F488162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1012 | 445 | 2024 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100002770|Ga0068860_10000277011 |
| Length | 249 |
| Sequence | MTDQTVSFGYEDIASTEKTARVGEVFTSVARSYDLMNDAMSGGMHRLWKDRFVRRLKPRAGETILDMAGGTGDIAFRIAKSGAQVTVSDINPDMLAVGMDRARKKGPENKGLAGLVWSEQNAEALTFPTATFDAYTIAFGIRNVTHVQQALGEAHRVLRRGGRFFCLEFSTTLWPGFADVYDAYSHHIVPRLGKLLANDADSYRYLIESIRRFPDMATFEGMIAKAGFVRTHVEPMLGGLVAIHSGWKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 120 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 202 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 228 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 235 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 236 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 237 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 238 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 239 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 240 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 241 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 242 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 243 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 244 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 316 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 318 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 329 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 330 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 333 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 334 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 335 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 346 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 348 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 349 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 350 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 351 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 353 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 356 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 358 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 363 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 364 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 365 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 366 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 368 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 369 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 371 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 372 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 373 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 374 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 375 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 377 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 378 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 379 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 380 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 381 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 382 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 383 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 384 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 385 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 386 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 387 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 388 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 389 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 390 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 391 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 392 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 393 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 394 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 395 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 396 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 397 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 398 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 399 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 400 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 401 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 402 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 403 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 404 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 405 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 406 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 407 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 408 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 409 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 410 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 411 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 412 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 413 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 414 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 415 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 416 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 417 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 418 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 419 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 420 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 421 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 422 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 423 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 424 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 425 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 426 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 427 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 428 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 429 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 430 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 431 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 432 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 433 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 434 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 435 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 436 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 437 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 438 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 439 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 440 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 441 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 442 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 443 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 444 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 445 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.28 |
| Metatranscriptomes | 0 |
| Isolates | 6.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.59 |
| Bulb | 0 |
| Endosphere | 19.17 |
| Nodule | 0.1 |
| Rhizoplane | 2.37 |
| Rhizosphere | 63.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068860_100002770 | 3300005843 | Bacteria | 18221 |
| 2 | SwRhRL2b_contig_2092658 | 2162886007 | Bacteria | 3968 |
| 3 | SwRhRL2b_contig_2737664 | 2162886007 | Bacteria | 6858 |
| 4 | SwRhRL2b_contig_582393 | 2162886007 | Bacteria | 3266 |
| 5 | JGI24736J21556_1013858 | 3300001904 | Bacteria | 1299 |
| 6 | JGI24741J21665_1001762 | 3300001915 | Bacteria | 5953 |
| 7 | JGI24739J22299_10002548 | 3300001989 | Bacteria | 7028 |
| 8 | JGI24739J22299_10011332 | 3300001989 | Bacteria | 3293 |
| 9 | JGI24739J22299_10017654 | 3300001989 | Bacteria | 2572 |
| 10 | JGI24737J22298_10004146 | 3300001990 | Bacteria | 5068 |
| 11 | JGI24737J22298_10047037 | 3300001990 | Bacteria | 1316 |
| 12 | JGI24735J21928_10004389 | 3300002067 | Bacteria | 4746 |
| 13 | JGI24735J21928_10005489 | 3300002067 | Bacteria | 4206 |
| 14 | JGI24735J21928_10007628 | 3300002067 | Bacteria | 3524 |
| 15 | JGI24735J21928_10011878 | 3300002067 | Bacteria | 2756 |
| 16 | JGI24735J21928_10022420 | 3300002067 | Bacteria | 1922 |
| 17 | JGI24735J21928_10035929 | 3300002067 | Bacteria | 1454 |
| 18 | JGI24748J21848_1000454 | 3300002074 | Bacteria | 4554 |
| 19 | JGI24738J21930_10000636 | 3300002075 | Bacteria | 10127 |
| 20 | JGI24738J21930_10005673 | 3300002075 | Bacteria | 2972 |
| 21 | JGI24034J26672_10000696 | 3300002239 | Bacteria | 4316 |
| 22 | JGI24742J22300_10019210 | 3300002244 | Bacteria | 1160 |
| 23 | JGI24742J22300_10021347 | 3300002244 | Bacteria | 1105 |
| 24 | JGI25152J39213_1000659 | 3300002773 | Bacteria | 18044 |
| 25 | JGI25150J39212_1000347 | 3300002774 | Bacteria | 22719 |
| 26 | JGI25150J39212_1000465 | 3300002774 | Bacteria | 17717 |
| 27 | JGI25151J46595_10001250 | 3300003187 | Bacteria | 18044 |
| 28 | JGI25151J46595_10029422 | 3300003187 | Bacteria | 2175 |
| 29 | JGI25165J46597_1000094 | 3300003214 | Bacteria | 164674 |
| 30 | JGI25153J46596_10000008 | 3300003215 | Bacteria | 376808 |
| 31 | JGI25153J46596_10000029 | 3300003215 | Bacteria | 201658 |
| 32 | JGI25153J46596_10000903 | 3300003215 | Bacteria | 18044 |
| 33 | rootH1_10093328 | 3300003316 | Bacteria | 1204 |
| 34 | rootH2_10030501 | 3300003320 | Bacteria | 3170 |
| 35 | rootH1_10120080 | 3300003323 | Bacteria | 1376 |
| 36 | Ga0055525_1000063 | 3300003759 | Bacteria | 198877 |
| 37 | Ga0055525_1000064 | 3300003759 | Bacteria | 198750 |
| 38 | Ga0055542_1000795 | 3300003762 | Bacteria | 23364 |
| 39 | Ga0055542_1001337 | 3300003762 | Bacteria | 12843 |
| 40 | Ga0055529_1000037 | 3300003763 | Bacteria | 237307 |
| 41 | Ga0055526_1004964 | 3300003771 | Bacteria | 7812 |
| 42 | Ga0055526_1005847 | 3300003771 | Bacteria | 6908 |
| 43 | Ga0055526_1016035 | 3300003771 | Bacteria | 2966 |
| 44 | Ga0055537_1000403 | 3300003773 | Bacteria | 28853 |
| 45 | Ga0055537_1003251 | 3300003773 | Bacteria | 5061 |
| 46 | Ga0055537_1006067 | 3300003773 | Bacteria | 3130 |
| 47 | Ga0055524_1000410 | 3300003775 | Bacteria | 36259 |
| 48 | Ga0055524_1027333 | 3300003775 | Bacteria | 1734 |
| 49 | Ga0055536_1002521 | 3300003781 | Bacteria | 10262 |
| 50 | Ga0055536_1004416 | 3300003781 | Bacteria | 7202 |
| 51 | Ga0055536_1014951 | 3300003781 | Bacteria | 2686 |
| 52 | Ga0055536_1022199 | 3300003781 | Bacteria | 1902 |
| 53 | Ga0055534_1005664 | 3300003784 | Bacteria | 3294 |
| 54 | Ga0055528_1001877 | 3300003790 | Bacteria | 11968 |
| 55 | Ga0055530_10000005 | 3300003791 | Bacteria | 206625 |
| 56 | Ga0055530_10000409 | 3300003791 | Bacteria | 38215 |
| 57 | Ga0055530_10003696 | 3300003791 | Bacteria | 8527 |
| 58 | Ga0055530_10004768 | 3300003791 | Bacteria | 6819 |
| 59 | Ga0055530_10013230 | 3300003791 | Bacteria | 2825 |
| 60 | Ga0055531_10000009 | 3300003794 | Bacteria | 210399 |
| 61 | Ga0055531_10000687 | 3300003794 | Bacteria | 28808 |
| 62 | Ga0055531_10009392 | 3300003794 | Bacteria | 4998 |
| 63 | Ga0055531_10020213 | 3300003794 | Bacteria | 2648 |
| 64 | Ga0055531_10030079 | 3300003794 | Bacteria | 1833 |
| 65 | Ga0058692_1000053 | 3300003856 | Bacteria | 107166 |
| 66 | Ga0058692_1000370 | 3300003856 | Bacteria | 21615 |
| 67 | Ga0065165_1002223 | 3300005262 | Bacteria | 17324 |
| 68 | Ga0065165_1061613 | 3300005262 | Bacteria | 1026 |
| 69 | Ga0065704_10070413 | 3300005289 | Bacteria | 26038 |
| 70 | Ga0065704_10071247 | 3300005289 | Bacteria | 12254 |
| 71 | Ga0065704_10075189 | 3300005289 | Bacteria | 5743 |
| 72 | Ga0065704_10107595 | 3300005289 | Bacteria | 2051 |
| 73 | Ga0065704_10112030 | 3300005289 | Bacteria | 1943 |
| 74 | Ga0065707_10087869 | 3300005295 | Bacteria | 4858 |
| 75 | Ga0065707_10268188 | 3300005295 | Bacteria | 1078 |
| 76 | Ga0070658_10000703 | 3300005327 | Bacteria | 29018 |
| 77 | Ga0070658_10002141 | 3300005327 | Bacteria | 16565 |
| 78 | Ga0070658_10003377 | 3300005327 | Bacteria | 13153 |
| 79 | Ga0070676_10000747 | 3300005328 | Bacteria | 15988 |
| 80 | Ga0070683_100025777 | 3300005329 | Bacteria | 5286 |
| 81 | Ga0070670_100000016 | 3300005331 | Bacteria | 226440 |
| 82 | Ga0070670_100009550 | 3300005331 | Bacteria | 8277 |
| 83 | Ga0068869_100009489 | 3300005334 | Bacteria | 6317 |
| 84 | Ga0068869_100022149 | 3300005334 | Bacteria | 4375 |
| 85 | Ga0070666_10025171 | 3300005335 | Bacteria | 3879 |
| 86 | Ga0070666_10109106 | 3300005335 | Bacteria | 1913 |
| 87 | Ga0070682_100073849 | 3300005337 | Bacteria | 2189 |
| 88 | Ga0068868_100001464 | 3300005338 | Bacteria | 16289 |
| 89 | Ga0070660_100002482 | 3300005339 | Bacteria | 12651 |
| 90 | Ga0070660_100010090 | 3300005339 | Bacteria | 6663 |
| 91 | Ga0070660_100119026 | 3300005339 | Bacteria | 2106 |
| 92 | Ga0070660_100202413 | 3300005339 | Bacteria | 1610 |
| 93 | Ga0070661_100008555 | 3300005344 | Bacteria | 7077 |
| 94 | Ga0070661_100117772 | 3300005344 | Bacteria | 1987 |
| 95 | Ga0070661_100381566 | 3300005344 | Bacteria | 1111 |
| 96 | Ga0070668_100000927 | 3300005347 | Bacteria | 20472 |
| 97 | Ga0070668_100004618 | 3300005347 | Bacteria | 10202 |
| 98 | Ga0070668_100029440 | 3300005347 | Bacteria | 4171 |
| 99 | Ga0070668_100313957 | 3300005347 | Bacteria | 1318 |
| 100 | Ga0070669_100000776 | 3300005353 | Bacteria | 23176 |
| 101 | Ga0070669_100001504 | 3300005353 | Bacteria | 16853 |
| 102 | Ga0070669_100118590 | 3300005353 | Bacteria | 2016 |
| 103 | Ga0070669_100123844 | 3300005353 | Bacteria | 1976 |
| 104 | Ga0070671_100000829 | 3300005355 | Bacteria | 22442 |
| 105 | Ga0070671_100027240 | 3300005355 | Bacteria | 4702 |
| 106 | Ga0070671_100035619 | 3300005355 | Bacteria | 4123 |
| 107 | Ga0070671_100088883 | 3300005355 | Bacteria | 2586 |
| 108 | Ga0070671_100572422 | 3300005355 | Bacteria | 975 |
| 109 | Ga0070674_100004401 | 3300005356 | Bacteria | 8030 |
| 110 | Ga0070674_100010366 | 3300005356 | Bacteria | 5630 |
| 111 | Ga0070674_100231178 | 3300005356 | Bacteria | 1443 |
| 112 | Ga0070673_100000018 | 3300005364 | Bacteria | 110071 |
| 113 | Ga0070659_100242055 | 3300005366 | Bacteria | 1493 |
| 114 | Ga0070667_100000528 | 3300005367 | Bacteria | 38357 |
| 115 | Ga0070667_100001140 | 3300005367 | Bacteria | 24152 |
| 116 | Ga0070667_100016515 | 3300005367 | Bacteria | 6109 |
| 117 | Ga0070667_100193863 | 3300005367 | Bacteria | 1801 |
| 118 | Ga0070663_100000625 | 3300005455 | Bacteria | 18934 |
| 119 | Ga0070663_100061889 | 3300005455 | Bacteria | 2697 |
| 120 | Ga0070663_100170665 | 3300005455 | Bacteria | 1681 |
| 121 | Ga0070663_100582844 | 3300005455 | Bacteria | 939 |
| 122 | Ga0070678_100007825 | 3300005456 | Bacteria | 6358 |
| 123 | Ga0070678_100055931 | 3300005456 | Bacteria | 2883 |
| 124 | Ga0070662_100000183 | 3300005457 | Bacteria | 36515 |
| 125 | Ga0070662_100002569 | 3300005457 | Bacteria | 11185 |
| 126 | Ga0070662_100037941 | 3300005457 | Bacteria | 3419 |
| 127 | Ga0070681_10004781 | 3300005458 | Bacteria | 12980 |
| 128 | Ga0068867_100001234 | 3300005459 | Bacteria | 17608 |
| 129 | Ga0070679_100001448 | 3300005530 | Bacteria | 20991 |
| 130 | Ga0070684_100160304 | 3300005535 | Bacteria | 2041 |
| 131 | Ga0070684_100733962 | 3300005535 | Bacteria | 921 |
| 132 | Ga0068853_100002487 | 3300005539 | Bacteria | 13809 |
| 133 | Ga0068853_100029337 | 3300005539 | Bacteria | 4636 |
| 134 | Ga0068853_100347654 | 3300005539 | Bacteria | 1379 |
| 135 | Ga0068853_100397668 | 3300005539 | Bacteria | 1289 |
| 136 | Ga0068853_100487548 | 3300005539 | Bacteria | 1162 |
| 137 | Ga0070672_100015740 | 3300005543 | Bacteria | 5400 |
| 138 | Ga0070672_100232606 | 3300005543 | Bacteria | 1549 |
| 139 | Ga0070672_100830901 | 3300005543 | Bacteria | 814 |
| 140 | Ga0070665_100000023 | 3300005548 | Bacteria | 375278 |
| 141 | Ga0070665_100000070 | 3300005548 | Bacteria | 200681 |
| 142 | Ga0070665_100008683 | 3300005548 | Bacteria | 10285 |
| 143 | Ga0070665_100177602 | 3300005548 | Bacteria | 2130 |
| 144 | Ga0070665_100452386 | 3300005548 | Bacteria | 1294 |
| 145 | Ga0070665_100503137 | 3300005548 | Bacteria | 1223 |
| 146 | Ga0068855_100000066 | 3300005563 | Bacteria | 125787 |
| 147 | Ga0068855_100004493 | 3300005563 | Bacteria | 17049 |
| 148 | Ga0068855_100051665 | 3300005563 | Bacteria | 4842 |
| 149 | Ga0068855_100180742 | 3300005563 | Bacteria | 2385 |
| 150 | Ga0068855_100188025 | 3300005563 | Bacteria | 2331 |
| 151 | Ga0068855_100361621 | 3300005563 | Bacteria | 1597 |
| 152 | Ga0070664_100216012 | 3300005564 | Bacteria | 1714 |
| 153 | Ga0068857_100037357 | 3300005577 | Bacteria | 4302 |
| 154 | Ga0068857_100201968 | 3300005577 | Bacteria | 1812 |
| 155 | Ga0068857_100506446 | 3300005577 | Bacteria | 1133 |
| 156 | Ga0068854_100000153 | 3300005578 | Bacteria | 47015 |
| 157 | Ga0068854_100007254 | 3300005578 | Bacteria | 7078 |
| 158 | Ga0068854_100010799 | 3300005578 | Bacteria | 5926 |
| 159 | Ga0068854_100037586 | 3300005578 | Bacteria | 3399 |
| 160 | Ga0068854_100078801 | 3300005578 | Bacteria | 2428 |
| 161 | Ga0068854_100121886 | 3300005578 | Bacteria | 1981 |
| 162 | Ga0068856_100009163 | 3300005614 | Bacteria | 9623 |
| 163 | Ga0068856_100030557 | 3300005614 | Bacteria | 5265 |
| 164 | Ga0068852_100056880 | 3300005616 | Bacteria | 3382 |
| 165 | Ga0068852_100078536 | 3300005616 | Bacteria | 2920 |
| 166 | Ga0068852_100217427 | 3300005616 | Bacteria | 1816 |
| 167 | Ga0068852_100476291 | 3300005616 | Bacteria | 1240 |
| 168 | Ga0068859_100005055 | 3300005617 | Bacteria | 13386 |
| 169 | Ga0068859_100074439 | 3300005617 | Bacteria | 3435 |
| 170 | Ga0068859_100095478 | 3300005617 | Bacteria | 3026 |
| 171 | Ga0068864_100000017 | 3300005618 | Bacteria | 285607 |
| 172 | Ga0068861_100000002 | 3300005719 | Bacteria | 111914 |
| 173 | Ga0068863_100000018 | 3300005841 | Bacteria | 206948 |
| 174 | Ga0068863_100002981 | 3300005841 | Bacteria | 16743 |
| 175 | Ga0068863_100291741 | 3300005841 | Bacteria | 1581 |
| 176 | Ga0068858_100000112 | 3300005842 | Bacteria | 86034 |
| 177 | Ga0068858_100015224 | 3300005842 | Bacteria | 7235 |
| 178 | Ga0068858_100370622 | 3300005842 | Bacteria | 1373 |
| 179 | Ga0068858_100794712 | 3300005842 | Bacteria | 923 |
| 180 | Ga0068860_100004621 | 3300005843 | Bacteria | 14059 |
| 181 | Ga0068860_100042994 | 3300005843 | Bacteria | 4312 |
| 182 | Ga0068860_100128610 | 3300005843 | Bacteria | 2429 |
| 183 | Ga0068860_100452717 | 3300005843 | Bacteria | 1276 |
| 184 | Ga0068860_100535766 | 3300005843 | Bacteria | 1172 |
| 185 | Ga0068862_100000010 | 3300005844 | Bacteria | 285607 |
| 186 | Ga0068862_100000877 | 3300005844 | Bacteria | 29301 |
| 187 | Ga0068862_100001863 | 3300005844 | Bacteria | 19097 |
| 188 | Ga0068862_100007339 | 3300005844 | Bacteria | 9155 |
| 189 | Ga0068862_100076371 | 3300005844 | Bacteria | 2899 |
| 190 | Ga0068862_100090810 | 3300005844 | Bacteria | 2659 |
| 191 | Ga0075365_10106104 | 3300006038 | Bacteria | 1927 |
| 192 | Ga0075368_10000152 | 3300006042 | Bacteria | 18566 |
| 193 | Ga0075363_100000467 | 3300006048 | Bacteria | 12681 |
| 194 | Ga0075363_100002645 | 3300006048 | Bacteria | 7386 |
| 195 | Ga0075364_10020634 | 3300006051 | Bacteria | 4146 |
| 196 | Ga0075362_10000066 | 3300006177 | Bacteria | 29420 |
| 197 | Ga0075362_10000596 | 3300006177 | Bacteria | 10593 |
| 198 | Ga0075362_10009230 | 3300006177 | Bacteria | 3806 |
| 199 | Ga0075362_10075098 | 3300006177 | Bacteria | 1550 |
| 200 | Ga0075367_10007912 | 3300006178 | Bacteria | 5478 |
| 201 | Ga0075367_10079057 | 3300006178 | Bacteria | 1987 |
| 202 | Ga0075369_10021559 | 3300006186 | Bacteria | 2649 |
| 203 | Ga0075369_10070859 | 3300006186 | Bacteria | 1534 |
| 204 | Ga0075366_10000145 | 3300006195 | Bacteria | 29884 |
| 205 | Ga0075366_10007378 | 3300006195 | Bacteria | 6069 |
| 206 | Ga0075366_10011539 | 3300006195 | Bacteria | 4989 |
| 207 | Ga0075366_10028114 | 3300006195 | Bacteria | 3299 |
| 208 | Ga0097621_100009955 | 3300006237 | Bacteria | 6930 |
| 209 | Ga0097621_100212787 | 3300006237 | Bacteria | 1682 |
| 210 | Ga0075370_10000055 | 3300006353 | Bacteria | 33979 |
| 211 | Ga0075370_10004306 | 3300006353 | Bacteria | 6891 |
| 212 | Ga0075370_10008006 | 3300006353 | Bacteria | 5418 |
| 213 | Ga0075370_10037121 | 3300006353 | Bacteria | 2739 |
| 214 | Ga0075370_10269803 | 3300006353 | Bacteria | 1010 |
| 215 | Ga0068871_100042617 | 3300006358 | Bacteria | 3645 |
| 216 | Ga0068865_100000007 | 3300006881 | Bacteria | 185316 |
| 217 | Ga0097620_100005055 | 3300006931 | Bacteria | 13386 |
| 218 | Ga0097620_100074438 | 3300006931 | Bacteria | 3435 |
| 219 | Ga0097620_100095482 | 3300006931 | Bacteria | 3026 |
| 220 | Ga0105251_10000155 | 3300009011 | Bacteria | 69872 |
| 221 | Ga0105251_10002120 | 3300009011 | Bacteria | 15958 |
| 222 | Ga0105251_10002321 | 3300009011 | Bacteria | 15063 |
| 223 | Ga0105251_10003158 | 3300009011 | Bacteria | 12211 |
| 224 | Ga0105244_10011175 | 3300009036 | Bacteria | 5405 |
| 225 | Ga0105244_10049489 | 3300009036 | Bacteria | 2147 |
| 226 | Ga0105250_10099377 | 3300009092 | Bacteria | 1187 |
| 227 | Ga0105240_10030522 | 3300009093 | Bacteria | 7005 |
| 228 | Ga0105240_11213236 | 3300009093 | Bacteria | 798 |
| 229 | Ga0105245_10003037 | 3300009098 | Bacteria | 15045 |
| 230 | Ga0105245_10005071 | 3300009098 | Bacteria | 11578 |
| 231 | Ga0105247_10009791 | 3300009101 | Bacteria | 5807 |
| 232 | Ga0105247_10014568 | 3300009101 | Bacteria | 4716 |
| 233 | Ga0105243_10000221 | 3300009148 | Bacteria | 66335 |
| 234 | Ga0105243_10000264 | 3300009148 | Bacteria | 58988 |
| 235 | Ga0105243_10058114 | 3300009148 | Bacteria | 3081 |
| 236 | Ga0105243_10686186 | 3300009148 | Bacteria | 996 |
| 237 | Ga0105241_10033095 | 3300009174 | Bacteria | 3880 |
| 238 | Ga0105241_10089543 | 3300009174 | Bacteria | 2425 |
| 239 | Ga0105242_10002348 | 3300009176 | Bacteria | 14933 |
| 240 | Ga0105242_10359058 | 3300009176 | Bacteria | 1348 |
| 241 | Ga0105242_10507852 | 3300009176 | Bacteria | 1148 |
| 242 | Ga0105248_10000105 | 3300009177 | Bacteria | 94143 |
| 243 | Ga0105248_10004901 | 3300009177 | Bacteria | 14792 |
| 244 | Ga0105248_10013983 | 3300009177 | Bacteria | 8831 |
| 245 | Ga0105248_10022491 | 3300009177 | Bacteria | 6992 |
| 246 | Ga0105248_10076069 | 3300009177 | Bacteria | 3773 |
| 247 | Ga0105237_10002971 | 3300009545 | Bacteria | 20505 |
| 248 | Ga0105237_10073805 | 3300009545 | Bacteria | 3403 |
| 249 | Ga0105237_10372648 | 3300009545 | Bacteria | 1432 |
| 250 | Ga0105237_10531939 | 3300009545 | Bacteria | 1182 |
| 251 | Ga0105237_10702349 | 3300009545 | Bacteria | 1018 |
| 252 | Ga0105238_10712230 | 3300009551 | Bacteria | 1016 |
| 253 | Ga0105249_10000207 | 3300009553 | Bacteria | 67193 |
| 254 | Ga0105249_10000574 | 3300009553 | Bacteria | 33721 |
| 255 | Ga0105249_10032567 | 3300009553 | Bacteria | 4717 |
| 256 | Ga0105249_10035802 | 3300009553 | Bacteria | 4501 |
| 257 | Ga0105239_10000060 | 3300010375 | Bacteria | 155195 |
| 258 | Ga0105239_10170631 | 3300010375 | Bacteria | 2433 |
| 259 | Ga0105239_10853210 | 3300010375 | Bacteria | 1044 |
| 260 | Ga0105246_10006206 | 3300011119 | Bacteria | 7296 |
| 261 | Ga0157326_1004457 | 3300012513 | Bacteria | 1471 |
| 262 | Ga0157373_10007927 | 3300013100 | Bacteria | 7900 |
| 263 | Ga0157373_10550348 | 3300013100 | Bacteria | 837 |
| 264 | Ga0157371_10000256 | 3300013102 | Bacteria | 73768 |
| 265 | Ga0157371_10001424 | 3300013102 | Bacteria | 24845 |
| 266 | Ga0157371_10002212 | 3300013102 | Bacteria | 18831 |
| 267 | Ga0157371_10059147 | 3300013102 | Bacteria | 2717 |
| 268 | Ga0157371_10160945 | 3300013102 | Bacteria | 1603 |
| 269 | Ga0157371_10228486 | 3300013102 | Bacteria | 1337 |
| 270 | Ga0157371_10335632 | 3300013102 | Bacteria | 1099 |
| 271 | Ga0157370_10001069 | 3300013104 | Bacteria | 34283 |
| 272 | Ga0157370_10012091 | 3300013104 | Bacteria | 8981 |
| 273 | Ga0157370_10266839 | 3300013104 | Bacteria | 1582 |
| 274 | Ga0157370_10455638 | 3300013104 | Bacteria | 1176 |
| 275 | Ga0157369_10005291 | 3300013105 | Bacteria | 15039 |
| 276 | Ga0157369_10242641 | 3300013105 | Bacteria | 1882 |
| 277 | Ga0157369_10428312 | 3300013105 | Bacteria | 1371 |
| 278 | Ga0157374_10015731 | 3300013296 | Bacteria | 6644 |
| 279 | Ga0157374_10016936 | 3300013296 | Bacteria | 6415 |
| 280 | Ga0157374_10151118 | 3300013296 | Bacteria | 2258 |
| 281 | Ga0157378_10004659 | 3300013297 | Bacteria | 12028 |
| 282 | Ga0157378_10046547 | 3300013297 | Bacteria | 3856 |
| 283 | Ga0163162_10021575 | 3300013306 | Bacteria | 6344 |
| 284 | Ga0163162_10024944 | 3300013306 | Bacteria | 5906 |
| 285 | Ga0163162_10118060 | 3300013306 | Bacteria | 2754 |
| 286 | Ga0163162_10163793 | 3300013306 | Bacteria | 2347 |
| 287 | Ga0157372_10004975 | 3300013307 | Bacteria | 14115 |
| 288 | Ga0157372_10014109 | 3300013307 | Bacteria | 8533 |
| 289 | Ga0157372_10026789 | 3300013307 | Bacteria | 6275 |
| 290 | Ga0157372_10075308 | 3300013307 | Bacteria | 3808 |
| 291 | Ga0157372_10112502 | 3300013307 | Bacteria | 3119 |
| 292 | Ga0157372_10167980 | 3300013307 | Bacteria | 2537 |
| 293 | Ga0157372_10514262 | 3300013307 | Bacteria | 1396 |
| 294 | Ga0157372_10778103 | 3300013307 | Bacteria | 1112 |
| 295 | Ga0157372_11100078 | 3300013307 | Bacteria | 919 |
| 296 | Ga0157372_11272541 | 3300013307 | Bacteria | 849 |
| 297 | Ga0157375_10000706 | 3300013308 | Bacteria | 29469 |
| 298 | Ga0157375_10419646 | 3300013308 | Bacteria | 1504 |
| 299 | Ga0163163_10084394 | 3300014325 | Bacteria | 3182 |
| 300 | Ga0157380_10362738 | 3300014326 | Bacteria | 1360 |
| 301 | Ga0182008_10002286 | 3300014497 | Bacteria | 12080 |
| 302 | Ga0182008_10010202 | 3300014497 | Bacteria | 5034 |
| 303 | Ga0157379_10065246 | 3300014968 | Bacteria | 3255 |
| 304 | Ga0157379_10125715 | 3300014968 | Bacteria | 2307 |
| 305 | Ga0157376_10000046 | 3300014969 | Bacteria | 109341 |
| 306 | Ga0182007_10000131 | 3300015262 | Bacteria | 52730 |
| 307 | Ga0182005_1000437 | 3300015265 | Bacteria | 22152 |
| 308 | Ga0182005_1001317 | 3300015265 | Bacteria | 10164 |
| 309 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 310 | Ga0183361_13433 | 3300016635 | Bacteria | 863 |
| 311 | Ga0163161_10001840 | 3300017792 | Bacteria | 15493 |
| 312 | Ga0163161_10001980 | 3300017792 | Bacteria | 14861 |
| 313 | Ga0209563_100066 | 3300025230 | Bacteria | 257382 |
| 314 | Ga0207427_103136 | 3300025231 | Bacteria | 3709 |
| 315 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 316 | Ga0207425_1000064 | 3300025245 | Bacteria | 129075 |
| 317 | Ga0209026_1001795 | 3300025250 | Bacteria | 8872 |
| 318 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 319 | Ga0209148_1000074 | 3300025254 | Bacteria | 314356 |
| 320 | Ga0209148_1001136 | 3300025254 | Bacteria | 15574 |
| 321 | Ga0209129_1000101 | 3300025258 | Bacteria | 161931 |
| 322 | Ga0209129_1001272 | 3300025258 | Bacteria | 14424 |
| 323 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 324 | Ga0209233_1000026 | 3300025261 | Bacteria | 678466 |
| 325 | Ga0209233_1017631 | 3300025261 | Bacteria | 1941 |
| 326 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 327 | Ga0209565_1000060 | 3300025263 | Bacteria | 188543 |
| 328 | Ga0209565_1000755 | 3300025263 | Bacteria | 19012 |
| 329 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 330 | Ga0209455_1000985 | 3300025272 | Bacteria | 14404 |
| 331 | Ga0209455_1024569 | 3300025272 | Bacteria | 1110 |
| 332 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 333 | Ga0209673_1012801 | 3300025273 | Bacteria | 3354 |
| 334 | Ga0209673_1013903 | 3300025273 | Bacteria | 3150 |
| 335 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 336 | Ga0209675_1000564 | 3300025291 | Bacteria | 26703 |
| 337 | Ga0209675_1015297 | 3300025291 | Bacteria | 2288 |
| 338 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 339 | Ga0209676_1000132 | 3300025292 | Bacteria | 185063 |
| 340 | Ga0209676_1000146 | 3300025292 | Bacteria | 174095 |
| 341 | Ga0209676_1000411 | 3300025292 | Bacteria | 77084 |
| 342 | Ga0209676_1000620 | 3300025292 | Bacteria | 51683 |
| 343 | Ga0209025_1000048 | 3300025294 | Bacteria | 335574 |
| 344 | Ga0209025_1000654 | 3300025294 | Bacteria | 60452 |
| 345 | Ga0209025_1018129 | 3300025294 | Bacteria | 4016 |
| 346 | Ga0209564_1000252 | 3300025295 | Bacteria | 114416 |
| 347 | Ga0209564_1000565 | 3300025295 | Bacteria | 58712 |
| 348 | Ga0209564_1046617 | 3300025295 | Bacteria | 1102 |
| 349 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 350 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 351 | Ga0209758_1000056 | 3300025297 | Bacteria | 335574 |
| 352 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 353 | Ga0209050_1000014 | 3300025298 | Bacteria | 774327 |
| 354 | Ga0209050_1000139 | 3300025298 | Bacteria | 173691 |
| 355 | Ga0209050_1000740 | 3300025298 | Bacteria | 47372 |
| 356 | Ga0209050_1000870 | 3300025298 | Bacteria | 40796 |
| 357 | Ga0209050_1010220 | 3300025298 | Bacteria | 4656 |
| 358 | Ga0209050_1017968 | 3300025298 | Bacteria | 2781 |
| 359 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 360 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 361 | Ga0209256_1003547 | 3300025299 | Bacteria | 10814 |
| 362 | Ga0209256_1008988 | 3300025299 | Bacteria | 4482 |
| 363 | Ga0209051_1000475 | 3300025303 | Bacteria | 52139 |
| 364 | Ga0209051_1001835 | 3300025303 | Bacteria | 16786 |
| 365 | Ga0209257_1000019 | 3300025304 | Bacteria | 774261 |
| 366 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 367 | Ga0209257_1000046 | 3300025304 | Bacteria | 477765 |
| 368 | Ga0209257_1000164 | 3300025304 | Bacteria | 173339 |
| 369 | Ga0209257_1000277 | 3300025304 | Bacteria | 114825 |
| 370 | Ga0209257_1001111 | 3300025304 | Bacteria | 34963 |
| 371 | Ga0209257_1001426 | 3300025304 | Bacteria | 28374 |
| 372 | Ga0209257_1001546 | 3300025304 | Bacteria | 26728 |
| 373 | Ga0209257_1002572 | 3300025304 | Bacteria | 17649 |
| 374 | Ga0209257_1008341 | 3300025304 | Bacteria | 5923 |
| 375 | Ga0209257_1008364 | 3300025304 | Bacteria | 5906 |
| 376 | Ga0209257_1022795 | 3300025304 | Bacteria | 2222 |
| 377 | Ga0209257_1026604 | 3300025304 | Bacteria | 1945 |
| 378 | Ga0207697_10136156 | 3300025315 | Bacteria | 1063 |
| 379 | Ga0207656_10012961 | 3300025321 | Bacteria | 3175 |
| 380 | Ga0207696_1001953 | 3300025711 | Bacteria | 10478 |
| 381 | Ga0207713_1001324 | 3300025735 | Bacteria | 20306 |
| 382 | Ga0207713_1004906 | 3300025735 | Bacteria | 8551 |
| 383 | Ga0207713_1007429 | 3300025735 | Bacteria | 6468 |
| 384 | Ga0207713_1018913 | 3300025735 | Bacteria | 3392 |
| 385 | Ga0207710_10004777 | 3300025900 | Bacteria | 5878 |
| 386 | Ga0207680_10115626 | 3300025903 | Bacteria | 1747 |
| 387 | Ga0207647_10000421 | 3300025904 | Bacteria | 34968 |
| 388 | Ga0207647_10004216 | 3300025904 | Bacteria | 10663 |
| 389 | Ga0207647_10124711 | 3300025904 | Bacteria | 1516 |
| 390 | Ga0207647_10181754 | 3300025904 | Bacteria | 1221 |
| 391 | Ga0207645_10000811 | 3300025907 | Bacteria | 26153 |
| 392 | Ga0207643_10208146 | 3300025908 | Bacteria | 1193 |
| 393 | Ga0207705_10000044 | 3300025909 | Bacteria | 180886 |
| 394 | Ga0207705_10000513 | 3300025909 | Bacteria | 33021 |
| 395 | Ga0207705_10010060 | 3300025909 | Bacteria | 6884 |
| 396 | Ga0207705_10253214 | 3300025909 | Bacteria | 1343 |
| 397 | Ga0207654_10004906 | 3300025911 | Bacteria | 6773 |
| 398 | Ga0207654_10070889 | 3300025911 | Bacteria | 2070 |
| 399 | Ga0207695_10009843 | 3300025913 | Bacteria | 11749 |
| 400 | Ga0207695_10032721 | 3300025913 | Bacteria | 5686 |
| 401 | Ga0207695_10047824 | 3300025913 | Bacteria | 4523 |
| 402 | Ga0207671_10001071 | 3300025914 | Bacteria | 33222 |
| 403 | Ga0207671_10012983 | 3300025914 | Bacteria | 6663 |
| 404 | Ga0207660_10176382 | 3300025917 | Bacteria | 1657 |
| 405 | Ga0207657_10000123 | 3300025919 | Bacteria | 77348 |
| 406 | Ga0207657_10034797 | 3300025919 | Bacteria | 4524 |
| 407 | Ga0207657_10121364 | 3300025919 | Bacteria | 2150 |
| 408 | Ga0207649_10000347 | 3300025920 | Bacteria | 35041 |
| 409 | Ga0207649_10017466 | 3300025920 | Bacteria | 4065 |
| 410 | Ga0207652_10025012 | 3300025921 | Bacteria | 4959 |
| 411 | Ga0207681_10002329 | 3300025923 | Bacteria | 12089 |
| 412 | Ga0207681_10003582 | 3300025923 | Bacteria | 9670 |
| 413 | Ga0207681_10059028 | 3300025923 | Bacteria | 2629 |
| 414 | Ga0207681_10070070 | 3300025923 | Bacteria | 2441 |
| 415 | Ga0207681_10071300 | 3300025923 | Bacteria | 2423 |
| 416 | Ga0207681_10191510 | 3300025923 | Bacteria | 1565 |
| 417 | Ga0207694_10079412 | 3300025924 | Bacteria | 2573 |
| 418 | Ga0207694_10466217 | 3300025924 | Bacteria | 1056 |
| 419 | Ga0207694_10675380 | 3300025924 | Bacteria | 871 |
| 420 | Ga0207650_10000057 | 3300025925 | Bacteria | 156913 |
| 421 | Ga0207650_10001882 | 3300025925 | Bacteria | 14815 |
| 422 | Ga0207650_10052193 | 3300025925 | Bacteria | 3028 |
| 423 | Ga0207659_10380891 | 3300025926 | Bacteria | 1176 |
| 424 | Ga0207687_10002295 | 3300025927 | Bacteria | 13027 |
| 425 | Ga0207687_10041644 | 3300025927 | Bacteria | 3155 |
| 426 | Ga0207644_10004486 | 3300025931 | Bacteria | 9064 |
| 427 | Ga0207644_10006854 | 3300025931 | Bacteria | 7422 |
| 428 | Ga0207644_10225963 | 3300025931 | Bacteria | 1486 |
| 429 | Ga0207690_10003709 | 3300025932 | Bacteria | 9080 |
| 430 | Ga0207690_10015155 | 3300025932 | Bacteria | 4668 |
| 431 | Ga0207690_10041814 | 3300025932 | Bacteria | 3006 |
| 432 | Ga0207690_10044717 | 3300025932 | Bacteria | 2921 |
| 433 | Ga0207690_10073557 | 3300025932 | Bacteria | 2364 |
| 434 | Ga0207690_10193916 | 3300025932 | Bacteria | 1538 |
| 435 | Ga0207706_10000193 | 3300025933 | Bacteria | 68202 |
| 436 | Ga0207706_10005814 | 3300025933 | Bacteria | 11472 |
| 437 | Ga0207706_10028490 | 3300025933 | Bacteria | 4988 |
| 438 | Ga0207706_10035771 | 3300025933 | Bacteria | 4413 |
| 439 | Ga0207706_10089690 | 3300025933 | Bacteria | 2703 |
| 440 | Ga0207706_10219164 | 3300025933 | Bacteria | 1666 |
| 441 | Ga0207706_10398092 | 3300025933 | Bacteria | 1194 |
| 442 | Ga0207686_10002994 | 3300025934 | Bacteria | 9113 |
| 443 | Ga0207709_10000078 | 3300025935 | Bacteria | 169141 |
| 444 | Ga0207709_10000277 | 3300025935 | Bacteria | 59636 |
| 445 | Ga0207709_10000732 | 3300025935 | Bacteria | 26258 |
| 446 | Ga0207709_10007614 | 3300025935 | Bacteria | 6009 |
| 447 | Ga0207669_10000020 | 3300025937 | Bacteria | 105051 |
| 448 | Ga0207669_10003084 | 3300025937 | Bacteria | 7176 |
| 449 | Ga0207704_10000168 | 3300025938 | Bacteria | 34759 |
| 450 | Ga0207691_10006781 | 3300025940 | Bacteria | 11041 |
| 451 | Ga0207691_10141440 | 3300025940 | Bacteria | 2120 |
| 452 | Ga0207711_10000031 | 3300025941 | Bacteria | 203323 |
| 453 | Ga0207711_10020363 | 3300025941 | Bacteria | 5530 |
| 454 | Ga0207711_10020863 | 3300025941 | Bacteria | 5468 |
| 455 | Ga0207711_10116551 | 3300025941 | Bacteria | 2382 |
| 456 | Ga0207689_10005309 | 3300025942 | Bacteria | 11544 |
| 457 | Ga0207689_10043302 | 3300025942 | Bacteria | 3722 |
| 458 | Ga0207679_10032153 | 3300025945 | Bacteria | 3680 |
| 459 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 460 | Ga0207667_10000137 | 3300025949 | Bacteria | 110326 |
| 461 | Ga0207667_10002490 | 3300025949 | Bacteria | 22955 |
| 462 | Ga0207667_10014229 | 3300025949 | Bacteria | 9076 |
| 463 | Ga0207667_10339843 | 3300025949 | Bacteria | 1532 |
| 464 | Ga0207667_10635853 | 3300025949 | Bacteria | 1074 |
| 465 | Ga0207651_10000011 | 3300025960 | Bacteria | 191950 |
| 466 | Ga0207651_10317150 | 3300025960 | Bacteria | 1302 |
| 467 | Ga0207712_10000234 | 3300025961 | Bacteria | 54386 |
| 468 | Ga0207712_10000476 | 3300025961 | Bacteria | 33733 |
| 469 | Ga0207712_10003720 | 3300025961 | Bacteria | 9628 |
| 470 | Ga0207668_10000746 | 3300025972 | Bacteria | 19869 |
| 471 | Ga0207668_10003547 | 3300025972 | Bacteria | 9173 |
| 472 | Ga0207668_10017031 | 3300025972 | Bacteria | 4547 |
| 473 | Ga0207668_10247549 | 3300025972 | Bacteria | 1446 |
| 474 | Ga0207668_10288916 | 3300025972 | Bacteria | 1348 |
| 475 | Ga0207640_10000236 | 3300025981 | Bacteria | 37779 |
| 476 | Ga0207640_10013334 | 3300025981 | Bacteria | 4706 |
| 477 | Ga0207640_10018292 | 3300025981 | Bacteria | 4115 |
| 478 | Ga0207640_10029440 | 3300025981 | Bacteria | 3371 |
| 479 | Ga0207640_10032710 | 3300025981 | Bacteria | 3227 |
| 480 | Ga0207640_10037685 | 3300025981 | Bacteria | 3044 |
| 481 | Ga0207640_10741936 | 3300025981 | Bacteria | 846 |
| 482 | Ga0207658_10001382 | 3300025986 | Bacteria | 18946 |
| 483 | Ga0207658_10005000 | 3300025986 | Bacteria | 9134 |
| 484 | Ga0207658_10006307 | 3300025986 | Bacteria | 8100 |
| 485 | Ga0207658_10129351 | 3300025986 | Bacteria | 2026 |
| 486 | Ga0207658_10151910 | 3300025986 | Bacteria | 1888 |
| 487 | Ga0207658_10330590 | 3300025986 | Bacteria | 1322 |
| 488 | Ga0207677_10001007 | 3300026023 | Bacteria | 15561 |
| 489 | Ga0207703_10002992 | 3300026035 | Bacteria | 14332 |
| 490 | Ga0207703_10009901 | 3300026035 | Bacteria | 7478 |
| 491 | Ga0207703_10168040 | 3300026035 | Bacteria | 1927 |
| 492 | Ga0207703_10243230 | 3300026035 | Bacteria | 1619 |
| 493 | Ga0207703_10436676 | 3300026035 | Bacteria | 1221 |
| 494 | Ga0207639_10002135 | 3300026041 | Bacteria | 13313 |
| 495 | Ga0207639_10005268 | 3300026041 | Bacteria | 8727 |
| 496 | Ga0207639_10005755 | 3300026041 | Bacteria | 8392 |
| 497 | Ga0207639_10061557 | 3300026041 | Bacteria | 2899 |
| 498 | Ga0207639_10304378 | 3300026041 | Bacteria | 1410 |
| 499 | Ga0207639_10321808 | 3300026041 | Bacteria | 1373 |
| 500 | Ga0207639_10340890 | 3300026041 | Bacteria | 1336 |
| 501 | Ga0207639_10447372 | 3300026041 | Bacteria | 1172 |
| 502 | Ga0207678_10000946 | 3300026067 | Bacteria | 26486 |
| 503 | Ga0207678_10006261 | 3300026067 | Bacteria | 10569 |
| 504 | Ga0207678_10007535 | 3300026067 | Bacteria | 9620 |
| 505 | Ga0207678_10461650 | 3300026067 | Bacteria | 1105 |
| 506 | Ga0207708_10249196 | 3300026075 | Bacteria | 1431 |
| 507 | Ga0207702_10007234 | 3300026078 | Bacteria | 9495 |
| 508 | Ga0207702_10012593 | 3300026078 | Bacteria | 7039 |
| 509 | Ga0207702_10013929 | 3300026078 | Bacteria | 6680 |
| 510 | Ga0207702_10077753 | 3300026078 | Bacteria | 2871 |
| 511 | Ga0207702_10443618 | 3300026078 | Bacteria | 1258 |
| 512 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 513 | Ga0207641_10004191 | 3300026088 | Bacteria | 12564 |
| 514 | Ga0207641_10320210 | 3300026088 | Bacteria | 1470 |
| 515 | Ga0207648_10000047 | 3300026089 | Bacteria | 110365 |
| 516 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 517 | Ga0207674_10008601 | 3300026116 | Bacteria | 11767 |
| 518 | Ga0207674_10010604 | 3300026116 | Bacteria | 10425 |
| 519 | Ga0207675_100000021 | 3300026118 | Bacteria | 116776 |
| 520 | Ga0207683_10001150 | 3300026121 | Bacteria | 24080 |
| 521 | Ga0207683_10037334 | 3300026121 | Bacteria | 4230 |
| 522 | Ga0207683_10201812 | 3300026121 | Bacteria | 1808 |
| 523 | Ga0207698_10001045 | 3300026142 | Bacteria | 16122 |
| 524 | Ga0207698_10018394 | 3300026142 | Bacteria | 4760 |
| 525 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 526 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 527 | Ga0209813_10000082 | 3300027866 | Bacteria | 34870 |
| 528 | Ga0209974_10036797 | 3300027876 | Bacteria | 1625 |
| 529 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 530 | Ga0268266_10001471 | 3300028379 | Bacteria | 27988 |
| 531 | Ga0268266_10002431 | 3300028379 | Bacteria | 20016 |
| 532 | Ga0268266_10033151 | 3300028379 | Bacteria | 4392 |
| 533 | Ga0268266_10142959 | 3300028379 | Bacteria | 2148 |
| 534 | Ga0268266_10162973 | 3300028379 | Bacteria | 2018 |
| 535 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 536 | Ga0268265_10000424 | 3300028380 | Bacteria | 45348 |
| 537 | Ga0268265_10007903 | 3300028380 | Bacteria | 7177 |
| 538 | Ga0268265_10036208 | 3300028380 | Bacteria | 3613 |
| 539 | Ga0268264_10001182 | 3300028381 | Bacteria | 25302 |
| 540 | Ga0268264_10031281 | 3300028381 | Bacteria | 4364 |
| 541 | Ga0268264_10045475 | 3300028381 | Bacteria | 3644 |
| 542 | Ga0268264_10062626 | 3300028381 | Bacteria | 3124 |
| 543 | Ga0307517_10018404 | 3300028786 | Bacteria | 9039 |
| 544 | Ga0307517_10251191 | 3300028786 | Bacteria | 1037 |
| 545 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 546 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 547 | Ga0314311_1075969 | 3300030733 | Bacteria | 1772 |
| 548 | Ga0314311_1115565 | 3300030733 | Bacteria | 1167 |
| 549 | Ga0316183_1110894 | 3300030742 | Bacteria | 1126 |
| 550 | Ga0316183_1164325 | 3300030742 | Bacteria | 999 |
| 551 | Ga0307513_10039689 | 3300031456 | Bacteria | 5216 |
| 552 | Ga0307513_10097114 | 3300031456 | Bacteria | 2982 |
| 553 | Ga0307513_10206471 | 3300031456 | Bacteria | 1799 |
| 554 | Ga0307408_100186371 | 3300031548 | Bacteria | 1668 |
| 555 | Ga0307408_100298772 | 3300031548 | Bacteria | 1348 |
| 556 | Ga0307508_10009433 | 3300031616 | Bacteria | 8978 |
| 557 | Ga0307405_10000445 | 3300031731 | Bacteria | 15493 |
| 558 | Ga0316577_10140284 | 3300031733 | Bacteria | 1362 |
| 559 | Ga0307413_10071278 | 3300031824 | Bacteria | 2189 |
| 560 | Ga0307413_10197001 | 3300031824 | Bacteria | 1451 |
| 561 | Ga0307413_10462187 | 3300031824 | Bacteria | 1010 |
| 562 | Ga0307410_10060998 | 3300031852 | Bacteria | 2580 |
| 563 | Ga0307410_10156661 | 3300031852 | Bacteria | 1702 |
| 564 | Ga0307406_10079342 | 3300031901 | Bacteria | 2177 |
| 565 | Ga0307412_10003432 | 3300031911 | Bacteria | 8806 |
| 566 | Ga0307412_10005593 | 3300031911 | Bacteria | 7055 |
| 567 | Ga0307412_10016843 | 3300031911 | Bacteria | 4365 |
| 568 | Ga0307412_10048784 | 3300031911 | Bacteria | 2786 |
| 569 | Ga0307412_10052199 | 3300031911 | Bacteria | 2706 |
| 570 | Ga0307412_10070245 | 3300031911 | Bacteria | 2386 |
| 571 | Ga0307412_10239243 | 3300031911 | Bacteria | 1403 |
| 572 | Ga0307412_10247267 | 3300031911 | Bacteria | 1383 |
| 573 | Ga0307412_10399278 | 3300031911 | Bacteria | 1119 |
| 574 | Ga0307412_10413221 | 3300031911 | Bacteria | 1102 |
| 575 | Ga0307409_100207365 | 3300031995 | Bacteria | 1759 |
| 576 | Ga0307409_100857467 | 3300031995 | Bacteria | 919 |
| 577 | Ga0307414_10000251 | 3300032004 | Bacteria | 33637 |
| 578 | Ga0307414_10001515 | 3300032004 | Bacteria | 12072 |
| 579 | Ga0307414_10004650 | 3300032004 | Bacteria | 7475 |
| 580 | Ga0307414_10007830 | 3300032004 | Bacteria | 6028 |
| 581 | Ga0307414_10015078 | 3300032004 | Bacteria | 4656 |
| 582 | Ga0307414_10020297 | 3300032004 | Bacteria | 4139 |
| 583 | Ga0307414_10031336 | 3300032004 | Bacteria | 3487 |
| 584 | Ga0307414_10044838 | 3300032004 | Bacteria | 3024 |
| 585 | Ga0307414_10087909 | 3300032004 | Bacteria | 2298 |
| 586 | Ga0307414_10157139 | 3300032004 | Bacteria | 1802 |
| 587 | Ga0307414_10176111 | 3300032004 | Bacteria | 1715 |
| 588 | Ga0307414_10347958 | 3300032004 | Bacteria | 1271 |
| 589 | Ga0307414_10394476 | 3300032004 | Bacteria | 1200 |
| 590 | Ga0307414_10503390 | 3300032004 | Bacteria | 1072 |
| 591 | Ga0307411_10078383 | 3300032005 | Bacteria | 2265 |
| 592 | Ga0307411_10316030 | 3300032005 | Bacteria | 1259 |
| 593 | Ga0307411_10464123 | 3300032005 | Bacteria | 1062 |
| 594 | Ga0307415_100030269 | 3300032126 | Bacteria | 3472 |
| 595 | Ga0307510_10001089 | 3300033180 | Bacteria | 28935 |
| 596 | Ga0373923_0123256 | 3300035111 | Bacteria | 1160 |
| 597 | Ga0373923_0248307 | 3300035111 | Bacteria | 832 |
| 598 | Ga0316574_0165096 | 3300035398 | Bacteria | 1426 |
| 599 | Ga0373931_0165440 | 3300035691 | Bacteria | 1299 |
| 600 | Ga0316582_0043273 | 3300036647 | Bacteria | 2824 |
| 601 | Ga0395899_0009504 | 3300037312 | Bacteria | 7461 |
| 602 | Ga0395899_0036920 | 3300037312 | Bacteria | 3664 |
| 603 | Ga0395900_0039298 | 3300037418 | Bacteria | 4875 |
| 604 | Ga0395900_0069449 | 3300037418 | Bacteria | 3621 |
| 605 | Ga0395900_0171035 | 3300037418 | Bacteria | 2212 |
| 606 | Ga0395905_0013942 | 3300037471 | Bacteria | 7687 |
| 607 | Ga0395905_0161200 | 3300037471 | Bacteria | 2108 |
| 608 | Ga0395905_0248194 | 3300037471 | Bacteria | 1663 |
| 609 | Ga0436364_0184827 | 3300037853 | Bacteria | 146498 |
| 610 | Ga0436364_0296893 | 3300037853 | Bacteria | 967 |
| 611 | Ga0237819_00128 | 3300038705 | Bacteria | 28583 |
| 612 | Ga0436365_0341898 | 3300039437 | Bacteria | 1545 |
| 613 | Ga0436365_1628748 | 3300039437 | Bacteria | 1523 |
| 614 | Ga0439436_0008965 | 3300041404 | Bacteria | 3070 |
| 615 | Ga0439439_0006402 | 3300041406 | Bacteria | 2723 |
| 616 | Ga0439461_0000103 | 3300041410 | Bacteria | 11142 |
| 617 | Ga0439461_0015624 | 3300041410 | Bacteria | 1456 |
| 618 | Ga0439465_0000289 | 3300041413 | Bacteria | 14190 |
| 619 | Ga0439465_0004367 | 3300041413 | Bacteria | 4577 |
| 620 | Ga0451797_0789101 | 3300041453 | Bacteria | 1764 |
| 621 | Ga0451806_635767 | 3300041462 | Bacteria | 2649 |
| 622 | Ga0451807_1567495 | 3300041486 | Bacteria | 1708 |
| 623 | Ga0451807_2581624 | 3300041486 | Bacteria | 1206 |
| 624 | Ga0451837_1421368 | 3300041494 | Bacteria | 3026 |
| 625 | Ga0451841_0235217 | 3300041498 | Bacteria | 3061 |
| 626 | Ga0451853_1744520 | 3300041512 | Bacteria | 2027 |
| 627 | Ga0439442_006641 | 3300042002 | Bacteria | 2323 |
| 628 | Ga0439442_034127 | 3300042002 | Bacteria | 1064 |
| 629 | Ga0439445_0000781 | 3300042004 | Bacteria | 6688 |
| 630 | Ga0439445_0059390 | 3300042004 | Bacteria | 1043 |
| 631 | Ga0439448_0000936 | 3300042005 | Bacteria | 7186 |
| 632 | Ga0439448_0040650 | 3300042005 | Bacteria | 1502 |
| 633 | Ga0439448_0043441 | 3300042005 | Bacteria | 1459 |
| 634 | Ga0439432_000148 | 3300042006 | Bacteria | 23778 |
| 635 | Ga0439449_0000404 | 3300042007 | Bacteria | 16023 |
| 636 | Ga0439449_0065930 | 3300042007 | Bacteria | 1335 |
| 637 | Ga0439455_0002098 | 3300042012 | Bacteria | 3551 |
| 638 | Ga0439455_0002979 | 3300042012 | Bacteria | 3175 |
| 639 | Ga0439455_0039678 | 3300042012 | Bacteria | 1201 |
| 640 | Ga0439458_0001035 | 3300042157 | Bacteria | 7103 |
| 641 | Ga0439458_0003163 | 3300042157 | Bacteria | 3902 |
| 642 | Ga0439434_0000989 | 3300042435 | Bacteria | 8197 |
| 643 | Ga0439434_0007665 | 3300042435 | Bacteria | 3163 |
| 644 | Ga0451577_0203403 | 3300042876 | Bacteria | 1788 |
| 645 | Ga0466965_0085185 | 3300044683 | Bacteria | 1602 |
| 646 | Ga0466966_0021309 | 3300044684 | Bacteria | 4256 |
| 647 | Ga0466966_0023777 | 3300044684 | Bacteria | 4010 |
| 648 | Ga0466963_0005372 | 3300044694 | Bacteria | 7499 |
| 649 | Ga0453684_0801468 | 3300044712 | Bacteria | 1016 |
| 650 | Ga0466971_0025908 | 3300044719 | Bacteria | 2619 |
| 651 | Ga0466968_0043036 | 3300044735 | Bacteria | 1910 |
| 652 | Ga0466968_0045930 | 3300044735 | Bacteria | 1855 |
| 653 | Ga0466970_0008610 | 3300044765 | Bacteria | 5138 |
| 654 | Ga0466957_0033293 | 3300044842 | Bacteria | 3091 |
| 655 | Ga0466957_0074212 | 3300044842 | Bacteria | 2109 |
| 656 | Ga0466959_0000648 | 3300045049 | Bacteria | 20299 |
| 657 | Ga0466959_0088190 | 3300045049 | Bacteria | 2230 |
| 658 | Ga0466958_0042755 | 3300045836 | Bacteria | 2729 |
| 659 | Ga0466967_0016678 | 3300045976 | Bacteria | 5801 |
| 660 | Ga0495617_006544 | 3300046452 | Bacteria | 4079 |
| 661 | Ga0495627_043220 | 3300046453 | Bacteria | 1378 |
| 662 | Ga0495629_0338339 | 3300046459 | Bacteria | 1028 |
| 663 | Ga0495638_0001684 | 3300046460 | Bacteria | 19543 |
| 664 | Ga0495638_0010375 | 3300046460 | Bacteria | 6475 |
| 665 | Ga0495638_0225768 | 3300046460 | Bacteria | 1044 |
| 666 | Ga0495650_0000172 | 3300046471 | Bacteria | 142776 |
| 667 | Ga0495584_0124803 | 3300046491 | Bacteria | 1304 |
| 668 | Ga0495607_0012787 | 3300046501 | Bacteria | 5522 |
| 669 | Ga0495607_0029971 | 3300046501 | Bacteria | 3345 |
| 670 | Ga0495583_0000027 | 3300046506 | Bacteria | 256299 |
| 671 | Ga0495583_0002525 | 3300046506 | Bacteria | 15492 |
| 672 | Ga0495583_0004847 | 3300046506 | Bacteria | 9408 |
| 673 | Ga0495583_0011033 | 3300046506 | Bacteria | 5210 |
| 674 | Ga0495606_0000365 | 3300046507 | Bacteria | 77476 |
| 675 | Ga0495606_0005421 | 3300046507 | Bacteria | 12223 |
| 676 | Ga0495606_0263910 | 3300046507 | Bacteria | 949 |
| 677 | Ga0495610_0009902 | 3300046512 | Bacteria | 5966 |
| 678 | Ga0495631_0005889 | 3300046518 | Bacteria | 6389 |
| 679 | Ga0495631_0048151 | 3300046518 | Bacteria | 1870 |
| 680 | Ga0495637_0083892 | 3300046520 | Bacteria | 1266 |
| 681 | Ga0495643_0000659 | 3300046522 | Bacteria | 40777 |
| 682 | Ga0495643_0009971 | 3300046522 | Bacteria | 5868 |
| 683 | Ga0495643_0017797 | 3300046522 | Bacteria | 4145 |
| 684 | Ga0495643_0120839 | 3300046522 | Bacteria | 1323 |
| 685 | Ga0495648_0000249 | 3300046524 | Bacteria | 60793 |
| 686 | Ga0495663_0001306 | 3300046525 | Bacteria | 7894 |
| 687 | Ga0495663_0001822 | 3300046525 | Bacteria | 6582 |
| 688 | Ga0495663_0010012 | 3300046525 | Bacteria | 2631 |
| 689 | Ga0495642_0007737 | 3300046528 | Bacteria | 4118 |
| 690 | Ga0495654_0004263 | 3300046530 | Bacteria | 8544 |
| 691 | Ga0495621_0002343 | 3300046539 | Bacteria | 5090 |
| 692 | Ga0495621_0117253 | 3300046539 | Bacteria | 1026 |
| 693 | Ga0495622_0019534 | 3300046557 | Bacteria | 3154 |
| 694 | Ga0495633_0000622 | 3300046558 | Bacteria | 33329 |
| 695 | Ga0495633_0051499 | 3300046558 | Bacteria | 1939 |
| 696 | Ga0495668_0000015 | 3300046616 | Bacteria | 441932 |
| 697 | Ga0495668_0000080 | 3300046616 | Bacteria | 157259 |
| 698 | Ga0495668_0007017 | 3300046616 | Bacteria | 7272 |
| 699 | Ga0495668_0058918 | 3300046616 | Bacteria | 2119 |
| 700 | Ga0495668_0147240 | 3300046616 | Bacteria | 1289 |
| 701 | Ga0495611_0053373 | 3300046648 | Bacteria | 1824 |
| 702 | Ga0495625_0000541 | 3300046660 | Bacteria | 55446 |
| 703 | Ga0495625_0000876 | 3300046660 | Bacteria | 40885 |
| 704 | Ga0495625_0006423 | 3300046660 | Bacteria | 10467 |
| 705 | Ga0495625_0009642 | 3300046660 | Bacteria | 8051 |
| 706 | Ga0495625_0080157 | 3300046660 | Bacteria | 2274 |
| 707 | Ga0495625_0135702 | 3300046660 | Bacteria | 1663 |
| 708 | Ga0495625_0166692 | 3300046660 | Bacteria | 1472 |
| 709 | Ga0495625_0168732 | 3300046660 | Bacteria | 1462 |
| 710 | Ga0495661_0030557 | 3300046665 | Bacteria | 3429 |
| 711 | Ga0495669_0000011 | 3300046684 | Bacteria | 158720 |
| 712 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 713 | Ga0495670_0038462 | 3300046691 | Bacteria | 2385 |
| 714 | Ga0495670_0039186 | 3300046691 | Bacteria | 2363 |
| 715 | Ga0495670_0173194 | 3300046691 | Bacteria | 1137 |
| 716 | Ga0495671_0034844 | 3300046692 | Bacteria | 2558 |
| 717 | Ga0495649_0104002 | 3300046694 | Bacteria | 1508 |
| 718 | Ga0495600_0204353 | 3300046809 | Bacteria | 1267 |
| 719 | Ga0495672_0000411 | 3300047320 | Bacteria | 51888 |
| 720 | Ga0495683_0019425 | 3300047323 | Bacteria | 3507 |
| 721 | Ga0495687_000082 | 3300047443 | Bacteria | 147137 |
| 722 | Ga0495687_002094 | 3300047443 | Bacteria | 16772 |
| 723 | Ga0495677_0006435 | 3300047445 | Bacteria | 4439 |
| 724 | Ga0495681_0027622 | 3300047470 | Bacteria | 2932 |
| 725 | Ga0495681_0084020 | 3300047470 | Bacteria | 1416 |
| 726 | Ga0495686_0000201 | 3300047472 | Bacteria | 110982 |
| 727 | Ga0495686_0000430 | 3300047472 | Bacteria | 65300 |
| 728 | Ga0495686_0001136 | 3300047472 | Bacteria | 31452 |
| 729 | Ga0495686_0012074 | 3300047472 | Bacteria | 6066 |
| 730 | Ga0495686_0013397 | 3300047472 | Bacteria | 5689 |
| 731 | Ga0495686_0053124 | 3300047472 | Bacteria | 2540 |
| 732 | Ga0495686_0099219 | 3300047472 | Bacteria | 1758 |
| 733 | Ga0495615_0003040 | 3300048090 | Bacteria | 2771 |
| 734 | Ga0496101_0108103 | 3300048904 | Bacteria | 2090 |
| 735 | Ga0496101_0422018 | 3300048904 | Bacteria | 1051 |
| 736 | Ga0496102_0000471 | 3300048905 | Bacteria | 44758 |
| 737 | Ga0496102_0002022 | 3300048905 | Bacteria | 17516 |
| 738 | Ga0496103_0000166 | 3300048906 | Bacteria | 69117 |
| 739 | Ga0496103_0000581 | 3300048906 | Bacteria | 28917 |
| 740 | Ga0496103_0021341 | 3300048906 | Bacteria | 3895 |
| 741 | Ga0496104_0001657 | 3300048907 | Bacteria | 19233 |
| 742 | Ga0496104_0010654 | 3300048907 | Bacteria | 8217 |
| 743 | Ga0496105_0003221 | 3300048908 | Bacteria | 12024 |
| 744 | Ga0496105_0055737 | 3300048908 | Bacteria | 3263 |
| 745 | Ga0496109_0096519 | 3300048912 | Bacteria | 2739 |
| 746 | Ga0496110_0101023 | 3300048913 | Bacteria | 2585 |
| 747 | Ga0496110_0567834 | 3300048913 | Bacteria | 1030 |
| 748 | Ga0496111_0037863 | 3300048914 | Bacteria | 3453 |
| 749 | Ga0496114_0076871 | 3300048917 | Bacteria | 2814 |
| 750 | Ga0496115_0000030 | 3300048918 | Bacteria | 138328 |
| 751 | Ga0496115_0000390 | 3300048918 | Bacteria | 36134 |
| 752 | Ga0496115_0192261 | 3300048918 | Bacteria | 1686 |
| 753 | Ga0496116_0006531 | 3300048919 | Bacteria | 10566 |
| 754 | Ga0496116_0136807 | 3300048919 | Bacteria | 1385 |
| 755 | Ga0496116_0206341 | 3300048919 | Bacteria | 1023 |
| 756 | Ga0496117_0000142 | 3300048920 | Bacteria | 157953 |
| 757 | Ga0496117_0004574 | 3300048920 | Bacteria | 15136 |
| 758 | Ga0496117_0011257 | 3300048920 | Bacteria | 8029 |
| 759 | Ga0496117_0014014 | 3300048920 | Bacteria | 6938 |
| 760 | Ga0496117_0015294 | 3300048920 | Bacteria | 6550 |
| 761 | Ga0496117_0016703 | 3300048920 | Bacteria | 6173 |
| 762 | Ga0496117_0020049 | 3300048920 | Bacteria | 5468 |
| 763 | Ga0496117_0023122 | 3300048920 | Bacteria | 4965 |
| 764 | Ga0496117_0029258 | 3300048920 | Bacteria | 4250 |
| 765 | Ga0496117_0104338 | 3300048920 | Bacteria | 1784 |
| 766 | Ga0496117_0138815 | 3300048920 | Bacteria | 1459 |
| 767 | Ga0496117_0143375 | 3300048920 | Bacteria | 1426 |
| 768 | Ga0496117_0167954 | 3300048920 | Bacteria | 1277 |
| 769 | Ga0496118_0000115 | 3300048921 | Bacteria | 146533 |
| 770 | Ga0496118_0000332 | 3300048921 | Bacteria | 80480 |
| 771 | Ga0496118_0000787 | 3300048921 | Bacteria | 50784 |
| 772 | Ga0496118_0004303 | 3300048921 | Bacteria | 17009 |
| 773 | Ga0496118_0016020 | 3300048921 | Bacteria | 6902 |
| 774 | Ga0496118_0020501 | 3300048921 | Bacteria | 5857 |
| 775 | Ga0496118_0029158 | 3300048921 | Bacteria | 4633 |
| 776 | Ga0496118_0040683 | 3300048921 | Bacteria | 3693 |
| 777 | Ga0496118_0069964 | 3300048921 | Bacteria | 2537 |
| 778 | Ga0496118_0085096 | 3300048921 | Bacteria | 2203 |
| 779 | Ga0496119_0000518 | 3300048922 | Bacteria | 52520 |
| 780 | Ga0496119_0007761 | 3300048922 | Bacteria | 9570 |
| 781 | Ga0496119_0019968 | 3300048922 | Bacteria | 4907 |
| 782 | Ga0496119_0022570 | 3300048922 | Bacteria | 4497 |
| 783 | Ga0496119_0059672 | 3300048922 | Bacteria | 2290 |
| 784 | Ga0496119_0150252 | 3300048922 | Bacteria | 1249 |
| 785 | Ga0496120_0000630 | 3300048923 | Bacteria | 52559 |
| 786 | Ga0496120_0001627 | 3300048923 | Bacteria | 26035 |
| 787 | Ga0496120_0035145 | 3300048923 | Bacteria | 2996 |
| 788 | Ga0496120_0057448 | 3300048923 | Bacteria | 2189 |
| 789 | Ga0496121_0000173 | 3300048924 | Bacteria | 143397 |
| 790 | Ga0496121_0000193 | 3300048924 | Bacteria | 136526 |
| 791 | Ga0496121_0004372 | 3300048924 | Bacteria | 19102 |
| 792 | Ga0496121_0011321 | 3300048924 | Bacteria | 9926 |
| 793 | Ga0496121_0049171 | 3300048924 | Bacteria | 3579 |
| 794 | Ga0496121_0051813 | 3300048924 | Bacteria | 3453 |
| 795 | Ga0496121_0123174 | 3300048924 | Bacteria | 1954 |
| 796 | Ga0496121_0222123 | 3300048924 | Bacteria | 1330 |
| 797 | Ga0496122_0001011 | 3300048925 | Bacteria | 49773 |
| 798 | Ga0496122_0001736 | 3300048925 | Bacteria | 33820 |
| 799 | Ga0496122_0002817 | 3300048925 | Bacteria | 23835 |
| 800 | Ga0496122_0018085 | 3300048925 | Bacteria | 6532 |
| 801 | Ga0496122_0055645 | 3300048925 | Bacteria | 2957 |
| 802 | Ga0496122_0099454 | 3300048925 | Bacteria | 1950 |
| 803 | Ga0496122_0235337 | 3300048925 | Bacteria | 1037 |
| 804 | Ga0496123_0001458 | 3300048926 | Bacteria | 32935 |
| 805 | Ga0496123_0001830 | 3300048926 | Bacteria | 27941 |
| 806 | Ga0496123_0002477 | 3300048926 | Bacteria | 22792 |
| 807 | Ga0496123_0018268 | 3300048926 | Bacteria | 5584 |
| 808 | Ga0496123_0044829 | 3300048926 | Bacteria | 3020 |
| 809 | Ga0496123_0083914 | 3300048926 | Bacteria | 1924 |
| 810 | Ga0496123_0116623 | 3300048926 | Bacteria | 1512 |
| 811 | Ga0496123_0118683 | 3300048926 | Bacteria | 1493 |
| 812 | Ga0496123_0131852 | 3300048926 | Bacteria | 1382 |
| 813 | Ga0496123_0364964 | 3300048926 | Bacteria | 667 |
| 814 | Ga0496124_0000034 | 3300048927 | Bacteria | 325332 |
| 815 | Ga0496124_0000071 | 3300048927 | Bacteria | 220642 |
| 816 | Ga0496124_0000146 | 3300048927 | Bacteria | 146468 |
| 817 | Ga0496124_0001905 | 3300048927 | Bacteria | 28630 |
| 818 | Ga0496124_0007734 | 3300048927 | Bacteria | 11361 |
| 819 | Ga0496124_0011525 | 3300048927 | Bacteria | 8824 |
| 820 | Ga0496124_0018592 | 3300048927 | Bacteria | 6504 |
| 821 | Ga0496124_0022889 | 3300048927 | Bacteria | 5720 |
| 822 | Ga0496124_0025738 | 3300048927 | Bacteria | 5321 |
| 823 | Ga0496124_0026277 | 3300048927 | Bacteria | 5254 |
| 824 | Ga0496124_0055280 | 3300048927 | Bacteria | 3355 |
| 825 | Ga0496124_0086022 | 3300048927 | Bacteria | 2574 |
| 826 | Ga0496124_0093929 | 3300048927 | Bacteria | 2440 |
| 827 | Ga0496124_0215134 | 3300048927 | Bacteria | 1450 |
| 828 | Ga0496124_0499608 | 3300048927 | Bacteria | 816 |
| 829 | Ga0496125_0003343 | 3300048928 | Bacteria | 19548 |
| 830 | Ga0496125_0009005 | 3300048928 | Bacteria | 10344 |
| 831 | Ga0496125_0033384 | 3300048928 | Bacteria | 4554 |
| 832 | Ga0496125_0034978 | 3300048928 | Bacteria | 4418 |
| 833 | Ga0496125_0133819 | 3300048928 | Bacteria | 1738 |
| 834 | Ga0496126_0000174 | 3300048929 | Bacteria | 146468 |
| 835 | Ga0496126_0001265 | 3300048929 | Bacteria | 40729 |
| 836 | Ga0496126_0002590 | 3300048929 | Bacteria | 24120 |
| 837 | Ga0496126_0018137 | 3300048929 | Bacteria | 6985 |
| 838 | Ga0496126_0021858 | 3300048929 | Bacteria | 6241 |
| 839 | Ga0496126_0046811 | 3300048929 | Bacteria | 3963 |
| 840 | Ga0496126_0053433 | 3300048929 | Bacteria | 3665 |
| 841 | Ga0496126_0089011 | 3300048929 | Bacteria | 2718 |
| 842 | Ga0495682_0013631 | 3300049460 | Bacteria | 3092 |
| 843 | Ga0501290_000159 | 3300049513 | Bacteria | 10830 |
| 844 | Ga0501292_000020 | 3300049515 | Bacteria | 54099 |
| 845 | Ga0501294_000262 | 3300049517 | Bacteria | 6516 |
| 846 | Ga0501300_007560 | 3300049523 | Bacteria | 1593 |
| 847 | Ga0501032_0075651 | 3300049569 | Bacteria | 2242 |
| 848 | Ga0501033_0008801 | 3300049570 | Bacteria | 7804 |
| 849 | Ga0501033_0010630 | 3300049570 | Bacteria | 7057 |
| 850 | Ga0501033_0037242 | 3300049570 | Bacteria | 3642 |
| 851 | Ga0501034_0059309 | 3300049571 | Bacteria | 3844 |
| 852 | Ga0501034_0070176 | 3300049571 | Bacteria | 3515 |
| 853 | Ga0501034_0077060 | 3300049571 | Bacteria | 3340 |
| 854 | Ga0501034_0098819 | 3300049571 | Bacteria | 2914 |
| 855 | Ga0501034_0445013 | 3300049571 | Bacteria | 1214 |
| 856 | Ga0501037_0073245 | 3300049573 | Bacteria | 2490 |
| 857 | Ga0501039_0015976 | 3300049575 | Bacteria | 5748 |
| 858 | Ga0501042_0501642 | 3300049578 | Bacteria | 881 |
| 859 | Ga0501043_0206628 | 3300049579 | Bacteria | 1522 |
| 860 | Ga0501046_0049775 | 3300049580 | Bacteria | 3314 |
| 861 | Ga0501047_0029763 | 3300049581 | Bacteria | 5263 |
| 862 | Ga0501047_0141957 | 3300049581 | Bacteria | 2280 |
| 863 | Ga0501206_009913 | 3300049653 | Bacteria | 1270 |
| 864 | Ga0501223_001949 | 3300049663 | Bacteria | 4641 |
| 865 | Ga0501224_006481 | 3300049664 | Bacteria | 1697 |
| 866 | Ga0501235_043515 | 3300049669 | Bacteria | 1031 |
| 867 | Ga0501261_000202 | 3300049690 | Bacteria | 8467 |
| 868 | Ga0501279_000022 | 3300049775 | Bacteria | 54370 |
| 869 | Ga0501280_000035 | 3300049776 | Bacteria | 40433 |
| 870 | Ga0501281_00180 | 3300049777 | Bacteria | 7296 |
| 871 | Ga0501035_0012696 | 3300049822 | Bacteria | 7783 |
| 872 | Ga0501035_0105528 | 3300049822 | Bacteria | 2470 |
| 873 | Ga0501044_0000290 | 3300049823 | Bacteria | 63934 |
| 874 | Ga0501044_0031302 | 3300049823 | Bacteria | 5601 |
| 875 | Ga0501044_0077793 | 3300049823 | Bacteria | 3363 |
| 876 | Ga0501044_0339354 | 3300049823 | Bacteria | 1424 |
| 877 | nmdc:mga03683_1345_c1 | 3300050489 | Bacteria | 7284 |
| 878 | nmdc:mga03683_55_c1 | 3300050489 | Bacteria | 47333 |
| 879 | nmdc:mga03683_9004_c1 | 3300050489 | Bacteria | 1737 |
| 880 | nmdc:mga03n38_9585_c1 | 3300050490 | Bacteria | 3529 |
| 881 | nmdc:mga00v17_10632_c1 | 3300050491 | Bacteria | 5033 |
| 882 | nmdc:mga00v17_1480_c1 | 3300050491 | Bacteria | 12287 |
| 883 | nmdc:mga00v17_16647_c1 | 3300050491 | Bacteria | 4146 |
| 884 | nmdc:mga0k408_253060_c1 | 3300050493 | Bacteria | 1052 |
| 885 | nmdc:mga0k408_63030_c1 | 3300050493 | Bacteria | 2156 |
| 886 | nmdc:mga0k408_6795_c1 | 3300050493 | Bacteria | 6101 |
| 887 | nmdc:mga0k408_7_c1 | 3300050493 | Bacteria | 164270 |
| 888 | nmdc:mga06z11_50364_c1 | 3300050494 | Bacteria | 2128 |
| 889 | nmdc:mga06z11_770_c1 | 3300050494 | Bacteria | 11686 |
| 890 | nmdc:mga04h51_339_c1 | 3300050495 | Bacteria | 11749 |
| 891 | nmdc:mga07m45_1849_c1 | 3300050496 | Bacteria | 9777 |
| 892 | nmdc:mga07m45_205200_c1 | 3300050496 | Bacteria | 1146 |
| 893 | nmdc:mga07m45_237745_c1 | 3300050496 | Bacteria | 1060 |
| 894 | nmdc:mga07m45_33716_c1 | 3300050496 | Bacteria | 2844 |
| 895 | nmdc:mga07m45_35_c1 | 3300050496 | Bacteria | 74486 |
| 896 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 897 | nmdc:mga0sz30_303_c1 | 3300050516 | Bacteria | 18938 |
| 898 | nmdc:mga0sz30_41_c1 | 3300050516 | Bacteria | 46173 |
| 899 | nmdc:mga0sz30_48235_c1 | 3300050516 | Bacteria | 1801 |
| 900 | Ga0500610_0000413 | 3300053079 | Bacteria | 13122 |
| 901 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 902 | Ga0500643_001644 | 3300053087 | Bacteria | 12495 |
| 903 | Ga0500643_002547 | 3300053087 | Bacteria | 9301 |
| 904 | Ga0500643_014583 | 3300053087 | Bacteria | 2725 |
| 905 | Ga0500651_0189408 | 3300053093 | Bacteria | 1218 |
| 906 | Ga0500566_0001263 | 3300053094 | Bacteria | 14752 |
| 907 | Ga0500566_0094666 | 3300053094 | Bacteria | 1646 |
| 908 | Ga0500641_0145362 | 3300053096 | Bacteria | 1024 |
| 909 | Ga0500555_001180 | 3300053103 | Bacteria | 8567 |
| 910 | Ga0500592_000329 | 3300053116 | Bacteria | 8061 |
| 911 | Ga0500595_000183 | 3300053119 | Bacteria | 42685 |
| 912 | Ga0500595_001555 | 3300053119 | Bacteria | 12143 |
| 913 | Ga0500595_037817 | 3300053119 | Bacteria | 1572 |
| 914 | Ga0500597_010411 | 3300053120 | Bacteria | 3319 |
| 915 | Ga0500607_000763 | 3300053121 | Bacteria | 30989 |
| 916 | Ga0500608_000074 | 3300053122 | Bacteria | 42636 |
| 917 | Ga0500614_006488 | 3300053123 | Bacteria | 2461 |
| 918 | Ga0500642_0001088 | 3300053130 | Bacteria | 7802 |
| 919 | Ga0500658_0003617 | 3300053134 | Bacteria | 5830 |
| 920 | Ga0500658_0005314 | 3300053134 | Bacteria | 4788 |
| 921 | Ga0500658_0033241 | 3300053134 | Bacteria | 2027 |
| 922 | Ga0500658_0038213 | 3300053134 | Bacteria | 1912 |
| 923 | Ga0500559_0044675 | 3300053136 | Bacteria | 1938 |
| 924 | Ga0500559_0046405 | 3300053136 | Bacteria | 1905 |
| 925 | Ga0500559_0174035 | 3300053136 | Bacteria | 1013 |
| 926 | Ga0500564_000068 | 3300053138 | Bacteria | 27518 |
| 927 | Ga0500568_0000658 | 3300053139 | Bacteria | 24979 |
| 928 | Ga0500573_0000029 | 3300053140 | Bacteria | 135595 |
| 929 | Ga0500590_036659 | 3300053148 | Bacteria | 2535 |
| 930 | Ga0500604_0013629 | 3300053151 | Bacteria | 2205 |
| 931 | Ga0500616_0219494 | 3300053153 | Bacteria | 830 |
| 932 | Ga0500622_0000119 | 3300053156 | Bacteria | 82219 |
| 933 | Ga0500624_000032 | 3300053157 | Bacteria | 104403 |
| 934 | Ga0500627_0000028 | 3300053158 | Bacteria | 99118 |
| 935 | Ga0500627_0008936 | 3300053158 | Bacteria | 3584 |
| 936 | Ga0500634_0014677 | 3300053161 | Bacteria | 4137 |
| 937 | Ga0500637_0000019 | 3300053178 | Bacteria | 65170 |
| 938 | Ga0500567_024519 | 3300053723 | Bacteria | 2883 |
| 939 | Ga0500611_009750 | 3300053727 | Bacteria | 1533 |
| 940 | Ga0500625_000004 | 3300053729 | Bacteria | 245905 |
| 941 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 942 | Ga0500645_015016 | 3300053730 | Bacteria | 2460 |
| 943 | Ga0500596_004764 | 3300053735 | Bacteria | 2454 |
| 944 | Ga0466962_0004007 | 3300061719 | Bacteria | 7054 |
| 945 | 2547501642 | 2547132130 | Bacteria | 4660562 |
| 946 | 2578456949 | 2576861471 | Bacteria | 4648976 |
| 947 | 2600225315 | 2599185359 | Bacteria | 4772316 |
| 948 | 2643820304 | 2643221560 | Bacteria | 4801179 |
| 949 | 2643834621 | 2643221563 | Bacteria | 4726935 |
| 950 | 2644055548 | 2643221608 | Bacteria | 4724829 |
| 951 | 2644126180 | 2643221622 | Bacteria | 4212502 |
| 952 | 2738710377 | 2738541275 | Bacteria | 4830863 |
| 953 | 2738848802 | 2738541301 | Bacteria | 4834102 |
| 954 | 2738864531 | 2738541304 | Bacteria | 4833665 |
| 955 | 2739297049 | 2738543022 | Bacteria | 4835059 |
| 956 | 2739358727 | 2738543033 | Bacteria | 4833336 |
| 957 | 2739650622 | 2739367664 | Bacteria | 4114334 |
| 958 | 2740029095 | 2739367865 | Bacteria | 4114482 |
| 959 | 2747951540 | 2747842428 | Bacteria | 4689383 |
| 960 | 2748018780 | 2747842501 | Bacteria | 5293829 |
| 961 | 2753767920 | 2751185897 | Bacteria | 5322941 |
| 962 | 2765580556 | 2765235840 | Bacteria | 4663337 |
| 963 | 2816518421 | 2816332141 | Bacteria | 4436036 |
| 964 | 2819661357 | 2818991457 | Bacteria | 5323295 |
| 965 | 2819713584 | 2818991466 | Bacteria | 4748179 |
| 966 | 2830078749 | 2830075706 | Bacteria | 3855215 |
| 967 | 2842394470 | 2842391507 | Bacteria | 4486072 |
| 968 | 2842781916 | 2842780639 | Bacteria | 4337790 |
| 969 | 2852652101 | 2852649853 | Bacteria | 4036942 |
| 970 | 2852656172 | 2852653556 | Bacteria | 4050083 |
| 971 | 2852683248 | 2852680915 | Bacteria | 4100189 |
| 972 | 2852687227 | 2852684882 | Bacteria | 5463342 |
| 973 | 2857444212 | 2857442823 | Bacteria | 4562550 |
| 974 | 2874223223 | 2874220319 | Bacteria | 4594709 |
| 975 | 2879166297 | 2879163058 | Bacteria | 4223965 |
| 976 | 2882808969 | 2882806704 | Bacteria | 3007728 |
| 977 | 2885430424 | 2885429604 | Bacteria | 3642894 |
| 978 | 2895499889 | 2895498888 | Bacteria | 5283788 |
| 979 | 2895512866 | 2895511927 | Bacteria | 6802080 |
| 980 | 2895522874 | 2895522137 | Bacteria | 3284416 |
| 981 | 2895525354 | 2895525241 | Bacteria | 3388457 |
| 982 | 2895882046 | 2895880812 | Bacteria | 11255272 |
| 983 | 2896187326 | 2896184354 | Bacteria | 3258548 |
| 984 | 2896254210 | 2896253425 | Bacteria | 3418029 |
| 985 | 2919092299 | 2919089067 | Bacteria | 4560942 |
| 986 | 2919137017 | 2919134579 | Bacteria | 4480386 |
| 987 | 2928028720 | 2928027323 | Bacteria | 4382488 |
| 988 | 2928100474 | 2928100450 | Bacteria | 4837635 |
| 989 | 2928499889 | 2928496128 | Bacteria | 4631123 |
| 990 | 2928530114 | 2928526807 | Bacteria | 4760224 |
| 991 | 2928960539 | 2928959182 | Bacteria | 4725774 |
| 992 | 2928969699 | 2928968154 | Bacteria | 4633371 |
| 993 | 2931383341 | 2931380184 | Bacteria | 4455911 |
| 994 | 2937614313 | 2937610967 | Bacteria | 4618818 |
| 995 | 2939589854 | 2939589442 | Bacteria | 4214238 |
| 996 | 2939624971 | 2939622612 | Bacteria | 4698046 |
| 997 | 2939629177 | 2939626828 | Bacteria | 4695272 |
| 998 | 2941478724 | 2941475908 | Bacteria | 4145589 |
| 999 | 2961049987 | 2961047084 | Bacteria | 4594415 |
| 1000 | 2961064855 | 2961064222 | Bacteria | 4749990 |
| 1001 | 2974307601 | 2974307012 | Bacteria | 4172388 |
| 1002 | 2977248312 | 2977247770 | Bacteria | 4160543 |
| 1003 | 2984517195 | 2984514374 | Bacteria | 4172479 |
| 1004 | 2984555453 | 2984555340 | Bacteria | 4247089 |
| 1005 | 2984566410 | 2984564862 | Bacteria | 4339992 |
| 1006 | 2990265856 | 2990265787 | Bacteria | 3943888 |
| 1007 | 2993357449 | 2993356040 | Bacteria | 4247105 |
| 1008 | 2993696353 | 2993693658 | Bacteria | 4040749 |
| 1009 | 3000867592 | 3000865235 | Bacteria | 3106258 |
| 1010 | 8002870927 | 8002869464 | Bacteria | 3588529 |
| 1011 | 8021625520 | 8021622325 | Bacteria | 4844743 |
| 1012 | 8021628644 | 8021626552 | Bacteria | 4665214 |
| 1013 | Ga0068860_100002770 | |||
| 1014 | SwRhRL2b_contig_2092658 | |||
| 1015 | SwRhRL2b_contig_2737664 | |||
| 1016 | SwRhRL2b_contig_582393 | |||
| 1017 | JGI24736J21556_1013858 | |||
| 1018 | JGI24741J21665_1001762 | |||
| 1019 | JGI24739J22299_10002548 | |||
| 1020 | JGI24739J22299_10011332 | |||
| 1021 | JGI24739J22299_10017654 | |||
| 1022 | JGI24737J22298_10004146 | |||
| 1023 | JGI24737J22298_10047037 | |||
| 1024 | JGI24735J21928_10004389 | |||
| 1025 | JGI24735J21928_10005489 | |||
| 1026 | JGI24735J21928_10007628 | |||
| 1027 | JGI24735J21928_10011878 | |||
| 1028 | JGI24735J21928_10022420 | |||
| 1029 | JGI24735J21928_10035929 | |||
| 1030 | JGI24748J21848_1000454 | |||
| 1031 | JGI24738J21930_10000636 | |||
| 1032 | JGI24738J21930_10005673 | |||
| 1033 | JGI24034J26672_10000696 | |||
| 1034 | JGI24742J22300_10019210 | |||
| 1035 | JGI24742J22300_10021347 | |||
| 1036 | JGI25152J39213_1000659 | |||
| 1037 | JGI25150J39212_1000347 | |||
| 1038 | JGI25150J39212_1000465 | |||
| 1039 | JGI25151J46595_10001250 | |||
| 1040 | JGI25151J46595_10029422 | |||
| 1041 | JGI25165J46597_1000094 | |||
| 1042 | JGI25153J46596_10000008 | |||
| 1043 | JGI25153J46596_10000029 | |||
| 1044 | JGI25153J46596_10000903 | |||
| 1045 | rootH1_10093328 | |||
| 1046 | rootH2_10030501 | |||
| 1047 | rootH1_10120080 | |||
| 1048 | Ga0055525_1000063 | |||
| 1049 | Ga0055525_1000064 | |||
| 1050 | Ga0055542_1000795 | |||
| 1051 | Ga0055542_1001337 | |||
| 1052 | Ga0055529_1000037 | |||
| 1053 | Ga0055526_1004964 | |||
| 1054 | Ga0055526_1005847 | |||
| 1055 | Ga0055526_1016035 | |||
| 1056 | Ga0055537_1000403 | |||
| 1057 | Ga0055537_1003251 | |||
| 1058 | Ga0055537_1006067 | |||
| 1059 | Ga0055524_1000410 | |||
| 1060 | Ga0055524_1027333 | |||
| 1061 | Ga0055536_1002521 | |||
| 1062 | Ga0055536_1004416 | |||
| 1063 | Ga0055536_1014951 | |||
| 1064 | Ga0055536_1022199 | |||
| 1065 | Ga0055534_1005664 | |||
| 1066 | Ga0055528_1001877 | |||
| 1067 | Ga0055530_10000005 | |||
| 1068 | Ga0055530_10000409 | |||
| 1069 | Ga0055530_10003696 | |||
| 1070 | Ga0055530_10004768 | |||
| 1071 | Ga0055530_10013230 | |||
| 1072 | Ga0055531_10000009 | |||
| 1073 | Ga0055531_10000687 | |||
| 1074 | Ga0055531_10009392 | |||
| 1075 | Ga0055531_10020213 | |||
| 1076 | Ga0055531_10030079 | |||
| 1077 | Ga0058692_1000053 | |||
| 1078 | Ga0058692_1000370 | |||
| 1079 | Ga0065165_1002223 | |||
| 1080 | Ga0065165_1061613 | |||
| 1081 | Ga0065704_10070413 | |||
| 1082 | Ga0065704_10071247 | |||
| 1083 | Ga0065704_10075189 | |||
| 1084 | Ga0065704_10107595 | |||
| 1085 | Ga0065704_10112030 | |||
| 1086 | Ga0065707_10087869 | |||
| 1087 | Ga0065707_10268188 | |||
| 1088 | Ga0070658_10000703 | |||
| 1089 | Ga0070658_10002141 | |||
| 1090 | Ga0070658_10003377 | |||
| 1091 | Ga0070676_10000747 | |||
| 1092 | Ga0070683_100025777 | |||
| 1093 | Ga0070670_100000016 | |||
| 1094 | Ga0070670_100009550 | |||
| 1095 | Ga0068869_100009489 | |||
| 1096 | Ga0068869_100022149 | |||
| 1097 | Ga0070666_10025171 | |||
| 1098 | Ga0070666_10109106 | |||
| 1099 | Ga0070682_100073849 | |||
| 1100 | Ga0068868_100001464 | |||
| 1101 | Ga0070660_100002482 | |||
| 1102 | Ga0070660_100010090 | |||
| 1103 | Ga0070660_100119026 | |||
| 1104 | Ga0070660_100202413 | |||
| 1105 | Ga0070661_100008555 | |||
| 1106 | Ga0070661_100117772 | |||
| 1107 | Ga0070661_100381566 | |||
| 1108 | Ga0070668_100000927 | |||
| 1109 | Ga0070668_100004618 | |||
| 1110 | Ga0070668_100029440 | |||
| 1111 | Ga0070668_100313957 | |||
| 1112 | Ga0070669_100000776 | |||
| 1113 | Ga0070669_100001504 | |||
| 1114 | Ga0070669_100118590 | |||
| 1115 | Ga0070669_100123844 | |||
| 1116 | Ga0070671_100000829 | |||
| 1117 | Ga0070671_100027240 | |||
| 1118 | Ga0070671_100035619 | |||
| 1119 | Ga0070671_100088883 | |||
| 1120 | Ga0070671_100572422 | |||
| 1121 | Ga0070674_100004401 | |||
| 1122 | Ga0070674_100010366 | |||
| 1123 | Ga0070674_100231178 | |||
| 1124 | Ga0070673_100000018 | |||
| 1125 | Ga0070659_100242055 | |||
| 1126 | Ga0070667_100000528 | |||
| 1127 | Ga0070667_100001140 | |||
| 1128 | Ga0070667_100016515 | |||
| 1129 | Ga0070667_100193863 | |||
| 1130 | Ga0070663_100000625 | |||
| 1131 | Ga0070663_100061889 | |||
| 1132 | Ga0070663_100170665 | |||
| 1133 | Ga0070663_100582844 | |||
| 1134 | Ga0070678_100007825 | |||
| 1135 | Ga0070678_100055931 | |||
| 1136 | Ga0070662_100000183 | |||
| 1137 | Ga0070662_100002569 | |||
| 1138 | Ga0070662_100037941 | |||
| 1139 | Ga0070681_10004781 | |||
| 1140 | Ga0068867_100001234 | |||
| 1141 | Ga0070679_100001448 | |||
| 1142 | Ga0070684_100160304 | |||
| 1143 | Ga0070684_100733962 | |||
| 1144 | Ga0068853_100002487 | |||
| 1145 | Ga0068853_100029337 | |||
| 1146 | Ga0068853_100347654 | |||
| 1147 | Ga0068853_100397668 | |||
| 1148 | Ga0068853_100487548 | |||
| 1149 | Ga0070672_100015740 | |||
| 1150 | Ga0070672_100232606 | |||
| 1151 | Ga0070672_100830901 | |||
| 1152 | Ga0070665_100000023 | |||
| 1153 | Ga0070665_100000070 | |||
| 1154 | Ga0070665_100008683 | |||
| 1155 | Ga0070665_100177602 | |||
| 1156 | Ga0070665_100452386 | |||
| 1157 | Ga0070665_100503137 | |||
| 1158 | Ga0068855_100000066 | |||
| 1159 | Ga0068855_100004493 | |||
| 1160 | Ga0068855_100051665 | |||
| 1161 | Ga0068855_100180742 | |||
| 1162 | Ga0068855_100188025 | |||
| 1163 | Ga0068855_100361621 | |||
| 1164 | Ga0070664_100216012 | |||
| 1165 | Ga0068857_100037357 | |||
| 1166 | Ga0068857_100201968 | |||
| 1167 | Ga0068857_100506446 | |||
| 1168 | Ga0068854_100000153 | |||
| 1169 | Ga0068854_100007254 | |||
| 1170 | Ga0068854_100010799 | |||
| 1171 | Ga0068854_100037586 | |||
| 1172 | Ga0068854_100078801 | |||
| 1173 | Ga0068854_100121886 | |||
| 1174 | Ga0068856_100009163 | |||
| 1175 | Ga0068856_100030557 | |||
| 1176 | Ga0068852_100056880 | |||
| 1177 | Ga0068852_100078536 | |||
| 1178 | Ga0068852_100217427 | |||
| 1179 | Ga0068852_100476291 | |||
| 1180 | Ga0068859_100005055 | |||
| 1181 | Ga0068859_100074439 | |||
| 1182 | Ga0068859_100095478 | |||
| 1183 | Ga0068864_100000017 | |||
| 1184 | Ga0068861_100000002 | |||
| 1185 | Ga0068863_100000018 | |||
| 1186 | Ga0068863_100002981 | |||
| 1187 | Ga0068863_100291741 | |||
| 1188 | Ga0068858_100000112 | |||
| 1189 | Ga0068858_100015224 | |||
| 1190 | Ga0068858_100370622 | |||
| 1191 | Ga0068858_100794712 | |||
| 1192 | Ga0068860_100004621 | |||
| 1193 | Ga0068860_100042994 | |||
| 1194 | Ga0068860_100128610 | |||
| 1195 | Ga0068860_100452717 | |||
| 1196 | Ga0068860_100535766 | |||
| 1197 | Ga0068862_100000010 | |||
| 1198 | Ga0068862_100000877 | |||
| 1199 | Ga0068862_100001863 | |||
| 1200 | Ga0068862_100007339 | |||
| 1201 | Ga0068862_100076371 | |||
| 1202 | Ga0068862_100090810 | |||
| 1203 | Ga0075365_10106104 | |||
| 1204 | Ga0075368_10000152 | |||
| 1205 | Ga0075363_100000467 | |||
| 1206 | Ga0075363_100002645 | |||
| 1207 | Ga0075364_10020634 | |||
| 1208 | Ga0075362_10000066 | |||
| 1209 | Ga0075362_10000596 | |||
| 1210 | Ga0075362_10009230 | |||
| 1211 | Ga0075362_10075098 | |||
| 1212 | Ga0075367_10007912 | |||
| 1213 | Ga0075367_10079057 | |||
| 1214 | Ga0075369_10021559 | |||
| 1215 | Ga0075369_10070859 | |||
| 1216 | Ga0075366_10000145 | |||
| 1217 | Ga0075366_10007378 | |||
| 1218 | Ga0075366_10011539 | |||
| 1219 | Ga0075366_10028114 | |||
| 1220 | Ga0097621_100009955 | |||
| 1221 | Ga0097621_100212787 | |||
| 1222 | Ga0075370_10000055 | |||
| 1223 | Ga0075370_10004306 | |||
| 1224 | Ga0075370_10008006 | |||
| 1225 | Ga0075370_10037121 | |||
| 1226 | Ga0075370_10269803 | |||
| 1227 | Ga0068871_100042617 | |||
| 1228 | Ga0068865_100000007 | |||
| 1229 | Ga0097620_100005055 | |||
| 1230 | Ga0097620_100074438 | |||
| 1231 | Ga0097620_100095482 | |||
| 1232 | Ga0105251_10000155 | |||
| 1233 | Ga0105251_10002120 | |||
| 1234 | Ga0105251_10002321 | |||
| 1235 | Ga0105251_10003158 | |||
| 1236 | Ga0105244_10011175 | |||
| 1237 | Ga0105244_10049489 | |||
| 1238 | Ga0105250_10099377 | |||
| 1239 | Ga0105240_10030522 | |||
| 1240 | Ga0105240_11213236 | |||
| 1241 | Ga0105245_10003037 | |||
| 1242 | Ga0105245_10005071 | |||
| 1243 | Ga0105247_10009791 | |||
| 1244 | Ga0105247_10014568 | |||
| 1245 | Ga0105243_10000221 | |||
| 1246 | Ga0105243_10000264 | |||
| 1247 | Ga0105243_10058114 | |||
| 1248 | Ga0105243_10686186 | |||
| 1249 | Ga0105241_10033095 | |||
| 1250 | Ga0105241_10089543 | |||
| 1251 | Ga0105242_10002348 | |||
| 1252 | Ga0105242_10359058 | |||
| 1253 | Ga0105242_10507852 | |||
| 1254 | Ga0105248_10000105 | |||
| 1255 | Ga0105248_10004901 | |||
| 1256 | Ga0105248_10013983 | |||
| 1257 | Ga0105248_10022491 | |||
| 1258 | Ga0105248_10076069 | |||
| 1259 | Ga0105237_10002971 | |||
| 1260 | Ga0105237_10073805 | |||
| 1261 | Ga0105237_10372648 | |||
| 1262 | Ga0105237_10531939 | |||
| 1263 | Ga0105237_10702349 | |||
| 1264 | Ga0105238_10712230 | |||
| 1265 | Ga0105249_10000207 | |||
| 1266 | Ga0105249_10000574 | |||
| 1267 | Ga0105249_10032567 | |||
| 1268 | Ga0105249_10035802 | |||
| 1269 | Ga0105239_10000060 | |||
| 1270 | Ga0105239_10170631 | |||
| 1271 | Ga0105239_10853210 | |||
| 1272 | Ga0105246_10006206 | |||
| 1273 | Ga0157326_1004457 | |||
| 1274 | Ga0157373_10007927 | |||
| 1275 | Ga0157373_10550348 | |||
| 1276 | Ga0157371_10000256 | |||
| 1277 | Ga0157371_10001424 | |||
| 1278 | Ga0157371_10002212 | |||
| 1279 | Ga0157371_10059147 | |||
| 1280 | Ga0157371_10160945 | |||
| 1281 | Ga0157371_10228486 | |||
| 1282 | Ga0157371_10335632 | |||
| 1283 | Ga0157370_10001069 | |||
| 1284 | Ga0157370_10012091 | |||
| 1285 | Ga0157370_10266839 | |||
| 1286 | Ga0157370_10455638 | |||
| 1287 | Ga0157369_10005291 | |||
| 1288 | Ga0157369_10242641 | |||
| 1289 | Ga0157369_10428312 | |||
| 1290 | Ga0157374_10015731 | |||
| 1291 | Ga0157374_10016936 | |||
| 1292 | Ga0157374_10151118 | |||
| 1293 | Ga0157378_10004659 | |||
| 1294 | Ga0157378_10046547 | |||
| 1295 | Ga0163162_10021575 | |||
| 1296 | Ga0163162_10024944 | |||
| 1297 | Ga0163162_10118060 | |||
| 1298 | Ga0163162_10163793 | |||
| 1299 | Ga0157372_10004975 | |||
| 1300 | Ga0157372_10014109 | |||
| 1301 | Ga0157372_10026789 | |||
| 1302 | Ga0157372_10075308 | |||
| 1303 | Ga0157372_10112502 | |||
| 1304 | Ga0157372_10167980 | |||
| 1305 | Ga0157372_10514262 | |||
| 1306 | Ga0157372_10778103 | |||
| 1307 | Ga0157372_11100078 | |||
| 1308 | Ga0157372_11272541 | |||
| 1309 | Ga0157375_10000706 | |||
| 1310 | Ga0157375_10419646 | |||
| 1311 | Ga0163163_10084394 | |||
| 1312 | Ga0157380_10362738 | |||
| 1313 | Ga0182008_10002286 | |||
| 1314 | Ga0182008_10010202 | |||
| 1315 | Ga0157379_10065246 | |||
| 1316 | Ga0157379_10125715 | |||
| 1317 | Ga0157376_10000046 | |||
| 1318 | Ga0182007_10000131 | |||
| 1319 | Ga0182005_1000437 | |||
| 1320 | Ga0182005_1001317 | |||
| 1321 | Ga0183363_1004 | |||
| 1322 | Ga0183361_13433 | |||
| 1323 | Ga0163161_10001840 | |||
| 1324 | Ga0163161_10001980 | |||
| 1325 | Ga0209563_100066 | |||
| 1326 | Ga0207427_103136 | |||
| 1327 | Ga0207425_1000041 | |||
| 1328 | Ga0207425_1000064 | |||
| 1329 | Ga0209026_1001795 | |||
| 1330 | Ga0209148_1000011 | |||
| 1331 | Ga0209148_1000074 | |||
| 1332 | Ga0209148_1001136 | |||
| 1333 | Ga0209129_1000101 | |||
| 1334 | Ga0209129_1001272 | |||
| 1335 | Ga0209233_1000003 | |||
| 1336 | Ga0209233_1000026 | |||
| 1337 | Ga0209233_1017631 | |||
| 1338 | Ga0209565_1000008 | |||
| 1339 | Ga0209565_1000060 | |||
| 1340 | Ga0209565_1000755 | |||
| 1341 | Ga0209455_1000006 | |||
| 1342 | Ga0209455_1000985 | |||
| 1343 | Ga0209455_1024569 | |||
| 1344 | Ga0209673_1000047 | |||
| 1345 | Ga0209673_1012801 | |||
| 1346 | Ga0209673_1013903 | |||
| 1347 | Ga0209675_1000007 | |||
| 1348 | Ga0209675_1000564 | |||
| 1349 | Ga0209675_1015297 | |||
| 1350 | Ga0209676_1000018 | |||
| 1351 | Ga0209676_1000132 | |||
| 1352 | Ga0209676_1000146 | |||
| 1353 | Ga0209676_1000411 | |||
| 1354 | Ga0209676_1000620 | |||
| 1355 | Ga0209025_1000048 | |||
| 1356 | Ga0209025_1000654 | |||
| 1357 | Ga0209025_1018129 | |||
| 1358 | Ga0209564_1000252 | |||
| 1359 | Ga0209564_1000565 | |||
| 1360 | Ga0209564_1046617 | |||
| 1361 | Ga0209758_1000004 | |||
| 1362 | Ga0209758_1000017 | |||
| 1363 | Ga0209758_1000056 | |||
| 1364 | Ga0209050_1000001 | |||
| 1365 | Ga0209050_1000014 | |||
| 1366 | Ga0209050_1000139 | |||
| 1367 | Ga0209050_1000740 | |||
| 1368 | Ga0209050_1000870 | |||
| 1369 | Ga0209050_1010220 | |||
| 1370 | Ga0209050_1017968 | |||
| 1371 | Ga0209256_1000009 | |||
| 1372 | Ga0209256_1000010 | |||
| 1373 | Ga0209256_1003547 | |||
| 1374 | Ga0209256_1008988 | |||
| 1375 | Ga0209051_1000475 | |||
| 1376 | Ga0209051_1001835 | |||
| 1377 | Ga0209257_1000019 | |||
| 1378 | Ga0209257_1000035 | |||
| 1379 | Ga0209257_1000046 | |||
| 1380 | Ga0209257_1000164 | |||
| 1381 | Ga0209257_1000277 | |||
| 1382 | Ga0209257_1001111 | |||
| 1383 | Ga0209257_1001426 | |||
| 1384 | Ga0209257_1001546 | |||
| 1385 | Ga0209257_1002572 | |||
| 1386 | Ga0209257_1008341 | |||
| 1387 | Ga0209257_1008364 | |||
| 1388 | Ga0209257_1022795 | |||
| 1389 | Ga0209257_1026604 | |||
| 1390 | Ga0207697_10136156 | |||
| 1391 | Ga0207656_10012961 | |||
| 1392 | Ga0207696_1001953 | |||
| 1393 | Ga0207713_1001324 | |||
| 1394 | Ga0207713_1004906 | |||
| 1395 | Ga0207713_1007429 | |||
| 1396 | Ga0207713_1018913 | |||
| 1397 | Ga0207710_10004777 | |||
| 1398 | Ga0207680_10115626 | |||
| 1399 | Ga0207647_10000421 | |||
| 1400 | Ga0207647_10004216 | |||
| 1401 | Ga0207647_10124711 | |||
| 1402 | Ga0207647_10181754 | |||
| 1403 | Ga0207645_10000811 | |||
| 1404 | Ga0207643_10208146 | |||
| 1405 | Ga0207705_10000044 | |||
| 1406 | Ga0207705_10000513 | |||
| 1407 | Ga0207705_10010060 | |||
| 1408 | Ga0207705_10253214 | |||
| 1409 | Ga0207654_10004906 | |||
| 1410 | Ga0207654_10070889 | |||
| 1411 | Ga0207695_10009843 | |||
| 1412 | Ga0207695_10032721 | |||
| 1413 | Ga0207695_10047824 | |||
| 1414 | Ga0207671_10001071 | |||
| 1415 | Ga0207671_10012983 | |||
| 1416 | Ga0207660_10176382 | |||
| 1417 | Ga0207657_10000123 | |||
| 1418 | Ga0207657_10034797 | |||
| 1419 | Ga0207657_10121364 | |||
| 1420 | Ga0207649_10000347 | |||
| 1421 | Ga0207649_10017466 | |||
| 1422 | Ga0207652_10025012 | |||
| 1423 | Ga0207681_10002329 | |||
| 1424 | Ga0207681_10003582 | |||
| 1425 | Ga0207681_10059028 | |||
| 1426 | Ga0207681_10070070 | |||
| 1427 | Ga0207681_10071300 | |||
| 1428 | Ga0207681_10191510 | |||
| 1429 | Ga0207694_10079412 | |||
| 1430 | Ga0207694_10466217 | |||
| 1431 | Ga0207694_10675380 | |||
| 1432 | Ga0207650_10000057 | |||
| 1433 | Ga0207650_10001882 | |||
| 1434 | Ga0207650_10052193 | |||
| 1435 | Ga0207659_10380891 | |||
| 1436 | Ga0207687_10002295 | |||
| 1437 | Ga0207687_10041644 | |||
| 1438 | Ga0207644_10004486 | |||
| 1439 | Ga0207644_10006854 | |||
| 1440 | Ga0207644_10225963 | |||
| 1441 | Ga0207690_10003709 | |||
| 1442 | Ga0207690_10015155 | |||
| 1443 | Ga0207690_10041814 | |||
| 1444 | Ga0207690_10044717 | |||
| 1445 | Ga0207690_10073557 | |||
| 1446 | Ga0207690_10193916 | |||
| 1447 | Ga0207706_10000193 | |||
| 1448 | Ga0207706_10005814 | |||
| 1449 | Ga0207706_10028490 | |||
| 1450 | Ga0207706_10035771 | |||
| 1451 | Ga0207706_10089690 | |||
| 1452 | Ga0207706_10219164 | |||
| 1453 | Ga0207706_10398092 | |||
| 1454 | Ga0207686_10002994 | |||
| 1455 | Ga0207709_10000078 | |||
| 1456 | Ga0207709_10000277 | |||
| 1457 | Ga0207709_10000732 | |||
| 1458 | Ga0207709_10007614 | |||
| 1459 | Ga0207669_10000020 | |||
| 1460 | Ga0207669_10003084 | |||
| 1461 | Ga0207704_10000168 | |||
| 1462 | Ga0207691_10006781 | |||
| 1463 | Ga0207691_10141440 | |||
| 1464 | Ga0207711_10000031 | |||
| 1465 | Ga0207711_10020363 | |||
| 1466 | Ga0207711_10020863 | |||
| 1467 | Ga0207711_10116551 | |||
| 1468 | Ga0207689_10005309 | |||
| 1469 | Ga0207689_10043302 | |||
| 1470 | Ga0207679_10032153 | |||
| 1471 | Ga0207667_10000002 | |||
| 1472 | Ga0207667_10000137 | |||
| 1473 | Ga0207667_10002490 | |||
| 1474 | Ga0207667_10014229 | |||
| 1475 | Ga0207667_10339843 | |||
| 1476 | Ga0207667_10635853 | |||
| 1477 | Ga0207651_10000011 | |||
| 1478 | Ga0207651_10317150 | |||
| 1479 | Ga0207712_10000234 | |||
| 1480 | Ga0207712_10000476 | |||
| 1481 | Ga0207712_10003720 | |||
| 1482 | Ga0207668_10000746 | |||
| 1483 | Ga0207668_10003547 | |||
| 1484 | Ga0207668_10017031 | |||
| 1485 | Ga0207668_10247549 | |||
| 1486 | Ga0207668_10288916 | |||
| 1487 | Ga0207640_10000236 | |||
| 1488 | Ga0207640_10013334 | |||
| 1489 | Ga0207640_10018292 | |||
| 1490 | Ga0207640_10029440 | |||
| 1491 | Ga0207640_10032710 | |||
| 1492 | Ga0207640_10037685 | |||
| 1493 | Ga0207640_10741936 | |||
| 1494 | Ga0207658_10001382 | |||
| 1495 | Ga0207658_10005000 | |||
| 1496 | Ga0207658_10006307 | |||
| 1497 | Ga0207658_10129351 | |||
| 1498 | Ga0207658_10151910 | |||
| 1499 | Ga0207658_10330590 | |||
| 1500 | Ga0207677_10001007 | |||
| 1501 | Ga0207703_10002992 | |||
| 1502 | Ga0207703_10009901 | |||
| 1503 | Ga0207703_10168040 | |||
| 1504 | Ga0207703_10243230 | |||
| 1505 | Ga0207703_10436676 | |||
| 1506 | Ga0207639_10002135 | |||
| 1507 | Ga0207639_10005268 | |||
| 1508 | Ga0207639_10005755 | |||
| 1509 | Ga0207639_10061557 | |||
| 1510 | Ga0207639_10304378 | |||
| 1511 | Ga0207639_10321808 | |||
| 1512 | Ga0207639_10340890 | |||
| 1513 | Ga0207639_10447372 | |||
| 1514 | Ga0207678_10000946 | |||
| 1515 | Ga0207678_10006261 | |||
| 1516 | Ga0207678_10007535 | |||
| 1517 | Ga0207678_10461650 | |||
| 1518 | Ga0207708_10249196 | |||
| 1519 | Ga0207702_10007234 | |||
| 1520 | Ga0207702_10012593 | |||
| 1521 | Ga0207702_10013929 | |||
| 1522 | Ga0207702_10077753 | |||
| 1523 | Ga0207702_10443618 | |||
| 1524 | Ga0207641_10000002 | |||
| 1525 | Ga0207641_10004191 | |||
| 1526 | Ga0207641_10320210 | |||
| 1527 | Ga0207648_10000047 | |||
| 1528 | Ga0207676_10000005 | |||
| 1529 | Ga0207674_10008601 | |||
| 1530 | Ga0207674_10010604 | |||
| 1531 | Ga0207675_100000021 | |||
| 1532 | Ga0207683_10001150 | |||
| 1533 | Ga0207683_10037334 | |||
| 1534 | Ga0207683_10201812 | |||
| 1535 | Ga0207698_10001045 | |||
| 1536 | Ga0207698_10018394 | |||
| 1537 | Ga0209371_1000018 | |||
| 1538 | Ga0209371_1000025 | |||
| 1539 | Ga0209813_10000082 | |||
| 1540 | Ga0209974_10036797 | |||
| 1541 | Ga0268266_10000002 | |||
| 1542 | Ga0268266_10001471 | |||
| 1543 | Ga0268266_10002431 | |||
| 1544 | Ga0268266_10033151 | |||
| 1545 | Ga0268266_10142959 | |||
| 1546 | Ga0268266_10162973 | |||
| 1547 | Ga0268265_10000003 | |||
| 1548 | Ga0268265_10000424 | |||
| 1549 | Ga0268265_10007903 | |||
| 1550 | Ga0268265_10036208 | |||
| 1551 | Ga0268264_10001182 | |||
| 1552 | Ga0268264_10031281 | |||
| 1553 | Ga0268264_10045475 | |||
| 1554 | Ga0268264_10062626 | |||
| 1555 | Ga0307517_10018404 | |||
| 1556 | Ga0307517_10251191 | |||
| 1557 | Ga0268256_1000016 | |||
| 1558 | Ga0268256_1000027 | |||
| 1559 | Ga0314311_1075969 | |||
| 1560 | Ga0314311_1115565 | |||
| 1561 | Ga0316183_1110894 | |||
| 1562 | Ga0316183_1164325 | |||
| 1563 | Ga0307513_10039689 | |||
| 1564 | Ga0307513_10097114 | |||
| 1565 | Ga0307513_10206471 | |||
| 1566 | Ga0307408_100186371 | |||
| 1567 | Ga0307408_100298772 | |||
| 1568 | Ga0307508_10009433 | |||
| 1569 | Ga0307405_10000445 | |||
| 1570 | Ga0316577_10140284 | |||
| 1571 | Ga0307413_10071278 | |||
| 1572 | Ga0307413_10197001 | |||
| 1573 | Ga0307413_10462187 | |||
| 1574 | Ga0307410_10060998 | |||
| 1575 | Ga0307410_10156661 | |||
| 1576 | Ga0307406_10079342 | |||
| 1577 | Ga0307412_10003432 | |||
| 1578 | Ga0307412_10005593 | |||
| 1579 | Ga0307412_10016843 | |||
| 1580 | Ga0307412_10048784 | |||
| 1581 | Ga0307412_10052199 | |||
| 1582 | Ga0307412_10070245 | |||
| 1583 | Ga0307412_10239243 | |||
| 1584 | Ga0307412_10247267 | |||
| 1585 | Ga0307412_10399278 | |||
| 1586 | Ga0307412_10413221 | |||
| 1587 | Ga0307409_100207365 | |||
| 1588 | Ga0307409_100857467 | |||
| 1589 | Ga0307414_10000251 | |||
| 1590 | Ga0307414_10001515 | |||
| 1591 | Ga0307414_10004650 | |||
| 1592 | Ga0307414_10007830 | |||
| 1593 | Ga0307414_10015078 | |||
| 1594 | Ga0307414_10020297 | |||
| 1595 | Ga0307414_10031336 | |||
| 1596 | Ga0307414_10044838 | |||
| 1597 | Ga0307414_10087909 | |||
| 1598 | Ga0307414_10157139 | |||
| 1599 | Ga0307414_10176111 | |||
| 1600 | Ga0307414_10347958 | |||
| 1601 | Ga0307414_10394476 | |||
| 1602 | Ga0307414_10503390 | |||
| 1603 | Ga0307411_10078383 | |||
| 1604 | Ga0307411_10316030 | |||
| 1605 | Ga0307411_10464123 | |||
| 1606 | Ga0307415_100030269 | |||
| 1607 | Ga0307510_10001089 | |||
| 1608 | Ga0373923_0123256 | |||
| 1609 | Ga0373923_0248307 | |||
| 1610 | Ga0316574_0165096 | |||
| 1611 | Ga0373931_0165440 | |||
| 1612 | Ga0316582_0043273 | |||
| 1613 | Ga0395899_0009504 | |||
| 1614 | Ga0395899_0036920 | |||
| 1615 | Ga0395900_0039298 | |||
| 1616 | Ga0395900_0069449 | |||
| 1617 | Ga0395900_0171035 | |||
| 1618 | Ga0395905_0013942 | |||
| 1619 | Ga0395905_0161200 | |||
| 1620 | Ga0395905_0248194 | |||
| 1621 | Ga0436364_0184827 | |||
| 1622 | Ga0436364_0296893 | |||
| 1623 | Ga0237819_00128 | |||
| 1624 | Ga0436365_0341898 | |||
| 1625 | Ga0436365_1628748 | |||
| 1626 | Ga0439436_0008965 | |||
| 1627 | Ga0439439_0006402 | |||
| 1628 | Ga0439461_0000103 | |||
| 1629 | Ga0439461_0015624 | |||
| 1630 | Ga0439465_0000289 | |||
| 1631 | Ga0439465_0004367 | |||
| 1632 | Ga0451797_0789101 | |||
| 1633 | Ga0451806_635767 | |||
| 1634 | Ga0451807_1567495 | |||
| 1635 | Ga0451807_2581624 | |||
| 1636 | Ga0451837_1421368 | |||
| 1637 | Ga0451841_0235217 | |||
| 1638 | Ga0451853_1744520 | |||
| 1639 | Ga0439442_006641 | |||
| 1640 | Ga0439442_034127 | |||
| 1641 | Ga0439445_0000781 | |||
| 1642 | Ga0439445_0059390 | |||
| 1643 | Ga0439448_0000936 | |||
| 1644 | Ga0439448_0040650 | |||
| 1645 | Ga0439448_0043441 | |||
| 1646 | Ga0439432_000148 | |||
| 1647 | Ga0439449_0000404 | |||
| 1648 | Ga0439449_0065930 | |||
| 1649 | Ga0439455_0002098 | |||
| 1650 | Ga0439455_0002979 | |||
| 1651 | Ga0439455_0039678 | |||
| 1652 | Ga0439458_0001035 | |||
| 1653 | Ga0439458_0003163 | |||
| 1654 | Ga0439434_0000989 | |||
| 1655 | Ga0439434_0007665 | |||
| 1656 | Ga0451577_0203403 | |||
| 1657 | Ga0466965_0085185 | |||
| 1658 | Ga0466966_0021309 | |||
| 1659 | Ga0466966_0023777 | |||
| 1660 | Ga0466963_0005372 | |||
| 1661 | Ga0453684_0801468 | |||
| 1662 | Ga0466971_0025908 | |||
| 1663 | Ga0466968_0043036 | |||
| 1664 | Ga0466968_0045930 | |||
| 1665 | Ga0466970_0008610 | |||
| 1666 | Ga0466957_0033293 | |||
| 1667 | Ga0466957_0074212 | |||
| 1668 | Ga0466959_0000648 | |||
| 1669 | Ga0466959_0088190 | |||
| 1670 | Ga0466958_0042755 | |||
| 1671 | Ga0466967_0016678 | |||
| 1672 | Ga0495617_006544 | |||
| 1673 | Ga0495627_043220 | |||
| 1674 | Ga0495629_0338339 | |||
| 1675 | Ga0495638_0001684 | |||
| 1676 | Ga0495638_0010375 | |||
| 1677 | Ga0495638_0225768 | |||
| 1678 | Ga0495650_0000172 | |||
| 1679 | Ga0495584_0124803 | |||
| 1680 | Ga0495607_0012787 | |||
| 1681 | Ga0495607_0029971 | |||
| 1682 | Ga0495583_0000027 | |||
| 1683 | Ga0495583_0002525 | |||
| 1684 | Ga0495583_0004847 | |||
| 1685 | Ga0495583_0011033 | |||
| 1686 | Ga0495606_0000365 | |||
| 1687 | Ga0495606_0005421 | |||
| 1688 | Ga0495606_0263910 | |||
| 1689 | Ga0495610_0009902 | |||
| 1690 | Ga0495631_0005889 | |||
| 1691 | Ga0495631_0048151 | |||
| 1692 | Ga0495637_0083892 | |||
| 1693 | Ga0495643_0000659 | |||
| 1694 | Ga0495643_0009971 | |||
| 1695 | Ga0495643_0017797 | |||
| 1696 | Ga0495643_0120839 | |||
| 1697 | Ga0495648_0000249 | |||
| 1698 | Ga0495663_0001306 | |||
| 1699 | Ga0495663_0001822 | |||
| 1700 | Ga0495663_0010012 | |||
| 1701 | Ga0495642_0007737 | |||
| 1702 | Ga0495654_0004263 | |||
| 1703 | Ga0495621_0002343 | |||
| 1704 | Ga0495621_0117253 | |||
| 1705 | Ga0495622_0019534 | |||
| 1706 | Ga0495633_0000622 | |||
| 1707 | Ga0495633_0051499 | |||
| 1708 | Ga0495668_0000015 | |||
| 1709 | Ga0495668_0000080 | |||
| 1710 | Ga0495668_0007017 | |||
| 1711 | Ga0495668_0058918 | |||
| 1712 | Ga0495668_0147240 | |||
| 1713 | Ga0495611_0053373 | |||
| 1714 | Ga0495625_0000541 | |||
| 1715 | Ga0495625_0000876 | |||
| 1716 | Ga0495625_0006423 | |||
| 1717 | Ga0495625_0009642 | |||
| 1718 | Ga0495625_0080157 | |||
| 1719 | Ga0495625_0135702 | |||
| 1720 | Ga0495625_0166692 | |||
| 1721 | Ga0495625_0168732 | |||
| 1722 | Ga0495661_0030557 | |||
| 1723 | Ga0495669_0000011 | |||
| 1724 | Ga0495670_0000002 | |||
| 1725 | Ga0495670_0038462 | |||
| 1726 | Ga0495670_0039186 | |||
| 1727 | Ga0495670_0173194 | |||
| 1728 | Ga0495671_0034844 | |||
| 1729 | Ga0495649_0104002 | |||
| 1730 | Ga0495600_0204353 | |||
| 1731 | Ga0495672_0000411 | |||
| 1732 | Ga0495683_0019425 | |||
| 1733 | Ga0495687_000082 | |||
| 1734 | Ga0495687_002094 | |||
| 1735 | Ga0495677_0006435 | |||
| 1736 | Ga0495681_0027622 | |||
| 1737 | Ga0495681_0084020 | |||
| 1738 | Ga0495686_0000201 | |||
| 1739 | Ga0495686_0000430 | |||
| 1740 | Ga0495686_0001136 | |||
| 1741 | Ga0495686_0012074 | |||
| 1742 | Ga0495686_0013397 | |||
| 1743 | Ga0495686_0053124 | |||
| 1744 | Ga0495686_0099219 | |||
| 1745 | Ga0495615_0003040 | |||
| 1746 | Ga0496101_0108103 | |||
| 1747 | Ga0496101_0422018 | |||
| 1748 | Ga0496102_0000471 | |||
| 1749 | Ga0496102_0002022 | |||
| 1750 | Ga0496103_0000166 | |||
| 1751 | Ga0496103_0000581 | |||
| 1752 | Ga0496103_0021341 | |||
| 1753 | Ga0496104_0001657 | |||
| 1754 | Ga0496104_0010654 | |||
| 1755 | Ga0496105_0003221 | |||
| 1756 | Ga0496105_0055737 | |||
| 1757 | Ga0496109_0096519 | |||
| 1758 | Ga0496110_0101023 | |||
| 1759 | Ga0496110_0567834 | |||
| 1760 | Ga0496111_0037863 | |||
| 1761 | Ga0496114_0076871 | |||
| 1762 | Ga0496115_0000030 | |||
| 1763 | Ga0496115_0000390 | |||
| 1764 | Ga0496115_0192261 | |||
| 1765 | Ga0496116_0006531 | |||
| 1766 | Ga0496116_0136807 | |||
| 1767 | Ga0496116_0206341 | |||
| 1768 | Ga0496117_0000142 | |||
| 1769 | Ga0496117_0004574 | |||
| 1770 | Ga0496117_0011257 | |||
| 1771 | Ga0496117_0014014 | |||
| 1772 | Ga0496117_0015294 | |||
| 1773 | Ga0496117_0016703 | |||
| 1774 | Ga0496117_0020049 | |||
| 1775 | Ga0496117_0023122 | |||
| 1776 | Ga0496117_0029258 | |||
| 1777 | Ga0496117_0104338 | |||
| 1778 | Ga0496117_0138815 | |||
| 1779 | Ga0496117_0143375 | |||
| 1780 | Ga0496117_0167954 | |||
| 1781 | Ga0496118_0000115 | |||
| 1782 | Ga0496118_0000332 | |||
| 1783 | Ga0496118_0000787 | |||
| 1784 | Ga0496118_0004303 | |||
| 1785 | Ga0496118_0016020 | |||
| 1786 | Ga0496118_0020501 | |||
| 1787 | Ga0496118_0029158 | |||
| 1788 | Ga0496118_0040683 | |||
| 1789 | Ga0496118_0069964 | |||
| 1790 | Ga0496118_0085096 | |||
| 1791 | Ga0496119_0000518 | |||
| 1792 | Ga0496119_0007761 | |||
| 1793 | Ga0496119_0019968 | |||
| 1794 | Ga0496119_0022570 | |||
| 1795 | Ga0496119_0059672 | |||
| 1796 | Ga0496119_0150252 | |||
| 1797 | Ga0496120_0000630 | |||
| 1798 | Ga0496120_0001627 | |||
| 1799 | Ga0496120_0035145 | |||
| 1800 | Ga0496120_0057448 | |||
| 1801 | Ga0496121_0000173 | |||
| 1802 | Ga0496121_0000193 | |||
| 1803 | Ga0496121_0004372 | |||
| 1804 | Ga0496121_0011321 | |||
| 1805 | Ga0496121_0049171 | |||
| 1806 | Ga0496121_0051813 | |||
| 1807 | Ga0496121_0123174 | |||
| 1808 | Ga0496121_0222123 | |||
| 1809 | Ga0496122_0001011 | |||
| 1810 | Ga0496122_0001736 | |||
| 1811 | Ga0496122_0002817 | |||
| 1812 | Ga0496122_0018085 | |||
| 1813 | Ga0496122_0055645 | |||
| 1814 | Ga0496122_0099454 | |||
| 1815 | Ga0496122_0235337 | |||
| 1816 | Ga0496123_0001458 | |||
| 1817 | Ga0496123_0001830 | |||
| 1818 | Ga0496123_0002477 | |||
| 1819 | Ga0496123_0018268 | |||
| 1820 | Ga0496123_0044829 | |||
| 1821 | Ga0496123_0083914 | |||
| 1822 | Ga0496123_0116623 | |||
| 1823 | Ga0496123_0118683 | |||
| 1824 | Ga0496123_0131852 | |||
| 1825 | Ga0496123_0364964 | |||
| 1826 | Ga0496124_0000034 | |||
| 1827 | Ga0496124_0000071 | |||
| 1828 | Ga0496124_0000146 | |||
| 1829 | Ga0496124_0001905 | |||
| 1830 | Ga0496124_0007734 | |||
| 1831 | Ga0496124_0011525 | |||
| 1832 | Ga0496124_0018592 | |||
| 1833 | Ga0496124_0022889 | |||
| 1834 | Ga0496124_0025738 | |||
| 1835 | Ga0496124_0026277 | |||
| 1836 | Ga0496124_0055280 | |||
| 1837 | Ga0496124_0086022 | |||
| 1838 | Ga0496124_0093929 | |||
| 1839 | Ga0496124_0215134 | |||
| 1840 | Ga0496124_0499608 | |||
| 1841 | Ga0496125_0003343 | |||
| 1842 | Ga0496125_0009005 | |||
| 1843 | Ga0496125_0033384 | |||
| 1844 | Ga0496125_0034978 | |||
| 1845 | Ga0496125_0133819 | |||
| 1846 | Ga0496126_0000174 | |||
| 1847 | Ga0496126_0001265 | |||
| 1848 | Ga0496126_0002590 | |||
| 1849 | Ga0496126_0018137 | |||
| 1850 | Ga0496126_0021858 | |||
| 1851 | Ga0496126_0046811 | |||
| 1852 | Ga0496126_0053433 | |||
| 1853 | Ga0496126_0089011 | |||
| 1854 | Ga0495682_0013631 | |||
| 1855 | Ga0501290_000159 | |||
| 1856 | Ga0501292_000020 | |||
| 1857 | Ga0501294_000262 | |||
| 1858 | Ga0501300_007560 | |||
| 1859 | Ga0501032_0075651 | |||
| 1860 | Ga0501033_0008801 | |||
| 1861 | Ga0501033_0010630 | |||
| 1862 | Ga0501033_0037242 | |||
| 1863 | Ga0501034_0059309 | |||
| 1864 | Ga0501034_0070176 | |||
| 1865 | Ga0501034_0077060 | |||
| 1866 | Ga0501034_0098819 | |||
| 1867 | Ga0501034_0445013 | |||
| 1868 | Ga0501037_0073245 | |||
| 1869 | Ga0501039_0015976 | |||
| 1870 | Ga0501042_0501642 | |||
| 1871 | Ga0501043_0206628 | |||
| 1872 | Ga0501046_0049775 | |||
| 1873 | Ga0501047_0029763 | |||
| 1874 | Ga0501047_0141957 | |||
| 1875 | Ga0501206_009913 | |||
| 1876 | Ga0501223_001949 | |||
| 1877 | Ga0501224_006481 | |||
| 1878 | Ga0501235_043515 | |||
| 1879 | Ga0501261_000202 | |||
| 1880 | Ga0501279_000022 | |||
| 1881 | Ga0501280_000035 | |||
| 1882 | Ga0501281_00180 | |||
| 1883 | Ga0501035_0012696 | |||
| 1884 | Ga0501035_0105528 | |||
| 1885 | Ga0501044_0000290 | |||
| 1886 | Ga0501044_0031302 | |||
| 1887 | Ga0501044_0077793 | |||
| 1888 | Ga0501044_0339354 | |||
| 1889 | nmdc:mga03683_1345_c1 | |||
| 1890 | nmdc:mga03683_55_c1 | |||
| 1891 | nmdc:mga03683_9004_c1 | |||
| 1892 | nmdc:mga03n38_9585_c1 | |||
| 1893 | nmdc:mga00v17_10632_c1 | |||
| 1894 | nmdc:mga00v17_1480_c1 | |||
| 1895 | nmdc:mga00v17_16647_c1 | |||
| 1896 | nmdc:mga0k408_253060_c1 | |||
| 1897 | nmdc:mga0k408_63030_c1 | |||
| 1898 | nmdc:mga0k408_6795_c1 | |||
| 1899 | nmdc:mga0k408_7_c1 | |||
| 1900 | nmdc:mga06z11_50364_c1 | |||
| 1901 | nmdc:mga06z11_770_c1 | |||
| 1902 | nmdc:mga04h51_339_c1 | |||
| 1903 | nmdc:mga07m45_1849_c1 | |||
| 1904 | nmdc:mga07m45_205200_c1 | |||
| 1905 | nmdc:mga07m45_237745_c1 | |||
| 1906 | nmdc:mga07m45_33716_c1 | |||
| 1907 | nmdc:mga07m45_35_c1 | |||
| 1908 | nmdc:mga07m45_3_c1 | |||
| 1909 | nmdc:mga0sz30_303_c1 | |||
| 1910 | nmdc:mga0sz30_41_c1 | |||
| 1911 | nmdc:mga0sz30_48235_c1 | |||
| 1912 | Ga0500610_0000413 | |||
| 1913 | Ga0500643_000001 | |||
| 1914 | Ga0500643_001644 | |||
| 1915 | Ga0500643_002547 | |||
| 1916 | Ga0500643_014583 | |||
| 1917 | Ga0500651_0189408 | |||
| 1918 | Ga0500566_0001263 | |||
| 1919 | Ga0500566_0094666 | |||
| 1920 | Ga0500641_0145362 | |||
| 1921 | Ga0500555_001180 | |||
| 1922 | Ga0500592_000329 | |||
| 1923 | Ga0500595_000183 | |||
| 1924 | Ga0500595_001555 | |||
| 1925 | Ga0500595_037817 | |||
| 1926 | Ga0500597_010411 | |||
| 1927 | Ga0500607_000763 | |||
| 1928 | Ga0500608_000074 | |||
| 1929 | Ga0500614_006488 | |||
| 1930 | Ga0500642_0001088 | |||
| 1931 | Ga0500658_0003617 | |||
| 1932 | Ga0500658_0005314 | |||
| 1933 | Ga0500658_0033241 | |||
| 1934 | Ga0500658_0038213 | |||
| 1935 | Ga0500559_0044675 | |||
| 1936 | Ga0500559_0046405 | |||
| 1937 | Ga0500559_0174035 | |||
| 1938 | Ga0500564_000068 | |||
| 1939 | Ga0500568_0000658 | |||
| 1940 | Ga0500573_0000029 | |||
| 1941 | Ga0500590_036659 | |||
| 1942 | Ga0500604_0013629 | |||
| 1943 | Ga0500616_0219494 | |||
| 1944 | Ga0500622_0000119 | |||
| 1945 | Ga0500624_000032 | |||
| 1946 | Ga0500627_0000028 | |||
| 1947 | Ga0500627_0008936 | |||
| 1948 | Ga0500634_0014677 | |||
| 1949 | Ga0500637_0000019 | |||
| 1950 | Ga0500567_024519 | |||
| 1951 | Ga0500611_009750 | |||
| 1952 | Ga0500625_000004 | |||
| 1953 | Ga0500645_000001 | |||
| 1954 | Ga0500645_015016 | |||
| 1955 | Ga0500596_004764 | |||
| 1956 | Ga0466962_0004007 | |||
| 1957 | 2547501642 | |||
| 1958 | 2578456949 | |||
| 1959 | 2600225315 | |||
| 1960 | 2643820304 | |||
| 1961 | 2643834621 | |||
| 1962 | 2644055548 | |||
| 1963 | 2644126180 | |||
| 1964 | 2738710377 | |||
| 1965 | 2738848802 | |||
| 1966 | 2738864531 | |||
| 1967 | 2739297049 | |||
| 1968 | 2739358727 | |||
| 1969 | 2739650622 | |||
| 1970 | 2740029095 | |||
| 1971 | 2747951540 | |||
| 1972 | 2748018780 | |||
| 1973 | 2753767920 | |||
| 1974 | 2765580556 | |||
| 1975 | 2816518421 | |||
| 1976 | 2819661357 | |||
| 1977 | 2819713584 | |||
| 1978 | 2830078749 | |||
| 1979 | 2842394470 | |||
| 1980 | 2842781916 | |||
| 1981 | 2852652101 | |||
| 1982 | 2852656172 | |||
| 1983 | 2852683248 | |||
| 1984 | 2852687227 | |||
| 1985 | 2857444212 | |||
| 1986 | 2874223223 | |||
| 1987 | 2879166297 | |||
| 1988 | 2882808969 | |||
| 1989 | 2885430424 | |||
| 1990 | 2895499889 | |||
| 1991 | 2895512866 | |||
| 1992 | 2895522874 | |||
| 1993 | 2895525354 | |||
| 1994 | 2895882046 | |||
| 1995 | 2896187326 | |||
| 1996 | 2896254210 | |||
| 1997 | 2919092299 | |||
| 1998 | 2919137017 | |||
| 1999 | 2928028720 | |||
| 2000 | 2928100474 | |||
| 2001 | 2928499889 | |||
| 2002 | 2928530114 | |||
| 2003 | 2928960539 | |||
| 2004 | 2928969699 | |||
| 2005 | 2931383341 | |||
| 2006 | 2937614313 | |||
| 2007 | 2939589854 | |||
| 2008 | 2939624971 | |||
| 2009 | 2939629177 | |||
| 2010 | 2941478724 | |||
| 2011 | 2961049987 | |||
| 2012 | 2961064855 | |||
| 2013 | 2974307601 | |||
| 2014 | 2977248312 | |||
| 2015 | 2984517195 | |||
| 2016 | 2984555453 | |||
| 2017 | 2984566410 | |||
| 2018 | 2990265856 | |||
| 2019 | 2993357449 | |||
| 2020 | 2993696353 | |||
| 2021 | 3000867592 | |||
| 2022 | 8002870927 | |||
| 2023 | 8021625520 | |||
| 2024 | 8021628644 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.9364 | 30 | 245 |
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.8596 | 30 | 245 |
| 3dh0-assembly1.cif.gz_A | crystal structure of a sam dependent methyltransferase from aquifex aeolicus | 0.8325 | 50 | 245 |
| 4krg-assembly2.cif.gz_B | semet haemonchus contortus phosphoethanolamine n-methyltransferase 1 in complex with phosphoethanolamine and s-adenosylhomocysteine | 0.8179 | 14 | 167 |
| 3wlf-assembly1.cif.gz_D | crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with (r)-1-phenyl-1,2-ethanediol | 0.8178 | 54 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9818 | 30 | 245 | 3.40.50.150 |
| af_A4IC78_24_256_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9701 | 30 | 245 | 3.40.50.150 |
| af_P9WFR3_19_228_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9645 | 31 | 245 | 3.40.50.150 |
| af_Q9VYF8_68_301_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9643 | 30 | 245 | 3.40.50.150 |
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9556 | 30 | 245 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S0F305-F1-model_v4 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) | 0.9783 | 1 | 244 |
GO:0008425
GO:0031314 GO:0032259 |
| AF-A0A6A5KTX5-F1-model_v4 | deleted | 0.9771 | 1 | 245 |
|
| AF-A0A2E2SF17-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9768 | 2 | 245 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A2G2QYU2-F1-model_v4 | Bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.-) | 0.976 | 32 | 245 |
GO:0008425
GO:0009234 GO:0032259 |
| AF-A0A0C1MTY0-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9759 | 5 | 245 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |