6963 |
| 534 | Ga0207658_10010390 | 3300025986 | Bacteria | 6323 |
| 535 | Ga0207658_10022632 | 3300025986 | Bacteria | 4378 |
| 536 | Ga0207658_10027021 | 3300025986 | Bacteria | 4029 |
| 537 | Ga0207658_10041925 | 3300025986 | Bacteria | 3317 |
| 538 | Ga0207658_10043322 | 3300025986 | Bacteria | 3271 |
| 539 | Ga0207677_10000422 | 3300026023 | Bacteria | 28652 |
| 540 | Ga0207703_10000960 | 3300026035 | Bacteria | 27866 |
| 541 | Ga0207703_10001057 | 3300026035 | Bacteria | 26252 |
| 542 | Ga0207703_10003379 | 3300026035 | Bacteria | 13405 |
| 543 | Ga0207703_10005421 | 3300026035 | Bacteria | 10266 |
| 544 | Ga0207703_10013659 | 3300026035 | Bacteria | 6327 |
| 545 | Ga0207703_10058480 | 3300026035 | Bacteria | 3147 |
| 546 | Ga0207703_10060053 | 3300026035 | Bacteria | 3107 |
| 547 | Ga0207639_10002096 | 3300026041 | Bacteria | 13429 |
| 548 | Ga0207639_10002194 | 3300026041 | Bacteria | 13147 |
| 549 | Ga0207639_10003396 | 3300026041 | Bacteria | 10708 |
| 550 | Ga0207639_10006965 | 3300026041 | Bacteria | 7704 |
| 551 | Ga0207639_10010464 | 3300026041 | Bacteria | 6426 |
| 552 | Ga0207639_10012207 | 3300026041 | Bacteria | 5978 |
| 553 | Ga0207639_10012523 | 3300026041 | Bacteria | 5909 |
| 554 | Ga0207639_10034036 | 3300026041 | Bacteria | 3763 |
| 555 | Ga0207678_10005788 | 3300026067 | Bacteria | 11022 |
| 556 | Ga0207678_10008843 | 3300026067 | Bacteria | 8866 |
| 557 | Ga0207678_10014971 | 3300026067 | Bacteria | 6824 |
| 558 | Ga0207678_10026153 | 3300026067 | Bacteria | 5092 |
| 559 | Ga0207678_10028154 | 3300026067 | Bacteria | 4907 |
| 560 | Ga0207678_10032966 | 3300026067 | Bacteria | 4513 |
| 561 | Ga0207702_10000324 | 3300026078 | Bacteria | 54694 |
| 562 | Ga0207702_10004001 | 3300026078 | Bacteria | 13237 |
| 563 | Ga0207702_10007522 | 3300026078 | Bacteria | 9287 |
| 564 | Ga0207702_10027033 | 3300026078 | Bacteria | 4764 |
| 565 | Ga0207702_10038212 | 3300026078 | Bacteria | 4020 |
| 566 | Ga0207641_10000022 | 3300026088 | Bacteria | 279334 |
| 567 | Ga0207641_10000057 | 3300026088 | Bacteria | 168603 |
| 568 | Ga0207641_10000139 | 3300026088 | Bacteria | 105740 |
| 569 | Ga0207641_10000557 | 3300026088 | Bacteria | 41685 |
| 570 | Ga0207641_10003469 | 3300026088 | Bacteria | 13968 |
| 571 | Ga0207641_10003978 | 3300026088 | Bacteria | 12899 |
| 572 | Ga0207641_10007052 | 3300026088 | Bacteria | 9389 |
| 573 | Ga0207641_10028210 | 3300026088 | Bacteria | 4637 |
| 574 | Ga0207641_10040282 | 3300026088 | Bacteria | 3911 |
| 575 | Ga0207641_10073453 | 3300026088 | Bacteria | 2948 |
| 576 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 577 | Ga0207648_10016932 | 3300026089 | Bacteria | 6642 |
| 578 | Ga0207648_10017811 | 3300026089 | Bacteria | 6447 |
| 579 | Ga0207648_10036459 | 3300026089 | Bacteria | 4332 |
| 580 | Ga0207648_10037944 | 3300026089 | Bacteria | 4241 |
| 581 | Ga0207676_10000012 | 3300026095 | Bacteria | 353971 |
| 582 | Ga0207676_10000051 | 3300026095 | Bacteria | 132645 |
| 583 | Ga0207676_10000783 | 3300026095 | Bacteria | 24809 |
| 584 | Ga0207676_10001536 | 3300026095 | Bacteria | 17029 |
| 585 | Ga0207676_10003805 | 3300026095 | Bacteria | 10670 |
| 586 | Ga0207676_10007988 | 3300026095 | Bacteria | 7524 |
| 587 | Ga0207676_10100254 | 3300026095 | Bacteria | 2399 |
| 588 | Ga0207674_10000344 | 3300026116 | Bacteria | 59855 |
| 589 | Ga0207674_10008725 | 3300026116 | Bacteria | 11669 |
| 590 | Ga0207674_10010450 | 3300026116 | Bacteria | 10513 |
| 591 | Ga0207674_10016841 | 3300026116 | Bacteria | 7988 |
| 592 | Ga0207674_10016935 | 3300026116 | Bacteria | 7959 |
| 593 | Ga0207674_10019401 | 3300026116 | Bacteria | 7365 |
| 594 | Ga0207674_10039133 | 3300026116 | Bacteria | 4917 |
| 595 | Ga0207674_10144324 | 3300026116 | Bacteria | 2340 |
| 596 | Ga0207675_100003225 | 3300026118 | Bacteria | 15997 |
| 597 | Ga0207675_100007464 | 3300026118 | Bacteria | 10332 |
| 598 | Ga0207675_100039877 | 3300026118 | Bacteria | 4382 |
| 599 | Ga0207683_10005117 | 3300026121 | Bacteria | 11254 |
| 600 | Ga0207683_10005966 | 3300026121 | Bacteria | 10436 |
| 601 | Ga0207683_10008629 | 3300026121 | Bacteria | 8714 |
| 602 | Ga0207683_10028949 | 3300026121 | Bacteria | 4794 |
| 603 | Ga0207698_10000106 | 3300026142 | Bacteria | 52547 |
| 604 | Ga0207698_10000244 | 3300026142 | Bacteria | 33363 |
| 605 | Ga0207698_10001502 | 3300026142 | Bacteria | 13583 |
| 606 | Ga0207698_10076651 | 3300026142 | Bacteria | 2677 |
| 607 | Ga0209813_10000021 | 3300027866 | Bacteria | 75014 |
| 608 | Ga0209974_10001060 | 3300027876 | Bacteria | 9750 |
| 609 | Ga0209974_10002589 | 3300027876 | Bacteria | 6572 |
| 610 | Ga0268266_10000042 | 3300028379 | Bacteria | 316826 |
| 611 | Ga0268266_10000083 | 3300028379 | Bacteria | 202393 |
| 612 | Ga0268266_10000459 | 3300028379 | Bacteria | 59218 |
| 613 | Ga0268266_10001823 | 3300028379 | Bacteria | 24089 |
| 614 | Ga0268266_10008886 | 3300028379 | Bacteria | 8896 |
| 615 | Ga0268266_10025926 | 3300028379 | Bacteria | 4987 |
| 616 | Ga0268265_10000006 | 3300028380 | Bacteria | 466482 |
| 617 | Ga0268265_10000090 | 3300028380 | Bacteria | 116514 |
| 618 | Ga0268265_10000233 | 3300028380 | Bacteria | 63492 |
| 619 | Ga0268265_10000428 | 3300028380 | Bacteria | 44880 |
| 620 | Ga0268265_10001727 | 3300028380 | Bacteria | 17651 |
| 621 | Ga0268265_10004303 | 3300028380 | Bacteria | 9929 |
| 622 | Ga0268265_10006094 | 3300028380 | Bacteria | 8186 |
| 623 | Ga0268265_10015346 | 3300028380 | Bacteria | 5241 |
| 624 | Ga0268265_10067986 | 3300028380 | Bacteria | 2760 |
| 625 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 626 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 627 | Ga0268264_10000071 | 3300028381 | Bacteria | 267236 |
| 628 | Ga0268264_10000184 | 3300028381 | Bacteria | 131402 |
| 629 | Ga0268264_10001197 | 3300028381 | Bacteria | 25051 |
| 630 | Ga0268264_10005993 | 3300028381 | Bacteria | 10290 |
| 631 | Ga0268264_10006774 | 3300028381 | Bacteria | 9623 |
| 632 | Ga0268264_10007114 | 3300028381 | Bacteria | 9379 |
| 633 | Ga0268264_10015341 | 3300028381 | Bacteria | 6283 |
| 634 | Ga0268264_10023719 | 3300028381 | Bacteria | 5003 |
| 635 | Ga0268264_10084606 | 3300028381 | Bacteria | 2720 |
| 636 | Ga0268264_10115715 | 3300028381 | Bacteria | 2356 |
| 637 | Ga0307513_10029559 | 3300031456 | Bacteria | 6245 |
| 638 | Ga0307408_100010660 | 3300031548 | Bacteria | 6062 |
| 639 | Ga0307408_100012026 | 3300031548 | Bacteria | 5729 |
| 640 | Ga0307408_100012996 | 3300031548 | Bacteria | 5520 |
| 641 | Ga0307408_100013832 | 3300031548 | Bacteria | 5358 |
| 642 | Ga0307408_100023729 | 3300031548 | Bacteria | 4181 |
| 643 | Ga0307405_10002476 | 3300031731 | Bacteria | 8151 |
| 644 | Ga0307405_10003505 | 3300031731 | Bacteria | 7223 |
| 645 | Ga0307405_10025689 | 3300031731 | Bacteria | 3385 |
| 646 | Ga0307413_10008062 | 3300031824 | Bacteria | 4943 |
| 647 | Ga0307413_10016743 | 3300031824 | Bacteria | 3798 |
| 648 | Ga0307413_10063004 | 3300031824 | Bacteria | 2297 |
| 649 | Ga0307410_10004549 | 3300031852 | Bacteria | 7190 |
| 650 | Ga0307410_10006514 | 3300031852 | Bacteria | 6306 |
| 651 | Ga0307410_10011038 | 3300031852 | Bacteria | 5149 |
| 652 | Ga0307410_10025380 | 3300031852 | Bacteria | 3717 |
| 653 | Ga0307410_10025537 | 3300031852 | Bacteria | 3708 |
| 654 | Ga0307410_10042847 | 3300031852 | Bacteria | 2994 |
| 655 | Ga0307410_10060727 | 3300031852 | Bacteria | 2584 |
| 656 | Ga0307406_10002025 | 3300031901 | Bacteria | 11066 |
| 657 | Ga0307406_10007660 | 3300031901 | Bacteria | 5994 |
| 658 | Ga0307406_10013462 | 3300031901 | Bacteria | 4686 |
| 659 | Ga0307406_10015513 | 3300031901 | Bacteria | 4411 |
| 660 | Ga0307407_10000882 | 3300031903 | Bacteria | 10103 |
| 661 | Ga0307407_10032179 | 3300031903 | Bacteria | 2848 |
| 662 | Ga0307407_10036452 | 3300031903 | Bacteria | 2710 |
| 663 | Ga0307407_10037008 | 3300031903 | Bacteria | 2693 |
| 664 | Ga0307412_10000220 | 3300031911 | Bacteria | 38370 |
| 665 | Ga0307412_10008401 | 3300031911 | Bacteria | 5890 |
| 666 | Ga0307412_10011651 | 3300031911 | Bacteria | 5100 |
| 667 | Ga0307412_10014636 | 3300031911 | Bacteria | 4633 |
| 668 | Ga0307412_10025064 | 3300031911 | Bacteria | 3689 |
| 669 | Ga0307412_10033822 | 3300031911 | Bacteria | 3252 |
| 670 | Ga0307412_10052566 | 3300031911 | Bacteria | 2698 |
| 671 | Ga0307409_100002259 | 3300031995 | Bacteria | 9967 |
| 672 | Ga0307409_100002640 | 3300031995 | Bacteria | 9434 |
| 673 | Ga0307409_100011576 | 3300031995 | Bacteria | 5573 |
| 674 | Ga0307409_100017155 | 3300031995 | Bacteria | 4816 |
| 675 | Ga0307409_100030984 | 3300031995 | Bacteria | 3852 |
| 676 | Ga0307409_100066121 | 3300031995 | Bacteria | 2849 |
| 677 | Ga0307416_100002880 | 3300032002 | Bacteria | 10020 |
| 678 | Ga0307416_100005965 | 3300032002 | Bacteria | 7571 |
| 679 | Ga0307416_100006413 | 3300032002 | Bacteria | 7364 |
| 680 | Ga0307416_100011617 | 3300032002 | Bacteria | 5885 |
| 681 | Ga0307416_100017691 | 3300032002 | Bacteria | 4996 |
| 682 | Ga0307416_100084850 | 3300032002 | Bacteria | 2693 |
| 683 | Ga0307414_10000420 | 3300032004 | Bacteria | 22862 |
| 684 | Ga0307414_10015010 | 3300032004 | Bacteria | 4665 |
| 685 | Ga0307414_10015112 | 3300032004 | Bacteria | 4652 |
| 686 | Ga0307414_10016470 | 3300032004 | Bacteria | 4494 |
| 687 | Ga0307414_10016809 | 3300032004 | Bacteria | 4461 |
| 688 | Ga0307414_10025200 | 3300032004 | Bacteria | 3805 |
| 689 | Ga0307414_10045558 | 3300032004 | Bacteria | 3004 |
| 690 | Ga0307414_10047524 | 3300032004 | Bacteria | 2954 |
| 691 | Ga0307411_10003179 | 3300032005 | Bacteria | 7553 |
| 692 | Ga0307411_10004932 | 3300032005 | Bacteria | 6489 |
| 693 | Ga0307411_10005854 | 3300032005 | Bacteria | 6094 |
| 694 | Ga0307411_10021845 | 3300032005 | Bacteria | 3755 |
| 695 | Ga0307411_10033492 | 3300032005 | Bacteria | 3187 |
| 696 | Ga0307411_10035808 | 3300032005 | Bacteria | 3104 |
| 697 | Ga0307415_100001510 | 3300032126 | Bacteria | 11161 |
| 698 | Ga0307415_100001605 | 3300032126 | Bacteria | 10923 |
| 699 | Ga0307415_100024275 | 3300032126 | Bacteria | 3781 |
| 700 | Ga0307415_100027114 | 3300032126 | Bacteria | 3625 |
| 701 | Ga0373955_0061763 | 3300035172 | Bacteria | 2070 |
| 702 | Ga0373925_0018947 | 3300037068 | Bacteria | 5003 |
| 703 | Ga0395899_0001221 | 3300037312 | Bacteria | 22495 |
| 704 | Ga0395899_0001713 | 3300037312 | Bacteria | 18242 |
| 705 | Ga0395899_0002705 | 3300037312 | Bacteria | 14292 |
| 706 | Ga0395899_0004529 | 3300037312 | Bacteria | 10829 |
| 707 | Ga0395899_0007351 | 3300037312 | Bacteria | 8518 |
| 708 | Ga0395899_0017261 | 3300037312 | Bacteria | 5501 |
| 709 | Ga0395899_0018628 | 3300037312 | Bacteria | 5275 |
| 710 | Ga0395899_0023683 | 3300037312 | Bacteria | 4647 |
| 711 | Ga0395899_0023704 | 3300037312 | Bacteria | 4644 |
| 712 | Ga0395899_0058865 | 3300037312 | Bacteria | 2833 |
| 713 | Ga0395899_0064564 | 3300037312 | Bacteria | 2691 |
| 714 | Ga0395900_0000031 | 3300037418 | Bacteria | 262393 |
| 715 | Ga0395900_0000240 | 3300037418 | Bacteria | 86222 |
| 716 | Ga0395900_0001580 | 3300037418 | Bacteria | 26952 |
| 717 | Ga0395900_0005640 | 3300037418 | Bacteria | 13093 |
| 718 | Ga0395900_0008433 | 3300037418 | Bacteria | 10601 |
| 719 | Ga0395900_0017597 | 3300037418 | Bacteria | 7292 |
| 720 | Ga0395900_0019137 | 3300037418 | Bacteria | 6983 |
| 721 | Ga0395900_0021034 | 3300037418 | Bacteria | 6667 |
| 722 | Ga0395900_0021542 | 3300037418 | Bacteria | 6589 |
| 723 | Ga0395900_0021802 | 3300037418 | Bacteria | 6549 |
| 724 | Ga0395900_0030392 | 3300037418 | Bacteria | 5547 |
| 725 | Ga0395900_0035510 | 3300037418 | Bacteria | 5134 |
| 726 | Ga0395900_0037468 | 3300037418 | Bacteria | 4999 |
| 727 | Ga0395900_0115412 | 3300037418 | Bacteria | 2755 |
| 728 | Ga0395900_0154775 | 3300037418 | Bacteria | 2341 |
| 729 | Ga0395898_0002338 | 3300037466 | Bacteria | 22624 |
| 730 | Ga0395898_0003373 | 3300037466 | Bacteria | 17893 |
| 731 | Ga0395898_0013482 | 3300037466 | Bacteria | 8415 |
| 732 | Ga0395898_0015945 | 3300037466 | Bacteria | 7700 |
| 733 | Ga0395898_0027780 | 3300037466 | Bacteria | 5673 |
| 734 | Ga0395898_0028388 | 3300037466 | Bacteria | 5607 |
| 735 | Ga0395898_0029637 | 3300037466 | Bacteria | 5478 |
| 736 | Ga0395898_0034612 | 3300037466 | Bacteria | 5031 |
| 737 | Ga0395898_0044282 | 3300037466 | Bacteria | 4382 |
| 738 | Ga0395898_0054951 | 3300037466 | Bacteria | 3884 |
| 739 | Ga0395898_0082945 | 3300037466 | Bacteria | 3090 |
| 740 | Ga0395898_0108322 | 3300037466 | Bacteria | 2664 |
| 741 | Ga0395905_0000219 | 3300037471 | Bacteria | 87705 |
| 742 | Ga0395905_0000259 | 3300037471 | Bacteria | 79396 |
| 743 | Ga0395905_0000538 | 3300037471 | Bacteria | 51665 |
| 744 | Ga0395905_0001939 | 3300037471 | Bacteria | 23712 |
| 745 | Ga0395905_0005920 | 3300037471 | Bacteria | 12397 |
| 746 | Ga0395905_0006622 | 3300037471 | Bacteria | 11620 |
| 747 | Ga0395905_0006816 | 3300037471 | Bacteria | 11438 |
| 748 | Ga0395905_0013011 | 3300037471 | Bacteria | 7995 |
| 749 | Ga0395905_0014266 | 3300037471 | Bacteria | 7590 |
| 750 | Ga0395905_0017903 | 3300037471 | Bacteria | 6731 |
| 751 | Ga0395905_0017924 | 3300037471 | Bacteria | 6726 |
| 752 | Ga0395905_0021838 | 3300037471 | Bacteria | 6054 |
| 753 | Ga0395905_0022182 | 3300037471 | Bacteria | 6007 |
| 754 | Ga0395905_0022898 | 3300037471 | Bacteria | 5904 |
| 755 | Ga0395905_0032555 | 3300037471 | Bacteria | 4903 |
| 756 | Ga0395905_0039793 | 3300037471 | Bacteria | 4412 |
| 757 | Ga0395905_0041183 | 3300037471 | Bacteria | 4334 |
| 758 | Ga0395905_0041771 | 3300037471 | Bacteria | 4303 |
| 759 | Ga0395905_0048172 | 3300037471 | Bacteria | 3994 |
| 760 | Ga0395905_0053206 | 3300037471 | Bacteria | 3789 |
| 761 | Ga0395905_0059347 | 3300037471 | Bacteria | 3576 |
| 762 | Ga0395905_0064237 | 3300037471 | Bacteria | 3435 |
| 763 | Ga0395905_0070511 | 3300037471 | Bacteria | 3275 |
| 764 | Ga0395905_0072250 | 3300037471 | Bacteria | 3234 |
| 765 | Ga0395905_0081037 | 3300037471 | Bacteria | 3042 |
| 766 | Ga0395905_0088979 | 3300037471 | Bacteria | 2894 |
| 767 | Ga0436364_1265123 | 3300037853 | Bacteria | 88807 |
| 768 | Ga0436364_1516603 | 3300037853 | Bacteria | 34550 |
| 769 | Ga0395901_0000295 | 3300038443 | Bacteria | 61830 |
| 770 | Ga0395901_0002051 | 3300038443 | Bacteria | 20650 |
| 771 | Ga0395901_0002717 | 3300038443 | Bacteria | 17820 |
| 772 | Ga0395901_0003111 | 3300038443 | Bacteria | 16674 |
| 773 | Ga0395901_0005322 | 3300038443 | Bacteria | 13005 |
| 774 | Ga0395901_0008994 | 3300038443 | Bacteria | 10112 |
| 775 | Ga0395901_0012531 | 3300038443 | Bacteria | 8603 |
| 776 | Ga0395901_0015672 | 3300038443 | Bacteria | 7720 |
| 777 | Ga0395901_0023793 | 3300038443 | Bacteria | 6281 |
| 778 | Ga0395901_0047712 | 3300038443 | Bacteria | 4446 |
| 779 | Ga0395901_0057737 | 3300038443 | Bacteria | 4036 |
| 780 | Ga0395901_0065606 | 3300038443 | Bacteria | 3780 |
| 781 | Ga0395901_0075293 | 3300038443 | Bacteria | 3521 |
| 782 | Ga0395901_0087753 | 3300038443 | Bacteria | 3252 |
| 783 | Ga0395901_0161857 | 3300038443 | Bacteria | 2350 |
| 784 | Ga0237819_00654 | 3300038705 | Bacteria | 11248 |
| 785 | Ga0436365_0010969 | 3300039437 | Bacteria | 175809 |
| 786 | Ga0436365_0345276 | 3300039437 | Bacteria | 2445 |
| 787 | Ga0436365_0352550 | 3300039437 | Bacteria | 74350 |
| 788 | Ga0436365_0651625 | 3300039437 | Bacteria | 21859 |
| 789 | Ga0436363_0462432 | 3300039450 | Bacteria | 2853 |
| 790 | Ga0436362_0451893 | 3300039453 | Bacteria | 163419 |
| 791 | Ga0439461_0000053 | 3300041410 | Bacteria | 14109 |
| 792 | Ga0439465_0000404 | 3300041413 | Bacteria | 12518 |
| 793 | Ga0439431_0000039 | 3300041997 | Bacteria | 18972 |
| 794 | Ga0439455_0000903 | 3300042012 | Bacteria | 4595 |
| 795 | Ga0450889_000013 | 3300042144 | Bacteria | 15867 |
| 796 | Ga0439458_0000577 | 3300042157 | Bacteria | 9448 |
| 797 | Ga0439458_0001904 | 3300042157 | Bacteria | 5168 |
| 798 | Ga0466969_0005511 | 3300044656 | Bacteria | 6727 |
| 799 | Ga0466965_0026248 | 3300044683 | Bacteria | 2823 |
| 800 | Ga0466966_0001050 | 3300044684 | Bacteria | 17609 |
| 801 | Ga0466966_0008480 | 3300044684 | Bacteria | 6803 |
| 802 | Ga0466966_0066498 | 3300044684 | Bacteria | 2265 |
| 803 | Ga0466961_0007548 | 3300044693 | Bacteria | 6922 |
| 804 | Ga0466961_0010901 | 3300044693 | Bacteria | 5805 |
| 805 | Ga0466961_0020391 | 3300044693 | Bacteria | 4264 |
| 806 | Ga0466961_0029758 | 3300044693 | Bacteria | 3508 |
| 807 | Ga0466963_0007693 | 3300044694 | Bacteria | 6435 |
| 808 | Ga0466963_0009341 | 3300044694 | Bacteria | 5902 |
| 809 | Ga0466963_0038085 | 3300044694 | Bacteria | 3144 |
| 810 | Ga0466964_0011029 | 3300044706 | Bacteria | 3415 |
| 811 | Ga0466971_0009368 | 3300044719 | Bacteria | 4279 |
| 812 | Ga0466968_0002444 | 3300044735 | Bacteria | 6811 |
| 813 | Ga0466970_0010920 | 3300044765 | Bacteria | 4619 |
| 814 | Ga0466970_0019331 | 3300044765 | Bacteria | 3531 |
| 815 | Ga0466957_0005369 | 3300044842 | Bacteria | 7193 |
| 816 | Ga0466957_0007891 | 3300044842 | Bacteria | 6037 |
| 817 | Ga0466957_0008566 | 3300044842 | Bacteria | 5821 |
| 818 | Ga0466957_0037128 | 3300044842 | Bacteria | 2933 |
| 819 | Ga0466959_0005115 | 3300045049 | Bacteria | 8929 |
| 820 | Ga0466959_0007836 | 3300045049 | Bacteria | 7517 |
| 821 | Ga0466959_0030165 | 3300045049 | Bacteria | 4016 |
| 822 | Ga0466958_0012424 | 3300045836 | Bacteria | 4825 |
| 823 | Ga0466958_0017748 | 3300045836 | Bacteria | 4120 |
| 824 | Ga0466958_0036413 | 3300045836 | Bacteria | 2945 |
| 825 | Ga0466967_0001147 | 3300045976 | Bacteria | 14807 |
| 826 | Ga0466967_0017463 | 3300045976 | Bacteria | 5698 |
| 827 | Ga0466967_0024434 | 3300045976 | Bacteria | 4968 |
| 828 | Ga0466967_0031054 | 3300045976 | Bacteria | 4493 |
| 829 | Ga0466967_0039841 | 3300045976 | Bacteria | 4042 |
| 830 | Ga0466967_0111946 | 3300045976 | Bacteria | 2509 |
| 831 | Ga0495627_000494 | 3300046453 | Bacteria | 33081 |
| 832 | Ga0495627_002118 | 3300046453 | Bacteria | 10031 |
| 833 | Ga0495638_0000011 | 3300046460 | Bacteria | 442453 |
| 834 | Ga0495650_0002198 | 3300046471 | Bacteria | 16470 |
| 835 | Ga0495583_0000242 | 3300046506 | Bacteria | 90367 |
| 836 | Ga0495583_0000656 | 3300046506 | Bacteria | 45452 |
| 837 | Ga0495606_0011166 | 3300046507 | Bacteria | 7353 |
| 838 | Ga0495610_0000068 | 3300046512 | Bacteria | 122949 |
| 839 | Ga0495632_0000007 | 3300046519 | Bacteria | 343246 |
| 840 | Ga0495632_0000638 | 3300046519 | Bacteria | 32240 |
| 841 | Ga0495637_0001444 | 3300046520 | Bacteria | 13998 |
| 842 | Ga0495637_0013156 | 3300046520 | Bacteria | 3935 |
| 843 | Ga0495643_0000005 | 3300046522 | Bacteria | 443135 |
| 844 | Ga0495643_0037357 | 3300046522 | Bacteria | 2665 |
| 845 | Ga0495648_0000023 | 3300046524 | Bacteria | 240174 |
| 846 | Ga0495648_0000146 | 3300046524 | Bacteria | 84443 |
| 847 | Ga0495648_0005794 | 3300046524 | Bacteria | 10187 |
| 848 | Ga0495648_0032503 | 3300046524 | Bacteria | 3422 |
| 849 | Ga0495663_0000005 | 3300046525 | Bacteria | 342265 |
| 850 | Ga0495663_0001571 | 3300046525 | Bacteria | 7160 |
| 851 | Ga0495654_0000264 | 3300046530 | Bacteria | 47686 |
| 852 | Ga0495598_0000419 | 3300046537 | Bacteria | 7658 |
| 853 | Ga0495621_0000702 | 3300046539 | Bacteria | 8468 |
| 854 | Ga0495621_0001058 | 3300046539 | Bacteria | 7049 |
| 855 | Ga0495622_0001865 | 3300046557 | Bacteria | 10383 |
| 856 | Ga0495633_0000550 | 3300046558 | Bacteria | 36970 |
| 857 | Ga0495633_0009460 | 3300046558 | Bacteria | 5378 |
| 858 | Ga0495668_0000984 | 3300046616 | Bacteria | 31110 |
| 859 | Ga0495668_0008640 | 3300046616 | Bacteria | 6332 |
| 860 | Ga0495668_0012183 | 3300046616 | Bacteria | 5112 |
| 861 | Ga0495625_0000231 | 3300046660 | Bacteria | 87237 |
| 862 | Ga0495625_0003341 | 3300046660 | Bacteria | 16142 |
| 863 | Ga0495659_0014576 | 3300046664 | Bacteria | 2574 |
| 864 | Ga0495669_0004179 | 3300046684 | Bacteria | 5939 |
| 865 | Ga0495669_0005050 | 3300046684 | Bacteria | 5486 |
| 866 | Ga0495669_0018537 | 3300046684 | Bacteria | 2993 |
| 867 | Ga0495670_0000037 | 3300046691 | Bacteria | 77395 |
| 868 | Ga0495670_0003005 | 3300046691 | Bacteria | 8315 |
| 869 | Ga0495670_0011855 | 3300046691 | Bacteria | 4291 |
| 870 | Ga0495671_0000007 | 3300046692 | Bacteria | 443069 |
| 871 | Ga0495671_0000012 | 3300046692 | Bacteria | 358632 |
| 872 | Ga0495671_0005185 | 3300046692 | Bacteria | 7667 |
| 873 | Ga0495677_0006015 | 3300047445 | Bacteria | 4589 |
| 874 | Ga0495677_0007947 | 3300047445 | Bacteria | 3942 |
| 875 | Ga0495673_0000029 | 3300047469 | Bacteria | 471019 |
| 876 | Ga0495681_0000055 | 3300047470 | Bacteria | 104502 |
| 877 | Ga0495681_0003880 | 3300047470 | Bacteria | 10318 |
| 878 | Ga0495686_0000366 | 3300047472 | Bacteria | 73243 |
| 879 | Ga0495686_0000733 | 3300047472 | Bacteria | 43762 |
| 880 | Ga0495686_0002330 | 3300047472 | Bacteria | 18152 |
| 881 | Ga0495686_0003257 | 3300047472 | Bacteria | 14241 |
| 882 | Ga0495686_0006166 | 3300047472 | Bacteria | 9268 |
| 883 | Ga0496101_0003562 | 3300048904 | Bacteria | 9716 |
| 884 | Ga0496102_0000043 | 3300048905 | Bacteria | 189201 |
| 885 | Ga0496102_0098827 | 3300048905 | Bacteria | 2708 |
| 886 | Ga0496103_0000086 | 3300048906 | Bacteria | 104765 |
| 887 | Ga0496103_0001411 | 3300048906 | Bacteria | 16135 |
| 888 | Ga0496103_0017247 | 3300048906 | Bacteria | 4319 |
| 889 | Ga0496103_0025972 | 3300048906 | Bacteria | 3543 |
| 890 | Ga0496106_0022172 | 3300048909 | Bacteria | 4716 |
| 891 | Ga0496108_0000676 | 3300048911 | Bacteria | 26369 |
| 892 | Ga0496108_0007223 | 3300048911 | Bacteria | 9002 |
| 893 | Ga0496108_0014728 | 3300048911 | Bacteria | 6382 |
| 894 | Ga0496108_0142633 | 3300048911 | Bacteria | 2064 |
| 895 | Ga0496109_0007031 | 3300048912 | Bacteria | 9494 |
| 896 | Ga0496109_0010066 | 3300048912 | Bacteria | 8068 |
| 897 | Ga0496109_0013508 | 3300048912 | Bacteria | 7085 |
| 898 | Ga0496109_0015529 | 3300048912 | Bacteria | 6638 |
| 899 | Ga0496109_0052367 | 3300048912 | Bacteria | 3720 |
| 900 | Ga0496110_0007038 | 3300048913 | Bacteria | 8950 |
| 901 | Ga0496110_0019377 | 3300048913 | Bacteria | 5723 |
| 902 | Ga0496110_0037880 | 3300048913 | Bacteria | 4193 |
| 903 | Ga0496110_0052779 | 3300048913 | Bacteria | 3572 |
| 904 | Ga0496111_0004895 | 3300048914 | Bacteria | 8506 |
| 905 | Ga0496111_0010448 | 3300048914 | Bacteria | 6229 |
| 906 | Ga0496111_0053051 | 3300048914 | Bacteria | 2929 |
| 907 | Ga0496112_0008952 | 3300048915 | Bacteria | 8989 |
| 908 | Ga0496112_0019187 | 3300048915 | Bacteria | 6448 |
| 909 | Ga0496112_0028174 | 3300048915 | Bacteria | 5419 |
| 910 | Ga0496113_0004885 | 3300048916 | Bacteria | 8302 |
| 911 | Ga0496113_0021580 | 3300048916 | Bacteria | 4543 |
| 912 | Ga0496113_0022603 | 3300048916 | Bacteria | 4451 |
| 913 | Ga0496113_0026073 | 3300048916 | Bacteria | 4175 |
| 914 | Ga0496114_0000206 | 3300048917 | Bacteria | 42865 |
| 915 | Ga0496114_0008532 | 3300048917 | Bacteria | 8122 |
| 916 | Ga0496115_0000286 | 3300048918 | Bacteria | 43642 |
| 917 | Ga0496115_0001332 | 3300048918 | Bacteria | 17591 |
| 918 | Ga0496116_0001567 | 3300048919 | Bacteria | 25245 |
| 919 | Ga0496117_0000104 | 3300048920 | Bacteria | 189201 |
| 920 | Ga0496117_0005645 | 3300048920 | Bacteria | 13058 |
| 921 | Ga0496117_0040697 | 3300048920 | Bacteria | 3414 |
| 922 | Ga0496118_0000080 | 3300048921 | Bacteria | 189201 |
| 923 | Ga0496118_0002599 | 3300048921 | Bacteria | 24027 |
| 924 | Ga0496118_0004623 | 3300048921 | Bacteria | 16165 |
| 925 | Ga0496119_0015384 | 3300048922 | Bacteria | 5896 |
| 926 | Ga0496119_0045814 | 3300048922 | Bacteria | 2738 |
| 927 | Ga0496121_0001812 | 3300048924 | Bacteria | 34516 |
| 928 | Ga0496121_0069101 | 3300048924 | Bacteria | 2853 |
| 929 | Ga0496122_0000858 | 3300048925 | Bacteria | 57235 |
| 930 | Ga0496122_0006910 | 3300048925 | Bacteria | 12823 |
| 931 | Ga0496122_0026630 | 3300048925 | Bacteria | 4976 |
| 932 | Ga0496123_0001920 | 3300048926 | Bacteria | 27131 |
| 933 | Ga0496123_0003121 | 3300048926 | Bacteria | 18996 |
| 934 | Ga0496124_0000093 | 3300048927 | Bacteria | 189201 |
| 935 | Ga0496124_0000907 | 3300048927 | Bacteria | 47809 |
| 936 | Ga0496124_0016332 | 3300048927 | Bacteria | 7063 |
| 937 | Ga0496124_0016452 | 3300048927 | Bacteria | 7028 |
| 938 | Ga0496124_0016615 | 3300048927 | Bacteria | 6985 |
| 939 | Ga0496125_0022921 | 3300048928 | Bacteria | 5784 |
| 940 | Ga0496125_0088270 | 3300048928 | Bacteria | 2338 |
| 941 | Ga0501290_000062 | 3300049513 | Bacteria | 15054 |
| 942 | Ga0501292_000029 | 3300049515 | Bacteria | 40489 |
| 943 | Ga0501034_0022255 | 3300049571 | Bacteria | 6460 |
| 944 | Ga0501038_0085504 | 3300049574 | Bacteria | 2652 |
| 945 | Ga0501047_0003521 | 3300049581 | Bacteria | 14779 |
| 946 | Ga0501069_0004223 | 3300049585 | Bacteria | 7422 |
| 947 | Ga0501223_000002 | 3300049663 | Bacteria | 154573 |
| 948 | Ga0501223_000487 | 3300049663 | Bacteria | 9592 |
| 949 | Ga0501223_001991 | 3300049663 | Bacteria | 4590 |
| 950 | Ga0501224_000016 | 3300049664 | Bacteria | 86205 |
| 951 | Ga0501249_000065 | 3300049679 | Bacteria | 38092 |
| 952 | Ga0501261_000097 | 3300049690 | Bacteria | 13292 |
| 953 | Ga0501225_0000444 | 3300049705 | Bacteria | 12894 |
| 954 | Ga0501225_0000716 | 3300049705 | Bacteria | 10432 |
| 955 | Ga0501245_000589 | 3300049708 | Bacteria | 4447 |
| 956 | Ga0501279_000002 | 3300049775 | Bacteria | 205937 |
| 957 | Ga0501280_000003 | 3300049776 | Bacteria | 93762 |
| 958 | Ga0501282_000402 | 3300049778 | Bacteria | 5166 |
| 959 | Ga0501283_000291 | 3300049779 | Bacteria | 6641 |
| 960 | Ga0501044_0010861 | 3300049823 | Bacteria | 9880 |
| 961 | Ga0501044_0132203 | 3300049823 | Bacteria | 2489 |
| 962 | Ga0501226_000020 | 3300049853 | Bacteria | 141193 |
| 963 | nmdc:mga06z11_22_c1 | 3300050494 | Bacteria | 69485 |
| 964 | nmdc:mga04h51_163_c1 | 3300050495 | Bacteria | 19128 |
| 965 | nmdc:mga0qj67_82083_c1 | 3300050509 | Bacteria | 2585 |
| 966 | nmdc:mga0a205_9970_c1 | 3300050515 | Bacteria | 8717 |
| 967 | Ga0500643_000268 | 3300053087 | Bacteria | 45965 |
| 968 | Ga0500643_002236 | 3300053087 | Bacteria | 10213 |
| 969 | Ga0500643_002356 | 3300053087 | Bacteria | 9866 |
| 970 | Ga0500643_002728 | 3300053087 | Bacteria | 8858 |
| 971 | Ga0500646_0006209 | 3300053090 | Bacteria | 3038 |
| 972 | Ga0500566_0001604 | 3300053094 | Bacteria | 13311 |
| 973 | Ga0500555_000970 | 3300053103 | Bacteria | 9931 |
| 974 | Ga0500556_0000630 | 3300053104 | Bacteria | 22279 |
| 975 | Ga0500592_000112 | 3300053116 | Bacteria | 17479 |
| 976 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 977 | Ga0500642_0008568 | 3300053130 | Bacteria | 3510 |
| 978 | Ga0500655_000037 | 3300053133 | Bacteria | 38087 |
| 979 | Ga0500658_0000051 | 3300053134 | Bacteria | 62135 |
| 980 | Ga0500658_0000386 | 3300053134 | Bacteria | 19390 |
| 981 | Ga0500559_0023519 | 3300053136 | Bacteria | 2616 |
| 982 | Ga0500568_0000866 | 3300053139 | Bacteria | 21242 |
| 983 | Ga0500590_002839 | 3300053148 | Bacteria | 7830 |
| 984 | Ga0500604_0000124 | 3300053151 | Bacteria | 23474 |
| 985 | Ga0500616_0001216 | 3300053153 | Bacteria | 26011 |
| 986 | Ga0500616_0001550 | 3300053153 | Bacteria | 21556 |
| 987 | Ga0500616_0002224 | 3300053153 | Bacteria | 16590 |
| 988 | Ga0500624_000038 | 3300053157 | Bacteria | 93803 |
| 989 | Ga0500624_000042 | 3300053157 | Bacteria | 90289 |
| 990 | Ga0500624_000087 | 3300053157 | Bacteria | 47425 |
| 991 | Ga0500627_0000188 | 3300053158 | Bacteria | 18122 |
| 992 | Ga0500627_0000436 | 3300053158 | Bacteria | 11313 |
| 993 | Ga0500636_0000969 | 3300053177 | Bacteria | 15437 |
| 994 | Ga0500637_0000047 | 3300053178 | Bacteria | 43949 |
| 995 | Ga0500645_000831 | 3300053730 | Bacteria | 18380 |
| 996 | Ga0466962_0006197 | 3300061719 | Bacteria | 5745 |
| 997 | Ga0466962_0030675 | 3300061719 | Bacteria | 2575 |
| 998 | 2585262347 | 2582581305 | Bacteria | 4895574 |
| 999 | 2643730383 | 2643221541 | Bacteria | 5498788 |
| 1000 | 2644037203 | 2643221605 | Bacteria | 4772303 |
| 1001 | 2644043552 | 2643221606 | Bacteria | 5588032 |
| 1002 | 2644393711 | 2643221671 | Bacteria | 5496681 |
| 1003 | 2830078271 | 2830075706 | Bacteria | 3855215 |
| 1004 | 2885430243 | 2885429604 | Bacteria | 3642894 |
| 1005 | 2896429896 | 2896429255 | Bacteria | 2557483 |
| 1006 | 2928031183 | 2928027323 | Bacteria | 4382488 |
| 1007 | 2946789589 | 2946787523 | Bacteria | 4366789 |
| 1008 | 2984557404 | 2984555340 | Bacteria | 4247089 |
| 1009 | 2984568199 | 2984564862 | Bacteria | 4339992 |
| 1010 | 2990266130 | 2990265787 | Bacteria | 3943888 |
| 1011 | 2993359279 | 2993356040 | Bacteria | 4247105 |
| 1012 | 2993696076 | 2993693658 | Bacteria | 4040749 |
| 1013 | 8057105412 | 8057101203 | Bacteria | 5034064 |
| 1014 | Ga0081455_10001457 | |||
| 1015 | JGI24736J21556_1000147 | |||
| 1016 | JGI24752J21851_1001367 | |||
| 1017 | JGI24740J21852_10002826 | |||
| 1018 | JGI24737J22298_10000878 | |||
| 1019 | JGI24737J22298_10009088 | |||
| 1020 | JGI24735J21928_10001266 | |||
| 1021 | JGI24735J21928_10004279 | |||
| 1022 | JGI24748J21848_1000054 | |||
| 1023 | JGI24738J21930_10000337 | |||
| 1024 | JGI24738J21930_10001002 | |||
| 1025 | JGI24749J21850_1000089 | |||
| 1026 | JGI24034J26672_10000022 | |||
| 1027 | JGI24034J26672_10000052 | |||
| 1028 | JGI24751J29686_10000211 | |||
| 1029 | JGI25150J39212_1000349 | |||
| 1030 | JGI25151J46595_10010171 | |||
| 1031 | JGI25165J46597_1000043 | |||
| 1032 | JGI25165J46597_1000445 | |||
| 1033 | JGI25153J46596_10000715 | |||
| 1034 | Ga0055537_1003207 | |||
| 1035 | Ga0055537_1004434 | |||
| 1036 | Ga0055524_1000209 | |||
| 1037 | Ga0055530_10000131 | |||
| 1038 | Ga0055530_10005544 | |||
| 1039 | Ga0055540_1000884 | |||
| 1040 | Ga0055531_10000514 | |||
| 1041 | Ga0055531_10001213 | |||
| 1042 | Ga0055531_10012654 | |||
| 1043 | Ga0055531_10012656 | |||
| 1044 | Ga0065165_1001460 | |||
| 1045 | Ga0065165_1002740 | |||
| 1046 | Ga0065165_1005614 | |||
| 1047 | Ga0065704_10072750 | |||
| 1048 | Ga0065715_10090627 | |||
| 1049 | Ga0065707_10084485 | |||
| 1050 | Ga0070658_10000001 | |||
| 1051 | Ga0070658_10001115 | |||
| 1052 | Ga0070658_10001347 | |||
| 1053 | Ga0070658_10004856 | |||
| 1054 | Ga0070658_10006282 | |||
| 1055 | Ga0070658_10009163 | |||
| 1056 | Ga0070658_10009294 | |||
| 1057 | Ga0070658_10014226 | |||
| 1058 | Ga0070658_10024406 | |||
| 1059 | Ga0070658_10036889 | |||
| 1060 | Ga0070658_10056723 | |||
| 1061 | Ga0070683_100049156 | |||
| 1062 | Ga0070690_100000038 | |||
| 1063 | Ga0070670_100000012 | |||
| 1064 | Ga0070670_100000125 | |||
| 1065 | Ga0070670_100000517 | |||
| 1066 | Ga0070670_100001836 | |||
| 1067 | Ga0070670_100003954 | |||
| 1068 | Ga0070670_100006594 | |||
| 1069 | Ga0070670_100007253 | |||
| 1070 | Ga0070670_100007633 | |||
| 1071 | Ga0070670_100011972 | |||
| 1072 | Ga0070670_100024317 | |||
| 1073 | Ga0070670_100056973 | |||
| 1074 | Ga0070670_100075020 | |||
| 1075 | Ga0070677_10002056 | |||
| 1076 | Ga0070677_10007615 | |||
| 1077 | Ga0070666_10000002 | |||
| 1078 | Ga0070666_10001023 | |||
| 1079 | Ga0070666_10010671 | |||
| 1080 | Ga0070666_10012267 | |||
| 1081 | Ga0070680_100004659 | |||
| 1082 | Ga0070680_100011939 | |||
| 1083 | Ga0070680_100018665 | |||
| 1084 | Ga0070680_100045105 | |||
| 1085 | Ga0068868_100000752 | |||
| 1086 | Ga0068868_100001006 | |||
| 1087 | Ga0068868_100006922 | |||
| 1088 | Ga0070660_100000322 | |||
| 1089 | Ga0070660_100000862 | |||
| 1090 | Ga0070660_100001455 | |||
| 1091 | Ga0070660_100002916 | |||
| 1092 | Ga0070660_100004357 | |||
| 1093 | Ga0070660_100005333 | |||
| 1094 | Ga0070660_100009539 | |||
| 1095 | Ga0070660_100026922 | |||
| 1096 | Ga0070660_100044767 | |||
| 1097 | Ga0070691_10005365 | |||
| 1098 | Ga0070661_100000189 | |||
| 1099 | Ga0070661_100016453 | |||
| 1100 | Ga0070661_100033400 | |||
| 1101 | Ga0070661_100040827 | |||
| 1102 | Ga0070661_100043637 | |||
| 1103 | Ga0070668_100000004 | |||
| 1104 | Ga0070668_100001775 | |||
| 1105 | Ga0070668_100003499 | |||
| 1106 | Ga0070668_100008189 | |||
| 1107 | Ga0070668_100009224 | |||
| 1108 | Ga0070668_100018413 | |||
| 1109 | Ga0070668_100051271 | |||
| 1110 | Ga0070668_100075285 | |||
| 1111 | Ga0070669_100000001 | |||
| 1112 | Ga0070669_100000041 | |||
| 1113 | Ga0070669_100000237 | |||
| 1114 | Ga0070669_100004048 | |||
| 1115 | Ga0070669_100051823 | |||
| 1116 | Ga0070675_100000201 | |||
| 1117 | Ga0070675_100001388 | |||
| 1118 | Ga0070675_100014605 | |||
| 1119 | Ga0070671_100000007 | |||
| 1120 | Ga0070671_100000730 | |||
| 1121 | Ga0070671_100000951 | |||
| 1122 | Ga0070671_100001205 | |||
| 1123 | Ga0070671_100005522 | |||
| 1124 | Ga0070671_100007391 | |||
| 1125 | Ga0070671_100008497 | |||
| 1126 | Ga0070671_100024114 | |||
| 1127 | Ga0070671_100064067 | |||
| 1128 | Ga0070674_100007252 | |||
| 1129 | Ga0070673_100000006 | |||
| 1130 | Ga0070673_100010352 | |||
| 1131 | Ga0070673_100030287 | |||
| 1132 | Ga0070688_100001147 | |||
| 1133 | Ga0070659_100000032 | |||
| 1134 | Ga0070659_100001498 | |||
| 1135 | Ga0070659_100007541 | |||
| 1136 | Ga0070659_100019042 | |||
| 1137 | Ga0070659_100073404 | |||
| 1138 | Ga0070659_100075295 | |||
| 1139 | Ga0070667_100000024 | |||
| 1140 | Ga0070667_100000037 | |||
| 1141 | Ga0070667_100000273 | |||
| 1142 | Ga0070667_100000319 | |||
| 1143 | Ga0070667_100000836 | |||
| 1144 | Ga0070667_100001215 | |||
| 1145 | Ga0070667_100001851 | |||
| 1146 | Ga0070667_100005679 | |||
| 1147 | Ga0070667_100006741 | |||
| 1148 | Ga0070667_100022003 | |||
| 1149 | Ga0070667_100023080 | |||
| 1150 | Ga0070667_100023944 | |||
| 1151 | Ga0070667_100031595 | |||
| 1152 | Ga0070667_100048234 | |||
| 1153 | Ga0070709_10014179 | |||
| 1154 | Ga0070714_100007541 | |||
| 1155 | Ga0070714_100044833 | |||
| 1156 | Ga0070713_100005958 | |||
| 1157 | Ga0070694_100005190 | |||
| 1158 | Ga0070678_100002055 | |||
| 1159 | Ga0070678_100006988 | |||
| 1160 | Ga0070662_100000049 | |||
| 1161 | Ga0070662_100002297 | |||
| 1162 | Ga0070662_100007584 | |||
| 1163 | Ga0068867_100000001 | |||
| 1164 | Ga0068867_100012857 | |||
| 1165 | Ga0070679_100000019 | |||
| 1166 | Ga0070679_100046220 | |||
| 1167 | Ga0070679_100077629 | |||
| 1168 | Ga0070679_100094715 | |||
| 1169 | Ga0070684_100007236 | |||
| 1170 | Ga0070684_100009573 | |||
| 1171 | Ga0068853_100008695 | |||
| 1172 | Ga0068853_100079691 | |||
| 1173 | Ga0068853_100090576 | |||
| 1174 | Ga0070672_100003314 | |||
| 1175 | Ga0070672_100004957 | |||
| 1176 | Ga0070672_100010561 | |||
| 1177 | Ga0070686_100000003 | |||
| 1178 | Ga0070686_100000490 | |||
| 1179 | Ga0070693_100045150 | |||
| 1180 | Ga0070665_100000036 | |||
| 1181 | Ga0070665_100000089 | |||
| 1182 | Ga0070665_100001268 | |||
| 1183 | Ga0070665_100001846 | |||
| 1184 | Ga0070665_100028906 | |||
| 1185 | Ga0070665_100087480 | |||
| 1186 | Ga0068855_100000684 | |||
| 1187 | Ga0068855_100006131 | |||
| 1188 | Ga0068855_100006764 | |||
| 1189 | Ga0068855_100015361 | |||
| 1190 | Ga0068855_100059537 | |||
| 1191 | Ga0068855_100069687 | |||
| 1192 | Ga0070664_100000322 | |||
| 1193 | Ga0070664_100001418 | |||
| 1194 | Ga0070664_100006602 | |||
| 1195 | Ga0070664_100012169 | |||
| 1196 | Ga0070664_100090075 | |||
| 1197 | Ga0068857_100004087 | |||
| 1198 | Ga0068857_100006935 | |||
| 1199 | Ga0068857_100013154 | |||
| 1200 | Ga0068857_100023796 | |||
| 1201 | Ga0068854_100000227 | |||
| 1202 | Ga0068854_100005644 | |||
| 1203 | Ga0068856_100000219 | |||
| 1204 | Ga0068856_100005890 | |||
| 1205 | Ga0068856_100026966 | |||
| 1206 | Ga0068852_100000145 | |||
| 1207 | Ga0068852_100001923 | |||
| 1208 | Ga0068852_100008521 | |||
| 1209 | Ga0068852_100022979 | |||
| 1210 | Ga0068852_100054569 | |||
| 1211 | Ga0068859_100000294 | |||
| 1212 | Ga0068859_100004758 | |||
| 1213 | Ga0068859_100008230 | |||
| 1214 | Ga0068859_100016626 | |||
| 1215 | Ga0068859_100050792 | |||
| 1216 | Ga0068859_100066011 | |||
| 1217 | Ga0068864_100000010 | |||
| 1218 | Ga0068864_100000078 | |||
| 1219 | Ga0068864_100000098 | |||
| 1220 | Ga0068864_100009937 | |||
| 1221 | Ga0068864_100011924 | |||
| 1222 | Ga0068864_100022589 | |||
| 1223 | Ga0068864_100031073 | |||
| 1224 | Ga0068861_100018517 | |||
| 1225 | Ga0068861_100039024 | |||
| 1226 | Ga0068863_100000034 | |||
| 1227 | Ga0068863_100000082 | |||
| 1228 | Ga0068863_100000127 | |||
| 1229 | Ga0068863_100000882 | |||
| 1230 | Ga0068863_100002440 | |||
| 1231 | Ga0068863_100002504 | |||
| 1232 | Ga0068863_100007580 | |||
| 1233 | Ga0068863_100013498 | |||
| 1234 | Ga0068863_100071671 | |||
| 1235 | Ga0068858_100000466 | |||
| 1236 | Ga0068858_100002681 | |||
| 1237 | Ga0068858_100002977 | |||
| 1238 | Ga0068858_100008938 | |||
| 1239 | Ga0068858_100012035 | |||
| 1240 | Ga0068858_100018807 | |||
| 1241 | Ga0068860_100000001 | |||
| 1242 | Ga0068860_100000002 | |||
| 1243 | Ga0068860_100000269 | |||
| 1244 | Ga0068860_100000938 | |||
| 1245 | Ga0068860_100002576 | |||
| 1246 | Ga0068860_100003990 | |||
| 1247 | Ga0068860_100017254 | |||
| 1248 | Ga0068860_100020669 | |||
| 1249 | Ga0068860_100031311 | |||
| 1250 | Ga0068860_100042017 | |||
| 1251 | Ga0068862_100000016 | |||
| 1252 | Ga0068862_100000133 | |||
| 1253 | Ga0068862_100000236 | |||
| 1254 | Ga0068862_100000561 | |||
| 1255 | Ga0068862_100000580 | |||
| 1256 | Ga0068862_100000736 | |||
| 1257 | Ga0068862_100085040 | |||
| 1258 | Ga0081539_10009174 | |||
| 1259 | Ga0081539_10024161 | |||
| 1260 | Ga0070717_10006356 | |||
| 1261 | Ga0070717_10023147 | |||
| 1262 | Ga0075368_10000060 | |||
| 1263 | Ga0070712_100049134 | |||
| 1264 | Ga0097621_100020213 | |||
| 1265 | Ga0068871_100006672 | |||
| 1266 | Ga0075433_10021235 | |||
| 1267 | Ga0068865_100000003 | |||
| 1268 | Ga0097620_100000294 | |||
| 1269 | Ga0097620_100004758 | |||
| 1270 | Ga0097620_100008230 | |||
| 1271 | Ga0097620_100016626 | |||
| 1272 | Ga0097620_100044640 | |||
| 1273 | Ga0097620_100050794 | |||
| 1274 | Ga0097620_100066009 | |||
| 1275 | Ga0105251_10000741 | |||
| 1276 | Ga0105251_10016572 | |||
| 1277 | Ga0105240_10004567 | |||
| 1278 | Ga0105240_10010741 | |||
| 1279 | Ga0105240_10018147 | |||
| 1280 | Ga0105240_10022913 | |||
| 1281 | Ga0105240_10079325 | |||
| 1282 | Ga0105245_10054918 | |||
| 1283 | Ga0105243_10001081 | |||
| 1284 | Ga0105243_10048481 | |||
| 1285 | Ga0105242_10002812 | |||
| 1286 | Ga0105248_10000016 | |||
| 1287 | Ga0105248_10000413 | |||
| 1288 | Ga0105248_10001367 | |||
| 1289 | Ga0105248_10002175 | |||
| 1290 | Ga0105248_10004633 | |||
| 1291 | Ga0105248_10007162 | |||
| 1292 | Ga0105248_10010420 | |||
| 1293 | Ga0105248_10037189 | |||
| 1294 | Ga0105248_10122221 | |||
| 1295 | Ga0105248_10142088 | |||
| 1296 | Ga0105248_10156080 | |||
| 1297 | Ga0105237_10034586 | |||
| 1298 | Ga0105237_10054262 | |||
| 1299 | Ga0105237_10104268 | |||
| 1300 | Ga0105238_10050958 | |||
| 1301 | Ga0105249_10000026 | |||
| 1302 | Ga0105249_10000116 | |||
| 1303 | Ga0105249_10000244 | |||
| 1304 | Ga0105249_10003824 | |||
| 1305 | Ga0105249_10081919 | |||
| 1306 | Ga0105239_10000461 | |||
| 1307 | Ga0157373_10027756 | |||
| 1308 | Ga0157371_10003996 | |||
| 1309 | Ga0157371_10011083 | |||
| 1310 | Ga0157370_10000507 | |||
| 1311 | Ga0157370_10001258 | |||
| 1312 | Ga0157370_10014466 | |||
| 1313 | Ga0157370_10030819 | |||
| 1314 | Ga0157370_10042854 | |||
| 1315 | Ga0157369_10002111 | |||
| 1316 | Ga0157369_10002650 | |||
| 1317 | Ga0157369_10003933 | |||
| 1318 | Ga0157369_10012487 | |||
| 1319 | Ga0157369_10033310 | |||
| 1320 | Ga0157369_10086608 | |||
| 1321 | Ga0157374_10002117 | |||
| 1322 | Ga0157374_10008502 | |||
| 1323 | Ga0163162_10014543 | |||
| 1324 | Ga0163162_10081721 | |||
| 1325 | Ga0157372_10006625 | |||
| 1326 | Ga0157372_10050441 | |||
| 1327 | Ga0157372_10064916 | |||
| 1328 | Ga0157375_10002436 | |||
| 1329 | Ga0157375_10006830 | |||
| 1330 | Ga0157375_10009604 | |||
| 1331 | Ga0163163_10000258 | |||
| 1332 | Ga0163163_10000355 | |||
| 1333 | Ga0163163_10043116 | |||
| 1334 | Ga0157380_10000120 | |||
| 1335 | Ga0157380_10000896 | |||
| 1336 | Ga0157380_10033709 | |||
| 1337 | Ga0157377_10025825 | |||
| 1338 | Ga0157379_10004801 | |||
| 1339 | Ga0183363_1002 | |||
| 1340 | Ga0163161_10000008 | |||
| 1341 | Ga0163161_10074097 | |||
| 1342 | Ga0206356_10388316 | |||
| 1343 | Ga0206354_10280634 | |||
| 1344 | Ga0213873_10000007 | |||
| 1345 | Ga0213876_10000005 | |||
| 1346 | Ga0213876_10000332 | |||
| 1347 | Ga0213876_10008814 | |||
| 1348 | Ga0213875_10005221 | |||
| 1349 | Ga0213875_10006567 | |||
| 1350 | Ga0209147_101223 | |||
| 1351 | Ga0207427_100449 | |||
| 1352 | Ga0207425_1000094 | |||
| 1353 | Ga0209026_1002660 | |||
| 1354 | Ga0209148_1000117 | |||
| 1355 | Ga0209233_1000079 | |||
| 1356 | Ga0209565_1000011 | |||
| 1357 | Ga0209565_1000386 | |||
| 1358 | Ga0209455_1000579 | |||
| 1359 | Ga0209673_1004883 | |||
| 1360 | Ga0209673_1009923 | |||
| 1361 | Ga0209676_1002762 | |||
| 1362 | Ga0209025_1000727 | |||
| 1363 | Ga0209564_1001341 | |||
| 1364 | Ga0209758_1000002 | |||
| 1365 | Ga0209758_1000108 | |||
| 1366 | Ga0209758_1002726 | |||
| 1367 | Ga0209050_1000342 | |||
| 1368 | Ga0209050_1000347 | |||
| 1369 | Ga0209050_1005484 | |||
| 1370 | Ga0209256_1000016 | |||
| 1371 | Ga0209051_1000226 | |||
| 1372 | Ga0209257_1000371 | |||
| 1373 | Ga0209257_1001924 | |||
| 1374 | Ga0209257_1002720 | |||
| 1375 | Ga0209257_1005943 | |||
| 1376 | Ga0207697_10000041 | |||
| 1377 | Ga0207697_10004435 | |||
| 1378 | Ga0207713_1002691 | |||
| 1379 | Ga0207682_10001142 | |||
| 1380 | Ga0207682_10001680 | |||
| 1381 | Ga0207682_10006199 | |||
| 1382 | Ga0207682_10014465 | |||
| 1383 | Ga0207688_10043279 | |||
| 1384 | Ga0207680_10000004 | |||
| 1385 | Ga0207680_10000377 | |||
| 1386 | Ga0207680_10004847 | |||
| 1387 | Ga0207680_10008148 | |||
| 1388 | Ga0207647_10000746 | |||
| 1389 | Ga0207647_10002493 | |||
| 1390 | Ga0207647_10005416 | |||
| 1391 | Ga0207647_10005436 | |||
| 1392 | Ga0207647_10017017 | |||
| 1393 | Ga0207647_10017332 | |||
| 1394 | Ga0207705_10000002 | |||
| 1395 | Ga0207705_10000003 | |||
| 1396 | Ga0207705_10000076 | |||
| 1397 | Ga0207705_10000689 | |||
| 1398 | Ga0207705_10001091 | |||
| 1399 | Ga0207705_10003708 | |||
| 1400 | Ga0207705_10004401 | |||
| 1401 | Ga0207705_10009167 | |||
| 1402 | Ga0207705_10010637 | |||
| 1403 | Ga0207705_10012868 | |||
| 1404 | Ga0207705_10018123 | |||
| 1405 | Ga0207705_10020071 | |||
| 1406 | Ga0207705_10024959 | |||
| 1407 | Ga0207705_10032478 | |||
| 1408 | Ga0207707_10012625 | |||
| 1409 | Ga0207695_10001501 | |||
| 1410 | Ga0207695_10006489 | |||
| 1411 | Ga0207695_10008479 | |||
| 1412 | Ga0207695_10010486 | |||
| 1413 | Ga0207695_10026200 | |||
| 1414 | Ga0207695_10028820 | |||
| 1415 | Ga0207671_10004616 | |||
| 1416 | Ga0207693_10018427 | |||
| 1417 | Ga0207660_10000211 | |||
| 1418 | Ga0207660_10000241 | |||
| 1419 | Ga0207660_10005125 | |||
| 1420 | Ga0207660_10015903 | |||
| 1421 | Ga0207657_10000601 | |||
| 1422 | Ga0207657_10001227 | |||
| 1423 | Ga0207657_10001234 | |||
| 1424 | Ga0207657_10001913 | |||
| 1425 | Ga0207657_10006863 | |||
| 1426 | Ga0207657_10007072 | |||
| 1427 | Ga0207657_10009429 | |||
| 1428 | Ga0207657_10012931 | |||
| 1429 | Ga0207657_10014626 | |||
| 1430 | Ga0207657_10021003 | |||
| 1431 | Ga0207657_10024364 | |||
| 1432 | Ga0207657_10030124 | |||
| 1433 | Ga0207657_10068378 | |||
| 1434 | Ga0207649_10000055 | |||
| 1435 | Ga0207649_10000418 | |||
| 1436 | Ga0207649_10020495 | |||
| 1437 | Ga0207652_10000004 | |||
| 1438 | Ga0207652_10079482 | |||
| 1439 | Ga0207681_10000002 | |||
| 1440 | Ga0207681_10000013 | |||
| 1441 | Ga0207681_10000280 | |||
| 1442 | Ga0207681_10020642 | |||
| 1443 | Ga0207681_10044129 | |||
| 1444 | Ga0207694_10019525 | |||
| 1445 | Ga0207650_10000008 | |||
| 1446 | Ga0207650_10000683 | |||
| 1447 | Ga0207650_10000903 | |||
| 1448 | Ga0207650_10004449 | |||
| 1449 | Ga0207650_10006316 | |||
| 1450 | Ga0207650_10012542 | |||
| 1451 | Ga0207650_10012626 | |||
| 1452 | Ga0207650_10019150 | |||
| 1453 | Ga0207659_10000886 | |||
| 1454 | Ga0207659_10020367 | |||
| 1455 | Ga0207659_10029898 | |||
| 1456 | Ga0207700_10031014 | |||
| 1457 | Ga0207664_10032056 | |||
| 1458 | Ga0207644_10000002 | |||
| 1459 | Ga0207644_10000303 | |||
| 1460 | Ga0207644_10002544 | |||
| 1461 | Ga0207644_10005983 | |||
| 1462 | Ga0207644_10011588 | |||
| 1463 | Ga0207644_10012507 | |||
| 1464 | Ga0207644_10012633 | |||
| 1465 | Ga0207644_10012933 | |||
| 1466 | Ga0207644_10019287 | |||
| 1467 | Ga0207644_10027046 | |||
| 1468 | Ga0207644_10082304 | |||
| 1469 | Ga0207690_10000001 | |||
| 1470 | Ga0207690_10000045 | |||
| 1471 | Ga0207690_10001086 | |||
| 1472 | Ga0207690_10004589 | |||
| 1473 | Ga0207690_10004904 | |||
| 1474 | Ga0207690_10005587 | |||
| 1475 | Ga0207690_10025976 | |||
| 1476 | Ga0207690_10046506 | |||
| 1477 | Ga0207690_10058939 | |||
| 1478 | Ga0207706_10000920 | |||
| 1479 | Ga0207706_10001540 | |||
| 1480 | Ga0207706_10002229 | |||
| 1481 | Ga0207706_10004181 | |||
| 1482 | Ga0207706_10010819 | |||
| 1483 | Ga0207706_10018434 | |||
| 1484 | Ga0207706_10022102 | |||
| 1485 | Ga0207706_10061164 | |||
| 1486 | Ga0207706_10106973 | |||
| 1487 | Ga0207709_10000392 | |||
| 1488 | Ga0207704_10000001 | |||
| 1489 | Ga0207691_10002062 | |||
| 1490 | Ga0207691_10003851 | |||
| 1491 | Ga0207691_10017400 | |||
| 1492 | Ga0207691_10044981 | |||
| 1493 | Ga0207691_10099946 | |||
| 1494 | Ga0207711_10000022 | |||
| 1495 | Ga0207711_10000218 | |||
| 1496 | Ga0207711_10000534 | |||
| 1497 | Ga0207711_10000982 | |||
| 1498 | Ga0207711_10002001 | |||
| 1499 | Ga0207711_10002022 | |||
| 1500 | Ga0207711_10004208 | |||
| 1501 | Ga0207711_10006099 | |||
| 1502 | Ga0207711_10012933 | |||
| 1503 | Ga0207711_10019686 | |||
| 1504 | Ga0207711_10020799 | |||
| 1505 | Ga0207711_10075997 | |||
| 1506 | Ga0207689_10007603 | |||
| 1507 | Ga0207689_10016912 | |||
| 1508 | Ga0207661_10023087 | |||
| 1509 | Ga0207679_10009693 | |||
| 1510 | Ga0207679_10010537 | |||
| 1511 | Ga0207679_10013391 | |||
| 1512 | Ga0207667_10000013 | |||
| 1513 | Ga0207667_10001563 | |||
| 1514 | Ga0207667_10004518 | |||
| 1515 | Ga0207667_10005688 | |||
| 1516 | Ga0207667_10016822 | |||
| 1517 | Ga0207667_10023253 | |||
| 1518 | Ga0207667_10028992 | |||
| 1519 | Ga0207667_10035980 | |||
| 1520 | Ga0207667_10054784 | |||
| 1521 | Ga0207667_10058642 | |||
| 1522 | Ga0207667_10066158 | |||
| 1523 | Ga0207651_10000002 | |||
| 1524 | Ga0207651_10006617 | |||
| 1525 | Ga0207651_10013669 | |||
| 1526 | Ga0207712_10000001 | |||
| 1527 | Ga0207712_10000149 | |||
| 1528 | Ga0207712_10002657 | |||
| 1529 | Ga0207712_10009217 | |||
| 1530 | Ga0207668_10000021 | |||
| 1531 | Ga0207668_10000122 | |||
| 1532 | Ga0207668_10001573 | |||
| 1533 | Ga0207668_10004332 | |||
| 1534 | Ga0207668_10006879 | |||
| 1535 | Ga0207640_10000226 | |||
| 1536 | Ga0207640_10004019 | |||
| 1537 | Ga0207640_10012794 | |||
| 1538 | Ga0207640_10019698 | |||
| 1539 | Ga0207658_10000002 | |||
| 1540 | Ga0207658_10000022 | |||
| 1541 | Ga0207658_10000143 | |||
| 1542 | Ga0207658_10000338 | |||
| 1543 | Ga0207658_10001244 | |||
| 1544 | Ga0207658_10002864 | |||
| 1545 | Ga0207658_10004687 | |||
| 1546 | Ga0207658_10008551 | |||
| 1547 | Ga0207658_10010390 | |||
| 1548 | Ga0207658_10022632 | |||
| 1549 | Ga0207658_10027021 | |||
| 1550 | Ga0207658_10041925 | |||
| 1551 | Ga0207658_10043322 | |||
| 1552 | Ga0207677_10000422 | |||
| 1553 | Ga0207703_10000960 | |||
| 1554 | Ga0207703_10001057 | |||
| 1555 | Ga0207703_10003379 | |||
| 1556 | Ga0207703_10005421 | |||
| 1557 | Ga0207703_10013659 | |||
| 1558 | Ga0207703_10058480 | |||
| 1559 | Ga0207703_10060053 | |||
| 1560 | Ga0207639_10002096 | |||
| 1561 | Ga0207639_10002194 | |||
| 1562 | Ga0207639_10003396 | |||
| 1563 | Ga0207639_10006965 | |||
| 1564 | Ga0207639_10010464 | |||
| 1565 | Ga0207639_10012207 | |||
| 1566 | Ga0207639_10012523 | |||
| 1567 | Ga0207639_10034036 | |||
| 1568 | Ga0207678_10005788 | |||
| 1569 | Ga0207678_10008843 | |||
| 1570 | Ga0207678_10014971 | |||
| 1571 | Ga0207678_10026153 | |||
| 1572 | Ga0207678_10028154 | |||
| 1573 | Ga0207678_10032966 | |||
| 1574 | Ga0207702_10000324 | |||
| 1575 | Ga0207702_10004001 | |||
| 1576 | Ga0207702_10007522 | |||
| 1577 | Ga0207702_10027033 | |||
| 1578 | Ga0207702_10038212 | |||
| 1579 | Ga0207641_10000022 | |||
| 1580 | Ga0207641_10000057 | |||
| 1581 | Ga0207641_10000139 | |||
| 1582 | Ga0207641_10000557 | |||
| 1583 | Ga0207641_10003469 | |||
| 1584 | Ga0207641_10003978 | |||
| 1585 | Ga0207641_10007052 | |||
| 1586 | Ga0207641_10028210 | |||
| 1587 | Ga0207641_10040282 | |||
| 1588 | Ga0207641_10073453 | |||
| 1589 | Ga0207648_10000001 | |||
| 1590 | Ga0207648_10016932 | |||
| 1591 | Ga0207648_10017811 | |||
| 1592 | Ga0207648_10036459 | |||
| 1593 | Ga0207648_10037944 | |||
| 1594 | Ga0207676_10000012 | |||
| 1595 | Ga0207676_10000051 | |||
| 1596 | Ga0207676_10000783 | |||
| 1597 | Ga0207676_10001536 | |||
| 1598 | Ga0207676_10003805 | |||
| 1599 | Ga0207676_10007988 | |||
| 1600 | Ga0207676_10100254 | |||
| 1601 | Ga0207674_10000344 | |||
| 1602 | Ga0207674_10008725 | |||
| 1603 | Ga0207674_10010450 | |||
| 1604 | Ga0207674_10016841 | |||
| 1605 | Ga0207674_10016935 | |||
| 1606 | Ga0207674_10019401 | |||
| 1607 | Ga0207674_10039133 | |||
| 1608 | Ga0207674_10144324 | |||
| 1609 | Ga0207675_100003225 | |||
| 1610 | Ga0207675_100007464 | |||
| 1611 | Ga0207675_100039877 | |||
| 1612 | Ga0207683_10005117 | |||
| 1613 | Ga0207683_10005966 | |||
| 1614 | Ga0207683_10008629 | |||
| 1615 | Ga0207683_10028949 | |||
| 1616 | Ga0207698_10000106 | |||
| 1617 | Ga0207698_10000244 | |||
| 1618 | Ga0207698_10001502 | |||
| 1619 | Ga0207698_10076651 | |||
| 1620 | Ga0209813_10000021 | |||
| 1621 | Ga0209974_10001060 | |||
| 1622 | Ga0209974_10002589 | |||
| 1623 | Ga0268266_10000042 | |||
| 1624 | Ga0268266_10000083 | |||
| 1625 | Ga0268266_10000459 | |||
| 1626 | Ga0268266_10001823 | |||
| 1627 | Ga0268266_10008886 | |||
| 1628 | Ga0268266_10025926 | |||
| 1629 | Ga0268265_10000006 | |||
| 1630 | Ga0268265_10000090 | |||
| 1631 | Ga0268265_10000233 | |||
| 1632 | Ga0268265_10000428 | |||
| 1633 | Ga0268265_10001727 | |||
| 1634 | Ga0268265_10004303 | |||
| 1635 | Ga0268265_10006094 | |||
| 1636 | Ga0268265_10015346 | |||
| 1637 | Ga0268265_10067986 | |||
| 1638 | Ga0268264_10000001 | |||
| 1639 | Ga0268264_10000006 | |||
| 1640 | Ga0268264_10000071 | |||
| 1641 | Ga0268264_10000184 | |||
| 1642 | Ga0268264_10001197 | |||
| 1643 | Ga0268264_10005993 | |||
| 1644 | Ga0268264_10006774 | |||
| 1645 | Ga0268264_10007114 | |||
| 1646 | Ga0268264_10015341 | |||
| 1647 | Ga0268264_10023719 | |||
| 1648 | Ga0268264_10084606 | |||
| 1649 | Ga0268264_10115715 | |||
| 1650 | Ga0307513_10029559 | |||
| 1651 | Ga0307408_100010660 | |||
| 1652 | Ga0307408_100012026 | |||
| 1653 | Ga0307408_100012996 | |||
| 1654 | Ga0307408_100013832 | |||
| 1655 | Ga0307408_100023729 | |||
| 1656 | Ga0307405_10002476 | |||
| 1657 | Ga0307405_10003505 | |||
| 1658 | Ga0307405_10025689 | |||
| 1659 | Ga0307413_10008062 | |||
| 1660 | Ga0307413_10016743 | |||
| 1661 | Ga0307413_10063004 | |||
| 1662 | Ga0307410_10004549 | |||
| 1663 | Ga0307410_10006514 | |||
| 1664 | Ga0307410_10011038 | |||
| 1665 | Ga0307410_10025380 | |||
| 1666 | Ga0307410_10025537 | |||
| 1667 | Ga0307410_10042847 | |||
| 1668 | Ga0307410_10060727 | |||
| 1669 | Ga0307406_10002025 | |||
| 1670 | Ga0307406_10007660 | |||
| 1671 | Ga0307406_10013462 | |||
| 1672 | Ga0307406_10015513 | |||
| 1673 | Ga0307407_10000882 | |||
| 1674 | Ga0307407_10032179 | |||
| 1675 | Ga0307407_10036452 | |||
| 1676 | Ga0307407_10037008 | |||
| 1677 | Ga0307412_10000220 | |||
| 1678 | Ga0307412_10008401 | |||
| 1679 | Ga0307412_10011651 | |||
| 1680 | Ga0307412_10014636 | |||
| 1681 | Ga0307412_10025064 | |||
| 1682 | Ga0307412_10033822 | |||
| 1683 | Ga0307412_10052566 | |||
| 1684 | Ga0307409_100002259 | |||
| 1685 | Ga0307409_100002640 | |||
| 1686 | Ga0307409_100011576 | |||
| 1687 | Ga0307409_100017155 | |||
| 1688 | Ga0307409_100030984 | |||
| 1689 | Ga0307409_100066121 | |||
| 1690 | Ga0307416_100002880 | |||
| 1691 | Ga0307416_100005965 | |||
| 1692 | Ga0307416_100006413 | |||
| 1693 | Ga0307416_100011617 | |||
| 1694 | Ga0307416_100017691 | |||
| 1695 | Ga0307416_100084850 | |||
| 1696 | Ga0307414_10000420 | |||
| 1697 | Ga0307414_10015010 | |||
| 1698 | Ga0307414_10015112 | |||
| 1699 | Ga0307414_10016470 | |||
| 1700 | Ga0307414_10016809 | |||
| 1701 | Ga0307414_10025200 | |||
| 1702 | Ga0307414_10045558 | |||
| 1703 | Ga0307414_10047524 | |||
| 1704 | Ga0307411_10003179 | |||
| 1705 | Ga0307411_10004932 | |||
| 1706 | Ga0307411_10005854 | |||
| 1707 | Ga0307411_10021845 | |||
| 1708 | Ga0307411_10033492 | |||
| 1709 | Ga0307411_10035808 | |||
| 1710 | Ga0307415_100001510 | |||
| 1711 | Ga0307415_100001605 | |||
| 1712 | Ga0307415_100024275 | |||
| 1713 | Ga0307415_100027114 | |||
| 1714 | Ga0373955_0061763 | |||
| 1715 | Ga0373925_0018947 | |||
| 1716 | Ga0395899_0001221 | |||
| 1717 | Ga0395899_0001713 | |||
| 1718 | Ga0395899_0002705 | |||
| 1719 | Ga0395899_0004529 | |||
| 1720 | Ga0395899_0007351 | |||
| 1721 | Ga0395899_0017261 | |||
| 1722 | Ga0395899_0018628 | |||
| 1723 | Ga0395899_0023683 | |||
| 1724 | Ga0395899_0023704 | |||
| 1725 | Ga0395899_0058865 | |||
| 1726 | Ga0395899_0064564 | |||
| 1727 | Ga0395900_0000031 | |||
| 1728 | Ga0395900_0000240 | |||
| 1729 | Ga0395900_0001580 | |||
| 1730 | Ga0395900_0005640 | |||
| 1731 | Ga0395900_0008433 | |||
| 1732 | Ga0395900_0017597 | |||
| 1733 | Ga0395900_0019137 | |||
| 1734 | Ga0395900_0021034 | |||
| 1735 | Ga0395900_0021542 | |||
| 1736 | Ga0395900_0021802 | |||
| 1737 | Ga0395900_0030392 | |||
| 1738 | Ga0395900_0035510 | |||
| 1739 | Ga0395900_0037468 | |||
| 1740 | Ga0395900_0115412 | |||
| 1741 | Ga0395900_0154775 | |||
| 1742 | Ga0395898_0002338 | |||
| 1743 | Ga0395898_0003373 | |||
| 1744 | Ga0395898_0013482 | |||
| 1745 | Ga0395898_0015945 | |||
| 1746 | Ga0395898_0027780 | |||
| 1747 | Ga0395898_0028388 | |||
| 1748 | Ga0395898_0029637 | |||
| 1749 | Ga0395898_0034612 | |||
| 1750 | Ga0395898_0044282 | |||
| 1751 | Ga0395898_0054951 | |||
| 1752 | Ga0395898_0082945 | |||
| 1753 | Ga0395898_0108322 | |||
| 1754 | Ga0395905_0000219 | |||
| 1755 | Ga0395905_0000259 | |||
| 1756 | Ga0395905_0000538 | |||
| 1757 | Ga0395905_0001939 | |||
| 1758 | Ga0395905_0005920 | |||
| 1759 | Ga0395905_0006622 | |||
| 1760 | Ga0395905_0006816 | |||
| 1761 | Ga0395905_0013011 | |||
| 1762 | Ga0395905_0014266 | |||
| 1763 | Ga0395905_0017903 | |||
| 1764 | Ga0395905_0017924 | |||
| 1765 | Ga0395905_0021838 | |||
| 1766 | Ga0395905_0022182 | |||
| 1767 | Ga0395905_0022898 | |||
| 1768 | Ga0395905_0032555 | |||
| 1769 | Ga0395905_0039793 | |||
| 1770 | Ga0395905_0041183 | |||
| 1771 | Ga0395905_0041771 | |||
| 1772 | Ga0395905_0048172 | |||
| 1773 | Ga0395905_0053206 | |||
| 1774 | Ga0395905_0059347 | |||
| 1775 | Ga0395905_0064237 | |||
| 1776 | Ga0395905_0070511 | |||
| 1777 | Ga0395905_0072250 | |||
| 1778 | Ga0395905_0081037 | |||
| 1779 | Ga0395905_0088979 | |||
| 1780 | Ga0436364_1265123 | |||
| 1781 | Ga0436364_1516603 | |||
| 1782 | Ga0395901_0000295 | |||
| 1783 | Ga0395901_0002051 | |||
| 1784 | Ga0395901_0002717 | |||
| 1785 | Ga0395901_0003111 | |||
| 1786 | Ga0395901_0005322 | |||
| 1787 | Ga0395901_0008994 | |||
| 1788 | Ga0395901_0012531 | |||
| 1789 | Ga0395901_0015672 | |||
| 1790 | Ga0395901_0023793 | |||
| 1791 | Ga0395901_0047712 | |||
| 1792 | Ga0395901_0057737 | |||
| 1793 | Ga0395901_0065606 | |||
| 1794 | Ga0395901_0075293 | |||
| 1795 | Ga0395901_0087753 | |||
| 1796 | Ga0395901_0161857 | |||
| 1797 | Ga0237819_00654 | |||
| 1798 | Ga0436365_0010969 | |||
| 1799 | Ga0436365_0345276 | |||
| 1800 | Ga0436365_0352550 | |||
| 1801 | Ga0436365_0651625 | |||
| 1802 | Ga0436363_0462432 | |||
| 1803 | Ga0436362_0451893 | |||
| 1804 | Ga0439461_0000053 | |||
| 1805 | Ga0439465_0000404 | |||
| 1806 | Ga0439431_0000039 | |||
| 1807 | Ga0439455_0000903 | |||
| 1808 | Ga0450889_000013 | |||
| 1809 | Ga0439458_0000577 | |||
| 1810 | Ga0439458_0001904 | |||
| 1811 | Ga0466969_0005511 | |||
| 1812 | Ga0466965_0026248 | |||
| 1813 | Ga0466966_0001050 | |||
| 1814 | Ga0466966_0008480 | |||
| 1815 | Ga0466966_0066498 | |||
| 1816 | Ga0466961_0007548 | |||
| 1817 | Ga0466961_0010901 | |||
| 1818 | Ga0466961_0020391 | |||
| 1819 | Ga0466961_0029758 | |||
| 1820 | Ga0466963_0007693 | |||
| 1821 | Ga0466963_0009341 | |||
| 1822 | Ga0466963_0038085 | |||
| 1823 | Ga0466964_0011029 | |||
| 1824 | Ga0466971_0009368 | |||
| 1825 | Ga0466968_0002444 | |||
| 1826 | Ga0466970_0010920 | |||
| 1827 | Ga0466970_0019331 | |||
| 1828 | Ga0466957_0005369 | |||
| 1829 | Ga0466957_0007891 | |||
| 1830 | Ga0466957_0008566 | |||
| 1831 | Ga0466957_0037128 | |||
| 1832 | Ga0466959_0005115 | |||
| 1833 | Ga0466959_0007836 | |||
| 1834 | Ga0466959_0030165 | |||
| 1835 | Ga0466958_0012424 | |||
| 1836 | Ga0466958_0017748 | |||
| 1837 | Ga0466958_0036413 | |||
| 1838 | Ga0466967_0001147 | |||
| 1839 | Ga0466967_0017463 | |||
| 1840 | Ga0466967_0024434 | |||
| 1841 | Ga0466967_0031054 | |||
| 1842 | Ga0466967_0039841 | |||
| 1843 | Ga0466967_0111946 | |||
| 1844 | Ga0495627_000494 | |||
| 1845 | Ga0495627_002118 | |||
| 1846 | Ga0495638_0000011 | |||
| 1847 | Ga0495650_0002198 | |||
| 1848 | Ga0495583_0000242 | |||
| 1849 | Ga0495583_0000656 | |||
| 1850 | Ga0495606_0011166 | |||
| 1851 | Ga0495610_0000068 | |||
| 1852 | Ga0495632_0000007 | |||
| 1853 | Ga0495632_0000638 | |||
| 1854 | Ga0495637_0001444 | |||
| 1855 | Ga0495637_0013156 | |||
| 1856 | Ga0495643_0000005 | |||
| 1857 | Ga0495643_0037357 | |||
| 1858 | Ga0495648_0000023 | |||
| 1859 | Ga0495648_0000146 | |||
| 1860 | Ga0495648_0005794 | |||
| 1861 | Ga0495648_0032503 | |||
| 1862 | Ga0495663_0000005 | |||
| 1863 | Ga0495663_0001571 | |||
| 1864 | Ga0495654_0000264 | |||
| 1865 | Ga0495598_0000419 | |||
| 1866 | Ga0495621_0000702 | |||
| 1867 | Ga0495621_0001058 | |||
| 1868 | Ga0495622_0001865 | |||
| 1869 | Ga0495633_0000550 | |||
| 1870 | Ga0495633_0009460 | |||
| 1871 | Ga0495668_0000984 | |||
| 1872 | Ga0495668_0008640 | |||
| 1873 | Ga0495668_0012183 | |||
| 1874 | Ga0495625_0000231 | |||
| 1875 | Ga0495625_0003341 | |||
| 1876 | Ga0495659_0014576 | |||
| 1877 | Ga0495669_0004179 | |||
| 1878 | Ga0495669_0005050 | |||
| 1879 | Ga0495669_0018537 | |||
| 1880 | Ga0495670_0000037 | |||
| 1881 | Ga0495670_0003005 | |||
| 1882 | Ga0495670_0011855 | |||
| 1883 | Ga0495671_0000007 | |||
| 1884 | Ga0495671_0000012 | |||
| 1885 | Ga0495671_0005185 | |||
| 1886 | Ga0495677_0006015 | |||
| 1887 | Ga0495677_0007947 | |||
| 1888 | Ga0495673_0000029 | |||
| 1889 | Ga0495681_0000055 | |||
| 1890 | Ga0495681_0003880 | |||
| 1891 | Ga0495686_0000366 | |||
| 1892 | Ga0495686_0000733 | |||
| 1893 | Ga0495686_0002330 | |||
| 1894 | Ga0495686_0003257 | |||
| 1895 | Ga0495686_0006166 | |||
| 1896 | Ga0496101_0003562 | |||
| 1897 | Ga0496102_0000043 | |||
| 1898 | Ga0496102_0098827 | |||
| 1899 | Ga0496103_0000086 | |||
| 1900 | Ga0496103_0001411 | |||
| 1901 | Ga0496103_0017247 | |||
| 1902 | Ga0496103_0025972 | |||
| 1903 | Ga0496106_0022172 | |||
| 1904 | Ga0496108_0000676 | |||
| 1905 | Ga0496108_0007223 | |||
| 1906 | Ga0496108_0014728 | |||
| 1907 | Ga0496108_0142633 | |||
| 1908 | Ga0496109_0007031 | |||
| 1909 | Ga0496109_0010066 | |||
| 1910 | Ga0496109_0013508 | |||
| 1911 | Ga0496109_0015529 | |||
| 1912 | Ga0496109_0052367 | |||
| 1913 | Ga0496110_0007038 | |||
| 1914 | Ga0496110_0019377 | |||
| 1915 | Ga0496110_0037880 | |||
| 1916 | Ga0496110_0052779 | |||
| 1917 | Ga0496111_0004895 | |||
| 1918 | Ga0496111_0010448 | |||
| 1919 | Ga0496111_0053051 | |||
| 1920 | Ga0496112_0008952 | |||
| 1921 | Ga0496112_0019187 | |||
| 1922 | Ga0496112_0028174 | |||
| 1923 | Ga0496113_0004885 | |||
| 1924 | Ga0496113_0021580 | |||
| 1925 | Ga0496113_0022603 | |||
| 1926 | Ga0496113_0026073 | |||
| 1927 | Ga0496114_0000206 | |||
| 1928 | Ga0496114_0008532 | |||
| 1929 | Ga0496115_0000286 | |||
| 1930 | Ga0496115_0001332 | |||
| 1931 | Ga0496116_0001567 | |||
| 1932 | Ga0496117_0000104 | |||
| 1933 | Ga0496117_0005645 | |||
| 1934 | Ga0496117_0040697 | |||
| 1935 | Ga0496118_0000080 | |||
| 1936 | Ga0496118_0002599 | |||
| 1937 | Ga0496118_0004623 | |||
| 1938 | Ga0496119_0015384 | |||
| 1939 | Ga0496119_0045814 | |||
| 1940 | Ga0496121_0001812 | |||
| 1941 | Ga0496121_0069101 | |||
| 1942 | Ga0496122_0000858 | |||
| 1943 | Ga0496122_0006910 | |||
| 1944 | Ga0496122_0026630 | |||
| 1945 | Ga0496123_0001920 | |||
| 1946 | Ga0496123_0003121 | |||
| 1947 | Ga0496124_0000093 | |||
| 1948 | Ga0496124_0000907 | |||
| 1949 | Ga0496124_0016332 | |||
| 1950 | Ga0496124_0016452 | |||
| 1951 | Ga0496124_0016615 | |||
| 1952 | Ga0496125_0022921 | |||
| 1953 | Ga0496125_0088270 | |||
| 1954 | Ga0501290_000062 | |||
| 1955 | Ga0501292_000029 | |||
| 1956 | Ga0501034_0022255 | |||
| 1957 | Ga0501038_0085504 | |||
| 1958 | Ga0501047_0003521 | |||
| 1959 | Ga0501069_0004223 | |||
| 1960 | Ga0501223_000002 | |||
| 1961 | Ga0501223_000487 | |||
| 1962 | Ga0501223_001991 | |||
| 1963 | Ga0501224_000016 | |||
| 1964 | Ga0501249_000065 | |||
| 1965 | Ga0501261_000097 | |||
| 1966 | Ga0501225_0000444 | |||
| 1967 | Ga0501225_0000716 | |||
| 1968 | Ga0501245_000589 | |||
| 1969 | Ga0501279_000002 | |||
| 1970 | Ga0501280_000003 | |||
| 1971 | Ga0501282_000402 | |||
| 1972 | Ga0501283_000291 | |||
| 1973 | Ga0501044_0010861 | |||
| 1974 | Ga0501044_0132203 | |||
| 1975 | Ga0501226_000020 | |||
| 1976 | nmdc:mga06z11_22_c1 | |||
| 1977 | nmdc:mga04h51_163_c1 | |||
| 1978 | nmdc:mga0qj67_82083_c1 | |||
| 1979 | nmdc:mga0a205_9970_c1 | |||
| 1980 | Ga0500643_000268 | |||
| 1981 | Ga0500643_002236 | |||
| 1982 | Ga0500643_002356 | |||
| 1983 | Ga0500643_002728 | |||
| 1984 | Ga0500646_0006209 | |||
| 1985 | Ga0500566_0001604 | |||
| 1986 | Ga0500555_000970 | |||
| 1987 | Ga0500556_0000630 | |||
| 1988 | Ga0500592_000112 | |||
| 1989 | Ga0500642_0000001 | |||
| 1990 | Ga0500642_0008568 | |||
| 1991 | Ga0500655_000037 | |||
| 1992 | Ga0500658_0000051 | |||
| 1993 | Ga0500658_0000386 | |||
| 1994 | Ga0500559_0023519 | |||
| 1995 | Ga0500568_0000866 | |||
| 1996 | Ga0500590_002839 | |||
| 1997 | Ga0500604_0000124 | |||
| 1998 | Ga0500616_0001216 | |||
| 1999 | Ga0500616_0001550 | |||
| 2000 | Ga0500616_0002224 | |||
| 2001 | Ga0500624_000038 | |||
| 2002 | Ga0500624_000042 | |||
| 2003 | Ga0500624_000087 | |||
| 2004 | Ga0500627_0000188 | |||
| 2005 | Ga0500627_0000436 | |||
| 2006 | Ga0500636_0000969 | |||
| 2007 | Ga0500637_0000047 | |||
| 2008 | Ga0500645_000831 | |||
| 2009 | Ga0466962_0006197 | |||
| 2010 | Ga0466962_0030675 | |||
| 2011 | 2585262347 | |||
| 2012 | 2643730383 | |||
| 2013 | 2644037203 | |||
| 2014 | 2644043552 | |||
| 2015 | 2644393711 | |||
| 2016 | 2830078271 | |||
| 2017 | 2885430243 | |||
| 2018 | 2896429896 | |||
| 2019 | 2928031183 | |||
| 2020 | 2946789589 | |||
| 2021 | 2984557404 | |||
| 2022 | 2984568199 | |||
| 2023 | 2990266130 | |||
| 2024 | 2993359279 | |||
| 2025 | 2993696076 | |||
| 2026 | 8057105412 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d7g-assembly1.cif.gz_B | crystal structure of the aa complex of the n-terminal domain of pria | 0.8217 | 18 | 98 |
| 6dcr-assembly1.cif.gz_A | e. coli pria helicase winged helix domain deletion protein | 0.8139 | 3 | 706 |
| 6dcr-assembly1.cif.gz_A | e. coli pria helicase winged helix domain deletion protein | 0.8103 | 3 | 706 |
| 4nl8-assembly2.cif.gz_B | pria helicase bound to ssb c-terminal tail peptide | 0.8096 | 6 | 707 |
| 4nl8-assembly2.cif.gz_B | pria helicase bound to ssb c-terminal tail peptide | 0.8043 | 6 | 707 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G266_251_447_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9293 | 187 | 372 | 3.40.50.300 |
| 4nl4H03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9201 | 182 | 372 | 3.40.50.300 |
| af_P17888_491_656_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8901 | 476 | 616 | 3.40.50.300 |
| 4nl4H03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8888 | 182 | 372 | 3.40.50.300 |
| af_Q2G266_251_447_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8755 | 187 | 372 | 3.40.50.300 |