F488192

General Info

Members Datasets Scaffolds Average Seq Length
1013 329 2026 705

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10001457|Ga0081455_1000145723
Length 742
Sequence VNRARVLLLNAALGPLDYRVDREHVVEPGSIVLAPLGPRQIAGVVWEPERMPSDAEVGDNRLRPLASVYDIPPIAAPLRRLIEWTADYYLAPPAAVLRMALASASALEERRSVIEYRVTGLVPDRLTPQRAQALERIGERQGLVRELAMIADVTDAVIRGLVKAGAIESVEVTIDDPFPVPDPDHAPPDLSPEQQTAAAVLVAAVGKNVPRRKLGSSSDLAPIGAFKSEDSMTGPRPSPGNKADIFLLDGVTGSGKTEVYFEAIAEAIRQERQALVLLPEIALTEPFLRRFEARFGHQPVAWHSDLRQSQRRRAWRAIATGEAKVVVGARSALFLPYRNLGLIVVDEAHEASFKQEDGVMYHARDVAVMRGHFEGCPVILASATPAIETQQQVTLGRYRELKLPRRFGAAVMPDIAAVDMLADPPPRGRWLAPSLVRAIEETLERKEQVLLFLNRRGYAPLTLCRHCGHRFQCPNCTAWMVEHRLTARLACPECGEAESLVACGPGVERIADEVAALFPDARRAIVTSDTIWSPARAADFVARMETGEIDIVIGTQLVTKGYHFPNLTLVGVVDADLGLQGGDLRAAERSFQQIAQVSGRAGRGVKKGHVLVQTHEPGAPVIKALVSGDAASFYAAETASRKSANAPPFGRYAAIIVSSEVLEEAVETARMIGRTAPKVEGMRVYGPAPAXLAMLRARHRQRLLVHARRALDVQDVIRDWIGALEWPRGVRVAVDVDPYSFL

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
211 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
273 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
279 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
280 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
281 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
282 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
283 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
284 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
285 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
286 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
287 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
295 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
296 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
297 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
298 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
299 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
300 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
301 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
302 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
303 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
306 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
309 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
315 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
316 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
317 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
318 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
319 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
320 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
321 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
322 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
323 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
324 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
325 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
326 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
327 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
328 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
329 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 0.2
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 7.5
Nodule 0
Rhizoplane 3.46
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10001457 3300005937 Bacteria 29274
2 JGI24736J21556_1000147 3300001904 Bacteria 12247
3 JGI24752J21851_1001367 3300001976 Bacteria 3296
4 JGI24740J21852_10002826 3300001979 Bacteria 7762
5 JGI24737J22298_10000878 3300001990 Bacteria 10727
6 JGI24737J22298_10009088 3300001990 Bacteria 3311
7 JGI24735J21928_10001266 3300002067 Bacteria 8973
8 JGI24735J21928_10004279 3300002067 Bacteria 4814
9 JGI24748J21848_1000054 3300002074 Bacteria 49652
10 JGI24738J21930_10000337 3300002075 Bacteria 12812
11 JGI24738J21930_10001002 3300002075 Bacteria 8087
12 JGI24749J21850_1000089 3300002076 Bacteria 16491
13 JGI24034J26672_10000022 3300002239 Bacteria 116342
14 JGI24034J26672_10000052 3300002239 Bacteria 49811
15 JGI24751J29686_10000211 3300002459 Bacteria 24751
16 JGI25150J39212_1000349 3300002774 Bacteria 22660
17 JGI25151J46595_10010171 3300003187 Bacteria 4391
18 JGI25165J46597_1000043 3300003214 Bacteria 264515
19 JGI25165J46597_1000445 3300003214 Bacteria 41632
20 JGI25153J46596_10000715 3300003215 Bacteria 20302
21 Ga0055537_1003207 3300003773 Bacteria 5109
22 Ga0055537_1004434 3300003773 Bacteria 4016
23 Ga0055524_1000209 3300003775 Bacteria 62993
24 Ga0055530_10000131 3300003791 Bacteria 65535
25 Ga0055530_10005544 3300003791 Bacteria 5957
26 Ga0055540_1000884 3300003792 Bacteria 19850
27 Ga0055531_10000514 3300003794 Bacteria 34947
28 Ga0055531_10001213 3300003794 Bacteria 19774
29 Ga0055531_10012654 3300003794 Bacteria 3952
30 Ga0055531_10012656 3300003794 Bacteria 3952
31 Ga0065165_1001460 3300005262 Bacteria 25510
32 Ga0065165_1002740 3300005262 Bacteria 14065
33 Ga0065165_1005614 3300005262 Bacteria 6948
34 Ga0065704_10072750 3300005289 Bacteria 8060
35 Ga0065715_10090627 3300005293 Bacteria 6712
36 Ga0065707_10084485 3300005295 Bacteria 7154
37 Ga0070658_10000001 3300005327 Bacteria 856789
38 Ga0070658_10001115 3300005327 Bacteria 22930
39 Ga0070658_10001347 3300005327 Bacteria 20977
40 Ga0070658_10004856 3300005327 Bacteria 10948
41 Ga0070658_10006282 3300005327 Bacteria 9623
42 Ga0070658_10009163 3300005327 Bacteria 7956
43 Ga0070658_10009294 3300005327 Bacteria 7906
44 Ga0070658_10014226 3300005327 Bacteria 6386
45 Ga0070658_10024406 3300005327 Bacteria 4850
46 Ga0070658_10036889 3300005327 Bacteria 3939
47 Ga0070658_10056723 3300005327 Bacteria 3184
48 Ga0070683_100049156 3300005329 Bacteria 3900
49 Ga0070690_100000038 3300005330 Bacteria 60092
50 Ga0070670_100000012 3300005331 Bacteria 256314
51 Ga0070670_100000125 3300005331 Bacteria 71778
52 Ga0070670_100000517 3300005331 Bacteria 30886
53 Ga0070670_100001836 3300005331 Bacteria 17303
54 Ga0070670_100003954 3300005331 Bacteria 12367
55 Ga0070670_100006594 3300005331 Bacteria 9838
56 Ga0070670_100007253 3300005331 Bacteria 9397
57 Ga0070670_100007633 3300005331 Bacteria 9190
58 Ga0070670_100011972 3300005331 Bacteria 7421
59 Ga0070670_100024317 3300005331 Bacteria 5210
60 Ga0070670_100056973 3300005331 Bacteria 3355
61 Ga0070670_100075020 3300005331 Bacteria 2906
62 Ga0070677_10002056 3300005333 Bacteria 6407
63 Ga0070677_10007615 3300005333 Bacteria 3621
64 Ga0070666_10000002 3300005335 Bacteria 478684
65 Ga0070666_10001023 3300005335 Bacteria 17149
66 Ga0070666_10010671 3300005335 Bacteria 5751
67 Ga0070666_10012267 3300005335 Bacteria 5400
68 Ga0070680_100004659 3300005336 Bacteria 10313
69 Ga0070680_100011939 3300005336 Bacteria 6739
70 Ga0070680_100018665 3300005336 Bacteria 5485
71 Ga0070680_100045105 3300005336 Bacteria 3583
72 Ga0068868_100000752 3300005338 Bacteria 21953
73 Ga0068868_100001006 3300005338 Bacteria 19279
74 Ga0068868_100006922 3300005338 Bacteria 8057
75 Ga0070660_100000322 3300005339 Bacteria 31658
76 Ga0070660_100000862 3300005339 Bacteria 20203
77 Ga0070660_100001455 3300005339 Bacteria 16192
78 Ga0070660_100002916 3300005339 Bacteria 11778
79 Ga0070660_100004357 3300005339 Bacteria 9775
80 Ga0070660_100005333 3300005339 Bacteria 8896
81 Ga0070660_100009539 3300005339 Bacteria 6835
82 Ga0070660_100026922 3300005339 Bacteria 4285
83 Ga0070660_100044767 3300005339 Bacteria 3386
84 Ga0070691_10005365 3300005341 Bacteria 5832
85 Ga0070661_100000189 3300005344 Bacteria 51018
86 Ga0070661_100016453 3300005344 Bacteria 5229
87 Ga0070661_100033400 3300005344 Bacteria 3726
88 Ga0070661_100040827 3300005344 Bacteria 3386
89 Ga0070661_100043637 3300005344 Bacteria 3275
90 Ga0070668_100000004 3300005347 Bacteria 189408
91 Ga0070668_100001775 3300005347 Bacteria 15678
92 Ga0070668_100003499 3300005347 Bacteria 11577
93 Ga0070668_100008189 3300005347 Bacteria 7765
94 Ga0070668_100009224 3300005347 Bacteria 7316
95 Ga0070668_100018413 3300005347 Bacteria 5243
96 Ga0070668_100051271 3300005347 Bacteria 3179
97 Ga0070668_100075285 3300005347 Bacteria 2635
98 Ga0070669_100000001 3300005353 Bacteria 537589
99 Ga0070669_100000041 3300005353 Bacteria 127426
100 Ga0070669_100000237 3300005353 Bacteria 45913
101 Ga0070669_100004048 3300005353 Bacteria 10601
102 Ga0070669_100051823 3300005353 Bacteria 3001
103 Ga0070675_100000201 3300005354 Bacteria 37824
104 Ga0070675_100001388 3300005354 Bacteria 17768
105 Ga0070675_100014605 3300005354 Bacteria 6192
106 Ga0070671_100000007 3300005355 Bacteria 250397
107 Ga0070671_100000730 3300005355 Bacteria 23532
108 Ga0070671_100000951 3300005355 Bacteria 21207
109 Ga0070671_100001205 3300005355 Bacteria 19357
110 Ga0070671_100005522 3300005355 Bacteria 10071
111 Ga0070671_100007391 3300005355 Bacteria 8777
112 Ga0070671_100008497 3300005355 Bacteria 8230
113 Ga0070671_100024114 3300005355 Bacteria 4979
114 Ga0070671_100064067 3300005355 Bacteria 3062
115 Ga0070674_100007252 3300005356 Bacteria 6529
116 Ga0070673_100000006 3300005364 Bacteria 184299
117 Ga0070673_100010352 3300005364 Bacteria 6311
118 Ga0070673_100030287 3300005364 Bacteria 4046
119 Ga0070688_100001147 3300005365 Bacteria 13242
120 Ga0070659_100000032 3300005366 Bacteria 120241
121 Ga0070659_100001498 3300005366 Bacteria 16822
122 Ga0070659_100007541 3300005366 Bacteria 7907
123 Ga0070659_100019042 3300005366 Bacteria 5190
124 Ga0070659_100073404 3300005366 Bacteria 2723
125 Ga0070659_100075295 3300005366 Bacteria 2690
126 Ga0070667_100000024 3300005367 Bacteria 191216
127 Ga0070667_100000037 3300005367 Bacteria 172343
128 Ga0070667_100000273 3300005367 Bacteria 58596
129 Ga0070667_100000319 3300005367 Bacteria 53623
130 Ga0070667_100000836 3300005367 Bacteria 28641
131 Ga0070667_100001215 3300005367 Bacteria 23486
132 Ga0070667_100001851 3300005367 Bacteria 18782
133 Ga0070667_100005679 3300005367 Bacteria 10420
134 Ga0070667_100006741 3300005367 Bacteria 9540
135 Ga0070667_100022003 3300005367 Bacteria 5290
136 Ga0070667_100023080 3300005367 Bacteria 5161
137 Ga0070667_100023944 3300005367 Bacteria 5070
138 Ga0070667_100031595 3300005367 Bacteria 4414
139 Ga0070667_100048234 3300005367 Bacteria 3584
140 Ga0070709_10014179 3300005434 Bacteria 4503
141 Ga0070714_100007541 3300005435 Bacteria 8469
142 Ga0070714_100044833 3300005435 Bacteria 3745
143 Ga0070713_100005958 3300005436 Bacteria 8384
144 Ga0070694_100005190 3300005444 Bacteria 7865
145 Ga0070678_100002055 3300005456 Bacteria 10907
146 Ga0070678_100006988 3300005456 Bacteria 6664
147 Ga0070662_100000049 3300005457 Bacteria 64630
148 Ga0070662_100002297 3300005457 Bacteria 11741
149 Ga0070662_100007584 3300005457 Bacteria 7041
150 Ga0068867_100000001 3300005459 Bacteria 427563
151 Ga0068867_100012857 3300005459 Bacteria 5925
152 Ga0070679_100000019 3300005530 Bacteria 127108
153 Ga0070679_100046220 3300005530 Bacteria 4339
154 Ga0070679_100077629 3300005530 Bacteria 3310
155 Ga0070679_100094715 3300005530 Bacteria 2973
156 Ga0070684_100007236 3300005535 Bacteria 8625
157 Ga0070684_100009573 3300005535 Bacteria 7634
158 Ga0068853_100008695 3300005539 Bacteria 8166
159 Ga0068853_100079691 3300005539 Bacteria 2864
160 Ga0068853_100090576 3300005539 Bacteria 2688
161 Ga0070672_100003314 3300005543 Bacteria 10425
162 Ga0070672_100004957 3300005543 Bacteria 8764
163 Ga0070672_100010561 3300005543 Bacteria 6408
164 Ga0070686_100000003 3300005544 Bacteria 308397
165 Ga0070686_100000490 3300005544 Bacteria 23906
166 Ga0070693_100045150 3300005547 Bacteria 2496
167 Ga0070665_100000036 3300005548 Bacteria 314603
168 Ga0070665_100000089 3300005548 Bacteria 177659
169 Ga0070665_100001268 3300005548 Bacteria 30326
170 Ga0070665_100001846 3300005548 Bacteria 24054
171 Ga0070665_100028906 3300005548 Bacteria 5580
172 Ga0070665_100087480 3300005548 Bacteria 3121
173 Ga0068855_100000684 3300005563 Bacteria 41463
174 Ga0068855_100006131 3300005563 Bacteria 14659
175 Ga0068855_100006764 3300005563 Bacteria 13908
176 Ga0068855_100015361 3300005563 Bacteria 9217
177 Ga0068855_100059537 3300005563 Bacteria 4468
178 Ga0068855_100069687 3300005563 Bacteria 4092
179 Ga0070664_100000322 3300005564 Bacteria 34843
180 Ga0070664_100001418 3300005564 Bacteria 19109
181 Ga0070664_100006602 3300005564 Bacteria 9354
182 Ga0070664_100012169 3300005564 Bacteria 6992
183 Ga0070664_100090075 3300005564 Bacteria 2655
184 Ga0068857_100004087 3300005577 Bacteria 12294
185 Ga0068857_100006935 3300005577 Bacteria 9750
186 Ga0068857_100013154 3300005577 Bacteria 7212
187 Ga0068857_100023796 3300005577 Bacteria 5393
188 Ga0068854_100000227 3300005578 Bacteria 38075
189 Ga0068854_100005644 3300005578 Bacteria 7905
190 Ga0068856_100000219 3300005614 Bacteria 61699
191 Ga0068856_100005890 3300005614 Bacteria 12085
192 Ga0068856_100026966 3300005614 Bacteria 5604
193 Ga0068852_100000145 3300005616 Bacteria 47983
194 Ga0068852_100001923 3300005616 Bacteria 14149
195 Ga0068852_100008521 3300005616 Bacteria 7563
196 Ga0068852_100022979 3300005616 Bacteria 5010
197 Ga0068852_100054569 3300005616 Bacteria 3445
198 Ga0068859_100000294 3300005617 Bacteria 49703
199 Ga0068859_100004758 3300005617 Bacteria 13803
200 Ga0068859_100008230 3300005617 Bacteria 10580
201 Ga0068859_100016626 3300005617 Bacteria 7385
202 Ga0068859_100050792 3300005617 Bacteria 4166
203 Ga0068859_100066011 3300005617 Bacteria 3653
204 Ga0068864_100000010 3300005618 Bacteria 358723
205 Ga0068864_100000078 3300005618 Bacteria 103622
206 Ga0068864_100000098 3300005618 Bacteria 85661
207 Ga0068864_100009937 3300005618 Bacteria 7849
208 Ga0068864_100011924 3300005618 Bacteria 7179
209 Ga0068864_100022589 3300005618 Bacteria 5275
210 Ga0068864_100031073 3300005618 Bacteria 4530
211 Ga0068861_100018517 3300005719 Bacteria 4961
212 Ga0068861_100039024 3300005719 Bacteria 3542
213 Ga0068863_100000034 3300005841 Bacteria 168359
214 Ga0068863_100000082 3300005841 Bacteria 105688
215 Ga0068863_100000127 3300005841 Bacteria 80572
216 Ga0068863_100000882 3300005841 Bacteria 30167
217 Ga0068863_100002440 3300005841 Bacteria 18462
218 Ga0068863_100002504 3300005841 Bacteria 18262
219 Ga0068863_100007580 3300005841 Bacteria 10614
220 Ga0068863_100013498 3300005841 Bacteria 7880
221 Ga0068863_100071671 3300005841 Bacteria 3278
222 Ga0068858_100000466 3300005842 Bacteria 42207
223 Ga0068858_100002681 3300005842 Bacteria 17926
224 Ga0068858_100002977 3300005842 Bacteria 17000
225 Ga0068858_100008938 3300005842 Bacteria 9602
226 Ga0068858_100012035 3300005842 Bacteria 8155
227 Ga0068858_100018807 3300005842 Bacteria 6464
228 Ga0068860_100000001 3300005843 Bacteria 703043
229 Ga0068860_100000002 3300005843 Bacteria 627849
230 Ga0068860_100000269 3300005843 Bacteria 76230
231 Ga0068860_100000938 3300005843 Bacteria 32302
232 Ga0068860_100002576 3300005843 Bacteria 18976
233 Ga0068860_100003990 3300005843 Bacteria 15145
234 Ga0068860_100017254 3300005843 Bacteria 7036
235 Ga0068860_100020669 3300005843 Bacteria 6377
236 Ga0068860_100031311 3300005843 Bacteria 5113
237 Ga0068860_100042017 3300005843 Bacteria 4368
238 Ga0068862_100000016 3300005844 Bacteria 250031
239 Ga0068862_100000133 3300005844 Bacteria 86113
240 Ga0068862_100000236 3300005844 Bacteria 61275
241 Ga0068862_100000561 3300005844 Bacteria 38672
242 Ga0068862_100000580 3300005844 Bacteria 38040
243 Ga0068862_100000736 3300005844 Bacteria 32921
244 Ga0068862_100085040 3300005844 Bacteria 2749
245 Ga0081539_10009174 3300005985 Bacteria 8344
246 Ga0081539_10024161 3300005985 Bacteria 3953
247 Ga0070717_10006356 3300006028 Bacteria 8687
248 Ga0070717_10023147 3300006028 Bacteria 4918
249 Ga0075368_10000060 3300006042 Bacteria 26223
250 Ga0070712_100049134 3300006175 Bacteria 2928
251 Ga0097621_100020213 3300006237 Bacteria 5129
252 Ga0068871_100006672 3300006358 Bacteria 8186
253 Ga0075433_10021235 3300006852 Bacteria 5443
254 Ga0068865_100000003 3300006881 Bacteria 231761
255 Ga0097620_100000294 3300006931 Bacteria 49703
256 Ga0097620_100004758 3300006931 Bacteria 13803
257 Ga0097620_100008230 3300006931 Bacteria 10580
258 Ga0097620_100016626 3300006931 Bacteria 7385
259 Ga0097620_100044640 3300006931 Bacteria 4453
260 Ga0097620_100050794 3300006931 Bacteria 4166
261 Ga0097620_100066009 3300006931 Bacteria 3653
262 Ga0105251_10000741 3300009011 Bacteria 29926
263 Ga0105251_10016572 3300009011 Bacteria 3978
264 Ga0105240_10004567 3300009093 Bacteria 20996
265 Ga0105240_10010741 3300009093 Bacteria 12846
266 Ga0105240_10018147 3300009093 Bacteria 9459
267 Ga0105240_10022913 3300009093 Bacteria 8273
268 Ga0105240_10079325 3300009093 Bacteria 4040
269 Ga0105245_10054918 3300009098 Bacteria 3577
270 Ga0105243_10001081 3300009148 Bacteria 24937
271 Ga0105243_10048481 3300009148 Bacteria 3348
272 Ga0105242_10002812 3300009176 Bacteria 13637
273 Ga0105248_10000016 3300009177 Bacteria 308151
274 Ga0105248_10000413 3300009177 Bacteria 49136
275 Ga0105248_10001367 3300009177 Bacteria 27254
276 Ga0105248_10002175 3300009177 Bacteria 21708
277 Ga0105248_10004633 3300009177 Bacteria 15207
278 Ga0105248_10007162 3300009177 Bacteria 12236
279 Ga0105248_10010420 3300009177 Bacteria 10235
280 Ga0105248_10037189 3300009177 Bacteria 5445
281 Ga0105248_10122221 3300009177 Bacteria 2937
282 Ga0105248_10142088 3300009177 Bacteria 2708
283 Ga0105248_10156080 3300009177 Bacteria 2575
284 Ga0105237_10034586 3300009545 Bacteria 5116
285 Ga0105237_10054262 3300009545 Bacteria 4016
286 Ga0105237_10104268 3300009545 Bacteria 2827
287 Ga0105238_10050958 3300009551 Bacteria 4166
288 Ga0105249_10000026 3300009553 Bacteria 232053
289 Ga0105249_10000116 3300009553 Bacteria 108394
290 Ga0105249_10000244 3300009553 Bacteria 60263
291 Ga0105249_10003824 3300009553 Bacteria 12988
292 Ga0105249_10081919 3300009553 Bacteria 3001
293 Ga0105239_10000461 3300010375 Bacteria 59449
294 Ga0157373_10027756 3300013100 Bacteria 4084
295 Ga0157371_10003996 3300013102 Bacteria 13066
296 Ga0157371_10011083 3300013102 Bacteria 6981
297 Ga0157370_10000507 3300013104 Bacteria 48626
298 Ga0157370_10001258 3300013104 Bacteria 31653
299 Ga0157370_10014466 3300013104 Bacteria 8066
300 Ga0157370_10030819 3300013104 Bacteria 5254
301 Ga0157370_10042854 3300013104 Bacteria 4358
302 Ga0157369_10002111 3300013105 Bacteria 23970
303 Ga0157369_10002650 3300013105 Bacteria 21365
304 Ga0157369_10003933 3300013105 Bacteria 17627
305 Ga0157369_10012487 3300013105 Bacteria 9637
306 Ga0157369_10033310 3300013105 Bacteria 5662
307 Ga0157369_10086608 3300013105 Bacteria 3345
308 Ga0157374_10002117 3300013296 Bacteria 16704
309 Ga0157374_10008502 3300013296 Bacteria 8781
310 Ga0163162_10014543 3300013306 Bacteria 7690
311 Ga0163162_10081721 3300013306 Bacteria 3302
312 Ga0157372_10006625 3300013307 Bacteria 12328
313 Ga0157372_10050441 3300013307 Bacteria 4629
314 Ga0157372_10064916 3300013307 Bacteria 4097
315 Ga0157375_10002436 3300013308 Bacteria 16100
316 Ga0157375_10006830 3300013308 Bacteria 9941
317 Ga0157375_10009604 3300013308 Bacteria 8498
318 Ga0163163_10000258 3300014325 Bacteria 53627
319 Ga0163163_10000355 3300014325 Bacteria 44183
320 Ga0163163_10043116 3300014325 Bacteria 4421
321 Ga0157380_10000120 3300014326 Bacteria 43644
322 Ga0157380_10000896 3300014326 Bacteria 18732
323 Ga0157380_10033709 3300014326 Bacteria 3944
324 Ga0157377_10025825 3300014745 Bacteria 3137
325 Ga0157379_10004801 3300014968 Bacteria 11614
326 Ga0183363_1002 3300015690 Bacteria 425040
327 Ga0163161_10000008 3300017792 Bacteria 294642
328 Ga0163161_10074097 3300017792 Bacteria 2496
329 Ga0206356_10388316 3300020070 Bacteria 3652
330 Ga0206354_10280634 3300020081 Bacteria 8484
331 Ga0213873_10000007 3300021358 Bacteria 309961
332 Ga0213876_10000005 3300021384 Bacteria 727326
333 Ga0213876_10000332 3300021384 Bacteria 41214
334 Ga0213876_10008814 3300021384 Bacteria 5446
335 Ga0213875_10005221 3300021388 Bacteria 7011
336 Ga0213875_10006567 3300021388 Bacteria 6087
337 Ga0209147_101223 3300025229 Bacteria 10246
338 Ga0207427_100449 3300025231 Bacteria 22786
339 Ga0207425_1000094 3300025245 Bacteria 85629
340 Ga0209026_1002660 3300025250 Bacteria 6490
341 Ga0209148_1000117 3300025254 Bacteria 188938
342 Ga0209233_1000079 3300025261 Bacteria 346944
343 Ga0209565_1000011 3300025263 Bacteria 637062
344 Ga0209565_1000386 3300025263 Bacteria 37364
345 Ga0209455_1000579 3300025272 Bacteria 23844
346 Ga0209673_1004883 3300025273 Bacteria 6993
347 Ga0209673_1009923 3300025273 Bacteria 4067
348 Ga0209676_1002762 3300025292 Bacteria 11741
349 Ga0209025_1000727 3300025294 Bacteria 55857
350 Ga0209564_1001341 3300025295 Bacteria 26209
351 Ga0209758_1000002 3300025297 Bacteria 1400310
352 Ga0209758_1000108 3300025297 Bacteria 216541
353 Ga0209758_1002726 3300025297 Bacteria 17387
354 Ga0209050_1000342 3300025298 Bacteria 92644
355 Ga0209050_1000347 3300025298 Bacteria 90767
356 Ga0209050_1005484 3300025298 Bacteria 7943
357 Ga0209256_1000016 3300025299 Bacteria 599092
358 Ga0209051_1000226 3300025303 Bacteria 94990
359 Ga0209257_1000371 3300025304 Bacteria 90767
360 Ga0209257_1001924 3300025304 Bacteria 22420
361 Ga0209257_1002720 3300025304 Bacteria 16819
362 Ga0209257_1005943 3300025304 Bacteria 8199
363 Ga0207697_10000041 3300025315 Bacteria 48652
364 Ga0207697_10004435 3300025315 Bacteria 6708
365 Ga0207713_1002691 3300025735 Bacteria 12708
366 Ga0207682_10001142 3300025893 Bacteria 12295
367 Ga0207682_10001680 3300025893 Bacteria 10144
368 Ga0207682_10006199 3300025893 Bacteria 4833
369 Ga0207682_10014465 3300025893 Bacteria 3074
370 Ga0207688_10043279 3300025901 Bacteria 2507
371 Ga0207680_10000004 3300025903 Bacteria 827324
372 Ga0207680_10000377 3300025903 Bacteria 21333
373 Ga0207680_10004847 3300025903 Bacteria 6400
374 Ga0207680_10008148 3300025903 Bacteria 5134
375 Ga0207647_10000746 3300025904 Bacteria 25516
376 Ga0207647_10002493 3300025904 Bacteria 13942
377 Ga0207647_10005416 3300025904 Bacteria 9361
378 Ga0207647_10005436 3300025904 Bacteria 9336
379 Ga0207647_10017017 3300025904 Bacteria 4950
380 Ga0207647_10017332 3300025904 Bacteria 4897
381 Ga0207705_10000002 3300025909 Bacteria 2046852
382 Ga0207705_10000003 3300025909 Bacteria 709270
383 Ga0207705_10000076 3300025909 Bacteria 122975
384 Ga0207705_10000689 3300025909 Bacteria 27957
385 Ga0207705_10001091 3300025909 Bacteria 22077
386 Ga0207705_10003708 3300025909 Bacteria 11630
387 Ga0207705_10004401 3300025909 Bacteria 10644
388 Ga0207705_10009167 3300025909 Bacteria 7209
389 Ga0207705_10010637 3300025909 Bacteria 6683
390 Ga0207705_10012868 3300025909 Bacteria 6040
391 Ga0207705_10018123 3300025909 Bacteria 5034
392 Ga0207705_10020071 3300025909 Bacteria 4778
393 Ga0207705_10024959 3300025909 Bacteria 4266
394 Ga0207705_10032478 3300025909 Bacteria 3730
395 Ga0207707_10012625 3300025912 Bacteria 7340
396 Ga0207695_10001501 3300025913 Bacteria 38827
397 Ga0207695_10006489 3300025913 Bacteria 15170
398 Ga0207695_10008479 3300025913 Bacteria 12860
399 Ga0207695_10010486 3300025913 Bacteria 11335
400 Ga0207695_10026200 3300025913 Bacteria 6509
401 Ga0207695_10028820 3300025913 Bacteria 6147
402 Ga0207671_10004616 3300025914 Bacteria 13070
403 Ga0207693_10018427 3300025915 Bacteria 5562
404 Ga0207660_10000211 3300025917 Bacteria 37354
405 Ga0207660_10000241 3300025917 Bacteria 35515
406 Ga0207660_10005125 3300025917 Bacteria 8525
407 Ga0207660_10015903 3300025917 Bacteria 4974
408 Ga0207657_10000601 3300025919 Bacteria 38257
409 Ga0207657_10001227 3300025919 Bacteria 27358
410 Ga0207657_10001234 3300025919 Bacteria 27316
411 Ga0207657_10001913 3300025919 Bacteria 22483
412 Ga0207657_10006863 3300025919 Bacteria 11745
413 Ga0207657_10007072 3300025919 Bacteria 11529
414 Ga0207657_10009429 3300025919 Bacteria 9811
415 Ga0207657_10012931 3300025919 Bacteria 8207
416 Ga0207657_10014626 3300025919 Bacteria 7646
417 Ga0207657_10021003 3300025919 Bacteria 6156
418 Ga0207657_10024364 3300025919 Bacteria 5607
419 Ga0207657_10030124 3300025919 Bacteria 4930
420 Ga0207657_10068378 3300025919 Bacteria 3017
421 Ga0207649_10000055 3300025920 Bacteria 103054
422 Ga0207649_10000418 3300025920 Bacteria 31286
423 Ga0207649_10020495 3300025920 Bacteria 3793
424 Ga0207652_10000004 3300025921 Bacteria 436303
425 Ga0207652_10079482 3300025921 Bacteria 2865
426 Ga0207681_10000002 3300025923 Bacteria 985597
427 Ga0207681_10000013 3300025923 Bacteria 357411
428 Ga0207681_10000280 3300025923 Bacteria 37943
429 Ga0207681_10020642 3300025923 Bacteria 4177
430 Ga0207681_10044129 3300025923 Bacteria 2987
431 Ga0207694_10019525 3300025924 Bacteria 5124
432 Ga0207650_10000008 3300025925 Bacteria 498534
433 Ga0207650_10000683 3300025925 Bacteria 26649
434 Ga0207650_10000903 3300025925 Bacteria 22419
435 Ga0207650_10004449 3300025925 Bacteria 9574
436 Ga0207650_10006316 3300025925 Bacteria 8077
437 Ga0207650_10012542 3300025925 Bacteria 5848
438 Ga0207650_10012626 3300025925 Bacteria 5830
439 Ga0207650_10019150 3300025925 Bacteria 4809
440 Ga0207659_10000886 3300025926 Bacteria 17785
441 Ga0207659_10020367 3300025926 Bacteria 4383
442 Ga0207659_10029898 3300025926 Bacteria 3717
443 Ga0207700_10031014 3300025928 Bacteria 3793
444 Ga0207664_10032056 3300025929 Bacteria 4026
445 Ga0207644_10000002 3300025931 Bacteria 942221
446 Ga0207644_10000303 3300025931 Bacteria 32025
447 Ga0207644_10002544 3300025931 Bacteria 11738
448 Ga0207644_10005983 3300025931 Bacteria 7929
449 Ga0207644_10011588 3300025931 Bacteria 5837
450 Ga0207644_10012507 3300025931 Bacteria 5639
451 Ga0207644_10012633 3300025931 Bacteria 5613
452 Ga0207644_10012933 3300025931 Bacteria 5550
453 Ga0207644_10019287 3300025931 Bacteria 4624
454 Ga0207644_10027046 3300025931 Bacteria 3960
455 Ga0207644_10082304 3300025931 Bacteria 2381
456 Ga0207690_10000001 3300025932 Bacteria 807539
457 Ga0207690_10000045 3300025932 Bacteria 116965
458 Ga0207690_10001086 3300025932 Bacteria 17355
459 Ga0207690_10004589 3300025932 Bacteria 8164
460 Ga0207690_10004904 3300025932 Bacteria 7894
461 Ga0207690_10005587 3300025932 Bacteria 7429
462 Ga0207690_10025976 3300025932 Bacteria 3685
463 Ga0207690_10046506 3300025932 Bacteria 2875
464 Ga0207690_10058939 3300025932 Bacteria 2599
465 Ga0207706_10000920 3300025933 Bacteria 30195
466 Ga0207706_10001540 3300025933 Bacteria 22831
467 Ga0207706_10002229 3300025933 Bacteria 18927
468 Ga0207706_10004181 3300025933 Bacteria 13592
469 Ga0207706_10010819 3300025933 Bacteria 8324
470 Ga0207706_10018434 3300025933 Bacteria 6281
471 Ga0207706_10022102 3300025933 Bacteria 5709
472 Ga0207706_10061164 3300025933 Bacteria 3316
473 Ga0207706_10106973 3300025933 Bacteria 2461
474 Ga0207709_10000392 3300025935 Bacteria 43462
475 Ga0207704_10000001 3300025938 Bacteria 716296
476 Ga0207691_10002062 3300025940 Bacteria 19627
477 Ga0207691_10003851 3300025940 Bacteria 14559
478 Ga0207691_10017400 3300025940 Bacteria 6818
479 Ga0207691_10044981 3300025940 Bacteria 4061
480 Ga0207691_10099946 3300025940 Bacteria 2590
481 Ga0207711_10000022 3300025941 Bacteria 340441
482 Ga0207711_10000218 3300025941 Bacteria 61467
483 Ga0207711_10000534 3300025941 Bacteria 38916
484 Ga0207711_10000982 3300025941 Bacteria 27350
485 Ga0207711_10002001 3300025941 Bacteria 18440
486 Ga0207711_10002022 3300025941 Bacteria 18348
487 Ga0207711_10004208 3300025941 Bacteria 12318
488 Ga0207711_10006099 3300025941 Bacteria 10177
489 Ga0207711_10012933 3300025941 Bacteria 6932
490 Ga0207711_10019686 3300025941 Bacteria 5619
491 Ga0207711_10020799 3300025941 Bacteria 5475
492 Ga0207711_10075997 3300025941 Bacteria 2924
493 Ga0207689_10007603 3300025942 Bacteria 9493
494 Ga0207689_10016912 3300025942 Bacteria 6171
495 Ga0207661_10023087 3300025944 Bacteria 4696
496 Ga0207679_10009693 3300025945 Bacteria 6174
497 Ga0207679_10010537 3300025945 Bacteria 5957
498 Ga0207679_10013391 3300025945 Bacteria 5376
499 Ga0207667_10000013 3300025949 Bacteria 435875
500 Ga0207667_10001563 3300025949 Bacteria 28840
501 Ga0207667_10004518 3300025949 Bacteria 17046
502 Ga0207667_10005688 3300025949 Bacteria 15201
503 Ga0207667_10016822 3300025949 Bacteria 8250
504 Ga0207667_10023253 3300025949 Bacteria 6825
505 Ga0207667_10028992 3300025949 Bacteria 6008
506 Ga0207667_10035980 3300025949 Bacteria 5309
507 Ga0207667_10054784 3300025949 Bacteria 4194
508 Ga0207667_10058642 3300025949 Bacteria 4036
509 Ga0207667_10066158 3300025949 Bacteria 3768
510 Ga0207651_10000002 3300025960 Bacteria 427663
511 Ga0207651_10006617 3300025960 Bacteria 6089
512 Ga0207651_10013669 3300025960 Bacteria 4655
513 Ga0207712_10000001 3300025961 Bacteria 750309
514 Ga0207712_10000149 3300025961 Bacteria 72521
515 Ga0207712_10002657 3300025961 Bacteria 11439
516 Ga0207712_10009217 3300025961 Bacteria 6250
517 Ga0207668_10000021 3300025972 Bacteria 137592
518 Ga0207668_10000122 3300025972 Bacteria 54614
519 Ga0207668_10001573 3300025972 Bacteria 13356
520 Ga0207668_10004332 3300025972 Bacteria 8331
521 Ga0207668_10006879 3300025972 Bacteria 6749
522 Ga0207640_10000226 3300025981 Bacteria 39673
523 Ga0207640_10004019 3300025981 Bacteria 7949
524 Ga0207640_10012794 3300025981 Bacteria 4792
525 Ga0207640_10019698 3300025981 Bacteria 3991
526 Ga0207658_10000002 3300025986 Bacteria 1364188
527 Ga0207658_10000022 3300025986 Bacteria 191235
528 Ga0207658_10000143 3300025986 Bacteria 74612
529 Ga0207658_10000338 3300025986 Bacteria 46920
530 Ga0207658_10001244 3300025986 Bacteria 20133
531 Ga0207658_10002864 3300025986 Bacteria 12353
532 Ga0207658_10004687 3300025986 Bacteria 9475
533 Ga0207658_10008551 3300025986 Bacteria 6963
534 Ga0207658_10010390 3300025986 Bacteria 6323
535 Ga0207658_10022632 3300025986 Bacteria 4378
536 Ga0207658_10027021 3300025986 Bacteria 4029
537 Ga0207658_10041925 3300025986 Bacteria 3317
538 Ga0207658_10043322 3300025986 Bacteria 3271
539 Ga0207677_10000422 3300026023 Bacteria 28652
540 Ga0207703_10000960 3300026035 Bacteria 27866
541 Ga0207703_10001057 3300026035 Bacteria 26252
542 Ga0207703_10003379 3300026035 Bacteria 13405
543 Ga0207703_10005421 3300026035 Bacteria 10266
544 Ga0207703_10013659 3300026035 Bacteria 6327
545 Ga0207703_10058480 3300026035 Bacteria 3147
546 Ga0207703_10060053 3300026035 Bacteria 3107
547 Ga0207639_10002096 3300026041 Bacteria 13429
548 Ga0207639_10002194 3300026041 Bacteria 13147
549 Ga0207639_10003396 3300026041 Bacteria 10708
550 Ga0207639_10006965 3300026041 Bacteria 7704
551 Ga0207639_10010464 3300026041 Bacteria 6426
552 Ga0207639_10012207 3300026041 Bacteria 5978
553 Ga0207639_10012523 3300026041 Bacteria 5909
554 Ga0207639_10034036 3300026041 Bacteria 3763
555 Ga0207678_10005788 3300026067 Bacteria 11022
556 Ga0207678_10008843 3300026067 Bacteria 8866
557 Ga0207678_10014971 3300026067 Bacteria 6824
558 Ga0207678_10026153 3300026067 Bacteria 5092
559 Ga0207678_10028154 3300026067 Bacteria 4907
560 Ga0207678_10032966 3300026067 Bacteria 4513
561 Ga0207702_10000324 3300026078 Bacteria 54694
562 Ga0207702_10004001 3300026078 Bacteria 13237
563 Ga0207702_10007522 3300026078 Bacteria 9287
564 Ga0207702_10027033 3300026078 Bacteria 4764
565 Ga0207702_10038212 3300026078 Bacteria 4020
566 Ga0207641_10000022 3300026088 Bacteria 279334
567 Ga0207641_10000057 3300026088 Bacteria 168603
568 Ga0207641_10000139 3300026088 Bacteria 105740
569 Ga0207641_10000557 3300026088 Bacteria 41685
570 Ga0207641_10003469 3300026088 Bacteria 13968
571 Ga0207641_10003978 3300026088 Bacteria 12899
572 Ga0207641_10007052 3300026088 Bacteria 9389
573 Ga0207641_10028210 3300026088 Bacteria 4637
574 Ga0207641_10040282 3300026088 Bacteria 3911
575 Ga0207641_10073453 3300026088 Bacteria 2948
576 Ga0207648_10000001 3300026089 Bacteria 427499
577 Ga0207648_10016932 3300026089 Bacteria 6642
578 Ga0207648_10017811 3300026089 Bacteria 6447
579 Ga0207648_10036459 3300026089 Bacteria 4332
580 Ga0207648_10037944 3300026089 Bacteria 4241
581 Ga0207676_10000012 3300026095 Bacteria 353971
582 Ga0207676_10000051 3300026095 Bacteria 132645
583 Ga0207676_10000783 3300026095 Bacteria 24809
584 Ga0207676_10001536 3300026095 Bacteria 17029
585 Ga0207676_10003805 3300026095 Bacteria 10670
586 Ga0207676_10007988 3300026095 Bacteria 7524
587 Ga0207676_10100254 3300026095 Bacteria 2399
588 Ga0207674_10000344 3300026116 Bacteria 59855
589 Ga0207674_10008725 3300026116 Bacteria 11669
590 Ga0207674_10010450 3300026116 Bacteria 10513
591 Ga0207674_10016841 3300026116 Bacteria 7988
592 Ga0207674_10016935 3300026116 Bacteria 7959
593 Ga0207674_10019401 3300026116 Bacteria 7365
594 Ga0207674_10039133 3300026116 Bacteria 4917
595 Ga0207674_10144324 3300026116 Bacteria 2340
596 Ga0207675_100003225 3300026118 Bacteria 15997
597 Ga0207675_100007464 3300026118 Bacteria 10332
598 Ga0207675_100039877 3300026118 Bacteria 4382
599 Ga0207683_10005117 3300026121 Bacteria 11254
600 Ga0207683_10005966 3300026121 Bacteria 10436
601 Ga0207683_10008629 3300026121 Bacteria 8714
602 Ga0207683_10028949 3300026121 Bacteria 4794
603 Ga0207698_10000106 3300026142 Bacteria 52547
604 Ga0207698_10000244 3300026142 Bacteria 33363
605 Ga0207698_10001502 3300026142 Bacteria 13583
606 Ga0207698_10076651 3300026142 Bacteria 2677
607 Ga0209813_10000021 3300027866 Bacteria 75014
608 Ga0209974_10001060 3300027876 Bacteria 9750
609 Ga0209974_10002589 3300027876 Bacteria 6572
610 Ga0268266_10000042 3300028379 Bacteria 316826
611 Ga0268266_10000083 3300028379 Bacteria 202393
612 Ga0268266_10000459 3300028379 Bacteria 59218
613 Ga0268266_10001823 3300028379 Bacteria 24089
614 Ga0268266_10008886 3300028379 Bacteria 8896
615 Ga0268266_10025926 3300028379 Bacteria 4987
616 Ga0268265_10000006 3300028380 Bacteria 466482
617 Ga0268265_10000090 3300028380 Bacteria 116514
618 Ga0268265_10000233 3300028380 Bacteria 63492
619 Ga0268265_10000428 3300028380 Bacteria 44880
620 Ga0268265_10001727 3300028380 Bacteria 17651
621 Ga0268265_10004303 3300028380 Bacteria 9929
622 Ga0268265_10006094 3300028380 Bacteria 8186
623 Ga0268265_10015346 3300028380 Bacteria 5241
624 Ga0268265_10067986 3300028380 Bacteria 2760
625 Ga0268264_10000001 3300028381 Bacteria 1221000
626 Ga0268264_10000006 3300028381 Bacteria 827324
627 Ga0268264_10000071 3300028381 Bacteria 267236
628 Ga0268264_10000184 3300028381 Bacteria 131402
629 Ga0268264_10001197 3300028381 Bacteria 25051
630 Ga0268264_10005993 3300028381 Bacteria 10290
631 Ga0268264_10006774 3300028381 Bacteria 9623
632 Ga0268264_10007114 3300028381 Bacteria 9379
633 Ga0268264_10015341 3300028381 Bacteria 6283
634 Ga0268264_10023719 3300028381 Bacteria 5003
635 Ga0268264_10084606 3300028381 Bacteria 2720
636 Ga0268264_10115715 3300028381 Bacteria 2356
637 Ga0307513_10029559 3300031456 Bacteria 6245
638 Ga0307408_100010660 3300031548 Bacteria 6062
639 Ga0307408_100012026 3300031548 Bacteria 5729
640 Ga0307408_100012996 3300031548 Bacteria 5520
641 Ga0307408_100013832 3300031548 Bacteria 5358
642 Ga0307408_100023729 3300031548 Bacteria 4181
643 Ga0307405_10002476 3300031731 Bacteria 8151
644 Ga0307405_10003505 3300031731 Bacteria 7223
645 Ga0307405_10025689 3300031731 Bacteria 3385
646 Ga0307413_10008062 3300031824 Bacteria 4943
647 Ga0307413_10016743 3300031824 Bacteria 3798
648 Ga0307413_10063004 3300031824 Bacteria 2297
649 Ga0307410_10004549 3300031852 Bacteria 7190
650 Ga0307410_10006514 3300031852 Bacteria 6306
651 Ga0307410_10011038 3300031852 Bacteria 5149
652 Ga0307410_10025380 3300031852 Bacteria 3717
653 Ga0307410_10025537 3300031852 Bacteria 3708
654 Ga0307410_10042847 3300031852 Bacteria 2994
655 Ga0307410_10060727 3300031852 Bacteria 2584
656 Ga0307406_10002025 3300031901 Bacteria 11066
657 Ga0307406_10007660 3300031901 Bacteria 5994
658 Ga0307406_10013462 3300031901 Bacteria 4686
659 Ga0307406_10015513 3300031901 Bacteria 4411
660 Ga0307407_10000882 3300031903 Bacteria 10103
661 Ga0307407_10032179 3300031903 Bacteria 2848
662 Ga0307407_10036452 3300031903 Bacteria 2710
663 Ga0307407_10037008 3300031903 Bacteria 2693
664 Ga0307412_10000220 3300031911 Bacteria 38370
665 Ga0307412_10008401 3300031911 Bacteria 5890
666 Ga0307412_10011651 3300031911 Bacteria 5100
667 Ga0307412_10014636 3300031911 Bacteria 4633
668 Ga0307412_10025064 3300031911 Bacteria 3689
669 Ga0307412_10033822 3300031911 Bacteria 3252
670 Ga0307412_10052566 3300031911 Bacteria 2698
671 Ga0307409_100002259 3300031995 Bacteria 9967
672 Ga0307409_100002640 3300031995 Bacteria 9434
673 Ga0307409_100011576 3300031995 Bacteria 5573
674 Ga0307409_100017155 3300031995 Bacteria 4816
675 Ga0307409_100030984 3300031995 Bacteria 3852
676 Ga0307409_100066121 3300031995 Bacteria 2849
677 Ga0307416_100002880 3300032002 Bacteria 10020
678 Ga0307416_100005965 3300032002 Bacteria 7571
679 Ga0307416_100006413 3300032002 Bacteria 7364
680 Ga0307416_100011617 3300032002 Bacteria 5885
681 Ga0307416_100017691 3300032002 Bacteria 4996
682 Ga0307416_100084850 3300032002 Bacteria 2693
683 Ga0307414_10000420 3300032004 Bacteria 22862
684 Ga0307414_10015010 3300032004 Bacteria 4665
685 Ga0307414_10015112 3300032004 Bacteria 4652
686 Ga0307414_10016470 3300032004 Bacteria 4494
687 Ga0307414_10016809 3300032004 Bacteria 4461
688 Ga0307414_10025200 3300032004 Bacteria 3805
689 Ga0307414_10045558 3300032004 Bacteria 3004
690 Ga0307414_10047524 3300032004 Bacteria 2954
691 Ga0307411_10003179 3300032005 Bacteria 7553
692 Ga0307411_10004932 3300032005 Bacteria 6489
693 Ga0307411_10005854 3300032005 Bacteria 6094
694 Ga0307411_10021845 3300032005 Bacteria 3755
695 Ga0307411_10033492 3300032005 Bacteria 3187
696 Ga0307411_10035808 3300032005 Bacteria 3104
697 Ga0307415_100001510 3300032126 Bacteria 11161
698 Ga0307415_100001605 3300032126 Bacteria 10923
699 Ga0307415_100024275 3300032126 Bacteria 3781
700 Ga0307415_100027114 3300032126 Bacteria 3625
701 Ga0373955_0061763 3300035172 Bacteria 2070
702 Ga0373925_0018947 3300037068 Bacteria 5003
703 Ga0395899_0001221 3300037312 Bacteria 22495
704 Ga0395899_0001713 3300037312 Bacteria 18242
705 Ga0395899_0002705 3300037312 Bacteria 14292
706 Ga0395899_0004529 3300037312 Bacteria 10829
707 Ga0395899_0007351 3300037312 Bacteria 8518
708 Ga0395899_0017261 3300037312 Bacteria 5501
709 Ga0395899_0018628 3300037312 Bacteria 5275
710 Ga0395899_0023683 3300037312 Bacteria 4647
711 Ga0395899_0023704 3300037312 Bacteria 4644
712 Ga0395899_0058865 3300037312 Bacteria 2833
713 Ga0395899_0064564 3300037312 Bacteria 2691
714 Ga0395900_0000031 3300037418 Bacteria 262393
715 Ga0395900_0000240 3300037418 Bacteria 86222
716 Ga0395900_0001580 3300037418 Bacteria 26952
717 Ga0395900_0005640 3300037418 Bacteria 13093
718 Ga0395900_0008433 3300037418 Bacteria 10601
719 Ga0395900_0017597 3300037418 Bacteria 7292
720 Ga0395900_0019137 3300037418 Bacteria 6983
721 Ga0395900_0021034 3300037418 Bacteria 6667
722 Ga0395900_0021542 3300037418 Bacteria 6589
723 Ga0395900_0021802 3300037418 Bacteria 6549
724 Ga0395900_0030392 3300037418 Bacteria 5547
725 Ga0395900_0035510 3300037418 Bacteria 5134
726 Ga0395900_0037468 3300037418 Bacteria 4999
727 Ga0395900_0115412 3300037418 Bacteria 2755
728 Ga0395900_0154775 3300037418 Bacteria 2341
729 Ga0395898_0002338 3300037466 Bacteria 22624
730 Ga0395898_0003373 3300037466 Bacteria 17893
731 Ga0395898_0013482 3300037466 Bacteria 8415
732 Ga0395898_0015945 3300037466 Bacteria 7700
733 Ga0395898_0027780 3300037466 Bacteria 5673
734 Ga0395898_0028388 3300037466 Bacteria 5607
735 Ga0395898_0029637 3300037466 Bacteria 5478
736 Ga0395898_0034612 3300037466 Bacteria 5031
737 Ga0395898_0044282 3300037466 Bacteria 4382
738 Ga0395898_0054951 3300037466 Bacteria 3884
739 Ga0395898_0082945 3300037466 Bacteria 3090
740 Ga0395898_0108322 3300037466 Bacteria 2664
741 Ga0395905_0000219 3300037471 Bacteria 87705
742 Ga0395905_0000259 3300037471 Bacteria 79396
743 Ga0395905_0000538 3300037471 Bacteria 51665
744 Ga0395905_0001939 3300037471 Bacteria 23712
745 Ga0395905_0005920 3300037471 Bacteria 12397
746 Ga0395905_0006622 3300037471 Bacteria 11620
747 Ga0395905_0006816 3300037471 Bacteria 11438
748 Ga0395905_0013011 3300037471 Bacteria 7995
749 Ga0395905_0014266 3300037471 Bacteria 7590
750 Ga0395905_0017903 3300037471 Bacteria 6731
751 Ga0395905_0017924 3300037471 Bacteria 6726
752 Ga0395905_0021838 3300037471 Bacteria 6054
753 Ga0395905_0022182 3300037471 Bacteria 6007
754 Ga0395905_0022898 3300037471 Bacteria 5904
755 Ga0395905_0032555 3300037471 Bacteria 4903
756 Ga0395905_0039793 3300037471 Bacteria 4412
757 Ga0395905_0041183 3300037471 Bacteria 4334
758 Ga0395905_0041771 3300037471 Bacteria 4303
759 Ga0395905_0048172 3300037471 Bacteria 3994
760 Ga0395905_0053206 3300037471 Bacteria 3789
761 Ga0395905_0059347 3300037471 Bacteria 3576
762 Ga0395905_0064237 3300037471 Bacteria 3435
763 Ga0395905_0070511 3300037471 Bacteria 3275
764 Ga0395905_0072250 3300037471 Bacteria 3234
765 Ga0395905_0081037 3300037471 Bacteria 3042
766 Ga0395905_0088979 3300037471 Bacteria 2894
767 Ga0436364_1265123 3300037853 Bacteria 88807
768 Ga0436364_1516603 3300037853 Bacteria 34550
769 Ga0395901_0000295 3300038443 Bacteria 61830
770 Ga0395901_0002051 3300038443 Bacteria 20650
771 Ga0395901_0002717 3300038443 Bacteria 17820
772 Ga0395901_0003111 3300038443 Bacteria 16674
773 Ga0395901_0005322 3300038443 Bacteria 13005
774 Ga0395901_0008994 3300038443 Bacteria 10112
775 Ga0395901_0012531 3300038443 Bacteria 8603
776 Ga0395901_0015672 3300038443 Bacteria 7720
777 Ga0395901_0023793 3300038443 Bacteria 6281
778 Ga0395901_0047712 3300038443 Bacteria 4446
779 Ga0395901_0057737 3300038443 Bacteria 4036
780 Ga0395901_0065606 3300038443 Bacteria 3780
781 Ga0395901_0075293 3300038443 Bacteria 3521
782 Ga0395901_0087753 3300038443 Bacteria 3252
783 Ga0395901_0161857 3300038443 Bacteria 2350
784 Ga0237819_00654 3300038705 Bacteria 11248
785 Ga0436365_0010969 3300039437 Bacteria 175809
786 Ga0436365_0345276 3300039437 Bacteria 2445
787 Ga0436365_0352550 3300039437 Bacteria 74350
788 Ga0436365_0651625 3300039437 Bacteria 21859
789 Ga0436363_0462432 3300039450 Bacteria 2853
790 Ga0436362_0451893 3300039453 Bacteria 163419
791 Ga0439461_0000053 3300041410 Bacteria 14109
792 Ga0439465_0000404 3300041413 Bacteria 12518
793 Ga0439431_0000039 3300041997 Bacteria 18972
794 Ga0439455_0000903 3300042012 Bacteria 4595
795 Ga0450889_000013 3300042144 Bacteria 15867
796 Ga0439458_0000577 3300042157 Bacteria 9448
797 Ga0439458_0001904 3300042157 Bacteria 5168
798 Ga0466969_0005511 3300044656 Bacteria 6727
799 Ga0466965_0026248 3300044683 Bacteria 2823
800 Ga0466966_0001050 3300044684 Bacteria 17609
801 Ga0466966_0008480 3300044684 Bacteria 6803
802 Ga0466966_0066498 3300044684 Bacteria 2265
803 Ga0466961_0007548 3300044693 Bacteria 6922
804 Ga0466961_0010901 3300044693 Bacteria 5805
805 Ga0466961_0020391 3300044693 Bacteria 4264
806 Ga0466961_0029758 3300044693 Bacteria 3508
807 Ga0466963_0007693 3300044694 Bacteria 6435
808 Ga0466963_0009341 3300044694 Bacteria 5902
809 Ga0466963_0038085 3300044694 Bacteria 3144
810 Ga0466964_0011029 3300044706 Bacteria 3415
811 Ga0466971_0009368 3300044719 Bacteria 4279
812 Ga0466968_0002444 3300044735 Bacteria 6811
813 Ga0466970_0010920 3300044765 Bacteria 4619
814 Ga0466970_0019331 3300044765 Bacteria 3531
815 Ga0466957_0005369 3300044842 Bacteria 7193
816 Ga0466957_0007891 3300044842 Bacteria 6037
817 Ga0466957_0008566 3300044842 Bacteria 5821
818 Ga0466957_0037128 3300044842 Bacteria 2933
819 Ga0466959_0005115 3300045049 Bacteria 8929
820 Ga0466959_0007836 3300045049 Bacteria 7517
821 Ga0466959_0030165 3300045049 Bacteria 4016
822 Ga0466958_0012424 3300045836 Bacteria 4825
823 Ga0466958_0017748 3300045836 Bacteria 4120
824 Ga0466958_0036413 3300045836 Bacteria 2945
825 Ga0466967_0001147 3300045976 Bacteria 14807
826 Ga0466967_0017463 3300045976 Bacteria 5698
827 Ga0466967_0024434 3300045976 Bacteria 4968
828 Ga0466967_0031054 3300045976 Bacteria 4493
829 Ga0466967_0039841 3300045976 Bacteria 4042
830 Ga0466967_0111946 3300045976 Bacteria 2509
831 Ga0495627_000494 3300046453 Bacteria 33081
832 Ga0495627_002118 3300046453 Bacteria 10031
833 Ga0495638_0000011 3300046460 Bacteria 442453
834 Ga0495650_0002198 3300046471 Bacteria 16470
835 Ga0495583_0000242 3300046506 Bacteria 90367
836 Ga0495583_0000656 3300046506 Bacteria 45452
837 Ga0495606_0011166 3300046507 Bacteria 7353
838 Ga0495610_0000068 3300046512 Bacteria 122949
839 Ga0495632_0000007 3300046519 Bacteria 343246
840 Ga0495632_0000638 3300046519 Bacteria 32240
841 Ga0495637_0001444 3300046520 Bacteria 13998
842 Ga0495637_0013156 3300046520 Bacteria 3935
843 Ga0495643_0000005 3300046522 Bacteria 443135
844 Ga0495643_0037357 3300046522 Bacteria 2665
845 Ga0495648_0000023 3300046524 Bacteria 240174
846 Ga0495648_0000146 3300046524 Bacteria 84443
847 Ga0495648_0005794 3300046524 Bacteria 10187
848 Ga0495648_0032503 3300046524 Bacteria 3422
849 Ga0495663_0000005 3300046525 Bacteria 342265
850 Ga0495663_0001571 3300046525 Bacteria 7160
851 Ga0495654_0000264 3300046530 Bacteria 47686
852 Ga0495598_0000419 3300046537 Bacteria 7658
853 Ga0495621_0000702 3300046539 Bacteria 8468
854 Ga0495621_0001058 3300046539 Bacteria 7049
855 Ga0495622_0001865 3300046557 Bacteria 10383
856 Ga0495633_0000550 3300046558 Bacteria 36970
857 Ga0495633_0009460 3300046558 Bacteria 5378
858 Ga0495668_0000984 3300046616 Bacteria 31110
859 Ga0495668_0008640 3300046616 Bacteria 6332
860 Ga0495668_0012183 3300046616 Bacteria 5112
861 Ga0495625_0000231 3300046660 Bacteria 87237
862 Ga0495625_0003341 3300046660 Bacteria 16142
863 Ga0495659_0014576 3300046664 Bacteria 2574
864 Ga0495669_0004179 3300046684 Bacteria 5939
865 Ga0495669_0005050 3300046684 Bacteria 5486
866 Ga0495669_0018537 3300046684 Bacteria 2993
867 Ga0495670_0000037 3300046691 Bacteria 77395
868 Ga0495670_0003005 3300046691 Bacteria 8315
869 Ga0495670_0011855 3300046691 Bacteria 4291
870 Ga0495671_0000007 3300046692 Bacteria 443069
871 Ga0495671_0000012 3300046692 Bacteria 358632
872 Ga0495671_0005185 3300046692 Bacteria 7667
873 Ga0495677_0006015 3300047445 Bacteria 4589
874 Ga0495677_0007947 3300047445 Bacteria 3942
875 Ga0495673_0000029 3300047469 Bacteria 471019
876 Ga0495681_0000055 3300047470 Bacteria 104502
877 Ga0495681_0003880 3300047470 Bacteria 10318
878 Ga0495686_0000366 3300047472 Bacteria 73243
879 Ga0495686_0000733 3300047472 Bacteria 43762
880 Ga0495686_0002330 3300047472 Bacteria 18152
881 Ga0495686_0003257 3300047472 Bacteria 14241
882 Ga0495686_0006166 3300047472 Bacteria 9268
883 Ga0496101_0003562 3300048904 Bacteria 9716
884 Ga0496102_0000043 3300048905 Bacteria 189201
885 Ga0496102_0098827 3300048905 Bacteria 2708
886 Ga0496103_0000086 3300048906 Bacteria 104765
887 Ga0496103_0001411 3300048906 Bacteria 16135
888 Ga0496103_0017247 3300048906 Bacteria 4319
889 Ga0496103_0025972 3300048906 Bacteria 3543
890 Ga0496106_0022172 3300048909 Bacteria 4716
891 Ga0496108_0000676 3300048911 Bacteria 26369
892 Ga0496108_0007223 3300048911 Bacteria 9002
893 Ga0496108_0014728 3300048911 Bacteria 6382
894 Ga0496108_0142633 3300048911 Bacteria 2064
895 Ga0496109_0007031 3300048912 Bacteria 9494
896 Ga0496109_0010066 3300048912 Bacteria 8068
897 Ga0496109_0013508 3300048912 Bacteria 7085
898 Ga0496109_0015529 3300048912 Bacteria 6638
899 Ga0496109_0052367 3300048912 Bacteria 3720
900 Ga0496110_0007038 3300048913 Bacteria 8950
901 Ga0496110_0019377 3300048913 Bacteria 5723
902 Ga0496110_0037880 3300048913 Bacteria 4193
903 Ga0496110_0052779 3300048913 Bacteria 3572
904 Ga0496111_0004895 3300048914 Bacteria 8506
905 Ga0496111_0010448 3300048914 Bacteria 6229
906 Ga0496111_0053051 3300048914 Bacteria 2929
907 Ga0496112_0008952 3300048915 Bacteria 8989
908 Ga0496112_0019187 3300048915 Bacteria 6448
909 Ga0496112_0028174 3300048915 Bacteria 5419
910 Ga0496113_0004885 3300048916 Bacteria 8302
911 Ga0496113_0021580 3300048916 Bacteria 4543
912 Ga0496113_0022603 3300048916 Bacteria 4451
913 Ga0496113_0026073 3300048916 Bacteria 4175
914 Ga0496114_0000206 3300048917 Bacteria 42865
915 Ga0496114_0008532 3300048917 Bacteria 8122
916 Ga0496115_0000286 3300048918 Bacteria 43642
917 Ga0496115_0001332 3300048918 Bacteria 17591
918 Ga0496116_0001567 3300048919 Bacteria 25245
919 Ga0496117_0000104 3300048920 Bacteria 189201
920 Ga0496117_0005645 3300048920 Bacteria 13058
921 Ga0496117_0040697 3300048920 Bacteria 3414
922 Ga0496118_0000080 3300048921 Bacteria 189201
923 Ga0496118_0002599 3300048921 Bacteria 24027
924 Ga0496118_0004623 3300048921 Bacteria 16165
925 Ga0496119_0015384 3300048922 Bacteria 5896
926 Ga0496119_0045814 3300048922 Bacteria 2738
927 Ga0496121_0001812 3300048924 Bacteria 34516
928 Ga0496121_0069101 3300048924 Bacteria 2853
929 Ga0496122_0000858 3300048925 Bacteria 57235
930 Ga0496122_0006910 3300048925 Bacteria 12823
931 Ga0496122_0026630 3300048925 Bacteria 4976
932 Ga0496123_0001920 3300048926 Bacteria 27131
933 Ga0496123_0003121 3300048926 Bacteria 18996
934 Ga0496124_0000093 3300048927 Bacteria 189201
935 Ga0496124_0000907 3300048927 Bacteria 47809
936 Ga0496124_0016332 3300048927 Bacteria 7063
937 Ga0496124_0016452 3300048927 Bacteria 7028
938 Ga0496124_0016615 3300048927 Bacteria 6985
939 Ga0496125_0022921 3300048928 Bacteria 5784
940 Ga0496125_0088270 3300048928 Bacteria 2338
941 Ga0501290_000062 3300049513 Bacteria 15054
942 Ga0501292_000029 3300049515 Bacteria 40489
943 Ga0501034_0022255 3300049571 Bacteria 6460
944 Ga0501038_0085504 3300049574 Bacteria 2652
945 Ga0501047_0003521 3300049581 Bacteria 14779
946 Ga0501069_0004223 3300049585 Bacteria 7422
947 Ga0501223_000002 3300049663 Bacteria 154573
948 Ga0501223_000487 3300049663 Bacteria 9592
949 Ga0501223_001991 3300049663 Bacteria 4590
950 Ga0501224_000016 3300049664 Bacteria 86205
951 Ga0501249_000065 3300049679 Bacteria 38092
952 Ga0501261_000097 3300049690 Bacteria 13292
953 Ga0501225_0000444 3300049705 Bacteria 12894
954 Ga0501225_0000716 3300049705 Bacteria 10432
955 Ga0501245_000589 3300049708 Bacteria 4447
956 Ga0501279_000002 3300049775 Bacteria 205937
957 Ga0501280_000003 3300049776 Bacteria 93762
958 Ga0501282_000402 3300049778 Bacteria 5166
959 Ga0501283_000291 3300049779 Bacteria 6641
960 Ga0501044_0010861 3300049823 Bacteria 9880
961 Ga0501044_0132203 3300049823 Bacteria 2489
962 Ga0501226_000020 3300049853 Bacteria 141193
963 nmdc:mga06z11_22_c1 3300050494 Bacteria 69485
964 nmdc:mga04h51_163_c1 3300050495 Bacteria 19128
965 nmdc:mga0qj67_82083_c1 3300050509 Bacteria 2585
966 nmdc:mga0a205_9970_c1 3300050515 Bacteria 8717
967 Ga0500643_000268 3300053087 Bacteria 45965
968 Ga0500643_002236 3300053087 Bacteria 10213
969 Ga0500643_002356 3300053087 Bacteria 9866
970 Ga0500643_002728 3300053087 Bacteria 8858
971 Ga0500646_0006209 3300053090 Bacteria 3038
972 Ga0500566_0001604 3300053094 Bacteria 13311
973 Ga0500555_000970 3300053103 Bacteria 9931
974 Ga0500556_0000630 3300053104 Bacteria 22279
975 Ga0500592_000112 3300053116 Bacteria 17479
976 Ga0500642_0000001 3300053130 Bacteria 1468402
977 Ga0500642_0008568 3300053130 Bacteria 3510
978 Ga0500655_000037 3300053133 Bacteria 38087
979 Ga0500658_0000051 3300053134 Bacteria 62135
980 Ga0500658_0000386 3300053134 Bacteria 19390
981 Ga0500559_0023519 3300053136 Bacteria 2616
982 Ga0500568_0000866 3300053139 Bacteria 21242
983 Ga0500590_002839 3300053148 Bacteria 7830
984 Ga0500604_0000124 3300053151 Bacteria 23474
985 Ga0500616_0001216 3300053153 Bacteria 26011
986 Ga0500616_0001550 3300053153 Bacteria 21556
987 Ga0500616_0002224 3300053153 Bacteria 16590
988 Ga0500624_000038 3300053157 Bacteria 93803
989 Ga0500624_000042 3300053157 Bacteria 90289
990 Ga0500624_000087 3300053157 Bacteria 47425
991 Ga0500627_0000188 3300053158 Bacteria 18122
992 Ga0500627_0000436 3300053158 Bacteria 11313
993 Ga0500636_0000969 3300053177 Bacteria 15437
994 Ga0500637_0000047 3300053178 Bacteria 43949
995 Ga0500645_000831 3300053730 Bacteria 18380
996 Ga0466962_0006197 3300061719 Bacteria 5745
997 Ga0466962_0030675 3300061719 Bacteria 2575
998 2585262347 2582581305 Bacteria 4895574
999 2643730383 2643221541 Bacteria 5498788
1000 2644037203 2643221605 Bacteria 4772303
1001 2644043552 2643221606 Bacteria 5588032
1002 2644393711 2643221671 Bacteria 5496681
1003 2830078271 2830075706 Bacteria 3855215
1004 2885430243 2885429604 Bacteria 3642894
1005 2896429896 2896429255 Bacteria 2557483
1006 2928031183 2928027323 Bacteria 4382488
1007 2946789589 2946787523 Bacteria 4366789
1008 2984557404 2984555340 Bacteria 4247089
1009 2984568199 2984564862 Bacteria 4339992
1010 2990266130 2990265787 Bacteria 3943888
1011 2993359279 2993356040 Bacteria 4247105
1012 2993696076 2993693658 Bacteria 4040749
1013 8057105412 8057101203 Bacteria 5034064
1014 Ga0081455_10001457
1015 JGI24736J21556_1000147
1016 JGI24752J21851_1001367
1017 JGI24740J21852_10002826
1018 JGI24737J22298_10000878
1019 JGI24737J22298_10009088
1020 JGI24735J21928_10001266
1021 JGI24735J21928_10004279
1022 JGI24748J21848_1000054
1023 JGI24738J21930_10000337
1024 JGI24738J21930_10001002
1025 JGI24749J21850_1000089
1026 JGI24034J26672_10000022
1027 JGI24034J26672_10000052
1028 JGI24751J29686_10000211
1029 JGI25150J39212_1000349
1030 JGI25151J46595_10010171
1031 JGI25165J46597_1000043
1032 JGI25165J46597_1000445
1033 JGI25153J46596_10000715
1034 Ga0055537_1003207
1035 Ga0055537_1004434
1036 Ga0055524_1000209
1037 Ga0055530_10000131
1038 Ga0055530_10005544
1039 Ga0055540_1000884
1040 Ga0055531_10000514
1041 Ga0055531_10001213
1042 Ga0055531_10012654
1043 Ga0055531_10012656
1044 Ga0065165_1001460
1045 Ga0065165_1002740
1046 Ga0065165_1005614
1047 Ga0065704_10072750
1048 Ga0065715_10090627
1049 Ga0065707_10084485
1050 Ga0070658_10000001
1051 Ga0070658_10001115
1052 Ga0070658_10001347
1053 Ga0070658_10004856
1054 Ga0070658_10006282
1055 Ga0070658_10009163
1056 Ga0070658_10009294
1057 Ga0070658_10014226
1058 Ga0070658_10024406
1059 Ga0070658_10036889
1060 Ga0070658_10056723
1061 Ga0070683_100049156
1062 Ga0070690_100000038
1063 Ga0070670_100000012
1064 Ga0070670_100000125
1065 Ga0070670_100000517
1066 Ga0070670_100001836
1067 Ga0070670_100003954
1068 Ga0070670_100006594
1069 Ga0070670_100007253
1070 Ga0070670_100007633
1071 Ga0070670_100011972
1072 Ga0070670_100024317
1073 Ga0070670_100056973
1074 Ga0070670_100075020
1075 Ga0070677_10002056
1076 Ga0070677_10007615
1077 Ga0070666_10000002
1078 Ga0070666_10001023
1079 Ga0070666_10010671
1080 Ga0070666_10012267
1081 Ga0070680_100004659
1082 Ga0070680_100011939
1083 Ga0070680_100018665
1084 Ga0070680_100045105
1085 Ga0068868_100000752
1086 Ga0068868_100001006
1087 Ga0068868_100006922
1088 Ga0070660_100000322
1089 Ga0070660_100000862
1090 Ga0070660_100001455
1091 Ga0070660_100002916
1092 Ga0070660_100004357
1093 Ga0070660_100005333
1094 Ga0070660_100009539
1095 Ga0070660_100026922
1096 Ga0070660_100044767
1097 Ga0070691_10005365
1098 Ga0070661_100000189
1099 Ga0070661_100016453
1100 Ga0070661_100033400
1101 Ga0070661_100040827
1102 Ga0070661_100043637
1103 Ga0070668_100000004
1104 Ga0070668_100001775
1105 Ga0070668_100003499
1106 Ga0070668_100008189
1107 Ga0070668_100009224
1108 Ga0070668_100018413
1109 Ga0070668_100051271
1110 Ga0070668_100075285
1111 Ga0070669_100000001
1112 Ga0070669_100000041
1113 Ga0070669_100000237
1114 Ga0070669_100004048
1115 Ga0070669_100051823
1116 Ga0070675_100000201
1117 Ga0070675_100001388
1118 Ga0070675_100014605
1119 Ga0070671_100000007
1120 Ga0070671_100000730
1121 Ga0070671_100000951
1122 Ga0070671_100001205
1123 Ga0070671_100005522
1124 Ga0070671_100007391
1125 Ga0070671_100008497
1126 Ga0070671_100024114
1127 Ga0070671_100064067
1128 Ga0070674_100007252
1129 Ga0070673_100000006
1130 Ga0070673_100010352
1131 Ga0070673_100030287
1132 Ga0070688_100001147
1133 Ga0070659_100000032
1134 Ga0070659_100001498
1135 Ga0070659_100007541
1136 Ga0070659_100019042
1137 Ga0070659_100073404
1138 Ga0070659_100075295
1139 Ga0070667_100000024
1140 Ga0070667_100000037
1141 Ga0070667_100000273
1142 Ga0070667_100000319
1143 Ga0070667_100000836
1144 Ga0070667_100001215
1145 Ga0070667_100001851
1146 Ga0070667_100005679
1147 Ga0070667_100006741
1148 Ga0070667_100022003
1149 Ga0070667_100023080
1150 Ga0070667_100023944
1151 Ga0070667_100031595
1152 Ga0070667_100048234
1153 Ga0070709_10014179
1154 Ga0070714_100007541
1155 Ga0070714_100044833
1156 Ga0070713_100005958
1157 Ga0070694_100005190
1158 Ga0070678_100002055
1159 Ga0070678_100006988
1160 Ga0070662_100000049
1161 Ga0070662_100002297
1162 Ga0070662_100007584
1163 Ga0068867_100000001
1164 Ga0068867_100012857
1165 Ga0070679_100000019
1166 Ga0070679_100046220
1167 Ga0070679_100077629
1168 Ga0070679_100094715
1169 Ga0070684_100007236
1170 Ga0070684_100009573
1171 Ga0068853_100008695
1172 Ga0068853_100079691
1173 Ga0068853_100090576
1174 Ga0070672_100003314
1175 Ga0070672_100004957
1176 Ga0070672_100010561
1177 Ga0070686_100000003
1178 Ga0070686_100000490
1179 Ga0070693_100045150
1180 Ga0070665_100000036
1181 Ga0070665_100000089
1182 Ga0070665_100001268
1183 Ga0070665_100001846
1184 Ga0070665_100028906
1185 Ga0070665_100087480
1186 Ga0068855_100000684
1187 Ga0068855_100006131
1188 Ga0068855_100006764
1189 Ga0068855_100015361
1190 Ga0068855_100059537
1191 Ga0068855_100069687
1192 Ga0070664_100000322
1193 Ga0070664_100001418
1194 Ga0070664_100006602
1195 Ga0070664_100012169
1196 Ga0070664_100090075
1197 Ga0068857_100004087
1198 Ga0068857_100006935
1199 Ga0068857_100013154
1200 Ga0068857_100023796
1201 Ga0068854_100000227
1202 Ga0068854_100005644
1203 Ga0068856_100000219
1204 Ga0068856_100005890
1205 Ga0068856_100026966
1206 Ga0068852_100000145
1207 Ga0068852_100001923
1208 Ga0068852_100008521
1209 Ga0068852_100022979
1210 Ga0068852_100054569
1211 Ga0068859_100000294
1212 Ga0068859_100004758
1213 Ga0068859_100008230
1214 Ga0068859_100016626
1215 Ga0068859_100050792
1216 Ga0068859_100066011
1217 Ga0068864_100000010
1218 Ga0068864_100000078
1219 Ga0068864_100000098
1220 Ga0068864_100009937
1221 Ga0068864_100011924
1222 Ga0068864_100022589
1223 Ga0068864_100031073
1224 Ga0068861_100018517
1225 Ga0068861_100039024
1226 Ga0068863_100000034
1227 Ga0068863_100000082
1228 Ga0068863_100000127
1229 Ga0068863_100000882
1230 Ga0068863_100002440
1231 Ga0068863_100002504
1232 Ga0068863_100007580
1233 Ga0068863_100013498
1234 Ga0068863_100071671
1235 Ga0068858_100000466
1236 Ga0068858_100002681
1237 Ga0068858_100002977
1238 Ga0068858_100008938
1239 Ga0068858_100012035
1240 Ga0068858_100018807
1241 Ga0068860_100000001
1242 Ga0068860_100000002
1243 Ga0068860_100000269
1244 Ga0068860_100000938
1245 Ga0068860_100002576
1246 Ga0068860_100003990
1247 Ga0068860_100017254
1248 Ga0068860_100020669
1249 Ga0068860_100031311
1250 Ga0068860_100042017
1251 Ga0068862_100000016
1252 Ga0068862_100000133
1253 Ga0068862_100000236
1254 Ga0068862_100000561
1255 Ga0068862_100000580
1256 Ga0068862_100000736
1257 Ga0068862_100085040
1258 Ga0081539_10009174
1259 Ga0081539_10024161
1260 Ga0070717_10006356
1261 Ga0070717_10023147
1262 Ga0075368_10000060
1263 Ga0070712_100049134
1264 Ga0097621_100020213
1265 Ga0068871_100006672
1266 Ga0075433_10021235
1267 Ga0068865_100000003
1268 Ga0097620_100000294
1269 Ga0097620_100004758
1270 Ga0097620_100008230
1271 Ga0097620_100016626
1272 Ga0097620_100044640
1273 Ga0097620_100050794
1274 Ga0097620_100066009
1275 Ga0105251_10000741
1276 Ga0105251_10016572
1277 Ga0105240_10004567
1278 Ga0105240_10010741
1279 Ga0105240_10018147
1280 Ga0105240_10022913
1281 Ga0105240_10079325
1282 Ga0105245_10054918
1283 Ga0105243_10001081
1284 Ga0105243_10048481
1285 Ga0105242_10002812
1286 Ga0105248_10000016
1287 Ga0105248_10000413
1288 Ga0105248_10001367
1289 Ga0105248_10002175
1290 Ga0105248_10004633
1291 Ga0105248_10007162
1292 Ga0105248_10010420
1293 Ga0105248_10037189
1294 Ga0105248_10122221
1295 Ga0105248_10142088
1296 Ga0105248_10156080
1297 Ga0105237_10034586
1298 Ga0105237_10054262
1299 Ga0105237_10104268
1300 Ga0105238_10050958
1301 Ga0105249_10000026
1302 Ga0105249_10000116
1303 Ga0105249_10000244
1304 Ga0105249_10003824
1305 Ga0105249_10081919
1306 Ga0105239_10000461
1307 Ga0157373_10027756
1308 Ga0157371_10003996
1309 Ga0157371_10011083
1310 Ga0157370_10000507
1311 Ga0157370_10001258
1312 Ga0157370_10014466
1313 Ga0157370_10030819
1314 Ga0157370_10042854
1315 Ga0157369_10002111
1316 Ga0157369_10002650
1317 Ga0157369_10003933
1318 Ga0157369_10012487
1319 Ga0157369_10033310
1320 Ga0157369_10086608
1321 Ga0157374_10002117
1322 Ga0157374_10008502
1323 Ga0163162_10014543
1324 Ga0163162_10081721
1325 Ga0157372_10006625
1326 Ga0157372_10050441
1327 Ga0157372_10064916
1328 Ga0157375_10002436
1329 Ga0157375_10006830
1330 Ga0157375_10009604
1331 Ga0163163_10000258
1332 Ga0163163_10000355
1333 Ga0163163_10043116
1334 Ga0157380_10000120
1335 Ga0157380_10000896
1336 Ga0157380_10033709
1337 Ga0157377_10025825
1338 Ga0157379_10004801
1339 Ga0183363_1002
1340 Ga0163161_10000008
1341 Ga0163161_10074097
1342 Ga0206356_10388316
1343 Ga0206354_10280634
1344 Ga0213873_10000007
1345 Ga0213876_10000005
1346 Ga0213876_10000332
1347 Ga0213876_10008814
1348 Ga0213875_10005221
1349 Ga0213875_10006567
1350 Ga0209147_101223
1351 Ga0207427_100449
1352 Ga0207425_1000094
1353 Ga0209026_1002660
1354 Ga0209148_1000117
1355 Ga0209233_1000079
1356 Ga0209565_1000011
1357 Ga0209565_1000386
1358 Ga0209455_1000579
1359 Ga0209673_1004883
1360 Ga0209673_1009923
1361 Ga0209676_1002762
1362 Ga0209025_1000727
1363 Ga0209564_1001341
1364 Ga0209758_1000002
1365 Ga0209758_1000108
1366 Ga0209758_1002726
1367 Ga0209050_1000342
1368 Ga0209050_1000347
1369 Ga0209050_1005484
1370 Ga0209256_1000016
1371 Ga0209051_1000226
1372 Ga0209257_1000371
1373 Ga0209257_1001924
1374 Ga0209257_1002720
1375 Ga0209257_1005943
1376 Ga0207697_10000041
1377 Ga0207697_10004435
1378 Ga0207713_1002691
1379 Ga0207682_10001142
1380 Ga0207682_10001680
1381 Ga0207682_10006199
1382 Ga0207682_10014465
1383 Ga0207688_10043279
1384 Ga0207680_10000004
1385 Ga0207680_10000377
1386 Ga0207680_10004847
1387 Ga0207680_10008148
1388 Ga0207647_10000746
1389 Ga0207647_10002493
1390 Ga0207647_10005416
1391 Ga0207647_10005436
1392 Ga0207647_10017017
1393 Ga0207647_10017332
1394 Ga0207705_10000002
1395 Ga0207705_10000003
1396 Ga0207705_10000076
1397 Ga0207705_10000689
1398 Ga0207705_10001091
1399 Ga0207705_10003708
1400 Ga0207705_10004401
1401 Ga0207705_10009167
1402 Ga0207705_10010637
1403 Ga0207705_10012868
1404 Ga0207705_10018123
1405 Ga0207705_10020071
1406 Ga0207705_10024959
1407 Ga0207705_10032478
1408 Ga0207707_10012625
1409 Ga0207695_10001501
1410 Ga0207695_10006489
1411 Ga0207695_10008479
1412 Ga0207695_10010486
1413 Ga0207695_10026200
1414 Ga0207695_10028820
1415 Ga0207671_10004616
1416 Ga0207693_10018427
1417 Ga0207660_10000211
1418 Ga0207660_10000241
1419 Ga0207660_10005125
1420 Ga0207660_10015903
1421 Ga0207657_10000601
1422 Ga0207657_10001227
1423 Ga0207657_10001234
1424 Ga0207657_10001913
1425 Ga0207657_10006863
1426 Ga0207657_10007072
1427 Ga0207657_10009429
1428 Ga0207657_10012931
1429 Ga0207657_10014626
1430 Ga0207657_10021003
1431 Ga0207657_10024364
1432 Ga0207657_10030124
1433 Ga0207657_10068378
1434 Ga0207649_10000055
1435 Ga0207649_10000418
1436 Ga0207649_10020495
1437 Ga0207652_10000004
1438 Ga0207652_10079482
1439 Ga0207681_10000002
1440 Ga0207681_10000013
1441 Ga0207681_10000280
1442 Ga0207681_10020642
1443 Ga0207681_10044129
1444 Ga0207694_10019525
1445 Ga0207650_10000008
1446 Ga0207650_10000683
1447 Ga0207650_10000903
1448 Ga0207650_10004449
1449 Ga0207650_10006316
1450 Ga0207650_10012542
1451 Ga0207650_10012626
1452 Ga0207650_10019150
1453 Ga0207659_10000886
1454 Ga0207659_10020367
1455 Ga0207659_10029898
1456 Ga0207700_10031014
1457 Ga0207664_10032056
1458 Ga0207644_10000002
1459 Ga0207644_10000303
1460 Ga0207644_10002544
1461 Ga0207644_10005983
1462 Ga0207644_10011588
1463 Ga0207644_10012507
1464 Ga0207644_10012633
1465 Ga0207644_10012933
1466 Ga0207644_10019287
1467 Ga0207644_10027046
1468 Ga0207644_10082304
1469 Ga0207690_10000001
1470 Ga0207690_10000045
1471 Ga0207690_10001086
1472 Ga0207690_10004589
1473 Ga0207690_10004904
1474 Ga0207690_10005587
1475 Ga0207690_10025976
1476 Ga0207690_10046506
1477 Ga0207690_10058939
1478 Ga0207706_10000920
1479 Ga0207706_10001540
1480 Ga0207706_10002229
1481 Ga0207706_10004181
1482 Ga0207706_10010819
1483 Ga0207706_10018434
1484 Ga0207706_10022102
1485 Ga0207706_10061164
1486 Ga0207706_10106973
1487 Ga0207709_10000392
1488 Ga0207704_10000001
1489 Ga0207691_10002062
1490 Ga0207691_10003851
1491 Ga0207691_10017400
1492 Ga0207691_10044981
1493 Ga0207691_10099946
1494 Ga0207711_10000022
1495 Ga0207711_10000218
1496 Ga0207711_10000534
1497 Ga0207711_10000982
1498 Ga0207711_10002001
1499 Ga0207711_10002022
1500 Ga0207711_10004208
1501 Ga0207711_10006099
1502 Ga0207711_10012933
1503 Ga0207711_10019686
1504 Ga0207711_10020799
1505 Ga0207711_10075997
1506 Ga0207689_10007603
1507 Ga0207689_10016912
1508 Ga0207661_10023087
1509 Ga0207679_10009693
1510 Ga0207679_10010537
1511 Ga0207679_10013391
1512 Ga0207667_10000013
1513 Ga0207667_10001563
1514 Ga0207667_10004518
1515 Ga0207667_10005688
1516 Ga0207667_10016822
1517 Ga0207667_10023253
1518 Ga0207667_10028992
1519 Ga0207667_10035980
1520 Ga0207667_10054784
1521 Ga0207667_10058642
1522 Ga0207667_10066158
1523 Ga0207651_10000002
1524 Ga0207651_10006617
1525 Ga0207651_10013669
1526 Ga0207712_10000001
1527 Ga0207712_10000149
1528 Ga0207712_10002657
1529 Ga0207712_10009217
1530 Ga0207668_10000021
1531 Ga0207668_10000122
1532 Ga0207668_10001573
1533 Ga0207668_10004332
1534 Ga0207668_10006879
1535 Ga0207640_10000226
1536 Ga0207640_10004019
1537 Ga0207640_10012794
1538 Ga0207640_10019698
1539 Ga0207658_10000002
1540 Ga0207658_10000022
1541 Ga0207658_10000143
1542 Ga0207658_10000338
1543 Ga0207658_10001244
1544 Ga0207658_10002864
1545 Ga0207658_10004687
1546 Ga0207658_10008551
1547 Ga0207658_10010390
1548 Ga0207658_10022632
1549 Ga0207658_10027021
1550 Ga0207658_10041925
1551 Ga0207658_10043322
1552 Ga0207677_10000422
1553 Ga0207703_10000960
1554 Ga0207703_10001057
1555 Ga0207703_10003379
1556 Ga0207703_10005421
1557 Ga0207703_10013659
1558 Ga0207703_10058480
1559 Ga0207703_10060053
1560 Ga0207639_10002096
1561 Ga0207639_10002194
1562 Ga0207639_10003396
1563 Ga0207639_10006965
1564 Ga0207639_10010464
1565 Ga0207639_10012207
1566 Ga0207639_10012523
1567 Ga0207639_10034036
1568 Ga0207678_10005788
1569 Ga0207678_10008843
1570 Ga0207678_10014971
1571 Ga0207678_10026153
1572 Ga0207678_10028154
1573 Ga0207678_10032966
1574 Ga0207702_10000324
1575 Ga0207702_10004001
1576 Ga0207702_10007522
1577 Ga0207702_10027033
1578 Ga0207702_10038212
1579 Ga0207641_10000022
1580 Ga0207641_10000057
1581 Ga0207641_10000139
1582 Ga0207641_10000557
1583 Ga0207641_10003469
1584 Ga0207641_10003978
1585 Ga0207641_10007052
1586 Ga0207641_10028210
1587 Ga0207641_10040282
1588 Ga0207641_10073453
1589 Ga0207648_10000001
1590 Ga0207648_10016932
1591 Ga0207648_10017811
1592 Ga0207648_10036459
1593 Ga0207648_10037944
1594 Ga0207676_10000012
1595 Ga0207676_10000051
1596 Ga0207676_10000783
1597 Ga0207676_10001536
1598 Ga0207676_10003805
1599 Ga0207676_10007988
1600 Ga0207676_10100254
1601 Ga0207674_10000344
1602 Ga0207674_10008725
1603 Ga0207674_10010450
1604 Ga0207674_10016841
1605 Ga0207674_10016935
1606 Ga0207674_10019401
1607 Ga0207674_10039133
1608 Ga0207674_10144324
1609 Ga0207675_100003225
1610 Ga0207675_100007464
1611 Ga0207675_100039877
1612 Ga0207683_10005117
1613 Ga0207683_10005966
1614 Ga0207683_10008629
1615 Ga0207683_10028949
1616 Ga0207698_10000106
1617 Ga0207698_10000244
1618 Ga0207698_10001502
1619 Ga0207698_10076651
1620 Ga0209813_10000021
1621 Ga0209974_10001060
1622 Ga0209974_10002589
1623 Ga0268266_10000042
1624 Ga0268266_10000083
1625 Ga0268266_10000459
1626 Ga0268266_10001823
1627 Ga0268266_10008886
1628 Ga0268266_10025926
1629 Ga0268265_10000006
1630 Ga0268265_10000090
1631 Ga0268265_10000233
1632 Ga0268265_10000428
1633 Ga0268265_10001727
1634 Ga0268265_10004303
1635 Ga0268265_10006094
1636 Ga0268265_10015346
1637 Ga0268265_10067986
1638 Ga0268264_10000001
1639 Ga0268264_10000006
1640 Ga0268264_10000071
1641 Ga0268264_10000184
1642 Ga0268264_10001197
1643 Ga0268264_10005993
1644 Ga0268264_10006774
1645 Ga0268264_10007114
1646 Ga0268264_10015341
1647 Ga0268264_10023719
1648 Ga0268264_10084606
1649 Ga0268264_10115715
1650 Ga0307513_10029559
1651 Ga0307408_100010660
1652 Ga0307408_100012026
1653 Ga0307408_100012996
1654 Ga0307408_100013832
1655 Ga0307408_100023729
1656 Ga0307405_10002476
1657 Ga0307405_10003505
1658 Ga0307405_10025689
1659 Ga0307413_10008062
1660 Ga0307413_10016743
1661 Ga0307413_10063004
1662 Ga0307410_10004549
1663 Ga0307410_10006514
1664 Ga0307410_10011038
1665 Ga0307410_10025380
1666 Ga0307410_10025537
1667 Ga0307410_10042847
1668 Ga0307410_10060727
1669 Ga0307406_10002025
1670 Ga0307406_10007660
1671 Ga0307406_10013462
1672 Ga0307406_10015513
1673 Ga0307407_10000882
1674 Ga0307407_10032179
1675 Ga0307407_10036452
1676 Ga0307407_10037008
1677 Ga0307412_10000220
1678 Ga0307412_10008401
1679 Ga0307412_10011651
1680 Ga0307412_10014636
1681 Ga0307412_10025064
1682 Ga0307412_10033822
1683 Ga0307412_10052566
1684 Ga0307409_100002259
1685 Ga0307409_100002640
1686 Ga0307409_100011576
1687 Ga0307409_100017155
1688 Ga0307409_100030984
1689 Ga0307409_100066121
1690 Ga0307416_100002880
1691 Ga0307416_100005965
1692 Ga0307416_100006413
1693 Ga0307416_100011617
1694 Ga0307416_100017691
1695 Ga0307416_100084850
1696 Ga0307414_10000420
1697 Ga0307414_10015010
1698 Ga0307414_10015112
1699 Ga0307414_10016470
1700 Ga0307414_10016809
1701 Ga0307414_10025200
1702 Ga0307414_10045558
1703 Ga0307414_10047524
1704 Ga0307411_10003179
1705 Ga0307411_10004932
1706 Ga0307411_10005854
1707 Ga0307411_10021845
1708 Ga0307411_10033492
1709 Ga0307411_10035808
1710 Ga0307415_100001510
1711 Ga0307415_100001605
1712 Ga0307415_100024275
1713 Ga0307415_100027114
1714 Ga0373955_0061763
1715 Ga0373925_0018947
1716 Ga0395899_0001221
1717 Ga0395899_0001713
1718 Ga0395899_0002705
1719 Ga0395899_0004529
1720 Ga0395899_0007351
1721 Ga0395899_0017261
1722 Ga0395899_0018628
1723 Ga0395899_0023683
1724 Ga0395899_0023704
1725 Ga0395899_0058865
1726 Ga0395899_0064564
1727 Ga0395900_0000031
1728 Ga0395900_0000240
1729 Ga0395900_0001580
1730 Ga0395900_0005640
1731 Ga0395900_0008433
1732 Ga0395900_0017597
1733 Ga0395900_0019137
1734 Ga0395900_0021034
1735 Ga0395900_0021542
1736 Ga0395900_0021802
1737 Ga0395900_0030392
1738 Ga0395900_0035510
1739 Ga0395900_0037468
1740 Ga0395900_0115412
1741 Ga0395900_0154775
1742 Ga0395898_0002338
1743 Ga0395898_0003373
1744 Ga0395898_0013482
1745 Ga0395898_0015945
1746 Ga0395898_0027780
1747 Ga0395898_0028388
1748 Ga0395898_0029637
1749 Ga0395898_0034612
1750 Ga0395898_0044282
1751 Ga0395898_0054951
1752 Ga0395898_0082945
1753 Ga0395898_0108322
1754 Ga0395905_0000219
1755 Ga0395905_0000259
1756 Ga0395905_0000538
1757 Ga0395905_0001939
1758 Ga0395905_0005920
1759 Ga0395905_0006622
1760 Ga0395905_0006816
1761 Ga0395905_0013011
1762 Ga0395905_0014266
1763 Ga0395905_0017903
1764 Ga0395905_0017924
1765 Ga0395905_0021838
1766 Ga0395905_0022182
1767 Ga0395905_0022898
1768 Ga0395905_0032555
1769 Ga0395905_0039793
1770 Ga0395905_0041183
1771 Ga0395905_0041771
1772 Ga0395905_0048172
1773 Ga0395905_0053206
1774 Ga0395905_0059347
1775 Ga0395905_0064237
1776 Ga0395905_0070511
1777 Ga0395905_0072250
1778 Ga0395905_0081037
1779 Ga0395905_0088979
1780 Ga0436364_1265123
1781 Ga0436364_1516603
1782 Ga0395901_0000295
1783 Ga0395901_0002051
1784 Ga0395901_0002717
1785 Ga0395901_0003111
1786 Ga0395901_0005322
1787 Ga0395901_0008994
1788 Ga0395901_0012531
1789 Ga0395901_0015672
1790 Ga0395901_0023793
1791 Ga0395901_0047712
1792 Ga0395901_0057737
1793 Ga0395901_0065606
1794 Ga0395901_0075293
1795 Ga0395901_0087753
1796 Ga0395901_0161857
1797 Ga0237819_00654
1798 Ga0436365_0010969
1799 Ga0436365_0345276
1800 Ga0436365_0352550
1801 Ga0436365_0651625
1802 Ga0436363_0462432
1803 Ga0436362_0451893
1804 Ga0439461_0000053
1805 Ga0439465_0000404
1806 Ga0439431_0000039
1807 Ga0439455_0000903
1808 Ga0450889_000013
1809 Ga0439458_0000577
1810 Ga0439458_0001904
1811 Ga0466969_0005511
1812 Ga0466965_0026248
1813 Ga0466966_0001050
1814 Ga0466966_0008480
1815 Ga0466966_0066498
1816 Ga0466961_0007548
1817 Ga0466961_0010901
1818 Ga0466961_0020391
1819 Ga0466961_0029758
1820 Ga0466963_0007693
1821 Ga0466963_0009341
1822 Ga0466963_0038085
1823 Ga0466964_0011029
1824 Ga0466971_0009368
1825 Ga0466968_0002444
1826 Ga0466970_0010920
1827 Ga0466970_0019331
1828 Ga0466957_0005369
1829 Ga0466957_0007891
1830 Ga0466957_0008566
1831 Ga0466957_0037128
1832 Ga0466959_0005115
1833 Ga0466959_0007836
1834 Ga0466959_0030165
1835 Ga0466958_0012424
1836 Ga0466958_0017748
1837 Ga0466958_0036413
1838 Ga0466967_0001147
1839 Ga0466967_0017463
1840 Ga0466967_0024434
1841 Ga0466967_0031054
1842 Ga0466967_0039841
1843 Ga0466967_0111946
1844 Ga0495627_000494
1845 Ga0495627_002118
1846 Ga0495638_0000011
1847 Ga0495650_0002198
1848 Ga0495583_0000242
1849 Ga0495583_0000656
1850 Ga0495606_0011166
1851 Ga0495610_0000068
1852 Ga0495632_0000007
1853 Ga0495632_0000638
1854 Ga0495637_0001444
1855 Ga0495637_0013156
1856 Ga0495643_0000005
1857 Ga0495643_0037357
1858 Ga0495648_0000023
1859 Ga0495648_0000146
1860 Ga0495648_0005794
1861 Ga0495648_0032503
1862 Ga0495663_0000005
1863 Ga0495663_0001571
1864 Ga0495654_0000264
1865 Ga0495598_0000419
1866 Ga0495621_0000702
1867 Ga0495621_0001058
1868 Ga0495622_0001865
1869 Ga0495633_0000550
1870 Ga0495633_0009460
1871 Ga0495668_0000984
1872 Ga0495668_0008640
1873 Ga0495668_0012183
1874 Ga0495625_0000231
1875 Ga0495625_0003341
1876 Ga0495659_0014576
1877 Ga0495669_0004179
1878 Ga0495669_0005050
1879 Ga0495669_0018537
1880 Ga0495670_0000037
1881 Ga0495670_0003005
1882 Ga0495670_0011855
1883 Ga0495671_0000007
1884 Ga0495671_0000012
1885 Ga0495671_0005185
1886 Ga0495677_0006015
1887 Ga0495677_0007947
1888 Ga0495673_0000029
1889 Ga0495681_0000055
1890 Ga0495681_0003880
1891 Ga0495686_0000366
1892 Ga0495686_0000733
1893 Ga0495686_0002330
1894 Ga0495686_0003257
1895 Ga0495686_0006166
1896 Ga0496101_0003562
1897 Ga0496102_0000043
1898 Ga0496102_0098827
1899 Ga0496103_0000086
1900 Ga0496103_0001411
1901 Ga0496103_0017247
1902 Ga0496103_0025972
1903 Ga0496106_0022172
1904 Ga0496108_0000676
1905 Ga0496108_0007223
1906 Ga0496108_0014728
1907 Ga0496108_0142633
1908 Ga0496109_0007031
1909 Ga0496109_0010066
1910 Ga0496109_0013508
1911 Ga0496109_0015529
1912 Ga0496109_0052367
1913 Ga0496110_0007038
1914 Ga0496110_0019377
1915 Ga0496110_0037880
1916 Ga0496110_0052779
1917 Ga0496111_0004895
1918 Ga0496111_0010448
1919 Ga0496111_0053051
1920 Ga0496112_0008952
1921 Ga0496112_0019187
1922 Ga0496112_0028174
1923 Ga0496113_0004885
1924 Ga0496113_0021580
1925 Ga0496113_0022603
1926 Ga0496113_0026073
1927 Ga0496114_0000206
1928 Ga0496114_0008532
1929 Ga0496115_0000286
1930 Ga0496115_0001332
1931 Ga0496116_0001567
1932 Ga0496117_0000104
1933 Ga0496117_0005645
1934 Ga0496117_0040697
1935 Ga0496118_0000080
1936 Ga0496118_0002599
1937 Ga0496118_0004623
1938 Ga0496119_0015384
1939 Ga0496119_0045814
1940 Ga0496121_0001812
1941 Ga0496121_0069101
1942 Ga0496122_0000858
1943 Ga0496122_0006910
1944 Ga0496122_0026630
1945 Ga0496123_0001920
1946 Ga0496123_0003121
1947 Ga0496124_0000093
1948 Ga0496124_0000907
1949 Ga0496124_0016332
1950 Ga0496124_0016452
1951 Ga0496124_0016615
1952 Ga0496125_0022921
1953 Ga0496125_0088270
1954 Ga0501290_000062
1955 Ga0501292_000029
1956 Ga0501034_0022255
1957 Ga0501038_0085504
1958 Ga0501047_0003521
1959 Ga0501069_0004223
1960 Ga0501223_000002
1961 Ga0501223_000487
1962 Ga0501223_001991
1963 Ga0501224_000016
1964 Ga0501249_000065
1965 Ga0501261_000097
1966 Ga0501225_0000444
1967 Ga0501225_0000716
1968 Ga0501245_000589
1969 Ga0501279_000002
1970 Ga0501280_000003
1971 Ga0501282_000402
1972 Ga0501283_000291
1973 Ga0501044_0010861
1974 Ga0501044_0132203
1975 Ga0501226_000020
1976 nmdc:mga06z11_22_c1
1977 nmdc:mga04h51_163_c1
1978 nmdc:mga0qj67_82083_c1
1979 nmdc:mga0a205_9970_c1
1980 Ga0500643_000268
1981 Ga0500643_002236
1982 Ga0500643_002356
1983 Ga0500643_002728
1984 Ga0500646_0006209
1985 Ga0500566_0001604
1986 Ga0500555_000970
1987 Ga0500556_0000630
1988 Ga0500592_000112
1989 Ga0500642_0000001
1990 Ga0500642_0008568
1991 Ga0500655_000037
1992 Ga0500658_0000051
1993 Ga0500658_0000386
1994 Ga0500559_0023519
1995 Ga0500568_0000866
1996 Ga0500590_002839
1997 Ga0500604_0000124
1998 Ga0500616_0001216
1999 Ga0500616_0001550
2000 Ga0500616_0002224
2001 Ga0500624_000038
2002 Ga0500624_000042
2003 Ga0500624_000087
2004 Ga0500627_0000188
2005 Ga0500627_0000436
2006 Ga0500636_0000969
2007 Ga0500637_0000047
2008 Ga0500645_000831
2009 Ga0466962_0006197
2010 Ga0466962_0030675
2011 2585262347
2012 2643730383
2013 2644037203
2014 2644043552
2015 2644393711
2016 2830078271
2017 2885430243
2018 2896429896
2019 2928031183
2020 2946789589
2021 2984557404
2022 2984568199
2023 2990266130
2024 2993359279
2025 2993696076
2026 8057105412

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18074

PriA_C

Primosomal protein N C-terminal domain

648

738

0.96

PF17764

PriA_3primeBD

3'DNA-binding domain (3'BD)

5

102

0.9

PF00270

DEAD

DEAD/DEAH box helicase

239

393

0.88

PF04851

ResIII

Type III restriction enzyme, res subunit

189

387

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7g-assembly1.cif.gz_B crystal structure of the aa complex of the n-terminal domain of pria 0.8217 18 98
6dcr-assembly1.cif.gz_A e. coli pria helicase winged helix domain deletion protein 0.8139 3 706
6dcr-assembly1.cif.gz_A e. coli pria helicase winged helix domain deletion protein 0.8103 3 706
4nl8-assembly2.cif.gz_B pria helicase bound to ssb c-terminal tail peptide 0.8096 6 707
4nl8-assembly2.cif.gz_B pria helicase bound to ssb c-terminal tail peptide 0.8043 6 707
ID Description Score Start End Superfamily
af_Q2G266_251_447_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9293 187 372 3.40.50.300
4nl4H03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9201 182 372 3.40.50.300
af_P17888_491_656_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8901 476 616 3.40.50.300
4nl4H03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8888 182 372 3.40.50.300
af_Q2G266_251_447_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8755 187 372 3.40.50.300

Map