F488162

General Info

Members Datasets Scaffolds Average Seq Length
1012 445 2024 246

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100002770|Ga0068860_10000277011
Length 249
Sequence MTDQTVSFGYEDIASTEKTARVGEVFTSVARSYDLMNDAMSGGMHRLWKDRFVRRLKPRAGETILDMAGGTGDIAFRIAKSGAQVTVSDINPDMLAVGMDRARKKGPENKGLAGLVWSEQNAEALTFPTATFDAYTIAFGIRNVTHVQQALGEAHRVLRRGGRFFCLEFSTTLWPGFADVYDAYSHHIVPRLGKLLANDADSYRYLIESIRRFPDMATFEGMIAKAGFVRTHVEPMLGGLVAIHSGWKI

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
120 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
201 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
202 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
228 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
232 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
235 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
238 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
239 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
240 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
241 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
242 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
258 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
287 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
288 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
289 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
290 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
315 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
316 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
317 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
318 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
329 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
330 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
331 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
332 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
333 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
334 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
335 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
347 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
348 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
349 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
352 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
353 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
354 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
355 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
356 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
357 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
358 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
359 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
360 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
361 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
362 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
363 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
364 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
365 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
366 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
367 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
368 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
369 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
370 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
371 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
372 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
373 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
374 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
375 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
376 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
377 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
378 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
379 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
380 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
381 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
382 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
383 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
384 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
385 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
386 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
387 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
388 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
389 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
390 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
391 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
392 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
393 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
394 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
395 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
396 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
397 2818991457 Xanthomonas translucens 569 Isolate Unclassified
398 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
399 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
400 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
401 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
402 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
403 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
404 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
405 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
406 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
407 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
408 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
409 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
410 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
411 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
412 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
413 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
414 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
415 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
416 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
417 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
418 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
419 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
420 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
421 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
422 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
423 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
424 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
425 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
426 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
427 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
428 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
429 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
430 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
431 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
432 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
433 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
434 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
435 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
436 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
437 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
438 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
439 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
440 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
441 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
442 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
443 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
444 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
445 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.28
Metatranscriptomes 0
Isolates 6.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 19.17
Nodule 0.1
Rhizoplane 2.37
Rhizosphere 63.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100002770 3300005843 Bacteria 18221
2 SwRhRL2b_contig_2092658 2162886007 Bacteria 3968
3 SwRhRL2b_contig_2737664 2162886007 Bacteria 6858
4 SwRhRL2b_contig_582393 2162886007 Bacteria 3266
5 JGI24736J21556_1013858 3300001904 Bacteria 1299
6 JGI24741J21665_1001762 3300001915 Bacteria 5953
7 JGI24739J22299_10002548 3300001989 Bacteria 7028
8 JGI24739J22299_10011332 3300001989 Bacteria 3293
9 JGI24739J22299_10017654 3300001989 Bacteria 2572
10 JGI24737J22298_10004146 3300001990 Bacteria 5068
11 JGI24737J22298_10047037 3300001990 Bacteria 1316
12 JGI24735J21928_10004389 3300002067 Bacteria 4746
13 JGI24735J21928_10005489 3300002067 Bacteria 4206
14 JGI24735J21928_10007628 3300002067 Bacteria 3524
15 JGI24735J21928_10011878 3300002067 Bacteria 2756
16 JGI24735J21928_10022420 3300002067 Bacteria 1922
17 JGI24735J21928_10035929 3300002067 Bacteria 1454
18 JGI24748J21848_1000454 3300002074 Bacteria 4554
19 JGI24738J21930_10000636 3300002075 Bacteria 10127
20 JGI24738J21930_10005673 3300002075 Bacteria 2972
21 JGI24034J26672_10000696 3300002239 Bacteria 4316
22 JGI24742J22300_10019210 3300002244 Bacteria 1160
23 JGI24742J22300_10021347 3300002244 Bacteria 1105
24 JGI25152J39213_1000659 3300002773 Bacteria 18044
25 JGI25150J39212_1000347 3300002774 Bacteria 22719
26 JGI25150J39212_1000465 3300002774 Bacteria 17717
27 JGI25151J46595_10001250 3300003187 Bacteria 18044
28 JGI25151J46595_10029422 3300003187 Bacteria 2175
29 JGI25165J46597_1000094 3300003214 Bacteria 164674
30 JGI25153J46596_10000008 3300003215 Bacteria 376808
31 JGI25153J46596_10000029 3300003215 Bacteria 201658
32 JGI25153J46596_10000903 3300003215 Bacteria 18044
33 rootH1_10093328 3300003316 Bacteria 1204
34 rootH2_10030501 3300003320 Bacteria 3170
35 rootH1_10120080 3300003323 Bacteria 1376
36 Ga0055525_1000063 3300003759 Bacteria 198877
37 Ga0055525_1000064 3300003759 Bacteria 198750
38 Ga0055542_1000795 3300003762 Bacteria 23364
39 Ga0055542_1001337 3300003762 Bacteria 12843
40 Ga0055529_1000037 3300003763 Bacteria 237307
41 Ga0055526_1004964 3300003771 Bacteria 7812
42 Ga0055526_1005847 3300003771 Bacteria 6908
43 Ga0055526_1016035 3300003771 Bacteria 2966
44 Ga0055537_1000403 3300003773 Bacteria 28853
45 Ga0055537_1003251 3300003773 Bacteria 5061
46 Ga0055537_1006067 3300003773 Bacteria 3130
47 Ga0055524_1000410 3300003775 Bacteria 36259
48 Ga0055524_1027333 3300003775 Bacteria 1734
49 Ga0055536_1002521 3300003781 Bacteria 10262
50 Ga0055536_1004416 3300003781 Bacteria 7202
51 Ga0055536_1014951 3300003781 Bacteria 2686
52 Ga0055536_1022199 3300003781 Bacteria 1902
53 Ga0055534_1005664 3300003784 Bacteria 3294
54 Ga0055528_1001877 3300003790 Bacteria 11968
55 Ga0055530_10000005 3300003791 Bacteria 206625
56 Ga0055530_10000409 3300003791 Bacteria 38215
57 Ga0055530_10003696 3300003791 Bacteria 8527
58 Ga0055530_10004768 3300003791 Bacteria 6819
59 Ga0055530_10013230 3300003791 Bacteria 2825
60 Ga0055531_10000009 3300003794 Bacteria 210399
61 Ga0055531_10000687 3300003794 Bacteria 28808
62 Ga0055531_10009392 3300003794 Bacteria 4998
63 Ga0055531_10020213 3300003794 Bacteria 2648
64 Ga0055531_10030079 3300003794 Bacteria 1833
65 Ga0058692_1000053 3300003856 Bacteria 107166
66 Ga0058692_1000370 3300003856 Bacteria 21615
67 Ga0065165_1002223 3300005262 Bacteria 17324
68 Ga0065165_1061613 3300005262 Bacteria 1026
69 Ga0065704_10070413 3300005289 Bacteria 26038
70 Ga0065704_10071247 3300005289 Bacteria 12254
71 Ga0065704_10075189 3300005289 Bacteria 5743
72 Ga0065704_10107595 3300005289 Bacteria 2051
73 Ga0065704_10112030 3300005289 Bacteria 1943
74 Ga0065707_10087869 3300005295 Bacteria 4858
75 Ga0065707_10268188 3300005295 Bacteria 1078
76 Ga0070658_10000703 3300005327 Bacteria 29018
77 Ga0070658_10002141 3300005327 Bacteria 16565
78 Ga0070658_10003377 3300005327 Bacteria 13153
79 Ga0070676_10000747 3300005328 Bacteria 15988
80 Ga0070683_100025777 3300005329 Bacteria 5286
81 Ga0070670_100000016 3300005331 Bacteria 226440
82 Ga0070670_100009550 3300005331 Bacteria 8277
83 Ga0068869_100009489 3300005334 Bacteria 6317
84 Ga0068869_100022149 3300005334 Bacteria 4375
85 Ga0070666_10025171 3300005335 Bacteria 3879
86 Ga0070666_10109106 3300005335 Bacteria 1913
87 Ga0070682_100073849 3300005337 Bacteria 2189
88 Ga0068868_100001464 3300005338 Bacteria 16289
89 Ga0070660_100002482 3300005339 Bacteria 12651
90 Ga0070660_100010090 3300005339 Bacteria 6663
91 Ga0070660_100119026 3300005339 Bacteria 2106
92 Ga0070660_100202413 3300005339 Bacteria 1610
93 Ga0070661_100008555 3300005344 Bacteria 7077
94 Ga0070661_100117772 3300005344 Bacteria 1987
95 Ga0070661_100381566 3300005344 Bacteria 1111
96 Ga0070668_100000927 3300005347 Bacteria 20472
97 Ga0070668_100004618 3300005347 Bacteria 10202
98 Ga0070668_100029440 3300005347 Bacteria 4171
99 Ga0070668_100313957 3300005347 Bacteria 1318
100 Ga0070669_100000776 3300005353 Bacteria 23176
101 Ga0070669_100001504 3300005353 Bacteria 16853
102 Ga0070669_100118590 3300005353 Bacteria 2016
103 Ga0070669_100123844 3300005353 Bacteria 1976
104 Ga0070671_100000829 3300005355 Bacteria 22442
105 Ga0070671_100027240 3300005355 Bacteria 4702
106 Ga0070671_100035619 3300005355 Bacteria 4123
107 Ga0070671_100088883 3300005355 Bacteria 2586
108 Ga0070671_100572422 3300005355 Bacteria 975
109 Ga0070674_100004401 3300005356 Bacteria 8030
110 Ga0070674_100010366 3300005356 Bacteria 5630
111 Ga0070674_100231178 3300005356 Bacteria 1443
112 Ga0070673_100000018 3300005364 Bacteria 110071
113 Ga0070659_100242055 3300005366 Bacteria 1493
114 Ga0070667_100000528 3300005367 Bacteria 38357
115 Ga0070667_100001140 3300005367 Bacteria 24152
116 Ga0070667_100016515 3300005367 Bacteria 6109
117 Ga0070667_100193863 3300005367 Bacteria 1801
118 Ga0070663_100000625 3300005455 Bacteria 18934
119 Ga0070663_100061889 3300005455 Bacteria 2697
120 Ga0070663_100170665 3300005455 Bacteria 1681
121 Ga0070663_100582844 3300005455 Bacteria 939
122 Ga0070678_100007825 3300005456 Bacteria 6358
123 Ga0070678_100055931 3300005456 Bacteria 2883
124 Ga0070662_100000183 3300005457 Bacteria 36515
125 Ga0070662_100002569 3300005457 Bacteria 11185
126 Ga0070662_100037941 3300005457 Bacteria 3419
127 Ga0070681_10004781 3300005458 Bacteria 12980
128 Ga0068867_100001234 3300005459 Bacteria 17608
129 Ga0070679_100001448 3300005530 Bacteria 20991
130 Ga0070684_100160304 3300005535 Bacteria 2041
131 Ga0070684_100733962 3300005535 Bacteria 921
132 Ga0068853_100002487 3300005539 Bacteria 13809
133 Ga0068853_100029337 3300005539 Bacteria 4636
134 Ga0068853_100347654 3300005539 Bacteria 1379
135 Ga0068853_100397668 3300005539 Bacteria 1289
136 Ga0068853_100487548 3300005539 Bacteria 1162
137 Ga0070672_100015740 3300005543 Bacteria 5400
138 Ga0070672_100232606 3300005543 Bacteria 1549
139 Ga0070672_100830901 3300005543 Bacteria 814
140 Ga0070665_100000023 3300005548 Bacteria 375278
141 Ga0070665_100000070 3300005548 Bacteria 200681
142 Ga0070665_100008683 3300005548 Bacteria 10285
143 Ga0070665_100177602 3300005548 Bacteria 2130
144 Ga0070665_100452386 3300005548 Bacteria 1294
145 Ga0070665_100503137 3300005548 Bacteria 1223
146 Ga0068855_100000066 3300005563 Bacteria 125787
147 Ga0068855_100004493 3300005563 Bacteria 17049
148 Ga0068855_100051665 3300005563 Bacteria 4842
149 Ga0068855_100180742 3300005563 Bacteria 2385
150 Ga0068855_100188025 3300005563 Bacteria 2331
151 Ga0068855_100361621 3300005563 Bacteria 1597
152 Ga0070664_100216012 3300005564 Bacteria 1714
153 Ga0068857_100037357 3300005577 Bacteria 4302
154 Ga0068857_100201968 3300005577 Bacteria 1812
155 Ga0068857_100506446 3300005577 Bacteria 1133
156 Ga0068854_100000153 3300005578 Bacteria 47015
157 Ga0068854_100007254 3300005578 Bacteria 7078
158 Ga0068854_100010799 3300005578 Bacteria 5926
159 Ga0068854_100037586 3300005578 Bacteria 3399
160 Ga0068854_100078801 3300005578 Bacteria 2428
161 Ga0068854_100121886 3300005578 Bacteria 1981
162 Ga0068856_100009163 3300005614 Bacteria 9623
163 Ga0068856_100030557 3300005614 Bacteria 5265
164 Ga0068852_100056880 3300005616 Bacteria 3382
165 Ga0068852_100078536 3300005616 Bacteria 2920
166 Ga0068852_100217427 3300005616 Bacteria 1816
167 Ga0068852_100476291 3300005616 Bacteria 1240
168 Ga0068859_100005055 3300005617 Bacteria 13386
169 Ga0068859_100074439 3300005617 Bacteria 3435
170 Ga0068859_100095478 3300005617 Bacteria 3026
171 Ga0068864_100000017 3300005618 Bacteria 285607
172 Ga0068861_100000002 3300005719 Bacteria 111914
173 Ga0068863_100000018 3300005841 Bacteria 206948
174 Ga0068863_100002981 3300005841 Bacteria 16743
175 Ga0068863_100291741 3300005841 Bacteria 1581
176 Ga0068858_100000112 3300005842 Bacteria 86034
177 Ga0068858_100015224 3300005842 Bacteria 7235
178 Ga0068858_100370622 3300005842 Bacteria 1373
179 Ga0068858_100794712 3300005842 Bacteria 923
180 Ga0068860_100004621 3300005843 Bacteria 14059
181 Ga0068860_100042994 3300005843 Bacteria 4312
182 Ga0068860_100128610 3300005843 Bacteria 2429
183 Ga0068860_100452717 3300005843 Bacteria 1276
184 Ga0068860_100535766 3300005843 Bacteria 1172
185 Ga0068862_100000010 3300005844 Bacteria 285607
186 Ga0068862_100000877 3300005844 Bacteria 29301
187 Ga0068862_100001863 3300005844 Bacteria 19097
188 Ga0068862_100007339 3300005844 Bacteria 9155
189 Ga0068862_100076371 3300005844 Bacteria 2899
190 Ga0068862_100090810 3300005844 Bacteria 2659
191 Ga0075365_10106104 3300006038 Bacteria 1927
192 Ga0075368_10000152 3300006042 Bacteria 18566
193 Ga0075363_100000467 3300006048 Bacteria 12681
194 Ga0075363_100002645 3300006048 Bacteria 7386
195 Ga0075364_10020634 3300006051 Bacteria 4146
196 Ga0075362_10000066 3300006177 Bacteria 29420
197 Ga0075362_10000596 3300006177 Bacteria 10593
198 Ga0075362_10009230 3300006177 Bacteria 3806
199 Ga0075362_10075098 3300006177 Bacteria 1550
200 Ga0075367_10007912 3300006178 Bacteria 5478
201 Ga0075367_10079057 3300006178 Bacteria 1987
202 Ga0075369_10021559 3300006186 Bacteria 2649
203 Ga0075369_10070859 3300006186 Bacteria 1534
204 Ga0075366_10000145 3300006195 Bacteria 29884
205 Ga0075366_10007378 3300006195 Bacteria 6069
206 Ga0075366_10011539 3300006195 Bacteria 4989
207 Ga0075366_10028114 3300006195 Bacteria 3299
208 Ga0097621_100009955 3300006237 Bacteria 6930
209 Ga0097621_100212787 3300006237 Bacteria 1682
210 Ga0075370_10000055 3300006353 Bacteria 33979
211 Ga0075370_10004306 3300006353 Bacteria 6891
212 Ga0075370_10008006 3300006353 Bacteria 5418
213 Ga0075370_10037121 3300006353 Bacteria 2739
214 Ga0075370_10269803 3300006353 Bacteria 1010
215 Ga0068871_100042617 3300006358 Bacteria 3645
216 Ga0068865_100000007 3300006881 Bacteria 185316
217 Ga0097620_100005055 3300006931 Bacteria 13386
218 Ga0097620_100074438 3300006931 Bacteria 3435
219 Ga0097620_100095482 3300006931 Bacteria 3026
220 Ga0105251_10000155 3300009011 Bacteria 69872
221 Ga0105251_10002120 3300009011 Bacteria 15958
222 Ga0105251_10002321 3300009011 Bacteria 15063
223 Ga0105251_10003158 3300009011 Bacteria 12211
224 Ga0105244_10011175 3300009036 Bacteria 5405
225 Ga0105244_10049489 3300009036 Bacteria 2147
226 Ga0105250_10099377 3300009092 Bacteria 1187
227 Ga0105240_10030522 3300009093 Bacteria 7005
228 Ga0105240_11213236 3300009093 Bacteria 798
229 Ga0105245_10003037 3300009098 Bacteria 15045
230 Ga0105245_10005071 3300009098 Bacteria 11578
231 Ga0105247_10009791 3300009101 Bacteria 5807
232 Ga0105247_10014568 3300009101 Bacteria 4716
233 Ga0105243_10000221 3300009148 Bacteria 66335
234 Ga0105243_10000264 3300009148 Bacteria 58988
235 Ga0105243_10058114 3300009148 Bacteria 3081
236 Ga0105243_10686186 3300009148 Bacteria 996
237 Ga0105241_10033095 3300009174 Bacteria 3880
238 Ga0105241_10089543 3300009174 Bacteria 2425
239 Ga0105242_10002348 3300009176 Bacteria 14933
240 Ga0105242_10359058 3300009176 Bacteria 1348
241 Ga0105242_10507852 3300009176 Bacteria 1148
242 Ga0105248_10000105 3300009177 Bacteria 94143
243 Ga0105248_10004901 3300009177 Bacteria 14792
244 Ga0105248_10013983 3300009177 Bacteria 8831
245 Ga0105248_10022491 3300009177 Bacteria 6992
246 Ga0105248_10076069 3300009177 Bacteria 3773
247 Ga0105237_10002971 3300009545 Bacteria 20505
248 Ga0105237_10073805 3300009545 Bacteria 3403
249 Ga0105237_10372648 3300009545 Bacteria 1432
250 Ga0105237_10531939 3300009545 Bacteria 1182
251 Ga0105237_10702349 3300009545 Bacteria 1018
252 Ga0105238_10712230 3300009551 Bacteria 1016
253 Ga0105249_10000207 3300009553 Bacteria 67193
254 Ga0105249_10000574 3300009553 Bacteria 33721
255 Ga0105249_10032567 3300009553 Bacteria 4717
256 Ga0105249_10035802 3300009553 Bacteria 4501
257 Ga0105239_10000060 3300010375 Bacteria 155195
258 Ga0105239_10170631 3300010375 Bacteria 2433
259 Ga0105239_10853210 3300010375 Bacteria 1044
260 Ga0105246_10006206 3300011119 Bacteria 7296
261 Ga0157326_1004457 3300012513 Bacteria 1471
262 Ga0157373_10007927 3300013100 Bacteria 7900
263 Ga0157373_10550348 3300013100 Bacteria 837
264 Ga0157371_10000256 3300013102 Bacteria 73768
265 Ga0157371_10001424 3300013102 Bacteria 24845
266 Ga0157371_10002212 3300013102 Bacteria 18831
267 Ga0157371_10059147 3300013102 Bacteria 2717
268 Ga0157371_10160945 3300013102 Bacteria 1603
269 Ga0157371_10228486 3300013102 Bacteria 1337
270 Ga0157371_10335632 3300013102 Bacteria 1099
271 Ga0157370_10001069 3300013104 Bacteria 34283
272 Ga0157370_10012091 3300013104 Bacteria 8981
273 Ga0157370_10266839 3300013104 Bacteria 1582
274 Ga0157370_10455638 3300013104 Bacteria 1176
275 Ga0157369_10005291 3300013105 Bacteria 15039
276 Ga0157369_10242641 3300013105 Bacteria 1882
277 Ga0157369_10428312 3300013105 Bacteria 1371
278 Ga0157374_10015731 3300013296 Bacteria 6644
279 Ga0157374_10016936 3300013296 Bacteria 6415
280 Ga0157374_10151118 3300013296 Bacteria 2258
281 Ga0157378_10004659 3300013297 Bacteria 12028
282 Ga0157378_10046547 3300013297 Bacteria 3856
283 Ga0163162_10021575 3300013306 Bacteria 6344
284 Ga0163162_10024944 3300013306 Bacteria 5906
285 Ga0163162_10118060 3300013306 Bacteria 2754
286 Ga0163162_10163793 3300013306 Bacteria 2347
287 Ga0157372_10004975 3300013307 Bacteria 14115
288 Ga0157372_10014109 3300013307 Bacteria 8533
289 Ga0157372_10026789 3300013307 Bacteria 6275
290 Ga0157372_10075308 3300013307 Bacteria 3808
291 Ga0157372_10112502 3300013307 Bacteria 3119
292 Ga0157372_10167980 3300013307 Bacteria 2537
293 Ga0157372_10514262 3300013307 Bacteria 1396
294 Ga0157372_10778103 3300013307 Bacteria 1112
295 Ga0157372_11100078 3300013307 Bacteria 919
296 Ga0157372_11272541 3300013307 Bacteria 849
297 Ga0157375_10000706 3300013308 Bacteria 29469
298 Ga0157375_10419646 3300013308 Bacteria 1504
299 Ga0163163_10084394 3300014325 Bacteria 3182
300 Ga0157380_10362738 3300014326 Bacteria 1360
301 Ga0182008_10002286 3300014497 Bacteria 12080
302 Ga0182008_10010202 3300014497 Bacteria 5034
303 Ga0157379_10065246 3300014968 Bacteria 3255
304 Ga0157379_10125715 3300014968 Bacteria 2307
305 Ga0157376_10000046 3300014969 Bacteria 109341
306 Ga0182007_10000131 3300015262 Bacteria 52730
307 Ga0182005_1000437 3300015265 Bacteria 22152
308 Ga0182005_1001317 3300015265 Bacteria 10164
309 Ga0183363_1004 3300015690 Bacteria 416766
310 Ga0183361_13433 3300016635 Bacteria 863
311 Ga0163161_10001840 3300017792 Bacteria 15493
312 Ga0163161_10001980 3300017792 Bacteria 14861
313 Ga0209563_100066 3300025230 Bacteria 257382
314 Ga0207427_103136 3300025231 Bacteria 3709
315 Ga0207425_1000041 3300025245 Bacteria 210441
316 Ga0207425_1000064 3300025245 Bacteria 129075
317 Ga0209026_1001795 3300025250 Bacteria 8872
318 Ga0209148_1000011 3300025254 Bacteria 1196503
319 Ga0209148_1000074 3300025254 Bacteria 314356
320 Ga0209148_1001136 3300025254 Bacteria 15574
321 Ga0209129_1000101 3300025258 Bacteria 161931
322 Ga0209129_1001272 3300025258 Bacteria 14424
323 Ga0209233_1000003 3300025261 Bacteria 1607366
324 Ga0209233_1000026 3300025261 Bacteria 678466
325 Ga0209233_1017631 3300025261 Bacteria 1941
326 Ga0209565_1000008 3300025263 Bacteria 774179
327 Ga0209565_1000060 3300025263 Bacteria 188543
328 Ga0209565_1000755 3300025263 Bacteria 19012
329 Ga0209455_1000006 3300025272 Bacteria 1196503
330 Ga0209455_1000985 3300025272 Bacteria 14404
331 Ga0209455_1024569 3300025272 Bacteria 1110
332 Ga0209673_1000047 3300025273 Bacteria 289276
333 Ga0209673_1012801 3300025273 Bacteria 3354
334 Ga0209673_1013903 3300025273 Bacteria 3150
335 Ga0209675_1000007 3300025291 Bacteria 683430
336 Ga0209675_1000564 3300025291 Bacteria 26703
337 Ga0209675_1015297 3300025291 Bacteria 2288
338 Ga0209676_1000018 3300025292 Bacteria 631385
339 Ga0209676_1000132 3300025292 Bacteria 185063
340 Ga0209676_1000146 3300025292 Bacteria 174095
341 Ga0209676_1000411 3300025292 Bacteria 77084
342 Ga0209676_1000620 3300025292 Bacteria 51683
343 Ga0209025_1000048 3300025294 Bacteria 335574
344 Ga0209025_1000654 3300025294 Bacteria 60452
345 Ga0209025_1018129 3300025294 Bacteria 4016
346 Ga0209564_1000252 3300025295 Bacteria 114416
347 Ga0209564_1000565 3300025295 Bacteria 58712
348 Ga0209564_1046617 3300025295 Bacteria 1102
349 Ga0209758_1000004 3300025297 Bacteria 1375322
350 Ga0209758_1000017 3300025297 Bacteria 754393
351 Ga0209758_1000056 3300025297 Bacteria 335574
352 Ga0209050_1000001 3300025298 Bacteria 3563507
353 Ga0209050_1000014 3300025298 Bacteria 774327
354 Ga0209050_1000139 3300025298 Bacteria 173691
355 Ga0209050_1000740 3300025298 Bacteria 47372
356 Ga0209050_1000870 3300025298 Bacteria 40796
357 Ga0209050_1010220 3300025298 Bacteria 4656
358 Ga0209050_1017968 3300025298 Bacteria 2781
359 Ga0209256_1000009 3300025299 Bacteria 922071
360 Ga0209256_1000010 3300025299 Bacteria 912110
361 Ga0209256_1003547 3300025299 Bacteria 10814
362 Ga0209256_1008988 3300025299 Bacteria 4482
363 Ga0209051_1000475 3300025303 Bacteria 52139
364 Ga0209051_1001835 3300025303 Bacteria 16786
365 Ga0209257_1000019 3300025304 Bacteria 774261
366 Ga0209257_1000035 3300025304 Bacteria 631463
367 Ga0209257_1000046 3300025304 Bacteria 477765
368 Ga0209257_1000164 3300025304 Bacteria 173339
369 Ga0209257_1000277 3300025304 Bacteria 114825
370 Ga0209257_1001111 3300025304 Bacteria 34963
371 Ga0209257_1001426 3300025304 Bacteria 28374
372 Ga0209257_1001546 3300025304 Bacteria 26728
373 Ga0209257_1002572 3300025304 Bacteria 17649
374 Ga0209257_1008341 3300025304 Bacteria 5923
375 Ga0209257_1008364 3300025304 Bacteria 5906
376 Ga0209257_1022795 3300025304 Bacteria 2222
377 Ga0209257_1026604 3300025304 Bacteria 1945
378 Ga0207697_10136156 3300025315 Bacteria 1063
379 Ga0207656_10012961 3300025321 Bacteria 3175
380 Ga0207696_1001953 3300025711 Bacteria 10478
381 Ga0207713_1001324 3300025735 Bacteria 20306
382 Ga0207713_1004906 3300025735 Bacteria 8551
383 Ga0207713_1007429 3300025735 Bacteria 6468
384 Ga0207713_1018913 3300025735 Bacteria 3392
385 Ga0207710_10004777 3300025900 Bacteria 5878
386 Ga0207680_10115626 3300025903 Bacteria 1747
387 Ga0207647_10000421 3300025904 Bacteria 34968
388 Ga0207647_10004216 3300025904 Bacteria 10663
389 Ga0207647_10124711 3300025904 Bacteria 1516
390 Ga0207647_10181754 3300025904 Bacteria 1221
391 Ga0207645_10000811 3300025907 Bacteria 26153
392 Ga0207643_10208146 3300025908 Bacteria 1193
393 Ga0207705_10000044 3300025909 Bacteria 180886
394 Ga0207705_10000513 3300025909 Bacteria 33021
395 Ga0207705_10010060 3300025909 Bacteria 6884
396 Ga0207705_10253214 3300025909 Bacteria 1343
397 Ga0207654_10004906 3300025911 Bacteria 6773
398 Ga0207654_10070889 3300025911 Bacteria 2070
399 Ga0207695_10009843 3300025913 Bacteria 11749
400 Ga0207695_10032721 3300025913 Bacteria 5686
401 Ga0207695_10047824 3300025913 Bacteria 4523
402 Ga0207671_10001071 3300025914 Bacteria 33222
403 Ga0207671_10012983 3300025914 Bacteria 6663
404 Ga0207660_10176382 3300025917 Bacteria 1657
405 Ga0207657_10000123 3300025919 Bacteria 77348
406 Ga0207657_10034797 3300025919 Bacteria 4524
407 Ga0207657_10121364 3300025919 Bacteria 2150
408 Ga0207649_10000347 3300025920 Bacteria 35041
409 Ga0207649_10017466 3300025920 Bacteria 4065
410 Ga0207652_10025012 3300025921 Bacteria 4959
411 Ga0207681_10002329 3300025923 Bacteria 12089
412 Ga0207681_10003582 3300025923 Bacteria 9670
413 Ga0207681_10059028 3300025923 Bacteria 2629
414 Ga0207681_10070070 3300025923 Bacteria 2441
415 Ga0207681_10071300 3300025923 Bacteria 2423
416 Ga0207681_10191510 3300025923 Bacteria 1565
417 Ga0207694_10079412 3300025924 Bacteria 2573
418 Ga0207694_10466217 3300025924 Bacteria 1056
419 Ga0207694_10675380 3300025924 Bacteria 871
420 Ga0207650_10000057 3300025925 Bacteria 156913
421 Ga0207650_10001882 3300025925 Bacteria 14815
422 Ga0207650_10052193 3300025925 Bacteria 3028
423 Ga0207659_10380891 3300025926 Bacteria 1176
424 Ga0207687_10002295 3300025927 Bacteria 13027
425 Ga0207687_10041644 3300025927 Bacteria 3155
426 Ga0207644_10004486 3300025931 Bacteria 9064
427 Ga0207644_10006854 3300025931 Bacteria 7422
428 Ga0207644_10225963 3300025931 Bacteria 1486
429 Ga0207690_10003709 3300025932 Bacteria 9080
430 Ga0207690_10015155 3300025932 Bacteria 4668
431 Ga0207690_10041814 3300025932 Bacteria 3006
432 Ga0207690_10044717 3300025932 Bacteria 2921
433 Ga0207690_10073557 3300025932 Bacteria 2364
434 Ga0207690_10193916 3300025932 Bacteria 1538
435 Ga0207706_10000193 3300025933 Bacteria 68202
436 Ga0207706_10005814 3300025933 Bacteria 11472
437 Ga0207706_10028490 3300025933 Bacteria 4988
438 Ga0207706_10035771 3300025933 Bacteria 4413
439 Ga0207706_10089690 3300025933 Bacteria 2703
440 Ga0207706_10219164 3300025933 Bacteria 1666
441 Ga0207706_10398092 3300025933 Bacteria 1194
442 Ga0207686_10002994 3300025934 Bacteria 9113
443 Ga0207709_10000078 3300025935 Bacteria 169141
444 Ga0207709_10000277 3300025935 Bacteria 59636
445 Ga0207709_10000732 3300025935 Bacteria 26258
446 Ga0207709_10007614 3300025935 Bacteria 6009
447 Ga0207669_10000020 3300025937 Bacteria 105051
448 Ga0207669_10003084 3300025937 Bacteria 7176
449 Ga0207704_10000168 3300025938 Bacteria 34759
450 Ga0207691_10006781 3300025940 Bacteria 11041
451 Ga0207691_10141440 3300025940 Bacteria 2120
452 Ga0207711_10000031 3300025941 Bacteria 203323
453 Ga0207711_10020363 3300025941 Bacteria 5530
454 Ga0207711_10020863 3300025941 Bacteria 5468
455 Ga0207711_10116551 3300025941 Bacteria 2382
456 Ga0207689_10005309 3300025942 Bacteria 11544
457 Ga0207689_10043302 3300025942 Bacteria 3722
458 Ga0207679_10032153 3300025945 Bacteria 3680
459 Ga0207667_10000002 3300025949 Bacteria 895662
460 Ga0207667_10000137 3300025949 Bacteria 110326
461 Ga0207667_10002490 3300025949 Bacteria 22955
462 Ga0207667_10014229 3300025949 Bacteria 9076
463 Ga0207667_10339843 3300025949 Bacteria 1532
464 Ga0207667_10635853 3300025949 Bacteria 1074
465 Ga0207651_10000011 3300025960 Bacteria 191950
466 Ga0207651_10317150 3300025960 Bacteria 1302
467 Ga0207712_10000234 3300025961 Bacteria 54386
468 Ga0207712_10000476 3300025961 Bacteria 33733
469 Ga0207712_10003720 3300025961 Bacteria 9628
470 Ga0207668_10000746 3300025972 Bacteria 19869
471 Ga0207668_10003547 3300025972 Bacteria 9173
472 Ga0207668_10017031 3300025972 Bacteria 4547
473 Ga0207668_10247549 3300025972 Bacteria 1446
474 Ga0207668_10288916 3300025972 Bacteria 1348
475 Ga0207640_10000236 3300025981 Bacteria 37779
476 Ga0207640_10013334 3300025981 Bacteria 4706
477 Ga0207640_10018292 3300025981 Bacteria 4115
478 Ga0207640_10029440 3300025981 Bacteria 3371
479 Ga0207640_10032710 3300025981 Bacteria 3227
480 Ga0207640_10037685 3300025981 Bacteria 3044
481 Ga0207640_10741936 3300025981 Bacteria 846
482 Ga0207658_10001382 3300025986 Bacteria 18946
483 Ga0207658_10005000 3300025986 Bacteria 9134
484 Ga0207658_10006307 3300025986 Bacteria 8100
485 Ga0207658_10129351 3300025986 Bacteria 2026
486 Ga0207658_10151910 3300025986 Bacteria 1888
487 Ga0207658_10330590 3300025986 Bacteria 1322
488 Ga0207677_10001007 3300026023 Bacteria 15561
489 Ga0207703_10002992 3300026035 Bacteria 14332
490 Ga0207703_10009901 3300026035 Bacteria 7478
491 Ga0207703_10168040 3300026035 Bacteria 1927
492 Ga0207703_10243230 3300026035 Bacteria 1619
493 Ga0207703_10436676 3300026035 Bacteria 1221
494 Ga0207639_10002135 3300026041 Bacteria 13313
495 Ga0207639_10005268 3300026041 Bacteria 8727
496 Ga0207639_10005755 3300026041 Bacteria 8392
497 Ga0207639_10061557 3300026041 Bacteria 2899
498 Ga0207639_10304378 3300026041 Bacteria 1410
499 Ga0207639_10321808 3300026041 Bacteria 1373
500 Ga0207639_10340890 3300026041 Bacteria 1336
501 Ga0207639_10447372 3300026041 Bacteria 1172
502 Ga0207678_10000946 3300026067 Bacteria 26486
503 Ga0207678_10006261 3300026067 Bacteria 10569
504 Ga0207678_10007535 3300026067 Bacteria 9620
505 Ga0207678_10461650 3300026067 Bacteria 1105
506 Ga0207708_10249196 3300026075 Bacteria 1431
507 Ga0207702_10007234 3300026078 Bacteria 9495
508 Ga0207702_10012593 3300026078 Bacteria 7039
509 Ga0207702_10013929 3300026078 Bacteria 6680
510 Ga0207702_10077753 3300026078 Bacteria 2871
511 Ga0207702_10443618 3300026078 Bacteria 1258
512 Ga0207641_10000002 3300026088 Bacteria 981004
513 Ga0207641_10004191 3300026088 Bacteria 12564
514 Ga0207641_10320210 3300026088 Bacteria 1470
515 Ga0207648_10000047 3300026089 Bacteria 110365
516 Ga0207676_10000005 3300026095 Bacteria 698744
517 Ga0207674_10008601 3300026116 Bacteria 11767
518 Ga0207674_10010604 3300026116 Bacteria 10425
519 Ga0207675_100000021 3300026118 Bacteria 116776
520 Ga0207683_10001150 3300026121 Bacteria 24080
521 Ga0207683_10037334 3300026121 Bacteria 4230
522 Ga0207683_10201812 3300026121 Bacteria 1808
523 Ga0207698_10001045 3300026142 Bacteria 16122
524 Ga0207698_10018394 3300026142 Bacteria 4760
525 Ga0209371_1000018 3300027312 Bacteria 614700
526 Ga0209371_1000025 3300027312 Bacteria 450640
527 Ga0209813_10000082 3300027866 Bacteria 34870
528 Ga0209974_10036797 3300027876 Bacteria 1625
529 Ga0268266_10000002 3300028379 Bacteria 3059047
530 Ga0268266_10001471 3300028379 Bacteria 27988
531 Ga0268266_10002431 3300028379 Bacteria 20016
532 Ga0268266_10033151 3300028379 Bacteria 4392
533 Ga0268266_10142959 3300028379 Bacteria 2148
534 Ga0268266_10162973 3300028379 Bacteria 2018
535 Ga0268265_10000003 3300028380 Bacteria 949201
536 Ga0268265_10000424 3300028380 Bacteria 45348
537 Ga0268265_10007903 3300028380 Bacteria 7177
538 Ga0268265_10036208 3300028380 Bacteria 3613
539 Ga0268264_10001182 3300028381 Bacteria 25302
540 Ga0268264_10031281 3300028381 Bacteria 4364
541 Ga0268264_10045475 3300028381 Bacteria 3644
542 Ga0268264_10062626 3300028381 Bacteria 3124
543 Ga0307517_10018404 3300028786 Bacteria 9039
544 Ga0307517_10251191 3300028786 Bacteria 1037
545 Ga0268256_1000016 3300030500 Bacteria 614700
546 Ga0268256_1000027 3300030500 Bacteria 450640
547 Ga0314311_1075969 3300030733 Bacteria 1772
548 Ga0314311_1115565 3300030733 Bacteria 1167
549 Ga0316183_1110894 3300030742 Bacteria 1126
550 Ga0316183_1164325 3300030742 Bacteria 999
551 Ga0307513_10039689 3300031456 Bacteria 5216
552 Ga0307513_10097114 3300031456 Bacteria 2982
553 Ga0307513_10206471 3300031456 Bacteria 1799
554 Ga0307408_100186371 3300031548 Bacteria 1668
555 Ga0307408_100298772 3300031548 Bacteria 1348
556 Ga0307508_10009433 3300031616 Bacteria 8978
557 Ga0307405_10000445 3300031731 Bacteria 15493
558 Ga0316577_10140284 3300031733 Bacteria 1362
559 Ga0307413_10071278 3300031824 Bacteria 2189
560 Ga0307413_10197001 3300031824 Bacteria 1451
561 Ga0307413_10462187 3300031824 Bacteria 1010
562 Ga0307410_10060998 3300031852 Bacteria 2580
563 Ga0307410_10156661 3300031852 Bacteria 1702
564 Ga0307406_10079342 3300031901 Bacteria 2177
565 Ga0307412_10003432 3300031911 Bacteria 8806
566 Ga0307412_10005593 3300031911 Bacteria 7055
567 Ga0307412_10016843 3300031911 Bacteria 4365
568 Ga0307412_10048784 3300031911 Bacteria 2786
569 Ga0307412_10052199 3300031911 Bacteria 2706
570 Ga0307412_10070245 3300031911 Bacteria 2386
571 Ga0307412_10239243 3300031911 Bacteria 1403
572 Ga0307412_10247267 3300031911 Bacteria 1383
573 Ga0307412_10399278 3300031911 Bacteria 1119
574 Ga0307412_10413221 3300031911 Bacteria 1102
575 Ga0307409_100207365 3300031995 Bacteria 1759
576 Ga0307409_100857467 3300031995 Bacteria 919
577 Ga0307414_10000251 3300032004 Bacteria 33637
578 Ga0307414_10001515 3300032004 Bacteria 12072
579 Ga0307414_10004650 3300032004 Bacteria 7475
580 Ga0307414_10007830 3300032004 Bacteria 6028
581 Ga0307414_10015078 3300032004 Bacteria 4656
582 Ga0307414_10020297 3300032004 Bacteria 4139
583 Ga0307414_10031336 3300032004 Bacteria 3487
584 Ga0307414_10044838 3300032004 Bacteria 3024
585 Ga0307414_10087909 3300032004 Bacteria 2298
586 Ga0307414_10157139 3300032004 Bacteria 1802
587 Ga0307414_10176111 3300032004 Bacteria 1715
588 Ga0307414_10347958 3300032004 Bacteria 1271
589 Ga0307414_10394476 3300032004 Bacteria 1200
590 Ga0307414_10503390 3300032004 Bacteria 1072
591 Ga0307411_10078383 3300032005 Bacteria 2265
592 Ga0307411_10316030 3300032005 Bacteria 1259
593 Ga0307411_10464123 3300032005 Bacteria 1062
594 Ga0307415_100030269 3300032126 Bacteria 3472
595 Ga0307510_10001089 3300033180 Bacteria 28935
596 Ga0373923_0123256 3300035111 Bacteria 1160
597 Ga0373923_0248307 3300035111 Bacteria 832
598 Ga0316574_0165096 3300035398 Bacteria 1426
599 Ga0373931_0165440 3300035691 Bacteria 1299
600 Ga0316582_0043273 3300036647 Bacteria 2824
601 Ga0395899_0009504 3300037312 Bacteria 7461
602 Ga0395899_0036920 3300037312 Bacteria 3664
603 Ga0395900_0039298 3300037418 Bacteria 4875
604 Ga0395900_0069449 3300037418 Bacteria 3621
605 Ga0395900_0171035 3300037418 Bacteria 2212
606 Ga0395905_0013942 3300037471 Bacteria 7687
607 Ga0395905_0161200 3300037471 Bacteria 2108
608 Ga0395905_0248194 3300037471 Bacteria 1663
609 Ga0436364_0184827 3300037853 Bacteria 146498
610 Ga0436364_0296893 3300037853 Bacteria 967
611 Ga0237819_00128 3300038705 Bacteria 28583
612 Ga0436365_0341898 3300039437 Bacteria 1545
613 Ga0436365_1628748 3300039437 Bacteria 1523
614 Ga0439436_0008965 3300041404 Bacteria 3070
615 Ga0439439_0006402 3300041406 Bacteria 2723
616 Ga0439461_0000103 3300041410 Bacteria 11142
617 Ga0439461_0015624 3300041410 Bacteria 1456
618 Ga0439465_0000289 3300041413 Bacteria 14190
619 Ga0439465_0004367 3300041413 Bacteria 4577
620 Ga0451797_0789101 3300041453 Bacteria 1764
621 Ga0451806_635767 3300041462 Bacteria 2649
622 Ga0451807_1567495 3300041486 Bacteria 1708
623 Ga0451807_2581624 3300041486 Bacteria 1206
624 Ga0451837_1421368 3300041494 Bacteria 3026
625 Ga0451841_0235217 3300041498 Bacteria 3061
626 Ga0451853_1744520 3300041512 Bacteria 2027
627 Ga0439442_006641 3300042002 Bacteria 2323
628 Ga0439442_034127 3300042002 Bacteria 1064
629 Ga0439445_0000781 3300042004 Bacteria 6688
630 Ga0439445_0059390 3300042004 Bacteria 1043
631 Ga0439448_0000936 3300042005 Bacteria 7186
632 Ga0439448_0040650 3300042005 Bacteria 1502
633 Ga0439448_0043441 3300042005 Bacteria 1459
634 Ga0439432_000148 3300042006 Bacteria 23778
635 Ga0439449_0000404 3300042007 Bacteria 16023
636 Ga0439449_0065930 3300042007 Bacteria 1335
637 Ga0439455_0002098 3300042012 Bacteria 3551
638 Ga0439455_0002979 3300042012 Bacteria 3175
639 Ga0439455_0039678 3300042012 Bacteria 1201
640 Ga0439458_0001035 3300042157 Bacteria 7103
641 Ga0439458_0003163 3300042157 Bacteria 3902
642 Ga0439434_0000989 3300042435 Bacteria 8197
643 Ga0439434_0007665 3300042435 Bacteria 3163
644 Ga0451577_0203403 3300042876 Bacteria 1788
645 Ga0466965_0085185 3300044683 Bacteria 1602
646 Ga0466966_0021309 3300044684 Bacteria 4256
647 Ga0466966_0023777 3300044684 Bacteria 4010
648 Ga0466963_0005372 3300044694 Bacteria 7499
649 Ga0453684_0801468 3300044712 Bacteria 1016
650 Ga0466971_0025908 3300044719 Bacteria 2619
651 Ga0466968_0043036 3300044735 Bacteria 1910
652 Ga0466968_0045930 3300044735 Bacteria 1855
653 Ga0466970_0008610 3300044765 Bacteria 5138
654 Ga0466957_0033293 3300044842 Bacteria 3091
655 Ga0466957_0074212 3300044842 Bacteria 2109
656 Ga0466959_0000648 3300045049 Bacteria 20299
657 Ga0466959_0088190 3300045049 Bacteria 2230
658 Ga0466958_0042755 3300045836 Bacteria 2729
659 Ga0466967_0016678 3300045976 Bacteria 5801
660 Ga0495617_006544 3300046452 Bacteria 4079
661 Ga0495627_043220 3300046453 Bacteria 1378
662 Ga0495629_0338339 3300046459 Bacteria 1028
663 Ga0495638_0001684 3300046460 Bacteria 19543
664 Ga0495638_0010375 3300046460 Bacteria 6475
665 Ga0495638_0225768 3300046460 Bacteria 1044
666 Ga0495650_0000172 3300046471 Bacteria 142776
667 Ga0495584_0124803 3300046491 Bacteria 1304
668 Ga0495607_0012787 3300046501 Bacteria 5522
669 Ga0495607_0029971 3300046501 Bacteria 3345
670 Ga0495583_0000027 3300046506 Bacteria 256299
671 Ga0495583_0002525 3300046506 Bacteria 15492
672 Ga0495583_0004847 3300046506 Bacteria 9408
673 Ga0495583_0011033 3300046506 Bacteria 5210
674 Ga0495606_0000365 3300046507 Bacteria 77476
675 Ga0495606_0005421 3300046507 Bacteria 12223
676 Ga0495606_0263910 3300046507 Bacteria 949
677 Ga0495610_0009902 3300046512 Bacteria 5966
678 Ga0495631_0005889 3300046518 Bacteria 6389
679 Ga0495631_0048151 3300046518 Bacteria 1870
680 Ga0495637_0083892 3300046520 Bacteria 1266
681 Ga0495643_0000659 3300046522 Bacteria 40777
682 Ga0495643_0009971 3300046522 Bacteria 5868
683 Ga0495643_0017797 3300046522 Bacteria 4145
684 Ga0495643_0120839 3300046522 Bacteria 1323
685 Ga0495648_0000249 3300046524 Bacteria 60793
686 Ga0495663_0001306 3300046525 Bacteria 7894
687 Ga0495663_0001822 3300046525 Bacteria 6582
688 Ga0495663_0010012 3300046525 Bacteria 2631
689 Ga0495642_0007737 3300046528 Bacteria 4118
690 Ga0495654_0004263 3300046530 Bacteria 8544
691 Ga0495621_0002343 3300046539 Bacteria 5090
692 Ga0495621_0117253 3300046539 Bacteria 1026
693 Ga0495622_0019534 3300046557 Bacteria 3154
694 Ga0495633_0000622 3300046558 Bacteria 33329
695 Ga0495633_0051499 3300046558 Bacteria 1939
696 Ga0495668_0000015 3300046616 Bacteria 441932
697 Ga0495668_0000080 3300046616 Bacteria 157259
698 Ga0495668_0007017 3300046616 Bacteria 7272
699 Ga0495668_0058918 3300046616 Bacteria 2119
700 Ga0495668_0147240 3300046616 Bacteria 1289
701 Ga0495611_0053373 3300046648 Bacteria 1824
702 Ga0495625_0000541 3300046660 Bacteria 55446
703 Ga0495625_0000876 3300046660 Bacteria 40885
704 Ga0495625_0006423 3300046660 Bacteria 10467
705 Ga0495625_0009642 3300046660 Bacteria 8051
706 Ga0495625_0080157 3300046660 Bacteria 2274
707 Ga0495625_0135702 3300046660 Bacteria 1663
708 Ga0495625_0166692 3300046660 Bacteria 1472
709 Ga0495625_0168732 3300046660 Bacteria 1462
710 Ga0495661_0030557 3300046665 Bacteria 3429
711 Ga0495669_0000011 3300046684 Bacteria 158720
712 Ga0495670_0000002 3300046691 Bacteria 601814
713 Ga0495670_0038462 3300046691 Bacteria 2385
714 Ga0495670_0039186 3300046691 Bacteria 2363
715 Ga0495670_0173194 3300046691 Bacteria 1137
716 Ga0495671_0034844 3300046692 Bacteria 2558
717 Ga0495649_0104002 3300046694 Bacteria 1508
718 Ga0495600_0204353 3300046809 Bacteria 1267
719 Ga0495672_0000411 3300047320 Bacteria 51888
720 Ga0495683_0019425 3300047323 Bacteria 3507
721 Ga0495687_000082 3300047443 Bacteria 147137
722 Ga0495687_002094 3300047443 Bacteria 16772
723 Ga0495677_0006435 3300047445 Bacteria 4439
724 Ga0495681_0027622 3300047470 Bacteria 2932
725 Ga0495681_0084020 3300047470 Bacteria 1416
726 Ga0495686_0000201 3300047472 Bacteria 110982
727 Ga0495686_0000430 3300047472 Bacteria 65300
728 Ga0495686_0001136 3300047472 Bacteria 31452
729 Ga0495686_0012074 3300047472 Bacteria 6066
730 Ga0495686_0013397 3300047472 Bacteria 5689
731 Ga0495686_0053124 3300047472 Bacteria 2540
732 Ga0495686_0099219 3300047472 Bacteria 1758
733 Ga0495615_0003040 3300048090 Bacteria 2771
734 Ga0496101_0108103 3300048904 Bacteria 2090
735 Ga0496101_0422018 3300048904 Bacteria 1051
736 Ga0496102_0000471 3300048905 Bacteria 44758
737 Ga0496102_0002022 3300048905 Bacteria 17516
738 Ga0496103_0000166 3300048906 Bacteria 69117
739 Ga0496103_0000581 3300048906 Bacteria 28917
740 Ga0496103_0021341 3300048906 Bacteria 3895
741 Ga0496104_0001657 3300048907 Bacteria 19233
742 Ga0496104_0010654 3300048907 Bacteria 8217
743 Ga0496105_0003221 3300048908 Bacteria 12024
744 Ga0496105_0055737 3300048908 Bacteria 3263
745 Ga0496109_0096519 3300048912 Bacteria 2739
746 Ga0496110_0101023 3300048913 Bacteria 2585
747 Ga0496110_0567834 3300048913 Bacteria 1030
748 Ga0496111_0037863 3300048914 Bacteria 3453
749 Ga0496114_0076871 3300048917 Bacteria 2814
750 Ga0496115_0000030 3300048918 Bacteria 138328
751 Ga0496115_0000390 3300048918 Bacteria 36134
752 Ga0496115_0192261 3300048918 Bacteria 1686
753 Ga0496116_0006531 3300048919 Bacteria 10566
754 Ga0496116_0136807 3300048919 Bacteria 1385
755 Ga0496116_0206341 3300048919 Bacteria 1023
756 Ga0496117_0000142 3300048920 Bacteria 157953
757 Ga0496117_0004574 3300048920 Bacteria 15136
758 Ga0496117_0011257 3300048920 Bacteria 8029
759 Ga0496117_0014014 3300048920 Bacteria 6938
760 Ga0496117_0015294 3300048920 Bacteria 6550
761 Ga0496117_0016703 3300048920 Bacteria 6173
762 Ga0496117_0020049 3300048920 Bacteria 5468
763 Ga0496117_0023122 3300048920 Bacteria 4965
764 Ga0496117_0029258 3300048920 Bacteria 4250
765 Ga0496117_0104338 3300048920 Bacteria 1784
766 Ga0496117_0138815 3300048920 Bacteria 1459
767 Ga0496117_0143375 3300048920 Bacteria 1426
768 Ga0496117_0167954 3300048920 Bacteria 1277
769 Ga0496118_0000115 3300048921 Bacteria 146533
770 Ga0496118_0000332 3300048921 Bacteria 80480
771 Ga0496118_0000787 3300048921 Bacteria 50784
772 Ga0496118_0004303 3300048921 Bacteria 17009
773 Ga0496118_0016020 3300048921 Bacteria 6902
774 Ga0496118_0020501 3300048921 Bacteria 5857
775 Ga0496118_0029158 3300048921 Bacteria 4633
776 Ga0496118_0040683 3300048921 Bacteria 3693
777 Ga0496118_0069964 3300048921 Bacteria 2537
778 Ga0496118_0085096 3300048921 Bacteria 2203
779 Ga0496119_0000518 3300048922 Bacteria 52520
780 Ga0496119_0007761 3300048922 Bacteria 9570
781 Ga0496119_0019968 3300048922 Bacteria 4907
782 Ga0496119_0022570 3300048922 Bacteria 4497
783 Ga0496119_0059672 3300048922 Bacteria 2290
784 Ga0496119_0150252 3300048922 Bacteria 1249
785 Ga0496120_0000630 3300048923 Bacteria 52559
786 Ga0496120_0001627 3300048923 Bacteria 26035
787 Ga0496120_0035145 3300048923 Bacteria 2996
788 Ga0496120_0057448 3300048923 Bacteria 2189
789 Ga0496121_0000173 3300048924 Bacteria 143397
790 Ga0496121_0000193 3300048924 Bacteria 136526
791 Ga0496121_0004372 3300048924 Bacteria 19102
792 Ga0496121_0011321 3300048924 Bacteria 9926
793 Ga0496121_0049171 3300048924 Bacteria 3579
794 Ga0496121_0051813 3300048924 Bacteria 3453
795 Ga0496121_0123174 3300048924 Bacteria 1954
796 Ga0496121_0222123 3300048924 Bacteria 1330
797 Ga0496122_0001011 3300048925 Bacteria 49773
798 Ga0496122_0001736 3300048925 Bacteria 33820
799 Ga0496122_0002817 3300048925 Bacteria 23835
800 Ga0496122_0018085 3300048925 Bacteria 6532
801 Ga0496122_0055645 3300048925 Bacteria 2957
802 Ga0496122_0099454 3300048925 Bacteria 1950
803 Ga0496122_0235337 3300048925 Bacteria 1037
804 Ga0496123_0001458 3300048926 Bacteria 32935
805 Ga0496123_0001830 3300048926 Bacteria 27941
806 Ga0496123_0002477 3300048926 Bacteria 22792
807 Ga0496123_0018268 3300048926 Bacteria 5584
808 Ga0496123_0044829 3300048926 Bacteria 3020
809 Ga0496123_0083914 3300048926 Bacteria 1924
810 Ga0496123_0116623 3300048926 Bacteria 1512
811 Ga0496123_0118683 3300048926 Bacteria 1493
812 Ga0496123_0131852 3300048926 Bacteria 1382
813 Ga0496123_0364964 3300048926 Bacteria 667
814 Ga0496124_0000034 3300048927 Bacteria 325332
815 Ga0496124_0000071 3300048927 Bacteria 220642
816 Ga0496124_0000146 3300048927 Bacteria 146468
817 Ga0496124_0001905 3300048927 Bacteria 28630
818 Ga0496124_0007734 3300048927 Bacteria 11361
819 Ga0496124_0011525 3300048927 Bacteria 8824
820 Ga0496124_0018592 3300048927 Bacteria 6504
821 Ga0496124_0022889 3300048927 Bacteria 5720
822 Ga0496124_0025738 3300048927 Bacteria 5321
823 Ga0496124_0026277 3300048927 Bacteria 5254
824 Ga0496124_0055280 3300048927 Bacteria 3355
825 Ga0496124_0086022 3300048927 Bacteria 2574
826 Ga0496124_0093929 3300048927 Bacteria 2440
827 Ga0496124_0215134 3300048927 Bacteria 1450
828 Ga0496124_0499608 3300048927 Bacteria 816
829 Ga0496125_0003343 3300048928 Bacteria 19548
830 Ga0496125_0009005 3300048928 Bacteria 10344
831 Ga0496125_0033384 3300048928 Bacteria 4554
832 Ga0496125_0034978 3300048928 Bacteria 4418
833 Ga0496125_0133819 3300048928 Bacteria 1738
834 Ga0496126_0000174 3300048929 Bacteria 146468
835 Ga0496126_0001265 3300048929 Bacteria 40729
836 Ga0496126_0002590 3300048929 Bacteria 24120
837 Ga0496126_0018137 3300048929 Bacteria 6985
838 Ga0496126_0021858 3300048929 Bacteria 6241
839 Ga0496126_0046811 3300048929 Bacteria 3963
840 Ga0496126_0053433 3300048929 Bacteria 3665
841 Ga0496126_0089011 3300048929 Bacteria 2718
842 Ga0495682_0013631 3300049460 Bacteria 3092
843 Ga0501290_000159 3300049513 Bacteria 10830
844 Ga0501292_000020 3300049515 Bacteria 54099
845 Ga0501294_000262 3300049517 Bacteria 6516
846 Ga0501300_007560 3300049523 Bacteria 1593
847 Ga0501032_0075651 3300049569 Bacteria 2242
848 Ga0501033_0008801 3300049570 Bacteria 7804
849 Ga0501033_0010630 3300049570 Bacteria 7057
850 Ga0501033_0037242 3300049570 Bacteria 3642
851 Ga0501034_0059309 3300049571 Bacteria 3844
852 Ga0501034_0070176 3300049571 Bacteria 3515
853 Ga0501034_0077060 3300049571 Bacteria 3340
854 Ga0501034_0098819 3300049571 Bacteria 2914
855 Ga0501034_0445013 3300049571 Bacteria 1214
856 Ga0501037_0073245 3300049573 Bacteria 2490
857 Ga0501039_0015976 3300049575 Bacteria 5748
858 Ga0501042_0501642 3300049578 Bacteria 881
859 Ga0501043_0206628 3300049579 Bacteria 1522
860 Ga0501046_0049775 3300049580 Bacteria 3314
861 Ga0501047_0029763 3300049581 Bacteria 5263
862 Ga0501047_0141957 3300049581 Bacteria 2280
863 Ga0501206_009913 3300049653 Bacteria 1270
864 Ga0501223_001949 3300049663 Bacteria 4641
865 Ga0501224_006481 3300049664 Bacteria 1697
866 Ga0501235_043515 3300049669 Bacteria 1031
867 Ga0501261_000202 3300049690 Bacteria 8467
868 Ga0501279_000022 3300049775 Bacteria 54370
869 Ga0501280_000035 3300049776 Bacteria 40433
870 Ga0501281_00180 3300049777 Bacteria 7296
871 Ga0501035_0012696 3300049822 Bacteria 7783
872 Ga0501035_0105528 3300049822 Bacteria 2470
873 Ga0501044_0000290 3300049823 Bacteria 63934
874 Ga0501044_0031302 3300049823 Bacteria 5601
875 Ga0501044_0077793 3300049823 Bacteria 3363
876 Ga0501044_0339354 3300049823 Bacteria 1424
877 nmdc:mga03683_1345_c1 3300050489 Bacteria 7284
878 nmdc:mga03683_55_c1 3300050489 Bacteria 47333
879 nmdc:mga03683_9004_c1 3300050489 Bacteria 1737
880 nmdc:mga03n38_9585_c1 3300050490 Bacteria 3529
881 nmdc:mga00v17_10632_c1 3300050491 Bacteria 5033
882 nmdc:mga00v17_1480_c1 3300050491 Bacteria 12287
883 nmdc:mga00v17_16647_c1 3300050491 Bacteria 4146
884 nmdc:mga0k408_253060_c1 3300050493 Bacteria 1052
885 nmdc:mga0k408_63030_c1 3300050493 Bacteria 2156
886 nmdc:mga0k408_6795_c1 3300050493 Bacteria 6101
887 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
888 nmdc:mga06z11_50364_c1 3300050494 Bacteria 2128
889 nmdc:mga06z11_770_c1 3300050494 Bacteria 11686
890 nmdc:mga04h51_339_c1 3300050495 Bacteria 11749
891 nmdc:mga07m45_1849_c1 3300050496 Bacteria 9777
892 nmdc:mga07m45_205200_c1 3300050496 Bacteria 1146
893 nmdc:mga07m45_237745_c1 3300050496 Bacteria 1060
894 nmdc:mga07m45_33716_c1 3300050496 Bacteria 2844
895 nmdc:mga07m45_35_c1 3300050496 Bacteria 74486
896 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
897 nmdc:mga0sz30_303_c1 3300050516 Bacteria 18938
898 nmdc:mga0sz30_41_c1 3300050516 Bacteria 46173
899 nmdc:mga0sz30_48235_c1 3300050516 Bacteria 1801
900 Ga0500610_0000413 3300053079 Bacteria 13122
901 Ga0500643_000001 3300053087 Bacteria 1440111
902 Ga0500643_001644 3300053087 Bacteria 12495
903 Ga0500643_002547 3300053087 Bacteria 9301
904 Ga0500643_014583 3300053087 Bacteria 2725
905 Ga0500651_0189408 3300053093 Bacteria 1218
906 Ga0500566_0001263 3300053094 Bacteria 14752
907 Ga0500566_0094666 3300053094 Bacteria 1646
908 Ga0500641_0145362 3300053096 Bacteria 1024
909 Ga0500555_001180 3300053103 Bacteria 8567
910 Ga0500592_000329 3300053116 Bacteria 8061
911 Ga0500595_000183 3300053119 Bacteria 42685
912 Ga0500595_001555 3300053119 Bacteria 12143
913 Ga0500595_037817 3300053119 Bacteria 1572
914 Ga0500597_010411 3300053120 Bacteria 3319
915 Ga0500607_000763 3300053121 Bacteria 30989
916 Ga0500608_000074 3300053122 Bacteria 42636
917 Ga0500614_006488 3300053123 Bacteria 2461
918 Ga0500642_0001088 3300053130 Bacteria 7802
919 Ga0500658_0003617 3300053134 Bacteria 5830
920 Ga0500658_0005314 3300053134 Bacteria 4788
921 Ga0500658_0033241 3300053134 Bacteria 2027
922 Ga0500658_0038213 3300053134 Bacteria 1912
923 Ga0500559_0044675 3300053136 Bacteria 1938
924 Ga0500559_0046405 3300053136 Bacteria 1905
925 Ga0500559_0174035 3300053136 Bacteria 1013
926 Ga0500564_000068 3300053138 Bacteria 27518
927 Ga0500568_0000658 3300053139 Bacteria 24979
928 Ga0500573_0000029 3300053140 Bacteria 135595
929 Ga0500590_036659 3300053148 Bacteria 2535
930 Ga0500604_0013629 3300053151 Bacteria 2205
931 Ga0500616_0219494 3300053153 Bacteria 830
932 Ga0500622_0000119 3300053156 Bacteria 82219
933 Ga0500624_000032 3300053157 Bacteria 104403
934 Ga0500627_0000028 3300053158 Bacteria 99118
935 Ga0500627_0008936 3300053158 Bacteria 3584
936 Ga0500634_0014677 3300053161 Bacteria 4137
937 Ga0500637_0000019 3300053178 Bacteria 65170
938 Ga0500567_024519 3300053723 Bacteria 2883
939 Ga0500611_009750 3300053727 Bacteria 1533
940 Ga0500625_000004 3300053729 Bacteria 245905
941 Ga0500645_000001 3300053730 Bacteria 455558
942 Ga0500645_015016 3300053730 Bacteria 2460
943 Ga0500596_004764 3300053735 Bacteria 2454
944 Ga0466962_0004007 3300061719 Bacteria 7054
945 2547501642 2547132130 Bacteria 4660562
946 2578456949 2576861471 Bacteria 4648976
947 2600225315 2599185359 Bacteria 4772316
948 2643820304 2643221560 Bacteria 4801179
949 2643834621 2643221563 Bacteria 4726935
950 2644055548 2643221608 Bacteria 4724829
951 2644126180 2643221622 Bacteria 4212502
952 2738710377 2738541275 Bacteria 4830863
953 2738848802 2738541301 Bacteria 4834102
954 2738864531 2738541304 Bacteria 4833665
955 2739297049 2738543022 Bacteria 4835059
956 2739358727 2738543033 Bacteria 4833336
957 2739650622 2739367664 Bacteria 4114334
958 2740029095 2739367865 Bacteria 4114482
959 2747951540 2747842428 Bacteria 4689383
960 2748018780 2747842501 Bacteria 5293829
961 2753767920 2751185897 Bacteria 5322941
962 2765580556 2765235840 Bacteria 4663337
963 2816518421 2816332141 Bacteria 4436036
964 2819661357 2818991457 Bacteria 5323295
965 2819713584 2818991466 Bacteria 4748179
966 2830078749 2830075706 Bacteria 3855215
967 2842394470 2842391507 Bacteria 4486072
968 2842781916 2842780639 Bacteria 4337790
969 2852652101 2852649853 Bacteria 4036942
970 2852656172 2852653556 Bacteria 4050083
971 2852683248 2852680915 Bacteria 4100189
972 2852687227 2852684882 Bacteria 5463342
973 2857444212 2857442823 Bacteria 4562550
974 2874223223 2874220319 Bacteria 4594709
975 2879166297 2879163058 Bacteria 4223965
976 2882808969 2882806704 Bacteria 3007728
977 2885430424 2885429604 Bacteria 3642894
978 2895499889 2895498888 Bacteria 5283788
979 2895512866 2895511927 Bacteria 6802080
980 2895522874 2895522137 Bacteria 3284416
981 2895525354 2895525241 Bacteria 3388457
982 2895882046 2895880812 Bacteria 11255272
983 2896187326 2896184354 Bacteria 3258548
984 2896254210 2896253425 Bacteria 3418029
985 2919092299 2919089067 Bacteria 4560942
986 2919137017 2919134579 Bacteria 4480386
987 2928028720 2928027323 Bacteria 4382488
988 2928100474 2928100450 Bacteria 4837635
989 2928499889 2928496128 Bacteria 4631123
990 2928530114 2928526807 Bacteria 4760224
991 2928960539 2928959182 Bacteria 4725774
992 2928969699 2928968154 Bacteria 4633371
993 2931383341 2931380184 Bacteria 4455911
994 2937614313 2937610967 Bacteria 4618818
995 2939589854 2939589442 Bacteria 4214238
996 2939624971 2939622612 Bacteria 4698046
997 2939629177 2939626828 Bacteria 4695272
998 2941478724 2941475908 Bacteria 4145589
999 2961049987 2961047084 Bacteria 4594415
1000 2961064855 2961064222 Bacteria 4749990
1001 2974307601 2974307012 Bacteria 4172388
1002 2977248312 2977247770 Bacteria 4160543
1003 2984517195 2984514374 Bacteria 4172479
1004 2984555453 2984555340 Bacteria 4247089
1005 2984566410 2984564862 Bacteria 4339992
1006 2990265856 2990265787 Bacteria 3943888
1007 2993357449 2993356040 Bacteria 4247105
1008 2993696353 2993693658 Bacteria 4040749
1009 3000867592 3000865235 Bacteria 3106258
1010 8002870927 8002869464 Bacteria 3588529
1011 8021625520 8021622325 Bacteria 4844743
1012 8021628644 8021626552 Bacteria 4665214
1013 Ga0068860_100002770
1014 SwRhRL2b_contig_2092658
1015 SwRhRL2b_contig_2737664
1016 SwRhRL2b_contig_582393
1017 JGI24736J21556_1013858
1018 JGI24741J21665_1001762
1019 JGI24739J22299_10002548
1020 JGI24739J22299_10011332
1021 JGI24739J22299_10017654
1022 JGI24737J22298_10004146
1023 JGI24737J22298_10047037
1024 JGI24735J21928_10004389
1025 JGI24735J21928_10005489
1026 JGI24735J21928_10007628
1027 JGI24735J21928_10011878
1028 JGI24735J21928_10022420
1029 JGI24735J21928_10035929
1030 JGI24748J21848_1000454
1031 JGI24738J21930_10000636
1032 JGI24738J21930_10005673
1033 JGI24034J26672_10000696
1034 JGI24742J22300_10019210
1035 JGI24742J22300_10021347
1036 JGI25152J39213_1000659
1037 JGI25150J39212_1000347
1038 JGI25150J39212_1000465
1039 JGI25151J46595_10001250
1040 JGI25151J46595_10029422
1041 JGI25165J46597_1000094
1042 JGI25153J46596_10000008
1043 JGI25153J46596_10000029
1044 JGI25153J46596_10000903
1045 rootH1_10093328
1046 rootH2_10030501
1047 rootH1_10120080
1048 Ga0055525_1000063
1049 Ga0055525_1000064
1050 Ga0055542_1000795
1051 Ga0055542_1001337
1052 Ga0055529_1000037
1053 Ga0055526_1004964
1054 Ga0055526_1005847
1055 Ga0055526_1016035
1056 Ga0055537_1000403
1057 Ga0055537_1003251
1058 Ga0055537_1006067
1059 Ga0055524_1000410
1060 Ga0055524_1027333
1061 Ga0055536_1002521
1062 Ga0055536_1004416
1063 Ga0055536_1014951
1064 Ga0055536_1022199
1065 Ga0055534_1005664
1066 Ga0055528_1001877
1067 Ga0055530_10000005
1068 Ga0055530_10000409
1069 Ga0055530_10003696
1070 Ga0055530_10004768
1071 Ga0055530_10013230
1072 Ga0055531_10000009
1073 Ga0055531_10000687
1074 Ga0055531_10009392
1075 Ga0055531_10020213
1076 Ga0055531_10030079
1077 Ga0058692_1000053
1078 Ga0058692_1000370
1079 Ga0065165_1002223
1080 Ga0065165_1061613
1081 Ga0065704_10070413
1082 Ga0065704_10071247
1083 Ga0065704_10075189
1084 Ga0065704_10107595
1085 Ga0065704_10112030
1086 Ga0065707_10087869
1087 Ga0065707_10268188
1088 Ga0070658_10000703
1089 Ga0070658_10002141
1090 Ga0070658_10003377
1091 Ga0070676_10000747
1092 Ga0070683_100025777
1093 Ga0070670_100000016
1094 Ga0070670_100009550
1095 Ga0068869_100009489
1096 Ga0068869_100022149
1097 Ga0070666_10025171
1098 Ga0070666_10109106
1099 Ga0070682_100073849
1100 Ga0068868_100001464
1101 Ga0070660_100002482
1102 Ga0070660_100010090
1103 Ga0070660_100119026
1104 Ga0070660_100202413
1105 Ga0070661_100008555
1106 Ga0070661_100117772
1107 Ga0070661_100381566
1108 Ga0070668_100000927
1109 Ga0070668_100004618
1110 Ga0070668_100029440
1111 Ga0070668_100313957
1112 Ga0070669_100000776
1113 Ga0070669_100001504
1114 Ga0070669_100118590
1115 Ga0070669_100123844
1116 Ga0070671_100000829
1117 Ga0070671_100027240
1118 Ga0070671_100035619
1119 Ga0070671_100088883
1120 Ga0070671_100572422
1121 Ga0070674_100004401
1122 Ga0070674_100010366
1123 Ga0070674_100231178
1124 Ga0070673_100000018
1125 Ga0070659_100242055
1126 Ga0070667_100000528
1127 Ga0070667_100001140
1128 Ga0070667_100016515
1129 Ga0070667_100193863
1130 Ga0070663_100000625
1131 Ga0070663_100061889
1132 Ga0070663_100170665
1133 Ga0070663_100582844
1134 Ga0070678_100007825
1135 Ga0070678_100055931
1136 Ga0070662_100000183
1137 Ga0070662_100002569
1138 Ga0070662_100037941
1139 Ga0070681_10004781
1140 Ga0068867_100001234
1141 Ga0070679_100001448
1142 Ga0070684_100160304
1143 Ga0070684_100733962
1144 Ga0068853_100002487
1145 Ga0068853_100029337
1146 Ga0068853_100347654
1147 Ga0068853_100397668
1148 Ga0068853_100487548
1149 Ga0070672_100015740
1150 Ga0070672_100232606
1151 Ga0070672_100830901
1152 Ga0070665_100000023
1153 Ga0070665_100000070
1154 Ga0070665_100008683
1155 Ga0070665_100177602
1156 Ga0070665_100452386
1157 Ga0070665_100503137
1158 Ga0068855_100000066
1159 Ga0068855_100004493
1160 Ga0068855_100051665
1161 Ga0068855_100180742
1162 Ga0068855_100188025
1163 Ga0068855_100361621
1164 Ga0070664_100216012
1165 Ga0068857_100037357
1166 Ga0068857_100201968
1167 Ga0068857_100506446
1168 Ga0068854_100000153
1169 Ga0068854_100007254
1170 Ga0068854_100010799
1171 Ga0068854_100037586
1172 Ga0068854_100078801
1173 Ga0068854_100121886
1174 Ga0068856_100009163
1175 Ga0068856_100030557
1176 Ga0068852_100056880
1177 Ga0068852_100078536
1178 Ga0068852_100217427
1179 Ga0068852_100476291
1180 Ga0068859_100005055
1181 Ga0068859_100074439
1182 Ga0068859_100095478
1183 Ga0068864_100000017
1184 Ga0068861_100000002
1185 Ga0068863_100000018
1186 Ga0068863_100002981
1187 Ga0068863_100291741
1188 Ga0068858_100000112
1189 Ga0068858_100015224
1190 Ga0068858_100370622
1191 Ga0068858_100794712
1192 Ga0068860_100004621
1193 Ga0068860_100042994
1194 Ga0068860_100128610
1195 Ga0068860_100452717
1196 Ga0068860_100535766
1197 Ga0068862_100000010
1198 Ga0068862_100000877
1199 Ga0068862_100001863
1200 Ga0068862_100007339
1201 Ga0068862_100076371
1202 Ga0068862_100090810
1203 Ga0075365_10106104
1204 Ga0075368_10000152
1205 Ga0075363_100000467
1206 Ga0075363_100002645
1207 Ga0075364_10020634
1208 Ga0075362_10000066
1209 Ga0075362_10000596
1210 Ga0075362_10009230
1211 Ga0075362_10075098
1212 Ga0075367_10007912
1213 Ga0075367_10079057
1214 Ga0075369_10021559
1215 Ga0075369_10070859
1216 Ga0075366_10000145
1217 Ga0075366_10007378
1218 Ga0075366_10011539
1219 Ga0075366_10028114
1220 Ga0097621_100009955
1221 Ga0097621_100212787
1222 Ga0075370_10000055
1223 Ga0075370_10004306
1224 Ga0075370_10008006
1225 Ga0075370_10037121
1226 Ga0075370_10269803
1227 Ga0068871_100042617
1228 Ga0068865_100000007
1229 Ga0097620_100005055
1230 Ga0097620_100074438
1231 Ga0097620_100095482
1232 Ga0105251_10000155
1233 Ga0105251_10002120
1234 Ga0105251_10002321
1235 Ga0105251_10003158
1236 Ga0105244_10011175
1237 Ga0105244_10049489
1238 Ga0105250_10099377
1239 Ga0105240_10030522
1240 Ga0105240_11213236
1241 Ga0105245_10003037
1242 Ga0105245_10005071
1243 Ga0105247_10009791
1244 Ga0105247_10014568
1245 Ga0105243_10000221
1246 Ga0105243_10000264
1247 Ga0105243_10058114
1248 Ga0105243_10686186
1249 Ga0105241_10033095
1250 Ga0105241_10089543
1251 Ga0105242_10002348
1252 Ga0105242_10359058
1253 Ga0105242_10507852
1254 Ga0105248_10000105
1255 Ga0105248_10004901
1256 Ga0105248_10013983
1257 Ga0105248_10022491
1258 Ga0105248_10076069
1259 Ga0105237_10002971
1260 Ga0105237_10073805
1261 Ga0105237_10372648
1262 Ga0105237_10531939
1263 Ga0105237_10702349
1264 Ga0105238_10712230
1265 Ga0105249_10000207
1266 Ga0105249_10000574
1267 Ga0105249_10032567
1268 Ga0105249_10035802
1269 Ga0105239_10000060
1270 Ga0105239_10170631
1271 Ga0105239_10853210
1272 Ga0105246_10006206
1273 Ga0157326_1004457
1274 Ga0157373_10007927
1275 Ga0157373_10550348
1276 Ga0157371_10000256
1277 Ga0157371_10001424
1278 Ga0157371_10002212
1279 Ga0157371_10059147
1280 Ga0157371_10160945
1281 Ga0157371_10228486
1282 Ga0157371_10335632
1283 Ga0157370_10001069
1284 Ga0157370_10012091
1285 Ga0157370_10266839
1286 Ga0157370_10455638
1287 Ga0157369_10005291
1288 Ga0157369_10242641
1289 Ga0157369_10428312
1290 Ga0157374_10015731
1291 Ga0157374_10016936
1292 Ga0157374_10151118
1293 Ga0157378_10004659
1294 Ga0157378_10046547
1295 Ga0163162_10021575
1296 Ga0163162_10024944
1297 Ga0163162_10118060
1298 Ga0163162_10163793
1299 Ga0157372_10004975
1300 Ga0157372_10014109
1301 Ga0157372_10026789
1302 Ga0157372_10075308
1303 Ga0157372_10112502
1304 Ga0157372_10167980
1305 Ga0157372_10514262
1306 Ga0157372_10778103
1307 Ga0157372_11100078
1308 Ga0157372_11272541
1309 Ga0157375_10000706
1310 Ga0157375_10419646
1311 Ga0163163_10084394
1312 Ga0157380_10362738
1313 Ga0182008_10002286
1314 Ga0182008_10010202
1315 Ga0157379_10065246
1316 Ga0157379_10125715
1317 Ga0157376_10000046
1318 Ga0182007_10000131
1319 Ga0182005_1000437
1320 Ga0182005_1001317
1321 Ga0183363_1004
1322 Ga0183361_13433
1323 Ga0163161_10001840
1324 Ga0163161_10001980
1325 Ga0209563_100066
1326 Ga0207427_103136
1327 Ga0207425_1000041
1328 Ga0207425_1000064
1329 Ga0209026_1001795
1330 Ga0209148_1000011
1331 Ga0209148_1000074
1332 Ga0209148_1001136
1333 Ga0209129_1000101
1334 Ga0209129_1001272
1335 Ga0209233_1000003
1336 Ga0209233_1000026
1337 Ga0209233_1017631
1338 Ga0209565_1000008
1339 Ga0209565_1000060
1340 Ga0209565_1000755
1341 Ga0209455_1000006
1342 Ga0209455_1000985
1343 Ga0209455_1024569
1344 Ga0209673_1000047
1345 Ga0209673_1012801
1346 Ga0209673_1013903
1347 Ga0209675_1000007
1348 Ga0209675_1000564
1349 Ga0209675_1015297
1350 Ga0209676_1000018
1351 Ga0209676_1000132
1352 Ga0209676_1000146
1353 Ga0209676_1000411
1354 Ga0209676_1000620
1355 Ga0209025_1000048
1356 Ga0209025_1000654
1357 Ga0209025_1018129
1358 Ga0209564_1000252
1359 Ga0209564_1000565
1360 Ga0209564_1046617
1361 Ga0209758_1000004
1362 Ga0209758_1000017
1363 Ga0209758_1000056
1364 Ga0209050_1000001
1365 Ga0209050_1000014
1366 Ga0209050_1000139
1367 Ga0209050_1000740
1368 Ga0209050_1000870
1369 Ga0209050_1010220
1370 Ga0209050_1017968
1371 Ga0209256_1000009
1372 Ga0209256_1000010
1373 Ga0209256_1003547
1374 Ga0209256_1008988
1375 Ga0209051_1000475
1376 Ga0209051_1001835
1377 Ga0209257_1000019
1378 Ga0209257_1000035
1379 Ga0209257_1000046
1380 Ga0209257_1000164
1381 Ga0209257_1000277
1382 Ga0209257_1001111
1383 Ga0209257_1001426
1384 Ga0209257_1001546
1385 Ga0209257_1002572
1386 Ga0209257_1008341
1387 Ga0209257_1008364
1388 Ga0209257_1022795
1389 Ga0209257_1026604
1390 Ga0207697_10136156
1391 Ga0207656_10012961
1392 Ga0207696_1001953
1393 Ga0207713_1001324
1394 Ga0207713_1004906
1395 Ga0207713_1007429
1396 Ga0207713_1018913
1397 Ga0207710_10004777
1398 Ga0207680_10115626
1399 Ga0207647_10000421
1400 Ga0207647_10004216
1401 Ga0207647_10124711
1402 Ga0207647_10181754
1403 Ga0207645_10000811
1404 Ga0207643_10208146
1405 Ga0207705_10000044
1406 Ga0207705_10000513
1407 Ga0207705_10010060
1408 Ga0207705_10253214
1409 Ga0207654_10004906
1410 Ga0207654_10070889
1411 Ga0207695_10009843
1412 Ga0207695_10032721
1413 Ga0207695_10047824
1414 Ga0207671_10001071
1415 Ga0207671_10012983
1416 Ga0207660_10176382
1417 Ga0207657_10000123
1418 Ga0207657_10034797
1419 Ga0207657_10121364
1420 Ga0207649_10000347
1421 Ga0207649_10017466
1422 Ga0207652_10025012
1423 Ga0207681_10002329
1424 Ga0207681_10003582
1425 Ga0207681_10059028
1426 Ga0207681_10070070
1427 Ga0207681_10071300
1428 Ga0207681_10191510
1429 Ga0207694_10079412
1430 Ga0207694_10466217
1431 Ga0207694_10675380
1432 Ga0207650_10000057
1433 Ga0207650_10001882
1434 Ga0207650_10052193
1435 Ga0207659_10380891
1436 Ga0207687_10002295
1437 Ga0207687_10041644
1438 Ga0207644_10004486
1439 Ga0207644_10006854
1440 Ga0207644_10225963
1441 Ga0207690_10003709
1442 Ga0207690_10015155
1443 Ga0207690_10041814
1444 Ga0207690_10044717
1445 Ga0207690_10073557
1446 Ga0207690_10193916
1447 Ga0207706_10000193
1448 Ga0207706_10005814
1449 Ga0207706_10028490
1450 Ga0207706_10035771
1451 Ga0207706_10089690
1452 Ga0207706_10219164
1453 Ga0207706_10398092
1454 Ga0207686_10002994
1455 Ga0207709_10000078
1456 Ga0207709_10000277
1457 Ga0207709_10000732
1458 Ga0207709_10007614
1459 Ga0207669_10000020
1460 Ga0207669_10003084
1461 Ga0207704_10000168
1462 Ga0207691_10006781
1463 Ga0207691_10141440
1464 Ga0207711_10000031
1465 Ga0207711_10020363
1466 Ga0207711_10020863
1467 Ga0207711_10116551
1468 Ga0207689_10005309
1469 Ga0207689_10043302
1470 Ga0207679_10032153
1471 Ga0207667_10000002
1472 Ga0207667_10000137
1473 Ga0207667_10002490
1474 Ga0207667_10014229
1475 Ga0207667_10339843
1476 Ga0207667_10635853
1477 Ga0207651_10000011
1478 Ga0207651_10317150
1479 Ga0207712_10000234
1480 Ga0207712_10000476
1481 Ga0207712_10003720
1482 Ga0207668_10000746
1483 Ga0207668_10003547
1484 Ga0207668_10017031
1485 Ga0207668_10247549
1486 Ga0207668_10288916
1487 Ga0207640_10000236
1488 Ga0207640_10013334
1489 Ga0207640_10018292
1490 Ga0207640_10029440
1491 Ga0207640_10032710
1492 Ga0207640_10037685
1493 Ga0207640_10741936
1494 Ga0207658_10001382
1495 Ga0207658_10005000
1496 Ga0207658_10006307
1497 Ga0207658_10129351
1498 Ga0207658_10151910
1499 Ga0207658_10330590
1500 Ga0207677_10001007
1501 Ga0207703_10002992
1502 Ga0207703_10009901
1503 Ga0207703_10168040
1504 Ga0207703_10243230
1505 Ga0207703_10436676
1506 Ga0207639_10002135
1507 Ga0207639_10005268
1508 Ga0207639_10005755
1509 Ga0207639_10061557
1510 Ga0207639_10304378
1511 Ga0207639_10321808
1512 Ga0207639_10340890
1513 Ga0207639_10447372
1514 Ga0207678_10000946
1515 Ga0207678_10006261
1516 Ga0207678_10007535
1517 Ga0207678_10461650
1518 Ga0207708_10249196
1519 Ga0207702_10007234
1520 Ga0207702_10012593
1521 Ga0207702_10013929
1522 Ga0207702_10077753
1523 Ga0207702_10443618
1524 Ga0207641_10000002
1525 Ga0207641_10004191
1526 Ga0207641_10320210
1527 Ga0207648_10000047
1528 Ga0207676_10000005
1529 Ga0207674_10008601
1530 Ga0207674_10010604
1531 Ga0207675_100000021
1532 Ga0207683_10001150
1533 Ga0207683_10037334
1534 Ga0207683_10201812
1535 Ga0207698_10001045
1536 Ga0207698_10018394
1537 Ga0209371_1000018
1538 Ga0209371_1000025
1539 Ga0209813_10000082
1540 Ga0209974_10036797
1541 Ga0268266_10000002
1542 Ga0268266_10001471
1543 Ga0268266_10002431
1544 Ga0268266_10033151
1545 Ga0268266_10142959
1546 Ga0268266_10162973
1547 Ga0268265_10000003
1548 Ga0268265_10000424
1549 Ga0268265_10007903
1550 Ga0268265_10036208
1551 Ga0268264_10001182
1552 Ga0268264_10031281
1553 Ga0268264_10045475
1554 Ga0268264_10062626
1555 Ga0307517_10018404
1556 Ga0307517_10251191
1557 Ga0268256_1000016
1558 Ga0268256_1000027
1559 Ga0314311_1075969
1560 Ga0314311_1115565
1561 Ga0316183_1110894
1562 Ga0316183_1164325
1563 Ga0307513_10039689
1564 Ga0307513_10097114
1565 Ga0307513_10206471
1566 Ga0307408_100186371
1567 Ga0307408_100298772
1568 Ga0307508_10009433
1569 Ga0307405_10000445
1570 Ga0316577_10140284
1571 Ga0307413_10071278
1572 Ga0307413_10197001
1573 Ga0307413_10462187
1574 Ga0307410_10060998
1575 Ga0307410_10156661
1576 Ga0307406_10079342
1577 Ga0307412_10003432
1578 Ga0307412_10005593
1579 Ga0307412_10016843
1580 Ga0307412_10048784
1581 Ga0307412_10052199
1582 Ga0307412_10070245
1583 Ga0307412_10239243
1584 Ga0307412_10247267
1585 Ga0307412_10399278
1586 Ga0307412_10413221
1587 Ga0307409_100207365
1588 Ga0307409_100857467
1589 Ga0307414_10000251
1590 Ga0307414_10001515
1591 Ga0307414_10004650
1592 Ga0307414_10007830
1593 Ga0307414_10015078
1594 Ga0307414_10020297
1595 Ga0307414_10031336
1596 Ga0307414_10044838
1597 Ga0307414_10087909
1598 Ga0307414_10157139
1599 Ga0307414_10176111
1600 Ga0307414_10347958
1601 Ga0307414_10394476
1602 Ga0307414_10503390
1603 Ga0307411_10078383
1604 Ga0307411_10316030
1605 Ga0307411_10464123
1606 Ga0307415_100030269
1607 Ga0307510_10001089
1608 Ga0373923_0123256
1609 Ga0373923_0248307
1610 Ga0316574_0165096
1611 Ga0373931_0165440
1612 Ga0316582_0043273
1613 Ga0395899_0009504
1614 Ga0395899_0036920
1615 Ga0395900_0039298
1616 Ga0395900_0069449
1617 Ga0395900_0171035
1618 Ga0395905_0013942
1619 Ga0395905_0161200
1620 Ga0395905_0248194
1621 Ga0436364_0184827
1622 Ga0436364_0296893
1623 Ga0237819_00128
1624 Ga0436365_0341898
1625 Ga0436365_1628748
1626 Ga0439436_0008965
1627 Ga0439439_0006402
1628 Ga0439461_0000103
1629 Ga0439461_0015624
1630 Ga0439465_0000289
1631 Ga0439465_0004367
1632 Ga0451797_0789101
1633 Ga0451806_635767
1634 Ga0451807_1567495
1635 Ga0451807_2581624
1636 Ga0451837_1421368
1637 Ga0451841_0235217
1638 Ga0451853_1744520
1639 Ga0439442_006641
1640 Ga0439442_034127
1641 Ga0439445_0000781
1642 Ga0439445_0059390
1643 Ga0439448_0000936
1644 Ga0439448_0040650
1645 Ga0439448_0043441
1646 Ga0439432_000148
1647 Ga0439449_0000404
1648 Ga0439449_0065930
1649 Ga0439455_0002098
1650 Ga0439455_0002979
1651 Ga0439455_0039678
1652 Ga0439458_0001035
1653 Ga0439458_0003163
1654 Ga0439434_0000989
1655 Ga0439434_0007665
1656 Ga0451577_0203403
1657 Ga0466965_0085185
1658 Ga0466966_0021309
1659 Ga0466966_0023777
1660 Ga0466963_0005372
1661 Ga0453684_0801468
1662 Ga0466971_0025908
1663 Ga0466968_0043036
1664 Ga0466968_0045930
1665 Ga0466970_0008610
1666 Ga0466957_0033293
1667 Ga0466957_0074212
1668 Ga0466959_0000648
1669 Ga0466959_0088190
1670 Ga0466958_0042755
1671 Ga0466967_0016678
1672 Ga0495617_006544
1673 Ga0495627_043220
1674 Ga0495629_0338339
1675 Ga0495638_0001684
1676 Ga0495638_0010375
1677 Ga0495638_0225768
1678 Ga0495650_0000172
1679 Ga0495584_0124803
1680 Ga0495607_0012787
1681 Ga0495607_0029971
1682 Ga0495583_0000027
1683 Ga0495583_0002525
1684 Ga0495583_0004847
1685 Ga0495583_0011033
1686 Ga0495606_0000365
1687 Ga0495606_0005421
1688 Ga0495606_0263910
1689 Ga0495610_0009902
1690 Ga0495631_0005889
1691 Ga0495631_0048151
1692 Ga0495637_0083892
1693 Ga0495643_0000659
1694 Ga0495643_0009971
1695 Ga0495643_0017797
1696 Ga0495643_0120839
1697 Ga0495648_0000249
1698 Ga0495663_0001306
1699 Ga0495663_0001822
1700 Ga0495663_0010012
1701 Ga0495642_0007737
1702 Ga0495654_0004263
1703 Ga0495621_0002343
1704 Ga0495621_0117253
1705 Ga0495622_0019534
1706 Ga0495633_0000622
1707 Ga0495633_0051499
1708 Ga0495668_0000015
1709 Ga0495668_0000080
1710 Ga0495668_0007017
1711 Ga0495668_0058918
1712 Ga0495668_0147240
1713 Ga0495611_0053373
1714 Ga0495625_0000541
1715 Ga0495625_0000876
1716 Ga0495625_0006423
1717 Ga0495625_0009642
1718 Ga0495625_0080157
1719 Ga0495625_0135702
1720 Ga0495625_0166692
1721 Ga0495625_0168732
1722 Ga0495661_0030557
1723 Ga0495669_0000011
1724 Ga0495670_0000002
1725 Ga0495670_0038462
1726 Ga0495670_0039186
1727 Ga0495670_0173194
1728 Ga0495671_0034844
1729 Ga0495649_0104002
1730 Ga0495600_0204353
1731 Ga0495672_0000411
1732 Ga0495683_0019425
1733 Ga0495687_000082
1734 Ga0495687_002094
1735 Ga0495677_0006435
1736 Ga0495681_0027622
1737 Ga0495681_0084020
1738 Ga0495686_0000201
1739 Ga0495686_0000430
1740 Ga0495686_0001136
1741 Ga0495686_0012074
1742 Ga0495686_0013397
1743 Ga0495686_0053124
1744 Ga0495686_0099219
1745 Ga0495615_0003040
1746 Ga0496101_0108103
1747 Ga0496101_0422018
1748 Ga0496102_0000471
1749 Ga0496102_0002022
1750 Ga0496103_0000166
1751 Ga0496103_0000581
1752 Ga0496103_0021341
1753 Ga0496104_0001657
1754 Ga0496104_0010654
1755 Ga0496105_0003221
1756 Ga0496105_0055737
1757 Ga0496109_0096519
1758 Ga0496110_0101023
1759 Ga0496110_0567834
1760 Ga0496111_0037863
1761 Ga0496114_0076871
1762 Ga0496115_0000030
1763 Ga0496115_0000390
1764 Ga0496115_0192261
1765 Ga0496116_0006531
1766 Ga0496116_0136807
1767 Ga0496116_0206341
1768 Ga0496117_0000142
1769 Ga0496117_0004574
1770 Ga0496117_0011257
1771 Ga0496117_0014014
1772 Ga0496117_0015294
1773 Ga0496117_0016703
1774 Ga0496117_0020049
1775 Ga0496117_0023122
1776 Ga0496117_0029258
1777 Ga0496117_0104338
1778 Ga0496117_0138815
1779 Ga0496117_0143375
1780 Ga0496117_0167954
1781 Ga0496118_0000115
1782 Ga0496118_0000332
1783 Ga0496118_0000787
1784 Ga0496118_0004303
1785 Ga0496118_0016020
1786 Ga0496118_0020501
1787 Ga0496118_0029158
1788 Ga0496118_0040683
1789 Ga0496118_0069964
1790 Ga0496118_0085096
1791 Ga0496119_0000518
1792 Ga0496119_0007761
1793 Ga0496119_0019968
1794 Ga0496119_0022570
1795 Ga0496119_0059672
1796 Ga0496119_0150252
1797 Ga0496120_0000630
1798 Ga0496120_0001627
1799 Ga0496120_0035145
1800 Ga0496120_0057448
1801 Ga0496121_0000173
1802 Ga0496121_0000193
1803 Ga0496121_0004372
1804 Ga0496121_0011321
1805 Ga0496121_0049171
1806 Ga0496121_0051813
1807 Ga0496121_0123174
1808 Ga0496121_0222123
1809 Ga0496122_0001011
1810 Ga0496122_0001736
1811 Ga0496122_0002817
1812 Ga0496122_0018085
1813 Ga0496122_0055645
1814 Ga0496122_0099454
1815 Ga0496122_0235337
1816 Ga0496123_0001458
1817 Ga0496123_0001830
1818 Ga0496123_0002477
1819 Ga0496123_0018268
1820 Ga0496123_0044829
1821 Ga0496123_0083914
1822 Ga0496123_0116623
1823 Ga0496123_0118683
1824 Ga0496123_0131852
1825 Ga0496123_0364964
1826 Ga0496124_0000034
1827 Ga0496124_0000071
1828 Ga0496124_0000146
1829 Ga0496124_0001905
1830 Ga0496124_0007734
1831 Ga0496124_0011525
1832 Ga0496124_0018592
1833 Ga0496124_0022889
1834 Ga0496124_0025738
1835 Ga0496124_0026277
1836 Ga0496124_0055280
1837 Ga0496124_0086022
1838 Ga0496124_0093929
1839 Ga0496124_0215134
1840 Ga0496124_0499608
1841 Ga0496125_0003343
1842 Ga0496125_0009005
1843 Ga0496125_0033384
1844 Ga0496125_0034978
1845 Ga0496125_0133819
1846 Ga0496126_0000174
1847 Ga0496126_0001265
1848 Ga0496126_0002590
1849 Ga0496126_0018137
1850 Ga0496126_0021858
1851 Ga0496126_0046811
1852 Ga0496126_0053433
1853 Ga0496126_0089011
1854 Ga0495682_0013631
1855 Ga0501290_000159
1856 Ga0501292_000020
1857 Ga0501294_000262
1858 Ga0501300_007560
1859 Ga0501032_0075651
1860 Ga0501033_0008801
1861 Ga0501033_0010630
1862 Ga0501033_0037242
1863 Ga0501034_0059309
1864 Ga0501034_0070176
1865 Ga0501034_0077060
1866 Ga0501034_0098819
1867 Ga0501034_0445013
1868 Ga0501037_0073245
1869 Ga0501039_0015976
1870 Ga0501042_0501642
1871 Ga0501043_0206628
1872 Ga0501046_0049775
1873 Ga0501047_0029763
1874 Ga0501047_0141957
1875 Ga0501206_009913
1876 Ga0501223_001949
1877 Ga0501224_006481
1878 Ga0501235_043515
1879 Ga0501261_000202
1880 Ga0501279_000022
1881 Ga0501280_000035
1882 Ga0501281_00180
1883 Ga0501035_0012696
1884 Ga0501035_0105528
1885 Ga0501044_0000290
1886 Ga0501044_0031302
1887 Ga0501044_0077793
1888 Ga0501044_0339354
1889 nmdc:mga03683_1345_c1
1890 nmdc:mga03683_55_c1
1891 nmdc:mga03683_9004_c1
1892 nmdc:mga03n38_9585_c1
1893 nmdc:mga00v17_10632_c1
1894 nmdc:mga00v17_1480_c1
1895 nmdc:mga00v17_16647_c1
1896 nmdc:mga0k408_253060_c1
1897 nmdc:mga0k408_63030_c1
1898 nmdc:mga0k408_6795_c1
1899 nmdc:mga0k408_7_c1
1900 nmdc:mga06z11_50364_c1
1901 nmdc:mga06z11_770_c1
1902 nmdc:mga04h51_339_c1
1903 nmdc:mga07m45_1849_c1
1904 nmdc:mga07m45_205200_c1
1905 nmdc:mga07m45_237745_c1
1906 nmdc:mga07m45_33716_c1
1907 nmdc:mga07m45_35_c1
1908 nmdc:mga07m45_3_c1
1909 nmdc:mga0sz30_303_c1
1910 nmdc:mga0sz30_41_c1
1911 nmdc:mga0sz30_48235_c1
1912 Ga0500610_0000413
1913 Ga0500643_000001
1914 Ga0500643_001644
1915 Ga0500643_002547
1916 Ga0500643_014583
1917 Ga0500651_0189408
1918 Ga0500566_0001263
1919 Ga0500566_0094666
1920 Ga0500641_0145362
1921 Ga0500555_001180
1922 Ga0500592_000329
1923 Ga0500595_000183
1924 Ga0500595_001555
1925 Ga0500595_037817
1926 Ga0500597_010411
1927 Ga0500607_000763
1928 Ga0500608_000074
1929 Ga0500614_006488
1930 Ga0500642_0001088
1931 Ga0500658_0003617
1932 Ga0500658_0005314
1933 Ga0500658_0033241
1934 Ga0500658_0038213
1935 Ga0500559_0044675
1936 Ga0500559_0046405
1937 Ga0500559_0174035
1938 Ga0500564_000068
1939 Ga0500568_0000658
1940 Ga0500573_0000029
1941 Ga0500590_036659
1942 Ga0500604_0013629
1943 Ga0500616_0219494
1944 Ga0500622_0000119
1945 Ga0500624_000032
1946 Ga0500627_0000028
1947 Ga0500627_0008936
1948 Ga0500634_0014677
1949 Ga0500637_0000019
1950 Ga0500567_024519
1951 Ga0500611_009750
1952 Ga0500625_000004
1953 Ga0500645_000001
1954 Ga0500645_015016
1955 Ga0500596_004764
1956 Ga0466962_0004007
1957 2547501642
1958 2578456949
1959 2600225315
1960 2643820304
1961 2643834621
1962 2644055548
1963 2644126180
1964 2738710377
1965 2738848802
1966 2738864531
1967 2739297049
1968 2739358727
1969 2739650622
1970 2740029095
1971 2747951540
1972 2748018780
1973 2753767920
1974 2765580556
1975 2816518421
1976 2819661357
1977 2819713584
1978 2830078749
1979 2842394470
1980 2842781916
1981 2852652101
1982 2852656172
1983 2852683248
1984 2852687227
1985 2857444212
1986 2874223223
1987 2879166297
1988 2882808969
1989 2885430424
1990 2895499889
1991 2895512866
1992 2895522874
1993 2895525354
1994 2895882046
1995 2896187326
1996 2896254210
1997 2919092299
1998 2919137017
1999 2928028720
2000 2928100474
2001 2928499889
2002 2928530114
2003 2928960539
2004 2928969699
2005 2931383341
2006 2937614313
2007 2939589854
2008 2939624971
2009 2939629177
2010 2941478724
2011 2961049987
2012 2961064855
2013 2974307601
2014 2977248312
2015 2984517195
2016 2984555453
2017 2984566410
2018 2990265856
2019 2993357449
2020 2993696353
2021 3000867592
2022 8002870927
2023 8021625520
2024 8021628644

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

14

248

0.95

PF08241

Methyltransf_11

Methyltransferase domain

65

166

0.93

PF13649

Methyltransf_25

Methyltransferase domain

64

162

0.93

PF13847

Methyltransf_31

Methyltransferase domain

58

209

0.89

PF08242

Methyltransf_12

Methyltransferase domain

65

164

0.84

PF13489

Methyltransf_23

Methyltransferase domain

40

233

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9364 30 245
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8596 30 245
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8325 50 245
4krg-assembly2.cif.gz_B semet haemonchus contortus phosphoethanolamine n-methyltransferase 1 in complex with phosphoethanolamine and s-adenosylhomocysteine 0.8179 14 167
3wlf-assembly1.cif.gz_D crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with (r)-1-phenyl-1,2-ethanediol 0.8178 54 158
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9818 30 245 3.40.50.150
af_A4IC78_24_256_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9701 30 245 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9645 31 245 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9643 30 245 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9556 30 245 3.40.50.150
ID Description Score Start End GO Terms
AF-S0F305-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.9783 1 244 GO:0008425
GO:0031314
GO:0032259
AF-A0A6A5KTX5-F1-model_v4 deleted 0.9771 1 245
AF-A0A2E2SF17-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9768 2 245 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A2G2QYU2-F1-model_v4 Bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.-) 0.976 32 245 GO:0008425
GO:0009234
GO:0032259
AF-A0A0C1MTY0-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9759 5 245 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770

Map