F488102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1009 | 371 | 1006 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300049683|Ga0501253_011091|Ga0501253_011091_147_530 |
| Length | 127 |
| Sequence | MSAAKIRKGDKVVVLSGRDKGKTGEIVSASPKDSKVVVSGVNIATRHKKATQTNPQGGLERREAPMHVSKVAIIDPKDGKATRALRDGRRQEGPRRCAVRGEDRWLKPTRRKRPTSRVCARIMTIAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 2 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 3 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 4 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 11 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 98 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 99 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 179 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 180 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 181 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 182 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 183 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 184 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 209 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 210 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 211 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 218 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 219 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 220 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 221 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 222 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 223 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 224 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 225 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 226 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 229 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 230 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 231 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 232 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 233 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 234 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 235 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 236 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 237 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 238 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 239 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 240 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 241 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 242 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 243 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 244 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 245 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 246 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 301 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 320 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 321 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 322 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 327 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 328 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 329 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 330 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 331 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 332 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 333 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 334 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 336 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 337 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 338 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 341 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 342 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 343 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 348 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 350 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 359 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 360 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 363 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 365 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 366 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 367 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 369 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 370 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 371 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.42 |
| Metatranscriptomes | 2.28 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.28 |
| Nodule | 0 |
| Rhizoplane | 1.98 |
| Rhizosphere | 95.14 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 0.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1012887 | 3300000549 | Bacteria | 986 |
| 2 | ARCol0yngRDRAFT_1001879 | 3300000652 | Bacteria | 1643 |
| 3 | JGI24737J22298_10105196 | 3300001990 | Bacteria | 836 |
| 4 | JGI24735J21928_10253867 | 3300002067 | Bacteria | 513 |
| 5 | JGI24750J21931_1006318 | 3300002070 | Bacteria | 1474 |
| 6 | JGI24748J21848_1001483 | 3300002074 | Bacteria | 2593 |
| 7 | JGI24035J26624_1015105 | 3300002126 | Bacteria | 790 |
| 8 | JGI24033J26618_1047719 | 3300002155 | Bacteria | 609 |
| 9 | JGI24742J22300_10007510 | 3300002244 | Bacteria | 1799 |
| 10 | JGI24751J29686_10022529 | 3300002459 | Bacteria | 1307 |
| 11 | JGI24751J29686_10039569 | 3300002459 | Bacteria | 976 |
| 12 | Ga0065712_10037815 | 3300005290 | Bacteria | 1041 |
| 13 | Ga0065712_10230156 | 3300005290 | Bacteria | 1011 |
| 14 | Ga0065715_10000098 | 3300005293 | Bacteria | 2789 |
| 15 | Ga0065715_10219721 | 3300005293 | Bacteria | 1277 |
| 16 | Ga0065715_10373912 | 3300005293 | Bacteria | 917 |
| 17 | Ga0065715_10395125 | 3300005293 | Bacteria | 889 |
| 18 | Ga0065715_10910021 | 3300005293 | Bacteria | 568 |
| 19 | Ga0065707_10477737 | 3300005295 | Bacteria | 750 |
| 20 | Ga0070676_10010202 | 3300005328 | Bacteria | 5093 |
| 21 | Ga0070676_10027273 | 3300005328 | Bacteria | 3237 |
| 22 | Ga0070676_10051799 | 3300005328 | Bacteria | 2411 |
| 23 | Ga0070676_11527306 | 3300005328 | Bacteria | 515 |
| 24 | Ga0070690_101309456 | 3300005330 | Bacteria | 581 |
| 25 | Ga0070670_100047139 | 3300005331 | Bacteria | 3707 |
| 26 | Ga0070670_100296578 | 3300005331 | Bacteria | 1413 |
| 27 | Ga0070670_100364193 | 3300005331 | Bacteria | 1272 |
| 28 | Ga0070670_100533843 | 3300005331 | Bacteria | 1045 |
| 29 | Ga0070670_100652050 | 3300005331 | Bacteria | 944 |
| 30 | Ga0070677_10016266 | 3300005333 | Bacteria | 2646 |
| 31 | Ga0070677_10018931 | 3300005333 | Bacteria | 2487 |
| 32 | Ga0068869_100109201 | 3300005334 | Bacteria | 2102 |
| 33 | Ga0068869_101102592 | 3300005334 | Bacteria | 694 |
| 34 | Ga0068869_101383123 | 3300005334 | Bacteria | 623 |
| 35 | Ga0068868_100133596 | 3300005338 | Bacteria | 2032 |
| 36 | Ga0068868_100297235 | 3300005338 | Bacteria | 1370 |
| 37 | Ga0070660_100151852 | 3300005339 | Bacteria | 1862 |
| 38 | Ga0070660_100514385 | 3300005339 | Bacteria | 996 |
| 39 | Ga0070691_11089721 | 3300005341 | Bacteria | 503 |
| 40 | Ga0070687_100404902 | 3300005343 | Bacteria | 896 |
| 41 | Ga0070687_100546187 | 3300005343 | Bacteria | 788 |
| 42 | Ga0070661_100308934 | 3300005344 | Bacteria | 1232 |
| 43 | Ga0070692_10038276 | 3300005345 | Bacteria | 2443 |
| 44 | Ga0070668_100048313 | 3300005347 | Bacteria | 3272 |
| 45 | Ga0070668_100105756 | 3300005347 | Bacteria | 2235 |
| 46 | Ga0070668_100107439 | 3300005347 | Bacteria | 2218 |
| 47 | Ga0070668_100165579 | 3300005347 | Bacteria | 1796 |
| 48 | Ga0070668_100393760 | 3300005347 | Bacteria | 1181 |
| 49 | Ga0070668_100560337 | 3300005347 | Bacteria | 995 |
| 50 | Ga0070668_100691677 | 3300005347 | Bacteria | 899 |
| 51 | Ga0070668_101016540 | 3300005347 | Bacteria | 745 |
| 52 | Ga0070668_101111744 | 3300005347 | Bacteria | 713 |
| 53 | Ga0070668_101772386 | 3300005347 | Bacteria | 567 |
| 54 | Ga0070669_100014400 | 3300005353 | Bacteria | 5629 |
| 55 | Ga0070669_100069493 | 3300005353 | Bacteria | 2601 |
| 56 | Ga0070669_100259429 | 3300005353 | Bacteria | 1386 |
| 57 | Ga0070669_100399911 | 3300005353 | Bacteria | 1123 |
| 58 | Ga0070669_100406010 | 3300005353 | Bacteria | 1115 |
| 59 | Ga0070669_100823875 | 3300005353 | Bacteria | 789 |
| 60 | Ga0070669_100903125 | 3300005353 | Bacteria | 754 |
| 61 | Ga0070669_100974610 | 3300005353 | Bacteria | 727 |
| 62 | Ga0070669_101067692 | 3300005353 | Bacteria | 695 |
| 63 | Ga0070669_101174155 | 3300005353 | Bacteria | 662 |
| 64 | Ga0070669_101502259 | 3300005353 | Bacteria | 586 |
| 65 | Ga0070669_101661144 | 3300005353 | Bacteria | 556 |
| 66 | Ga0070675_100048237 | 3300005354 | Bacteria | 3491 |
| 67 | Ga0070675_100108237 | 3300005354 | Bacteria | 2347 |
| 68 | Ga0070675_100458797 | 3300005354 | Bacteria | 1143 |
| 69 | Ga0070675_100479567 | 3300005354 | Bacteria | 1118 |
| 70 | Ga0070675_100679650 | 3300005354 | Bacteria | 937 |
| 71 | Ga0070675_101692367 | 3300005354 | Bacteria | 584 |
| 72 | Ga0070671_100052885 | 3300005355 | Bacteria | 3376 |
| 73 | Ga0070671_100214400 | 3300005355 | Bacteria | 1633 |
| 74 | Ga0070671_100277720 | 3300005355 | Bacteria | 1424 |
| 75 | Ga0070671_100400255 | 3300005355 | Bacteria | 1174 |
| 76 | Ga0070671_100742586 | 3300005355 | Bacteria | 853 |
| 77 | Ga0070674_100022854 | 3300005356 | Bacteria | 4036 |
| 78 | Ga0070674_100214360 | 3300005356 | Bacteria | 1494 |
| 79 | Ga0070674_100528176 | 3300005356 | Bacteria | 987 |
| 80 | Ga0070674_101058136 | 3300005356 | Bacteria | 715 |
| 81 | Ga0070674_101192319 | 3300005356 | Bacteria | 675 |
| 82 | Ga0070674_101470859 | 3300005356 | Bacteria | 612 |
| 83 | Ga0070674_101804373 | 3300005356 | Bacteria | 555 |
| 84 | Ga0070673_100041643 | 3300005364 | Bacteria | 3535 |
| 85 | Ga0070673_100061829 | 3300005364 | Bacteria | 2972 |
| 86 | Ga0070673_100113379 | 3300005364 | Bacteria | 2251 |
| 87 | Ga0070673_100337611 | 3300005364 | Bacteria | 1334 |
| 88 | Ga0070673_100488405 | 3300005364 | Bacteria | 1112 |
| 89 | Ga0070673_100598365 | 3300005364 | Bacteria | 1006 |
| 90 | Ga0070673_101642507 | 3300005364 | Bacteria | 608 |
| 91 | Ga0070673_101669902 | 3300005364 | Bacteria | 602 |
| 92 | Ga0070659_100085064 | 3300005366 | Bacteria | 2529 |
| 93 | Ga0070659_100147960 | 3300005366 | Bacteria | 1914 |
| 94 | Ga0070659_100694277 | 3300005366 | Bacteria | 880 |
| 95 | Ga0070667_100050290 | 3300005367 | Bacteria | 3512 |
| 96 | Ga0070667_100087293 | 3300005367 | Bacteria | 2677 |
| 97 | Ga0070667_100284964 | 3300005367 | Bacteria | 1484 |
| 98 | Ga0070667_100450097 | 3300005367 | Bacteria | 1176 |
| 99 | Ga0070701_10337157 | 3300005438 | Bacteria | 938 |
| 100 | Ga0070705_100323221 | 3300005440 | Bacteria | 1115 |
| 101 | Ga0070705_100378721 | 3300005440 | Bacteria | 1041 |
| 102 | Ga0070700_100161545 | 3300005441 | Bacteria | 1543 |
| 103 | Ga0070694_100046855 | 3300005444 | Bacteria | 2904 |
| 104 | Ga0070694_101373582 | 3300005444 | Bacteria | 595 |
| 105 | Ga0070708_101309207 | 3300005445 | Bacteria | 677 |
| 106 | Ga0070663_100116425 | 3300005455 | Bacteria | 2014 |
| 107 | Ga0070663_100154628 | 3300005455 | Bacteria | 1761 |
| 108 | Ga0070663_100430002 | 3300005455 | Bacteria | 1084 |
| 109 | Ga0070663_100613117 | 3300005455 | Bacteria | 917 |
| 110 | Ga0070678_100020582 | 3300005456 | Bacteria | 4331 |
| 111 | Ga0070678_100099383 | 3300005456 | Bacteria | 2251 |
| 112 | Ga0070678_100301549 | 3300005456 | Bacteria | 1362 |
| 113 | Ga0070678_100424540 | 3300005456 | Bacteria | 1160 |
| 114 | Ga0070662_100102075 | 3300005457 | Bacteria | 2172 |
| 115 | Ga0070662_100286323 | 3300005457 | Bacteria | 1335 |
| 116 | Ga0070662_100305495 | 3300005457 | Bacteria | 1293 |
| 117 | Ga0070662_100456267 | 3300005457 | Bacteria | 1061 |
| 118 | Ga0070662_100567120 | 3300005457 | Bacteria | 952 |
| 119 | Ga0070662_100872865 | 3300005457 | Bacteria | 767 |
| 120 | Ga0070681_10185659 | 3300005458 | Bacteria | 2000 |
| 121 | Ga0070681_11149784 | 3300005458 | Bacteria | 698 |
| 122 | Ga0068867_100004535 | 3300005459 | Bacteria | 9763 |
| 123 | Ga0068867_100091878 | 3300005459 | Bacteria | 2304 |
| 124 | Ga0068867_101109587 | 3300005459 | Bacteria | 723 |
| 125 | Ga0070679_101959082 | 3300005530 | Bacteria | 535 |
| 126 | Ga0068853_100140615 | 3300005539 | Bacteria | 2167 |
| 127 | Ga0068853_100143367 | 3300005539 | Bacteria | 2145 |
| 128 | Ga0068853_100680256 | 3300005539 | Bacteria | 980 |
| 129 | Ga0068853_101255935 | 3300005539 | Bacteria | 715 |
| 130 | Ga0070672_100111378 | 3300005543 | Bacteria | 2231 |
| 131 | Ga0070672_100167954 | 3300005543 | Bacteria | 1823 |
| 132 | Ga0070672_100179493 | 3300005543 | Bacteria | 1764 |
| 133 | Ga0070672_100224987 | 3300005543 | Bacteria | 1574 |
| 134 | Ga0070672_100858471 | 3300005543 | Bacteria | 800 |
| 135 | Ga0070686_101479710 | 3300005544 | Bacteria | 572 |
| 136 | Ga0070695_101427466 | 3300005545 | Bacteria | 574 |
| 137 | Ga0070696_100017763 | 3300005546 | Bacteria | 4802 |
| 138 | Ga0070696_100322224 | 3300005546 | Bacteria | 1190 |
| 139 | Ga0070665_100043393 | 3300005548 | Bacteria | 4519 |
| 140 | Ga0070665_100093206 | 3300005548 | Bacteria | 3016 |
| 141 | Ga0070665_100578818 | 3300005548 | Bacteria | 1136 |
| 142 | Ga0070704_100588388 | 3300005549 | Bacteria | 977 |
| 143 | Ga0070704_101037899 | 3300005549 | Bacteria | 743 |
| 144 | Ga0068855_100383221 | 3300005563 | Bacteria | 1543 |
| 145 | Ga0068855_101506168 | 3300005563 | Bacteria | 691 |
| 146 | Ga0070664_100036985 | 3300005564 | Bacteria | 4103 |
| 147 | Ga0070664_100341882 | 3300005564 | Bacteria | 1359 |
| 148 | Ga0070664_100366566 | 3300005564 | Bacteria | 1313 |
| 149 | Ga0070664_100439599 | 3300005564 | Bacteria | 1196 |
| 150 | Ga0070664_101143950 | 3300005564 | Bacteria | 734 |
| 151 | Ga0070664_101456881 | 3300005564 | Bacteria | 648 |
| 152 | Ga0068857_100558037 | 3300005577 | Bacteria | 1079 |
| 153 | Ga0068857_101414475 | 3300005577 | Bacteria | 677 |
| 154 | Ga0068854_100107638 | 3300005578 | Bacteria | 2099 |
| 155 | Ga0068852_101569414 | 3300005616 | Bacteria | 681 |
| 156 | Ga0068859_100003314 | 3300005617 | Bacteria | 16364 |
| 157 | Ga0068859_100056343 | 3300005617 | Bacteria | 3955 |
| 158 | Ga0068859_100156934 | 3300005617 | Bacteria | 2353 |
| 159 | Ga0068859_100159089 | 3300005617 | Bacteria | 2337 |
| 160 | Ga0068864_100002491 | 3300005618 | Bacteria | 15219 |
| 161 | Ga0068864_100039730 | 3300005618 | Bacteria | 4021 |
| 162 | Ga0068864_100618311 | 3300005618 | Bacteria | 1053 |
| 163 | Ga0068866_10160423 | 3300005718 | Bacteria | 1311 |
| 164 | Ga0068866_10173232 | 3300005718 | Bacteria | 1268 |
| 165 | Ga0068861_100079732 | 3300005719 | Bacteria | 2560 |
| 166 | Ga0068861_100858086 | 3300005719 | Bacteria | 857 |
| 167 | Ga0068870_10062197 | 3300005840 | Bacteria | 2010 |
| 168 | Ga0068870_10490947 | 3300005840 | Bacteria | 817 |
| 169 | Ga0068870_10633028 | 3300005840 | Bacteria | 731 |
| 170 | Ga0068870_11247793 | 3300005840 | Bacteria | 540 |
| 171 | Ga0068863_100021286 | 3300005841 | Bacteria | 6189 |
| 172 | Ga0068863_100053086 | 3300005841 | Bacteria | 3841 |
| 173 | Ga0068863_100121571 | 3300005841 | Bacteria | 2490 |
| 174 | Ga0068863_100417823 | 3300005841 | Bacteria | 1313 |
| 175 | Ga0068858_100004068 | 3300005842 | Bacteria | 14403 |
| 176 | Ga0068858_100480250 | 3300005842 | Bacteria | 1199 |
| 177 | Ga0068858_100620712 | 3300005842 | Bacteria | 1049 |
| 178 | Ga0068860_100031635 | 3300005843 | Bacteria | 5086 |
| 179 | Ga0068860_100126139 | 3300005843 | Bacteria | 2453 |
| 180 | Ga0068860_100359305 | 3300005843 | Bacteria | 1434 |
| 181 | Ga0068860_100390251 | 3300005843 | Bacteria | 1375 |
| 182 | Ga0068860_101419385 | 3300005843 | Bacteria | 715 |
| 183 | Ga0068862_100059849 | 3300005844 | Bacteria | 3271 |
| 184 | Ga0068862_100101210 | 3300005844 | Bacteria | 2520 |
| 185 | Ga0068862_100202295 | 3300005844 | Bacteria | 1791 |
| 186 | Ga0068862_100237862 | 3300005844 | Bacteria | 1654 |
| 187 | Ga0068862_100244321 | 3300005844 | Bacteria | 1633 |
| 188 | Ga0068862_100368540 | 3300005844 | Bacteria | 1336 |
| 189 | Ga0068862_100443406 | 3300005844 | Bacteria | 1222 |
| 190 | Ga0068862_100742103 | 3300005844 | Bacteria | 954 |
| 191 | Ga0068862_100805571 | 3300005844 | Bacteria | 917 |
| 192 | Ga0068862_101687584 | 3300005844 | Bacteria | 642 |
| 193 | Ga0081539_10019248 | 3300005985 | Bacteria | 4683 |
| 194 | Ga0075368_10552403 | 3300006042 | Bacteria | 518 |
| 195 | Ga0075364_11193312 | 3300006051 | Bacteria | 516 |
| 196 | Ga0070712_100043947 | 3300006175 | Bacteria | 3078 |
| 197 | Ga0075366_10078589 | 3300006195 | Bacteria | 1969 |
| 198 | Ga0075366_10481337 | 3300006195 | Bacteria | 767 |
| 199 | Ga0075366_10934023 | 3300006195 | Bacteria | 541 |
| 200 | Ga0097621_100013419 | 3300006237 | Bacteria | 6107 |
| 201 | Ga0097621_101256226 | 3300006237 | Bacteria | 698 |
| 202 | Ga0097621_102319306 | 3300006237 | Bacteria | 514 |
| 203 | Ga0075370_10092311 | 3300006353 | Bacteria | 1747 |
| 204 | Ga0075370_10495879 | 3300006353 | Bacteria | 737 |
| 205 | Ga0068871_100025733 | 3300006358 | Bacteria | 4582 |
| 206 | Ga0075428_100136242 | 3300006844 | Bacteria | 2669 |
| 207 | Ga0075428_100485419 | 3300006844 | Bacteria | 1322 |
| 208 | Ga0075430_100620644 | 3300006846 | Bacteria | 892 |
| 209 | Ga0075431_100135405 | 3300006847 | Bacteria | 2539 |
| 210 | Ga0075434_100407578 | 3300006871 | Bacteria | 1380 |
| 211 | Ga0075434_102079706 | 3300006871 | Bacteria | 572 |
| 212 | Ga0068865_100522794 | 3300006881 | Bacteria | 992 |
| 213 | Ga0068865_100902546 | 3300006881 | Bacteria | 768 |
| 214 | Ga0068865_101600131 | 3300006881 | Bacteria | 586 |
| 215 | Ga0097620_100003314 | 3300006931 | Bacteria | 16364 |
| 216 | Ga0097620_100056349 | 3300006931 | Bacteria | 3955 |
| 217 | Ga0097620_100156943 | 3300006931 | Bacteria | 2353 |
| 218 | Ga0097620_100159093 | 3300006931 | Bacteria | 2337 |
| 219 | Ga0075435_100293915 | 3300007076 | Bacteria | 1388 |
| 220 | Ga0105250_10028500 | 3300009092 | Bacteria | 2248 |
| 221 | Ga0105250_10249058 | 3300009092 | Bacteria | 759 |
| 222 | Ga0105240_10551710 | 3300009093 | Bacteria | 1275 |
| 223 | Ga0111539_10049029 | 3300009094 | Bacteria | 5039 |
| 224 | Ga0111539_10732388 | 3300009094 | Bacteria | 1151 |
| 225 | Ga0111539_11658830 | 3300009094 | Bacteria | 741 |
| 226 | Ga0105245_10466695 | 3300009098 | Bacteria | 1274 |
| 227 | Ga0105245_12060467 | 3300009098 | Bacteria | 624 |
| 228 | Ga0105247_10184228 | 3300009101 | Bacteria | 1395 |
| 229 | Ga0114129_10364296 | 3300009147 | Bacteria | 1912 |
| 230 | Ga0105243_10177410 | 3300009148 | Bacteria | 1850 |
| 231 | Ga0105243_10633423 | 3300009148 | Bacteria | 1034 |
| 232 | Ga0105243_11471493 | 3300009148 | Bacteria | 704 |
| 233 | Ga0105243_12081884 | 3300009148 | Bacteria | 603 |
| 234 | Ga0105243_12090317 | 3300009148 | Bacteria | 602 |
| 235 | Ga0105241_10998788 | 3300009174 | Bacteria | 783 |
| 236 | Ga0105241_11224091 | 3300009174 | Bacteria | 712 |
| 237 | Ga0105242_10440468 | 3300009176 | Bacteria | 1226 |
| 238 | Ga0105242_11097517 | 3300009176 | Bacteria | 809 |
| 239 | Ga0105242_11842400 | 3300009176 | Bacteria | 644 |
| 240 | Ga0105248_10006714 | 3300009177 | Bacteria | 12621 |
| 241 | Ga0105248_10160056 | 3300009177 | Bacteria | 2540 |
| 242 | Ga0105248_10192438 | 3300009177 | Bacteria | 2298 |
| 243 | Ga0105248_10384527 | 3300009177 | Bacteria | 1580 |
| 244 | Ga0105248_10939619 | 3300009177 | Bacteria | 977 |
| 245 | Ga0105248_11516711 | 3300009177 | Bacteria | 759 |
| 246 | Ga0105237_11436505 | 3300009545 | Bacteria | 696 |
| 247 | Ga0105249_10097841 | 3300009553 | Bacteria | 2755 |
| 248 | Ga0105249_10536055 | 3300009553 | Bacteria | 1220 |
| 249 | Ga0105249_11183069 | 3300009553 | Bacteria | 835 |
| 250 | Ga0105249_11325169 | 3300009553 | Bacteria | 792 |
| 251 | Ga0105032_117129 | 3300009979 | Bacteria | 570 |
| 252 | Ga0105239_10558577 | 3300010375 | Bacteria | 1304 |
| 253 | Ga0157325_1027496 | 3300012485 | Bacteria | 550 |
| 254 | Ga0157315_1053009 | 3300012508 | Bacteria | 551 |
| 255 | Ga0157327_1004904 | 3300012512 | Bacteria | 1060 |
| 256 | Ga0157373_10141777 | 3300013100 | Bacteria | 1690 |
| 257 | Ga0157373_10299516 | 3300013100 | Bacteria | 1141 |
| 258 | Ga0157373_10651715 | 3300013100 | Bacteria | 769 |
| 259 | Ga0157373_10955924 | 3300013100 | Bacteria | 638 |
| 260 | Ga0157371_10594172 | 3300013102 | Bacteria | 823 |
| 261 | Ga0157369_10006198 | 3300013105 | Bacteria | 13875 |
| 262 | Ga0157369_11061297 | 3300013105 | Bacteria | 829 |
| 263 | Ga0163162_10052322 | 3300013306 | Bacteria | 4101 |
| 264 | Ga0163162_10336158 | 3300013306 | Bacteria | 1643 |
| 265 | Ga0163162_10338001 | 3300013306 | Bacteria | 1638 |
| 266 | Ga0163162_10344969 | 3300013306 | Bacteria | 1622 |
| 267 | Ga0163162_11626712 | 3300013306 | Bacteria | 737 |
| 268 | Ga0157375_10077381 | 3300013308 | Bacteria | 3356 |
| 269 | Ga0157375_10194162 | 3300013308 | Bacteria | 2185 |
| 270 | Ga0157375_10965695 | 3300013308 | Bacteria | 993 |
| 271 | Ga0157375_11227466 | 3300013308 | Bacteria | 880 |
| 272 | Ga0157375_11929267 | 3300013308 | Bacteria | 701 |
| 273 | Ga0157375_12710477 | 3300013308 | Bacteria | 593 |
| 274 | Ga0163163_10004858 | 3300014325 | Bacteria | 11551 |
| 275 | Ga0157380_10338680 | 3300014326 | Bacteria | 1402 |
| 276 | Ga0157380_10732531 | 3300014326 | Bacteria | 998 |
| 277 | Ga0157380_11039521 | 3300014326 | Bacteria | 855 |
| 278 | Ga0157377_10463159 | 3300014745 | Bacteria | 878 |
| 279 | Ga0157377_10679824 | 3300014745 | Bacteria | 745 |
| 280 | Ga0157379_10038791 | 3300014968 | Bacteria | 4249 |
| 281 | Ga0157379_11002470 | 3300014968 | Bacteria | 796 |
| 282 | Ga0157376_11568889 | 3300014969 | Bacteria | 692 |
| 283 | Ga0163161_10299503 | 3300017792 | Bacteria | 1266 |
| 284 | Ga0163161_10824666 | 3300017792 | Bacteria | 781 |
| 285 | Ga0207666_1012243 | 3300025271 | Bacteria | 1193 |
| 286 | Ga0207697_10001580 | 3300025315 | Bacteria | 12319 |
| 287 | Ga0207697_10035806 | 3300025315 | Bacteria | 2033 |
| 288 | Ga0207697_10067099 | 3300025315 | Bacteria | 1500 |
| 289 | Ga0207697_10535790 | 3300025315 | Bacteria | 515 |
| 290 | Ga0207696_1007651 | 3300025711 | Bacteria | 4210 |
| 291 | Ga0207696_1132876 | 3300025711 | Bacteria | 668 |
| 292 | Ga0207653_10375817 | 3300025885 | Bacteria | 556 |
| 293 | Ga0207682_10006590 | 3300025893 | Bacteria | 4672 |
| 294 | Ga0207682_10054106 | 3300025893 | Bacteria | 1667 |
| 295 | Ga0207682_10072275 | 3300025893 | Bacteria | 1463 |
| 296 | Ga0207682_10125454 | 3300025893 | Bacteria | 1142 |
| 297 | Ga0207682_10282905 | 3300025893 | Bacteria | 776 |
| 298 | Ga0207642_10060758 | 3300025899 | Bacteria | 1754 |
| 299 | Ga0207642_10078048 | 3300025899 | Bacteria | 1599 |
| 300 | Ga0207710_10168754 | 3300025900 | Bacteria | 1069 |
| 301 | Ga0207688_10100962 | 3300025901 | Bacteria | 1666 |
| 302 | Ga0207688_10162329 | 3300025901 | Bacteria | 1325 |
| 303 | Ga0207688_10396505 | 3300025901 | Bacteria | 855 |
| 304 | Ga0207647_10038196 | 3300025904 | Bacteria | 3037 |
| 305 | Ga0207647_10196815 | 3300025904 | Bacteria | 1167 |
| 306 | Ga0207647_10378421 | 3300025904 | Bacteria | 799 |
| 307 | Ga0207645_10014351 | 3300025907 | Bacteria | 5302 |
| 308 | Ga0207645_10062998 | 3300025907 | Bacteria | 2369 |
| 309 | Ga0207645_10088987 | 3300025907 | Bacteria | 1985 |
| 310 | Ga0207645_10094021 | 3300025907 | Bacteria | 1929 |
| 311 | Ga0207645_10400732 | 3300025907 | Bacteria | 923 |
| 312 | Ga0207645_10855819 | 3300025907 | Bacteria | 618 |
| 313 | Ga0207643_10053194 | 3300025908 | Bacteria | 2300 |
| 314 | Ga0207643_10242261 | 3300025908 | Bacteria | 1109 |
| 315 | Ga0207643_10364529 | 3300025908 | Bacteria | 909 |
| 316 | Ga0207643_10461573 | 3300025908 | Bacteria | 809 |
| 317 | Ga0207643_11002433 | 3300025908 | Bacteria | 540 |
| 318 | Ga0207654_10252074 | 3300025911 | Bacteria | 1184 |
| 319 | Ga0207707_10082443 | 3300025912 | Bacteria | 2808 |
| 320 | Ga0207671_10982750 | 3300025914 | Bacteria | 665 |
| 321 | Ga0207693_10253115 | 3300025915 | Bacteria | 1382 |
| 322 | Ga0207662_10323409 | 3300025918 | Bacteria | 1030 |
| 323 | Ga0207657_10472898 | 3300025919 | Bacteria | 983 |
| 324 | Ga0207657_10543695 | 3300025919 | Bacteria | 908 |
| 325 | Ga0207657_11027366 | 3300025919 | Bacteria | 632 |
| 326 | Ga0207649_10099638 | 3300025920 | Bacteria | 1920 |
| 327 | Ga0207649_10694314 | 3300025920 | Bacteria | 789 |
| 328 | Ga0207649_10790023 | 3300025920 | Bacteria | 740 |
| 329 | Ga0207652_11289783 | 3300025921 | Bacteria | 633 |
| 330 | Ga0207681_10001216 | 3300025923 | Bacteria | 16580 |
| 331 | Ga0207681_10041111 | 3300025923 | Bacteria | 3080 |
| 332 | Ga0207681_10518931 | 3300025923 | Bacteria | 977 |
| 333 | Ga0207681_10522152 | 3300025923 | Bacteria | 974 |
| 334 | Ga0207681_10549365 | 3300025923 | Bacteria | 950 |
| 335 | Ga0207681_10562070 | 3300025923 | Bacteria | 940 |
| 336 | Ga0207681_10900775 | 3300025923 | Bacteria | 741 |
| 337 | Ga0207681_10974693 | 3300025923 | Bacteria | 711 |
| 338 | Ga0207681_11062990 | 3300025923 | Bacteria | 679 |
| 339 | Ga0207681_11072264 | 3300025923 | Bacteria | 676 |
| 340 | Ga0207681_11305249 | 3300025923 | Bacteria | 609 |
| 341 | Ga0207681_11855488 | 3300025923 | Bacteria | 502 |
| 342 | Ga0207650_10012172 | 3300025925 | Bacteria | 5931 |
| 343 | Ga0207650_10033934 | 3300025925 | Bacteria | 3699 |
| 344 | Ga0207650_10084415 | 3300025925 | Bacteria | 2414 |
| 345 | Ga0207650_10300150 | 3300025925 | Bacteria | 1312 |
| 346 | Ga0207650_10369470 | 3300025925 | Bacteria | 1183 |
| 347 | Ga0207650_10472425 | 3300025925 | Bacteria | 1046 |
| 348 | Ga0207650_10704018 | 3300025925 | Bacteria | 853 |
| 349 | Ga0207650_10713455 | 3300025925 | Bacteria | 847 |
| 350 | Ga0207650_10783370 | 3300025925 | Bacteria | 808 |
| 351 | Ga0207659_10001819 | 3300025926 | Bacteria | 12629 |
| 352 | Ga0207659_10112471 | 3300025926 | Bacteria | 2072 |
| 353 | Ga0207659_10482092 | 3300025926 | Bacteria | 1048 |
| 354 | Ga0207659_10885959 | 3300025926 | Bacteria | 767 |
| 355 | Ga0207659_11278510 | 3300025926 | Bacteria | 630 |
| 356 | Ga0207659_11365502 | 3300025926 | Bacteria | 608 |
| 357 | Ga0207644_10013980 | 3300025931 | Bacteria | 5364 |
| 358 | Ga0207644_10111263 | 3300025931 | Bacteria | 2071 |
| 359 | Ga0207644_10243859 | 3300025931 | Bacteria | 1431 |
| 360 | Ga0207644_10724008 | 3300025931 | Bacteria | 830 |
| 361 | Ga0207644_10896058 | 3300025931 | Bacteria | 743 |
| 362 | Ga0207690_10014888 | 3300025932 | Bacteria | 4708 |
| 363 | Ga0207690_10151034 | 3300025932 | Bacteria | 1722 |
| 364 | Ga0207690_10350141 | 3300025932 | Bacteria | 1168 |
| 365 | Ga0207706_10000284 | 3300025933 | Bacteria | 55240 |
| 366 | Ga0207706_10303158 | 3300025933 | Bacteria | 1392 |
| 367 | Ga0207706_10337505 | 3300025933 | Bacteria | 1311 |
| 368 | Ga0207706_10347419 | 3300025933 | Bacteria | 1290 |
| 369 | Ga0207706_10558457 | 3300025933 | Bacteria | 985 |
| 370 | Ga0207706_10658424 | 3300025933 | Bacteria | 896 |
| 371 | Ga0207706_10864893 | 3300025933 | Bacteria | 765 |
| 372 | Ga0207706_11016931 | 3300025933 | Bacteria | 696 |
| 373 | Ga0207706_11165885 | 3300025933 | Bacteria | 641 |
| 374 | Ga0207686_11162733 | 3300025934 | Bacteria | 631 |
| 375 | Ga0207709_10133892 | 3300025935 | Bacteria | 1693 |
| 376 | Ga0207709_10143267 | 3300025935 | Bacteria | 1645 |
| 377 | Ga0207709_10539830 | 3300025935 | Bacteria | 916 |
| 378 | Ga0207709_11426508 | 3300025935 | Bacteria | 574 |
| 379 | Ga0207669_10036225 | 3300025937 | Bacteria | 2817 |
| 380 | Ga0207669_10176805 | 3300025937 | Bacteria | 1525 |
| 381 | Ga0207669_10217707 | 3300025937 | Bacteria | 1399 |
| 382 | Ga0207669_10330884 | 3300025937 | Bacteria | 1169 |
| 383 | Ga0207669_10916008 | 3300025937 | Bacteria | 733 |
| 384 | Ga0207669_11385341 | 3300025937 | Bacteria | 598 |
| 385 | Ga0207704_10077052 | 3300025938 | Bacteria | 2139 |
| 386 | Ga0207704_10148137 | 3300025938 | Bacteria | 1652 |
| 387 | Ga0207704_10776914 | 3300025938 | Bacteria | 798 |
| 388 | Ga0207691_10017921 | 3300025940 | Bacteria | 6710 |
| 389 | Ga0207691_10098382 | 3300025940 | Bacteria | 2613 |
| 390 | Ga0207691_10151074 | 3300025940 | Bacteria | 2042 |
| 391 | Ga0207691_10209251 | 3300025940 | Bacteria | 1695 |
| 392 | Ga0207691_10251286 | 3300025940 | Bacteria | 1526 |
| 393 | Ga0207691_10383118 | 3300025940 | Bacteria | 1200 |
| 394 | Ga0207691_10494545 | 3300025940 | Bacteria | 1039 |
| 395 | Ga0207691_10527775 | 3300025940 | Bacteria | 1002 |
| 396 | Ga0207691_10568742 | 3300025940 | Bacteria | 961 |
| 397 | Ga0207711_10000187 | 3300025941 | Bacteria | 66307 |
| 398 | Ga0207711_10002648 | 3300025941 | Bacteria | 15820 |
| 399 | Ga0207711_10146986 | 3300025941 | Bacteria | 2124 |
| 400 | Ga0207711_10311962 | 3300025941 | Bacteria | 1452 |
| 401 | Ga0207711_10830241 | 3300025941 | Bacteria | 860 |
| 402 | Ga0207689_10027620 | 3300025942 | Bacteria | 4749 |
| 403 | Ga0207689_10273854 | 3300025942 | Bacteria | 1397 |
| 404 | Ga0207689_10679147 | 3300025942 | Bacteria | 868 |
| 405 | Ga0207689_10839995 | 3300025942 | Bacteria | 775 |
| 406 | Ga0207679_10000847 | 3300025945 | Bacteria | 19669 |
| 407 | Ga0207679_10178447 | 3300025945 | Bacteria | 1755 |
| 408 | Ga0207679_10476415 | 3300025945 | Bacteria | 1111 |
| 409 | Ga0207679_10690008 | 3300025945 | Bacteria | 926 |
| 410 | Ga0207679_11034195 | 3300025945 | Bacteria | 753 |
| 411 | Ga0207679_11311878 | 3300025945 | Bacteria | 664 |
| 412 | Ga0207667_10844202 | 3300025949 | Bacteria | 910 |
| 413 | Ga0207667_11974698 | 3300025949 | Bacteria | 544 |
| 414 | Ga0207651_10051794 | 3300025960 | Bacteria | 2795 |
| 415 | Ga0207651_10057032 | 3300025960 | Bacteria | 2691 |
| 416 | Ga0207651_10149405 | 3300025960 | Bacteria | 1816 |
| 417 | Ga0207651_10463917 | 3300025960 | Bacteria | 1089 |
| 418 | Ga0207651_10653663 | 3300025960 | Bacteria | 923 |
| 419 | Ga0207651_11490797 | 3300025960 | Bacteria | 609 |
| 420 | Ga0207651_11906616 | 3300025960 | Bacteria | 534 |
| 421 | Ga0207712_10000723 | 3300025961 | Bacteria | 25323 |
| 422 | Ga0207712_10058661 | 3300025961 | Bacteria | 2720 |
| 423 | Ga0207712_10528760 | 3300025961 | Bacteria | 1012 |
| 424 | Ga0207712_11218363 | 3300025961 | Bacteria | 672 |
| 425 | Ga0207668_10000062 | 3300025972 | Bacteria | 88123 |
| 426 | Ga0207668_10005099 | 3300025972 | Bacteria | 7729 |
| 427 | Ga0207668_10307609 | 3300025972 | Bacteria | 1310 |
| 428 | Ga0207668_10489488 | 3300025972 | Bacteria | 1056 |
| 429 | Ga0207668_10555107 | 3300025972 | Bacteria | 995 |
| 430 | Ga0207668_10652594 | 3300025972 | Bacteria | 921 |
| 431 | Ga0207668_11391155 | 3300025972 | Bacteria | 632 |
| 432 | Ga0207668_11532923 | 3300025972 | Bacteria | 601 |
| 433 | Ga0207668_11629839 | 3300025972 | Bacteria | 582 |
| 434 | Ga0207668_11970300 | 3300025972 | Bacteria | 526 |
| 435 | Ga0207640_10411255 | 3300025981 | Bacteria | 1104 |
| 436 | Ga0207640_10507195 | 3300025981 | Bacteria | 1006 |
| 437 | Ga0207640_10712610 | 3300025981 | Bacteria | 861 |
| 438 | Ga0207640_10799406 | 3300025981 | Bacteria | 817 |
| 439 | Ga0207658_10009384 | 3300025986 | Bacteria | 6636 |
| 440 | Ga0207658_10097851 | 3300025986 | Bacteria | 2291 |
| 441 | Ga0207658_10099440 | 3300025986 | Bacteria | 2275 |
| 442 | Ga0207658_10100496 | 3300025986 | Bacteria | 2264 |
| 443 | Ga0207658_10239370 | 3300025986 | Bacteria | 1536 |
| 444 | Ga0207658_11115281 | 3300025986 | Bacteria | 721 |
| 445 | Ga0207677_10161348 | 3300026023 | Bacteria | 1742 |
| 446 | Ga0207677_10414289 | 3300026023 | Bacteria | 1146 |
| 447 | Ga0207677_10819684 | 3300026023 | Bacteria | 834 |
| 448 | Ga0207703_10001977 | 3300026035 | Bacteria | 18099 |
| 449 | Ga0207703_10010836 | 3300026035 | Bacteria | 7111 |
| 450 | Ga0207703_10599177 | 3300026035 | Bacteria | 1042 |
| 451 | Ga0207639_10111479 | 3300026041 | Bacteria | 2230 |
| 452 | Ga0207678_10370331 | 3300026067 | Bacteria | 1237 |
| 453 | Ga0207678_10771868 | 3300026067 | Bacteria | 848 |
| 454 | Ga0207678_11458363 | 3300026067 | Bacteria | 604 |
| 455 | Ga0207678_11720542 | 3300026067 | Bacteria | 550 |
| 456 | Ga0207708_10078244 | 3300026075 | Bacteria | 2539 |
| 457 | Ga0207708_10417118 | 3300026075 | Bacteria | 1113 |
| 458 | Ga0207641_10001914 | 3300026088 | Bacteria | 19977 |
| 459 | Ga0207641_10048399 | 3300026088 | Bacteria | 3588 |
| 460 | Ga0207641_10303995 | 3300026088 | Bacteria | 1507 |
| 461 | Ga0207641_11644770 | 3300026088 | Bacteria | 644 |
| 462 | Ga0207648_10008052 | 3300026089 | Bacteria | 10268 |
| 463 | Ga0207648_10085028 | 3300026089 | Bacteria | 2759 |
| 464 | Ga0207648_10528360 | 3300026089 | Bacteria | 1082 |
| 465 | Ga0207648_11964576 | 3300026089 | Bacteria | 546 |
| 466 | Ga0207676_10000887 | 3300026095 | Bacteria | 23213 |
| 467 | Ga0207676_10136979 | 3300026095 | Bacteria | 2090 |
| 468 | Ga0207674_10200772 | 3300026116 | Bacteria | 1943 |
| 469 | Ga0207674_10248268 | 3300026116 | Bacteria | 1726 |
| 470 | Ga0207674_10326381 | 3300026116 | Bacteria | 1484 |
| 471 | Ga0207675_100058362 | 3300026118 | Bacteria | 3601 |
| 472 | Ga0207675_100112244 | 3300026118 | Bacteria | 2572 |
| 473 | Ga0207675_100427779 | 3300026118 | Bacteria | 1308 |
| 474 | Ga0207675_100939393 | 3300026118 | Bacteria | 882 |
| 475 | Ga0207675_101010232 | 3300026118 | Bacteria | 850 |
| 476 | Ga0207683_10048556 | 3300026121 | Bacteria | 3716 |
| 477 | Ga0207683_10062679 | 3300026121 | Bacteria | 3275 |
| 478 | Ga0207683_10083383 | 3300026121 | Bacteria | 2841 |
| 479 | Ga0207683_10195383 | 3300026121 | Bacteria | 1838 |
| 480 | Ga0209973_1018889 | 3300027252 | Bacteria | 898 |
| 481 | Ga0209967_1006839 | 3300027364 | Bacteria | 1554 |
| 482 | Ga0209967_1019832 | 3300027364 | Bacteria | 978 |
| 483 | Ga0209996_1039259 | 3300027395 | Bacteria | 701 |
| 484 | Ga0210000_1085988 | 3300027462 | Bacteria | 517 |
| 485 | Ga0209995_1021235 | 3300027471 | Bacteria | 1076 |
| 486 | Ga0209999_1017123 | 3300027543 | Bacteria | 1320 |
| 487 | Ga0209999_1018091 | 3300027543 | Bacteria | 1288 |
| 488 | Ga0209982_1041017 | 3300027552 | Bacteria | 738 |
| 489 | Ga0209970_1092736 | 3300027614 | Bacteria | 574 |
| 490 | Ga0210002_1015203 | 3300027617 | Bacteria | 1211 |
| 491 | Ga0210002_1044249 | 3300027617 | Bacteria | 760 |
| 492 | Ga0209983_1004203 | 3300027665 | Bacteria | 3037 |
| 493 | Ga0209983_1026942 | 3300027665 | Bacteria | 1217 |
| 494 | Ga0209971_1008830 | 3300027682 | Bacteria | 2391 |
| 495 | Ga0209971_1018387 | 3300027682 | Bacteria | 1658 |
| 496 | Ga0209971_1099775 | 3300027682 | Bacteria | 711 |
| 497 | Ga0209974_10006589 | 3300027876 | Bacteria | 4043 |
| 498 | Ga0209974_10026176 | 3300027876 | Bacteria | 1931 |
| 499 | Ga0207428_10035157 | 3300027907 | Bacteria | 4097 |
| 500 | Ga0207428_11058933 | 3300027907 | Bacteria | 568 |
| 501 | Ga0268266_10415156 | 3300028379 | Bacteria | 1275 |
| 502 | Ga0268266_10454790 | 3300028379 | Bacteria | 1217 |
| 503 | Ga0268265_10071746 | 3300028380 | Bacteria | 2698 |
| 504 | Ga0268265_10174961 | 3300028380 | Bacteria | 1838 |
| 505 | Ga0268265_10182671 | 3300028380 | Bacteria | 1803 |
| 506 | Ga0268265_10244660 | 3300028380 | Bacteria | 1585 |
| 507 | Ga0268265_10279378 | 3300028380 | Bacteria | 1493 |
| 508 | Ga0268265_10607693 | 3300028380 | Bacteria | 1046 |
| 509 | Ga0268265_11192780 | 3300028380 | Bacteria | 758 |
| 510 | Ga0268265_12715020 | 3300028380 | Bacteria | 500 |
| 511 | Ga0268264_10032595 | 3300028381 | Bacteria | 4275 |
| 512 | Ga0268264_10049844 | 3300028381 | Bacteria | 3485 |
| 513 | Ga0268264_10085501 | 3300028381 | Bacteria | 2707 |
| 514 | Ga0268264_10181307 | 3300028381 | Bacteria | 1913 |
| 515 | Ga0268264_12022403 | 3300028381 | Bacteria | 585 |
| 516 | Ga0268264_12028648 | 3300028381 | Bacteria | 584 |
| 517 | Ga0268264_12617168 | 3300028381 | Bacteria | 509 |
| 518 | Ga0307515_10499480 | 3300028794 | Bacteria | 827 |
| 519 | Ga0316177_1095584 | 3300030731 | Bacteria | 1544 |
| 520 | Ga0316176_1032322 | 3300030732 | Bacteria | 949 |
| 521 | Ga0314311_1156759 | 3300030733 | Bacteria | 566 |
| 522 | Ga0316178_1181760 | 3300030735 | Bacteria | 978 |
| 523 | Ga0316180_1044038 | 3300030736 | Bacteria | 632 |
| 524 | Ga0316181_1190288 | 3300030744 | Bacteria | 567 |
| 525 | Ga0316181_1197219 | 3300030744 | Bacteria | 931 |
| 526 | Ga0316182_1336707 | 3300030745 | Bacteria | 670 |
| 527 | Ga0316182_1382068 | 3300030745 | Bacteria | 827 |
| 528 | Ga0307513_10080829 | 3300031456 | Bacteria | 3351 |
| 529 | Ga0307408_100011902 | 3300031548 | Bacteria | 5756 |
| 530 | Ga0307408_100029728 | 3300031548 | Bacteria | 3788 |
| 531 | Ga0307408_100037962 | 3300031548 | Bacteria | 3396 |
| 532 | Ga0307408_100156015 | 3300031548 | Bacteria | 1807 |
| 533 | Ga0307408_100226414 | 3300031548 | Bacteria | 1529 |
| 534 | Ga0307408_100259848 | 3300031548 | Bacteria | 1437 |
| 535 | Ga0307408_100269957 | 3300031548 | Bacteria | 1412 |
| 536 | Ga0307408_100316085 | 3300031548 | Bacteria | 1314 |
| 537 | Ga0307408_100439960 | 3300031548 | Bacteria | 1128 |
| 538 | Ga0307408_100720196 | 3300031548 | Bacteria | 898 |
| 539 | Ga0307408_100810258 | 3300031548 | Bacteria | 850 |
| 540 | Ga0307408_100935096 | 3300031548 | Bacteria | 795 |
| 541 | Ga0307408_101245240 | 3300031548 | Bacteria | 695 |
| 542 | Ga0307408_101606305 | 3300031548 | Bacteria | 617 |
| 543 | Ga0307408_102087860 | 3300031548 | Bacteria | 546 |
| 544 | Ga0307408_102205024 | 3300031548 | Bacteria | 532 |
| 545 | Ga0307405_10010430 | 3300031731 | Bacteria | 4814 |
| 546 | Ga0307405_10018478 | 3300031731 | Bacteria | 3846 |
| 547 | Ga0307405_10023082 | 3300031731 | Bacteria | 3529 |
| 548 | Ga0307405_10039649 | 3300031731 | Bacteria | 2848 |
| 549 | Ga0307405_10155256 | 3300031731 | Bacteria | 1614 |
| 550 | Ga0307405_10233894 | 3300031731 | Bacteria | 1356 |
| 551 | Ga0307405_10334054 | 3300031731 | Bacteria | 1162 |
| 552 | Ga0307405_10341844 | 3300031731 | Bacteria | 1151 |
| 553 | Ga0307405_10437606 | 3300031731 | Bacteria | 1033 |
| 554 | Ga0307405_10753482 | 3300031731 | Bacteria | 811 |
| 555 | Ga0307405_10916131 | 3300031731 | Bacteria | 742 |
| 556 | Ga0307405_10984772 | 3300031731 | Bacteria | 718 |
| 557 | Ga0307405_11175338 | 3300031731 | Bacteria | 662 |
| 558 | Ga0307405_11922413 | 3300031731 | Bacteria | 528 |
| 559 | Ga0307405_12092790 | 3300031731 | Bacteria | 508 |
| 560 | Ga0307413_10028039 | 3300031824 | Bacteria | 3129 |
| 561 | Ga0307413_10030478 | 3300031824 | Bacteria | 3030 |
| 562 | Ga0307413_10047616 | 3300031824 | Bacteria | 2557 |
| 563 | Ga0307413_10093518 | 3300031824 | Bacteria | 1965 |
| 564 | Ga0307413_10194343 | 3300031824 | Bacteria | 1459 |
| 565 | Ga0307413_10231029 | 3300031824 | Bacteria | 1358 |
| 566 | Ga0307413_10379675 | 3300031824 | Bacteria | 1100 |
| 567 | Ga0307413_10570159 | 3300031824 | Bacteria | 921 |
| 568 | Ga0307413_10740652 | 3300031824 | Bacteria | 820 |
| 569 | Ga0307413_10823113 | 3300031824 | Bacteria | 782 |
| 570 | Ga0307413_10846257 | 3300031824 | Bacteria | 772 |
| 571 | Ga0307413_10906449 | 3300031824 | Bacteria | 749 |
| 572 | Ga0307413_10918840 | 3300031824 | Bacteria | 745 |
| 573 | Ga0307413_11128140 | 3300031824 | Bacteria | 678 |
| 574 | Ga0307413_11790309 | 3300031824 | Bacteria | 549 |
| 575 | Ga0307413_12117902 | 3300031824 | Bacteria | 509 |
| 576 | Ga0307410_10035633 | 3300031852 | Bacteria | 3233 |
| 577 | Ga0307410_10037070 | 3300031852 | Bacteria | 3181 |
| 578 | Ga0307410_10058166 | 3300031852 | Bacteria | 2635 |
| 579 | Ga0307410_10060845 | 3300031852 | Bacteria | 2582 |
| 580 | Ga0307410_10082754 | 3300031852 | Bacteria | 2258 |
| 581 | Ga0307410_10208325 | 3300031852 | Bacteria | 1496 |
| 582 | Ga0307410_10208624 | 3300031852 | Bacteria | 1495 |
| 583 | Ga0307410_10210448 | 3300031852 | Bacteria | 1489 |
| 584 | Ga0307410_10234192 | 3300031852 | Bacteria | 1419 |
| 585 | Ga0307410_10509222 | 3300031852 | Bacteria | 991 |
| 586 | Ga0307410_10598937 | 3300031852 | Bacteria | 919 |
| 587 | Ga0307410_10602380 | 3300031852 | Bacteria | 916 |
| 588 | Ga0307410_10755548 | 3300031852 | Bacteria | 824 |
| 589 | Ga0307410_10830731 | 3300031852 | Bacteria | 787 |
| 590 | Ga0307410_11206431 | 3300031852 | Bacteria | 659 |
| 591 | Ga0307410_11303930 | 3300031852 | Bacteria | 635 |
| 592 | Ga0307406_10008913 | 3300031901 | Bacteria | 5608 |
| 593 | Ga0307406_10064083 | 3300031901 | Bacteria | 2383 |
| 594 | Ga0307406_10073030 | 3300031901 | Bacteria | 2254 |
| 595 | Ga0307406_10240914 | 3300031901 | Bacteria | 1356 |
| 596 | Ga0307406_10248456 | 3300031901 | Bacteria | 1338 |
| 597 | Ga0307406_10388520 | 3300031901 | Bacteria | 1102 |
| 598 | Ga0307406_10402491 | 3300031901 | Bacteria | 1085 |
| 599 | Ga0307406_10433246 | 3300031901 | Bacteria | 1050 |
| 600 | Ga0307406_10540709 | 3300031901 | Bacteria | 951 |
| 601 | Ga0307406_10736089 | 3300031901 | Bacteria | 826 |
| 602 | Ga0307406_10992212 | 3300031901 | Bacteria | 720 |
| 603 | Ga0307406_12112191 | 3300031901 | Bacteria | 505 |
| 604 | Ga0307407_10008290 | 3300031903 | Bacteria | 4761 |
| 605 | Ga0307407_10009308 | 3300031903 | Bacteria | 4566 |
| 606 | Ga0307407_10060756 | 3300031903 | Bacteria | 2206 |
| 607 | Ga0307407_10167370 | 3300031903 | Bacteria | 1444 |
| 608 | Ga0307407_10218009 | 3300031903 | Bacteria | 1288 |
| 609 | Ga0307407_10335111 | 3300031903 | Bacteria | 1066 |
| 610 | Ga0307407_10342109 | 3300031903 | Bacteria | 1056 |
| 611 | Ga0307407_10464728 | 3300031903 | Bacteria | 921 |
| 612 | Ga0307407_10473362 | 3300031903 | Bacteria | 913 |
| 613 | Ga0307407_10525964 | 3300031903 | Bacteria | 871 |
| 614 | Ga0307407_10703507 | 3300031903 | Bacteria | 761 |
| 615 | Ga0307407_10742387 | 3300031903 | Bacteria | 742 |
| 616 | Ga0307407_10823678 | 3300031903 | Bacteria | 707 |
| 617 | Ga0307407_11005090 | 3300031903 | Bacteria | 644 |
| 618 | Ga0307407_11116489 | 3300031903 | Bacteria | 613 |
| 619 | Ga0307407_11227213 | 3300031903 | Bacteria | 586 |
| 620 | Ga0307407_11296610 | 3300031903 | Bacteria | 571 |
| 621 | Ga0307407_11407525 | 3300031903 | Bacteria | 549 |
| 622 | Ga0307412_10006281 | 3300031911 | Bacteria | 6709 |
| 623 | Ga0307412_10012926 | 3300031911 | Bacteria | 4879 |
| 624 | Ga0307412_10036041 | 3300031911 | Bacteria | 3165 |
| 625 | Ga0307412_10044633 | 3300031911 | Bacteria | 2892 |
| 626 | Ga0307412_10047521 | 3300031911 | Bacteria | 2819 |
| 627 | Ga0307412_10124407 | 3300031911 | Bacteria | 1862 |
| 628 | Ga0307412_10277576 | 3300031911 | Bacteria | 1314 |
| 629 | Ga0307412_10313154 | 3300031911 | Bacteria | 1245 |
| 630 | Ga0307412_10450200 | 3300031911 | Bacteria | 1060 |
| 631 | Ga0307412_10566574 | 3300031911 | Bacteria | 956 |
| 632 | Ga0307412_10863396 | 3300031911 | Bacteria | 790 |
| 633 | Ga0307412_11005137 | 3300031911 | Bacteria | 737 |
| 634 | Ga0307412_11296586 | 3300031911 | Bacteria | 655 |
| 635 | Ga0307412_11336188 | 3300031911 | Bacteria | 646 |
| 636 | Ga0307412_11661722 | 3300031911 | Bacteria | 584 |
| 637 | Ga0307412_11681117 | 3300031911 | Bacteria | 581 |
| 638 | Ga0307412_11840221 | 3300031911 | Bacteria | 557 |
| 639 | Ga0307412_12286736 | 3300031911 | Bacteria | 504 |
| 640 | Ga0307409_100032709 | 3300031995 | Bacteria | 3774 |
| 641 | Ga0307409_100057297 | 3300031995 | Bacteria | 3018 |
| 642 | Ga0307409_100179988 | 3300031995 | Bacteria | 1870 |
| 643 | Ga0307409_100220023 | 3300031995 | Bacteria | 1713 |
| 644 | Ga0307409_100267166 | 3300031995 | Bacteria | 1573 |
| 645 | Ga0307409_100289380 | 3300031995 | Bacteria | 1518 |
| 646 | Ga0307409_100344246 | 3300031995 | Bacteria | 1404 |
| 647 | Ga0307409_100395964 | 3300031995 | Bacteria | 1317 |
| 648 | Ga0307409_100404232 | 3300031995 | Bacteria | 1305 |
| 649 | Ga0307409_100434010 | 3300031995 | Bacteria | 1263 |
| 650 | Ga0307409_100519938 | 3300031995 | Bacteria | 1162 |
| 651 | Ga0307409_100563327 | 3300031995 | Bacteria | 1120 |
| 652 | Ga0307409_100840037 | 3300031995 | Bacteria | 928 |
| 653 | Ga0307409_101158821 | 3300031995 | Bacteria | 795 |
| 654 | Ga0307409_101309987 | 3300031995 | Bacteria | 749 |
| 655 | Ga0307409_101325463 | 3300031995 | Bacteria | 745 |
| 656 | Ga0307409_101404314 | 3300031995 | Bacteria | 724 |
| 657 | Ga0307409_101635272 | 3300031995 | Bacteria | 672 |
| 658 | Ga0307409_101848383 | 3300031995 | Bacteria | 633 |
| 659 | Ga0307409_102038076 | 3300031995 | Bacteria | 603 |
| 660 | Ga0307409_102314326 | 3300031995 | Bacteria | 566 |
| 661 | Ga0307416_100017376 | 3300032002 | Bacteria | 5032 |
| 662 | Ga0307416_100022017 | 3300032002 | Bacteria | 4589 |
| 663 | Ga0307416_100038293 | 3300032002 | Bacteria | 3698 |
| 664 | Ga0307416_100096521 | 3300032002 | Bacteria | 2556 |
| 665 | Ga0307416_100124968 | 3300032002 | Bacteria | 2302 |
| 666 | Ga0307416_100380751 | 3300032002 | Bacteria | 1441 |
| 667 | Ga0307416_100424701 | 3300032002 | Bacteria | 1374 |
| 668 | Ga0307416_100566945 | 3300032002 | Bacteria | 1211 |
| 669 | Ga0307416_100698249 | 3300032002 | Bacteria | 1103 |
| 670 | Ga0307416_100745941 | 3300032002 | Bacteria | 1071 |
| 671 | Ga0307416_101121299 | 3300032002 | Bacteria | 891 |
| 672 | Ga0307416_101161505 | 3300032002 | Bacteria | 877 |
| 673 | Ga0307416_101268871 | 3300032002 | Bacteria | 842 |
| 674 | Ga0307416_101493342 | 3300032002 | Bacteria | 781 |
| 675 | Ga0307416_102990679 | 3300032002 | Bacteria | 565 |
| 676 | Ga0307414_10018742 | 3300032004 | Bacteria | 4270 |
| 677 | Ga0307414_10022834 | 3300032004 | Bacteria | 3955 |
| 678 | Ga0307414_10072274 | 3300032004 | Bacteria | 2491 |
| 679 | Ga0307414_10320779 | 3300032004 | Bacteria | 1318 |
| 680 | Ga0307414_10353189 | 3300032004 | Bacteria | 1262 |
| 681 | Ga0307414_10433900 | 3300032004 | Bacteria | 1148 |
| 682 | Ga0307414_10434621 | 3300032004 | Bacteria | 1147 |
| 683 | Ga0307414_10439682 | 3300032004 | Bacteria | 1141 |
| 684 | Ga0307414_10492079 | 3300032004 | Bacteria | 1083 |
| 685 | Ga0307414_10528231 | 3300032004 | Bacteria | 1048 |
| 686 | Ga0307414_10546737 | 3300032004 | Bacteria | 1031 |
| 687 | Ga0307414_10602323 | 3300032004 | Bacteria | 985 |
| 688 | Ga0307414_10668635 | 3300032004 | Bacteria | 937 |
| 689 | Ga0307414_10787144 | 3300032004 | Bacteria | 866 |
| 690 | Ga0307414_10860700 | 3300032004 | Bacteria | 829 |
| 691 | Ga0307414_10897182 | 3300032004 | Bacteria | 812 |
| 692 | Ga0307414_10961044 | 3300032004 | Bacteria | 785 |
| 693 | Ga0307414_11044415 | 3300032004 | Bacteria | 753 |
| 694 | Ga0307414_11125013 | 3300032004 | Bacteria | 726 |
| 695 | Ga0307414_11163839 | 3300032004 | Bacteria | 713 |
| 696 | Ga0307414_11675005 | 3300032004 | Bacteria | 593 |
| 697 | Ga0307414_11910434 | 3300032004 | Bacteria | 554 |
| 698 | Ga0307411_10031516 | 3300032005 | Bacteria | 3263 |
| 699 | Ga0307411_10052995 | 3300032005 | Bacteria | 2655 |
| 700 | Ga0307411_10062837 | 3300032005 | Bacteria | 2478 |
| 701 | Ga0307411_10067691 | 3300032005 | Bacteria | 2404 |
| 702 | Ga0307411_10243867 | 3300032005 | Bacteria | 1408 |
| 703 | Ga0307411_10287202 | 3300032005 | Bacteria | 1312 |
| 704 | Ga0307411_10319854 | 3300032005 | Bacteria | 1252 |
| 705 | Ga0307411_10413340 | 3300032005 | Bacteria | 1118 |
| 706 | Ga0307411_10506610 | 3300032005 | Bacteria | 1021 |
| 707 | Ga0307411_10644191 | 3300032005 | Bacteria | 916 |
| 708 | Ga0307411_10661518 | 3300032005 | Bacteria | 905 |
| 709 | Ga0307411_10756839 | 3300032005 | Bacteria | 851 |
| 710 | Ga0307411_10793363 | 3300032005 | Bacteria | 833 |
| 711 | Ga0307411_10903904 | 3300032005 | Bacteria | 784 |
| 712 | Ga0307411_10942350 | 3300032005 | Bacteria | 769 |
| 713 | Ga0307411_10974947 | 3300032005 | Bacteria | 757 |
| 714 | Ga0307411_11171978 | 3300032005 | Bacteria | 695 |
| 715 | Ga0307411_11464693 | 3300032005 | Bacteria | 626 |
| 716 | Ga0307411_11650413 | 3300032005 | Bacteria | 592 |
| 717 | Ga0307411_11814352 | 3300032005 | Bacteria | 566 |
| 718 | Ga0307411_11883005 | 3300032005 | Bacteria | 556 |
| 719 | Ga0307411_12069499 | 3300032005 | Bacteria | 532 |
| 720 | Ga0307415_100011564 | 3300032126 | Bacteria | 5056 |
| 721 | Ga0307415_100013332 | 3300032126 | Bacteria | 4795 |
| 722 | Ga0307415_100028587 | 3300032126 | Bacteria | 3549 |
| 723 | Ga0307415_100036868 | 3300032126 | Bacteria | 3208 |
| 724 | Ga0307415_100043471 | 3300032126 | Bacteria | 2997 |
| 725 | Ga0307415_100270569 | 3300032126 | Bacteria | 1391 |
| 726 | Ga0307415_100298498 | 3300032126 | Bacteria | 1333 |
| 727 | Ga0307415_100301048 | 3300032126 | Bacteria | 1328 |
| 728 | Ga0307415_100426629 | 3300032126 | Bacteria | 1139 |
| 729 | Ga0307415_100531167 | 3300032126 | Bacteria | 1034 |
| 730 | Ga0307415_100590757 | 3300032126 | Bacteria | 986 |
| 731 | Ga0307415_100593777 | 3300032126 | Bacteria | 984 |
| 732 | Ga0307415_100699337 | 3300032126 | Bacteria | 914 |
| 733 | Ga0307415_100887487 | 3300032126 | Bacteria | 821 |
| 734 | Ga0307415_101098635 | 3300032126 | Bacteria | 744 |
| 735 | Ga0307415_101953376 | 3300032126 | Bacteria | 570 |
| 736 | Ga0307415_101982843 | 3300032126 | Bacteria | 566 |
| 737 | Ga0307415_102100374 | 3300032126 | Bacteria | 551 |
| 738 | Ga0307415_102110096 | 3300032126 | Bacteria | 550 |
| 739 | Ga0307415_102330520 | 3300032126 | Bacteria | 525 |
| 740 | Ga0373932_0250958 | 3300035112 | Bacteria | 646 |
| 741 | Ga0373943_0594593 | 3300035170 | Bacteria | 651 |
| 742 | Ga0373931_1123587 | 3300035691 | Bacteria | 536 |
| 743 | Ga0395899_0003333 | 3300037312 | Bacteria | 12734 |
| 744 | Ga0395899_0140550 | 3300037312 | Bacteria | 1718 |
| 745 | Ga0395899_0250955 | 3300037312 | Bacteria | 1214 |
| 746 | Ga0395899_0263368 | 3300037312 | Bacteria | 1178 |
| 747 | Ga0395900_0001654 | 3300037418 | Bacteria | 26100 |
| 748 | Ga0395900_0015985 | 3300037418 | Bacteria | 7647 |
| 749 | Ga0395900_0343221 | 3300037418 | Bacteria | 1468 |
| 750 | Ga0395900_0460257 | 3300037418 | Bacteria | 1227 |
| 751 | Ga0395900_0551353 | 3300037418 | Bacteria | 1097 |
| 752 | Ga0395898_0004457 | 3300037466 | Bacteria | 15305 |
| 753 | Ga0395905_0001805 | 3300037471 | Bacteria | 24778 |
| 754 | Ga0395905_0044969 | 3300037471 | Bacteria | 4142 |
| 755 | Ga0395905_0050764 | 3300037471 | Bacteria | 3885 |
| 756 | Ga0395905_0068615 | 3300037471 | Bacteria | 3321 |
| 757 | Ga0395905_0082015 | 3300037471 | Bacteria | 3022 |
| 758 | Ga0395905_0158329 | 3300037471 | Bacteria | 2129 |
| 759 | Ga0395905_0352281 | 3300037471 | Bacteria | 1364 |
| 760 | Ga0395905_0440016 | 3300037471 | Bacteria | 1201 |
| 761 | Ga0395905_0488828 | 3300037471 | Bacteria | 1130 |
| 762 | Ga0395905_0592508 | 3300037471 | Bacteria | 1010 |
| 763 | Ga0395905_1521906 | 3300037471 | Bacteria | 573 |
| 764 | Ga0395901_0005009 | 3300038443 | Bacteria | 13375 |
| 765 | Ga0395901_0014323 | 3300038443 | Bacteria | 8075 |
| 766 | Ga0395901_0134888 | 3300038443 | Bacteria | 2594 |
| 767 | Ga0395901_0693791 | 3300038443 | Bacteria | 1016 |
| 768 | Ga0395901_0796333 | 3300038443 | Bacteria | 934 |
| 769 | Ga0395901_1329930 | 3300038443 | Bacteria | 679 |
| 770 | Ga0237819_00486 | 3300038705 | Bacteria | 13460 |
| 771 | Ga0436363_1059172 | 3300039450 | Bacteria | 997 |
| 772 | Ga0439436_0183483 | 3300041404 | Bacteria | 596 |
| 773 | Ga0439438_057718 | 3300041405 | Bacteria | 976 |
| 774 | Ga0439439_0175481 | 3300041406 | Bacteria | 616 |
| 775 | Ga0439466_0145034 | 3300041411 | Bacteria | 728 |
| 776 | Ga0439465_0156535 | 3300041413 | Bacteria | 816 |
| 777 | Ga0439465_0251266 | 3300041413 | Bacteria | 654 |
| 778 | Ga0451791_1790522 | 3300041451 | Bacteria | 538 |
| 779 | Ga0451797_1562310 | 3300041453 | Bacteria | 509 |
| 780 | Ga0451802_1688601 | 3300041460 | Bacteria | 505 |
| 781 | Ga0451804_0932243 | 3300041463 | Bacteria | 812 |
| 782 | Ga0451837_1573589 | 3300041494 | Bacteria | 779 |
| 783 | Ga0439433_0015993 | 3300041999 | Bacteria | 1660 |
| 784 | Ga0439437_002305 | 3300042000 | Bacteria | 2041 |
| 785 | Ga0439442_144684 | 3300042002 | Bacteria | 527 |
| 786 | Ga0439445_0002249 | 3300042004 | Bacteria | 4286 |
| 787 | Ga0439432_029409 | 3300042006 | Bacteria | 1786 |
| 788 | Ga0439432_094846 | 3300042006 | Bacteria | 896 |
| 789 | Ga0439432_148528 | 3300042006 | Bacteria | 688 |
| 790 | Ga0439449_0151340 | 3300042007 | Bacteria | 865 |
| 791 | Ga0439449_0180434 | 3300042007 | Bacteria | 789 |
| 792 | Ga0439449_0334257 | 3300042007 | Bacteria | 573 |
| 793 | Ga0439449_0350808 | 3300042007 | Bacteria | 559 |
| 794 | Ga0439452_082101 | 3300042010 | Bacteria | 702 |
| 795 | Ga0439455_0070610 | 3300042012 | Bacteria | 938 |
| 796 | Ga0439457_039742 | 3300042014 | Bacteria | 1048 |
| 797 | Ga0439457_171302 | 3300042014 | Bacteria | 528 |
| 798 | Ga0439462_0021174 | 3300042015 | Bacteria | 1698 |
| 799 | Ga0439462_0120058 | 3300042015 | Bacteria | 731 |
| 800 | Ga0450913_027735 | 3300042117 | Bacteria | 547 |
| 801 | Ga0450917_012615 | 3300042120 | Bacteria | 689 |
| 802 | Ga0450920_096264 | 3300042122 | Bacteria | 613 |
| 803 | Ga0450921_008959 | 3300042123 | Bacteria | 821 |
| 804 | Ga0450922_038535 | 3300042124 | Bacteria | 536 |
| 805 | Ga0450890_002421 | 3300042127 | Bacteria | 2569 |
| 806 | Ga0450891_004475 | 3300042129 | Bacteria | 1307 |
| 807 | Ga0450892_010176 | 3300042130 | Bacteria | 822 |
| 808 | Ga0450889_001840 | 3300042144 | Bacteria | 2142 |
| 809 | Ga0450889_006019 | 3300042144 | Bacteria | 1214 |
| 810 | Ga0450906_057620 | 3300042145 | Bacteria | 689 |
| 811 | Ga0439446_0061998 | 3300042156 | Bacteria | 1132 |
| 812 | Ga0439446_0098894 | 3300042156 | Bacteria | 921 |
| 813 | Ga0439458_0046507 | 3300042157 | Bacteria | 1063 |
| 814 | Ga0439434_0019308 | 3300042435 | Bacteria | 2044 |
| 815 | Ga0439434_0243697 | 3300042435 | Bacteria | 614 |
| 816 | Ga0439435_0301583 | 3300042436 | Bacteria | 549 |
| 817 | Ga0439464_0032905 | 3300042439 | Bacteria | 1458 |
| 818 | Ga0439460_0020435 | 3300042461 | Bacteria | 1800 |
| 819 | Ga0450916_020927 | 3300042530 | Bacteria | 897 |
| 820 | Ga0450918_009803 | 3300042531 | Bacteria | 1676 |
| 821 | Ga0450893_0026458 | 3300042532 | Bacteria | 1020 |
| 822 | Ga0450893_0064368 | 3300042532 | Bacteria | 705 |
| 823 | Ga0451577_1298692 | 3300042876 | Bacteria | 647 |
| 824 | Ga0466969_0054413 | 3300044656 | Bacteria | 1960 |
| 825 | Ga0466966_0021881 | 3300044684 | Bacteria | 4198 |
| 826 | Ga0466966_0093437 | 3300044684 | Bacteria | 1865 |
| 827 | Ga0466961_0411205 | 3300044693 | Bacteria | 820 |
| 828 | Ga0466970_0154144 | 3300044765 | Bacteria | 1269 |
| 829 | Ga0466970_0157153 | 3300044765 | Bacteria | 1257 |
| 830 | Ga0466960_0042638 | 3300044901 | Bacteria | 2155 |
| 831 | Ga0466960_0549996 | 3300044901 | Bacteria | 681 |
| 832 | Ga0466959_0182707 | 3300045049 | Bacteria | 1466 |
| 833 | Ga0466967_1994837 | 3300045976 | Bacteria | 577 |
| 834 | Ga0495639_0073520 | 3300046475 | Bacteria | 1583 |
| 835 | Ga0495585_0446307 | 3300046492 | Bacteria | 619 |
| 836 | Ga0495585_0548424 | 3300046492 | Bacteria | 546 |
| 837 | Ga0495620_0051440 | 3300046515 | Bacteria | 1753 |
| 838 | Ga0495620_0101581 | 3300046515 | Bacteria | 1146 |
| 839 | Ga0495631_0406331 | 3300046518 | Bacteria | 580 |
| 840 | Ga0495637_0020520 | 3300046520 | Bacteria | 3041 |
| 841 | Ga0495643_0098437 | 3300046522 | Bacteria | 1501 |
| 842 | Ga0495644_0182568 | 3300046523 | Bacteria | 807 |
| 843 | Ga0495644_0313718 | 3300046523 | Bacteria | 615 |
| 844 | Ga0495648_0420692 | 3300046524 | Bacteria | 592 |
| 845 | Ga0495663_0011738 | 3300046525 | Bacteria | 2439 |
| 846 | Ga0495663_0051618 | 3300046525 | Bacteria | 1274 |
| 847 | Ga0495663_0086663 | 3300046525 | Bacteria | 1015 |
| 848 | Ga0495663_0102635 | 3300046525 | Bacteria | 943 |
| 849 | Ga0495663_0275085 | 3300046525 | Bacteria | 602 |
| 850 | Ga0495642_0006927 | 3300046528 | Bacteria | 4348 |
| 851 | Ga0495598_0001912 | 3300046537 | Bacteria | 4214 |
| 852 | Ga0495598_0026244 | 3300046537 | Bacteria | 1595 |
| 853 | Ga0495598_0142123 | 3300046537 | Bacteria | 831 |
| 854 | Ga0495598_0263710 | 3300046537 | Bacteria | 642 |
| 855 | Ga0495609_0292440 | 3300046538 | Bacteria | 664 |
| 856 | Ga0495621_0001529 | 3300046539 | Bacteria | 6017 |
| 857 | Ga0495621_0011525 | 3300046539 | Bacteria | 2738 |
| 858 | Ga0495621_0024686 | 3300046539 | Bacteria | 2010 |
| 859 | Ga0495621_0195853 | 3300046539 | Bacteria | 811 |
| 860 | Ga0495621_0329202 | 3300046539 | Bacteria | 637 |
| 861 | Ga0495633_0001763 | 3300046558 | Bacteria | 16049 |
| 862 | Ga0495633_0006943 | 3300046558 | Bacteria | 6620 |
| 863 | Ga0495668_0010177 | 3300046616 | Bacteria | 5716 |
| 864 | Ga0495668_0032702 | 3300046616 | Bacteria | 2925 |
| 865 | Ga0495668_0054103 | 3300046616 | Bacteria | 2219 |
| 866 | Ga0495668_0635583 | 3300046616 | Bacteria | 590 |
| 867 | Ga0495625_0053293 | 3300046660 | Bacteria | 2894 |
| 868 | Ga0495625_0533467 | 3300046660 | Bacteria | 713 |
| 869 | Ga0495659_0051088 | 3300046664 | Bacteria | 1505 |
| 870 | Ga0495659_0167995 | 3300046664 | Bacteria | 888 |
| 871 | Ga0495661_0229064 | 3300046665 | Bacteria | 959 |
| 872 | Ga0495661_0279995 | 3300046665 | Bacteria | 841 |
| 873 | Ga0495647_0015704 | 3300046681 | Bacteria | 2658 |
| 874 | Ga0495669_0054353 | 3300046684 | Bacteria | 1802 |
| 875 | Ga0495669_0059366 | 3300046684 | Bacteria | 1727 |
| 876 | Ga0495669_0062935 | 3300046684 | Bacteria | 1682 |
| 877 | Ga0495669_0138767 | 3300046684 | Bacteria | 1147 |
| 878 | Ga0495669_0241253 | 3300046684 | Bacteria | 867 |
| 879 | Ga0495670_0139924 | 3300046691 | Bacteria | 1265 |
| 880 | Ga0495670_0663255 | 3300046691 | Bacteria | 568 |
| 881 | Ga0495660_0153059 | 3300046810 | Bacteria | 1137 |
| 882 | Ga0495636_0034127 | 3300047318 | Bacteria | 2093 |
| 883 | Ga0495636_0273544 | 3300047318 | Bacteria | 785 |
| 884 | Ga0495672_0137127 | 3300047320 | Bacteria | 1282 |
| 885 | Ga0495683_0316836 | 3300047323 | Bacteria | 666 |
| 886 | Ga0495677_0032597 | 3300047445 | Bacteria | 1898 |
| 887 | Ga0495677_0410523 | 3300047445 | Bacteria | 536 |
| 888 | Ga0495681_0113591 | 3300047470 | Bacteria | 1170 |
| 889 | Ga0495626_0277920 | 3300048091 | Bacteria | 666 |
| 890 | Ga0496100_1009858 | 3300048903 | Bacteria | 655 |
| 891 | Ga0496101_0105642 | 3300048904 | Bacteria | 2113 |
| 892 | Ga0496101_1053437 | 3300048904 | Bacteria | 639 |
| 893 | Ga0496102_0073258 | 3300048905 | Bacteria | 3148 |
| 894 | Ga0496102_1195712 | 3300048905 | Bacteria | 680 |
| 895 | Ga0496103_0099525 | 3300048906 | Bacteria | 1839 |
| 896 | Ga0496106_0610295 | 3300048909 | Bacteria | 873 |
| 897 | Ga0496107_0017654 | 3300048910 | Bacteria | 5019 |
| 898 | Ga0496109_0273399 | 3300048912 | Bacteria | 1592 |
| 899 | Ga0496109_0572791 | 3300048912 | Bacteria | 1064 |
| 900 | Ga0496110_0017526 | 3300048913 | Bacteria | 5991 |
| 901 | Ga0496111_0488148 | 3300048914 | Bacteria | 907 |
| 902 | Ga0496111_0517612 | 3300048914 | Bacteria | 877 |
| 903 | Ga0496112_0183306 | 3300048915 | Bacteria | 2057 |
| 904 | Ga0496114_0029773 | 3300048917 | Bacteria | 4488 |
| 905 | Ga0496115_0076021 | 3300048918 | Bacteria | 2729 |
| 906 | Ga0501306_043570 | 3300049127 | Bacteria | 702 |
| 907 | Ga0501306_052369 | 3300049127 | Bacteria | 657 |
| 908 | Ga0501308_007173 | 3300049128 | Bacteria | 1161 |
| 909 | Ga0501308_028918 | 3300049128 | Bacteria | 734 |
| 910 | Ga0501308_081980 | 3300049128 | Bacteria | 515 |
| 911 | Ga0501309_011894 | 3300049129 | Bacteria | 1140 |
| 912 | Ga0501309_029350 | 3300049129 | Bacteria | 806 |
| 913 | Ga0501305_036942 | 3300049161 | Bacteria | 783 |
| 914 | Ga0501307_078880 | 3300049162 | Bacteria | 535 |
| 915 | Ga0501296_052740 | 3300049519 | Bacteria | 599 |
| 916 | Ga0501311_006508 | 3300049527 | Bacteria | 1318 |
| 917 | Ga0501312_019954 | 3300049528 | Bacteria | 988 |
| 918 | Ga0501312_021406 | 3300049528 | Bacteria | 963 |
| 919 | Ga0501312_114104 | 3300049528 | Bacteria | 518 |
| 920 | Ga0501313_006405 | 3300049529 | Bacteria | 1274 |
| 921 | Ga0501314_017158 | 3300049530 | Bacteria | 727 |
| 922 | Ga0501315_082851 | 3300049531 | Bacteria | 547 |
| 923 | Ga0501316_046553 | 3300049532 | Bacteria | 616 |
| 924 | Ga0501317_008465 | 3300049533 | Bacteria | 1185 |
| 925 | Ga0501320_033315 | 3300049536 | Bacteria | 650 |
| 926 | Ga0501322_001181 | 3300049538 | Bacteria | 1422 |
| 927 | Ga0501324_006512 | 3300049540 | Bacteria | 986 |
| 928 | Ga0501336_000759 | 3300049552 | Bacteria | 1734 |
| 929 | Ga0501038_1366848 | 3300049574 | Bacteria | 510 |
| 930 | Ga0501039_0917407 | 3300049575 | Bacteria | 682 |
| 931 | Ga0501041_0307832 | 3300049577 | Bacteria | 999 |
| 932 | Ga0501042_0277754 | 3300049578 | Bacteria | 1210 |
| 933 | Ga0501042_1128401 | 3300049578 | Bacteria | 572 |
| 934 | Ga0501067_0138597 | 3300049583 | Bacteria | 1354 |
| 935 | Ga0501069_0077653 | 3300049585 | Bacteria | 1867 |
| 936 | Ga0501069_0378964 | 3300049585 | Bacteria | 836 |
| 937 | Ga0501071_0347988 | 3300049587 | Bacteria | 1128 |
| 938 | Ga0501071_0763467 | 3300049587 | Bacteria | 745 |
| 939 | Ga0501202_119011 | 3300049652 | Bacteria | 662 |
| 940 | Ga0501207_137258 | 3300049654 | Bacteria | 518 |
| 941 | Ga0501217_180279 | 3300049661 | Bacteria | 648 |
| 942 | Ga0501227_023780 | 3300049665 | Bacteria | 1426 |
| 943 | Ga0501235_007961 | 3300049669 | Bacteria | 2309 |
| 944 | Ga0501238_018422 | 3300049671 | Bacteria | 977 |
| 945 | Ga0501242_079603 | 3300049674 | Bacteria | 524 |
| 946 | Ga0501243_004591 | 3300049675 | Bacteria | 2073 |
| 947 | Ga0501247_025857 | 3300049677 | Bacteria | 782 |
| 948 | Ga0501249_035773 | 3300049679 | Bacteria | 1117 |
| 949 | Ga0501249_152099 | 3300049679 | Bacteria | 583 |
| 950 | Ga0501252_084100 | 3300049682 | Bacteria | 531 |
| 951 | Ga0501253_011091 | 3300049683 | Bacteria | 1375 |
| 952 | Ga0501253_060926 | 3300049683 | Bacteria | 813 |
| 953 | Ga0501258_008068 | 3300049687 | Bacteria | 1076 |
| 954 | Ga0501258_030401 | 3300049687 | Bacteria | 680 |
| 955 | Ga0501245_100939 | 3300049708 | Bacteria | 585 |
| 956 | Ga0501232_026318 | 3300049757 | Bacteria | 783 |
| 957 | Ga0501262_050043 | 3300049759 | Bacteria | 645 |
| 958 | Ga0501266_006451 | 3300049763 | Bacteria | 1459 |
| 959 | Ga0501267_001469 | 3300049764 | Bacteria | 2031 |
| 960 | Ga0501268_001854 | 3300049765 | Bacteria | 2694 |
| 961 | Ga0501268_002791 | 3300049765 | Bacteria | 2332 |
| 962 | Ga0501268_100512 | 3300049765 | Bacteria | 619 |
| 963 | Ga0501268_123907 | 3300049765 | Bacteria | 575 |
| 964 | Ga0501270_025070 | 3300049767 | Bacteria | 942 |
| 965 | Ga0501271_008700 | 3300049768 | Bacteria | 1046 |
| 966 | Ga0501272_005184 | 3300049769 | Bacteria | 1368 |
| 967 | Ga0501272_054087 | 3300049769 | Bacteria | 563 |
| 968 | Ga0501273_018923 | 3300049770 | Bacteria | 920 |
| 969 | Ga0501273_022962 | 3300049770 | Bacteria | 854 |
| 970 | Ga0501275_088441 | 3300049772 | Bacteria | 512 |
| 971 | Ga0501279_007329 | 3300049775 | Bacteria | 1465 |
| 972 | Ga0501035_0732855 | 3300049822 | Bacteria | 795 |
| 973 | Ga0501044_0037302 | 3300049823 | Bacteria | 5081 |
| 974 | Ga0501045_1367344 | 3300049824 | Bacteria | 515 |
| 975 | Ga0501212_020814 | 3300049851 | Bacteria | 1014 |
| 976 | nmdc:mga0yw44_459926_c1 | 3300050492 | Bacteria | 862 |
| 977 | nmdc:mga0k408_299190_c1 | 3300050493 | Bacteria | 960 |
| 978 | nmdc:mga07m45_828407_c1 | 3300050496 | Bacteria | 530 |
| 979 | nmdc:mga05p37_239566_c1 | 3300050507 | Bacteria | 2182 |
| 980 | nmdc:mga09592_404177_c1 | 3300050508 | Bacteria | 1180 |
| 981 | nmdc:mga09592_781511_c1 | 3300050508 | Bacteria | 808 |
| 982 | nmdc:mga0qj67_1389098_c1 | 3300050509 | Bacteria | 542 |
| 983 | nmdc:mga06r32_830292_c1 | 3300050510 | Bacteria | 883 |
| 984 | nmdc:mga08y16_132375_c1 | 3300050511 | Bacteria | 2592 |
| 985 | nmdc:mga08y16_1608448_c1 | 3300050511 | Bacteria | 607 |
| 986 | nmdc:mga08y16_41479_c1 | 3300050511 | Bacteria | 4821 |
| 987 | nmdc:mga0n895_460363_c1 | 3300050512 | Bacteria | 1284 |
| 988 | nmdc:mga0rr50_264675_c1 | 3300050513 | Bacteria | 1431 |
| 989 | Ga0500647_0106045 | 3300053091 | Bacteria | 1339 |
| 990 | Ga0500651_0084712 | 3300053093 | Bacteria | 1960 |
| 991 | Ga0500651_0120654 | 3300053093 | Bacteria | 1592 |
| 992 | Ga0500618_088286 | 3300053125 | Bacteria | 696 |
| 993 | Ga0500642_0283850 | 3300053130 | Bacteria | 751 |
| 994 | Ga0500655_000265 | 3300053133 | Bacteria | 12247 |
| 995 | Ga0500658_0000023 | 3300053134 | Bacteria | 123176 |
| 996 | Ga0500658_0037508 | 3300053134 | Bacteria | 1928 |
| 997 | Ga0500590_015132 | 3300053148 | Bacteria | 3982 |
| 998 | Ga0500622_0124956 | 3300053156 | Bacteria | 1243 |
| 999 | Ga0500639_106017 | 3300053163 | Bacteria | 1375 |
| 1000 | Ga0500636_0211402 | 3300053177 | Bacteria | 1018 |
| 1001 | Ga0500570_047027 | 3300053724 | Bacteria | 2203 |
| 1002 | Ga0590071_048015 | 3300059421 | Bacteria | 1033 |
| 1003 | Ga0590071_147793 | 3300059421 | Bacteria | 608 |
| 1004 | Ga0590074_058671 | 3300059423 | Bacteria | 713 |
| 1005 | Ga0590074_076986 | 3300059423 | Bacteria | 634 |
| 1006 | Ga0587092_056635 | 3300059512 | Bacteria | 724 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049683 | Ga0501253_011091 | Ga0501253_011091_147_530 | 101 |
| 2 | 3300049763 | Ga0501266_006451 | Ga0501266_006451_499_810 | 102 |
| 3 | iso_pu_bacteria | 2582581305 | 2585262480 | 102 |
| 4 | iso_pu_bacteria | 2885427238 | 2885427581 | 102 |
| 5 | iso_pu_bacteria | 2896429255 | 2896431117 | 102 |
| 6 | 3300006195 | Ga0075366_10078589 | Ga0075366_100785893 | 104 |
| 7 | 3300013105 | Ga0157369_11061297 | Ga0157369_110612972 | 104 |
| 8 | 3300044684 | Ga0466966_0093437 | Ga0466966_0093437_640_957 | 104 |
| 9 | 3300053093 | Ga0500651_0084712 | Ga0500651_0084712_474_788 | 104 |
| 10 | 3300000549 | LJQas_1012887 | LJQas_10128872 | 105 |
| 11 | 3300000652 | ARCol0yngRDRAFT_1001879 | ARCol0yngRDRAFT_10018792 | 105 |
| 12 | 3300001990 | JGI24737J22298_10105196 | JGI24737J22298_101051961 | 105 |
| 13 | 3300002067 | JGI24735J21928_10253867 | JGI24735J21928_102538671 | 105 |
| 14 | 3300002070 | JGI24750J21931_1006318 | JGI24750J21931_10063184 | 105 |
| 15 | 3300002074 | JGI24748J21848_1001483 | JGI24748J21848_10014833 | 105 |
| 16 | 3300002126 | JGI24035J26624_1015105 | JGI24035J26624_10151052 | 105 |
| 17 | 3300002155 | JGI24033J26618_1047719 | JGI24033J26618_10477192 | 105 |
| 18 | 3300002244 | JGI24742J22300_10007510 | JGI24742J22300_100075104 | 105 |
| 19 | 3300002459 | JGI24751J29686_10022529 | JGI24751J29686_100225293 | 105 |
| 20 | 3300002459 | JGI24751J29686_10039569 | JGI24751J29686_100395692 | 105 |
| 21 | 3300005290 | Ga0065712_10037815 | Ga0065712_100378152 | 105 |
| 22 | 3300005290 | Ga0065712_10230156 | Ga0065712_102301562 | 105 |
| 23 | 3300005293 | Ga0065715_10000098 | Ga0065715_100000987 | 105 |
| 24 | 3300005293 | Ga0065715_10219721 | Ga0065715_102197212 | 105 |
| 25 | 3300005293 | Ga0065715_10373912 | Ga0065715_103739122 | 105 |
| 26 | 3300005293 | Ga0065715_10395125 | Ga0065715_103951252 | 105 |
| 27 | 3300005293 | Ga0065715_10910021 | Ga0065715_109100212 | 105 |
| 28 | 3300005295 | Ga0065707_10477737 | Ga0065707_104777371 | 105 |
| 29 | 3300005328 | Ga0070676_10010202 | Ga0070676_100102025 | 105 |
| 30 | 3300005328 | Ga0070676_10027273 | Ga0070676_100272736 | 105 |
| 31 | 3300005328 | Ga0070676_10051799 | Ga0070676_100517991 | 105 |
| 32 | 3300005328 | Ga0070676_11527306 | Ga0070676_115273061 | 105 |
| 33 | 3300005330 | Ga0070690_101309456 | Ga0070690_1013094561 | 105 |
| 34 | 3300005331 | Ga0070670_100047139 | Ga0070670_1000471392 | 105 |
| 35 | 3300005331 | Ga0070670_100296578 | Ga0070670_1002965782 | 105 |
| 36 | 3300005331 | Ga0070670_100364193 | Ga0070670_1003641932 | 105 |
| 37 | 3300005331 | Ga0070670_100533843 | Ga0070670_1005338431 | 105 |
| 38 | 3300005331 | Ga0070670_100652050 | Ga0070670_1006520502 | 105 |
| 39 | 3300005333 | Ga0070677_10016266 | Ga0070677_100162663 | 105 |
| 40 | 3300005333 | Ga0070677_10018931 | Ga0070677_100189312 | 105 |
| 41 | 3300005334 | Ga0068869_100109201 | Ga0068869_1001092012 | 105 |
| 42 | 3300005334 | Ga0068869_101102592 | Ga0068869_1011025922 | 105 |
| 43 | 3300005334 | Ga0068869_101383123 | Ga0068869_1013831232 | 105 |
| 44 | 3300005338 | Ga0068868_100133596 | Ga0068868_1001335962 | 105 |
| 45 | 3300005338 | Ga0068868_100297235 | Ga0068868_1002972352 | 105 |
| 46 | 3300005339 | Ga0070660_100151852 | Ga0070660_1001518523 | 105 |
| 47 | 3300005339 | Ga0070660_100514385 | Ga0070660_1005143852 | 105 |
| 48 | 3300005341 | Ga0070691_11089721 | Ga0070691_110897211 | 105 |
| 49 | 3300005343 | Ga0070687_100404902 | Ga0070687_1004049022 | 105 |
| 50 | 3300005343 | Ga0070687_100546187 | Ga0070687_1005461871 | 105 |
| 51 | 3300005344 | Ga0070661_100308934 | Ga0070661_1003089342 | 105 |
| 52 | 3300005345 | Ga0070692_10038276 | Ga0070692_100382766 | 105 |
| 53 | 3300005347 | Ga0070668_100048313 | Ga0070668_1000483132 | 105 |
| 54 | 3300005347 | Ga0070668_100105756 | Ga0070668_1001057562 | 105 |
| 55 | 3300005347 | Ga0070668_100107439 | Ga0070668_1001074395 | 105 |
| 56 | 3300005347 | Ga0070668_100165579 | Ga0070668_1001655794 | 105 |
| 57 | 3300005347 | Ga0070668_100393760 | Ga0070668_1003937603 | 105 |
| 58 | 3300005347 | Ga0070668_100560337 | Ga0070668_1005603372 | 105 |
| 59 | 3300005347 | Ga0070668_100691677 | Ga0070668_1006916772 | 105 |
| 60 | 3300005347 | Ga0070668_101016540 | Ga0070668_1010165402 | 105 |
| 61 | 3300005347 | Ga0070668_101111744 | Ga0070668_1011117442 | 105 |
| 62 | 3300005347 | Ga0070668_101772386 | Ga0070668_1017723861 | 105 |
| 63 | 3300005353 | Ga0070669_100014400 | Ga0070669_1000144009 | 105 |
| 64 | 3300005353 | Ga0070669_100069493 | Ga0070669_1000694936 | 105 |
| 65 | 3300005353 | Ga0070669_100259429 | Ga0070669_1002594292 | 105 |
| 66 | 3300005353 | Ga0070669_100399911 | Ga0070669_1003999112 | 105 |
| 67 | 3300005353 | Ga0070669_100406010 | Ga0070669_1004060103 | 105 |
| 68 | 3300005353 | Ga0070669_100823875 | Ga0070669_1008238752 | 105 |
| 69 | 3300005353 | Ga0070669_100903125 | Ga0070669_1009031251 | 105 |
| 70 | 3300005353 | Ga0070669_100974610 | Ga0070669_1009746102 | 105 |
| 71 | 3300005353 | Ga0070669_101067692 | Ga0070669_1010676921 | 105 |
| 72 | 3300005353 | Ga0070669_101174155 | Ga0070669_1011741552 | 105 |
| 73 | 3300005353 | Ga0070669_101502259 | Ga0070669_1015022592 | 105 |
| 74 | 3300005353 | Ga0070669_101661144 | Ga0070669_1016611442 | 105 |
| 75 | 3300005354 | Ga0070675_100048237 | Ga0070675_1000482375 | 105 |
| 76 | 3300005354 | Ga0070675_100108237 | Ga0070675_1001082372 | 105 |
| 77 | 3300005354 | Ga0070675_100458797 | Ga0070675_1004587971 | 105 |
| 78 | 3300005354 | Ga0070675_100479567 | Ga0070675_1004795672 | 105 |
| 79 | 3300005354 | Ga0070675_100679650 | Ga0070675_1006796502 | 105 |
| 80 | 3300005354 | Ga0070675_101692367 | Ga0070675_1016923672 | 105 |
| 81 | 3300005355 | Ga0070671_100052885 | Ga0070671_1000528852 | 105 |
| 82 | 3300005355 | Ga0070671_100214400 | Ga0070671_1002144003 | 105 |
| 83 | 3300005355 | Ga0070671_100277720 | Ga0070671_1002777202 | 105 |
| 84 | 3300005355 | Ga0070671_100400255 | Ga0070671_1004002551 | 105 |
| 85 | 3300005355 | Ga0070671_100742586 | Ga0070671_1007425862 | 105 |
| 86 | 3300005356 | Ga0070674_100022854 | Ga0070674_1000228547 | 105 |
| 87 | 3300005356 | Ga0070674_100214360 | Ga0070674_1002143602 | 105 |
| 88 | 3300005356 | Ga0070674_100528176 | Ga0070674_1005281763 | 105 |
| 89 | 3300005356 | Ga0070674_101058136 | Ga0070674_1010581362 | 105 |
| 90 | 3300005356 | Ga0070674_101192319 | Ga0070674_1011923192 | 105 |
| 91 | 3300005356 | Ga0070674_101470859 | Ga0070674_1014708592 | 105 |
| 92 | 3300005356 | Ga0070674_101804373 | Ga0070674_1018043732 | 105 |
| 93 | 3300005364 | Ga0070673_100041643 | Ga0070673_1000416435 | 105 |
| 94 | 3300005364 | Ga0070673_100061829 | Ga0070673_1000618295 | 105 |
| 95 | 3300005364 | Ga0070673_100113379 | Ga0070673_1001133792 | 105 |
| 96 | 3300005364 | Ga0070673_100337611 | Ga0070673_1003376112 | 105 |
| 97 | 3300005364 | Ga0070673_100488405 | Ga0070673_1004884053 | 105 |
| 98 | 3300005364 | Ga0070673_100598365 | Ga0070673_1005983652 | 105 |
| 99 | 3300005364 | Ga0070673_101642507 | Ga0070673_1016425071 | 105 |
| 100 | 3300005364 | Ga0070673_101669902 | Ga0070673_1016699022 | 105 |
| 101 | 3300005366 | Ga0070659_100085064 | Ga0070659_1000850644 | 105 |
| 102 | 3300005366 | Ga0070659_100147960 | Ga0070659_1001479602 | 105 |
| 103 | 3300005366 | Ga0070659_100694277 | Ga0070659_1006942772 | 105 |
| 104 | 3300005367 | Ga0070667_100050290 | Ga0070667_1000502902 | 105 |
| 105 | 3300005367 | Ga0070667_100087293 | Ga0070667_1000872932 | 105 |
| 106 | 3300005367 | Ga0070667_100284964 | Ga0070667_1002849642 | 105 |
| 107 | 3300005367 | Ga0070667_100450097 | Ga0070667_1004500972 | 105 |
| 108 | 3300005438 | Ga0070701_10337157 | Ga0070701_103371572 | 105 |
| 109 | 3300005440 | Ga0070705_100323221 | Ga0070705_1003232212 | 105 |
| 110 | 3300005440 | Ga0070705_100378721 | Ga0070705_1003787212 | 105 |
| 111 | 3300005441 | Ga0070700_100161545 | Ga0070700_1001615452 | 105 |
| 112 | 3300005444 | Ga0070694_100046855 | Ga0070694_1000468557 | 105 |
| 113 | 3300005444 | Ga0070694_101373582 | Ga0070694_1013735821 | 105 |
| 114 | 3300005445 | Ga0070708_101309207 | Ga0070708_1013092072 | 105 |
| 115 | 3300005455 | Ga0070663_100116425 | Ga0070663_1001164255 | 105 |
| 116 | 3300005455 | Ga0070663_100154628 | Ga0070663_1001546285 | 105 |
| 117 | 3300005455 | Ga0070663_100430002 | Ga0070663_1004300022 | 105 |
| 118 | 3300005455 | Ga0070663_100613117 | Ga0070663_1006131172 | 105 |
| 119 | 3300005456 | Ga0070678_100020582 | Ga0070678_1000205829 | 105 |
| 120 | 3300005456 | Ga0070678_100099383 | Ga0070678_1000993832 | 105 |
| 121 | 3300005456 | Ga0070678_100301549 | Ga0070678_1003015493 | 105 |
| 122 | 3300005456 | Ga0070678_100424540 | Ga0070678_1004245402 | 105 |
| 123 | 3300005457 | Ga0070662_100102075 | Ga0070662_1001020753 | 105 |
| 124 | 3300005457 | Ga0070662_100286323 | Ga0070662_1002863231 | 105 |
| 125 | 3300005457 | Ga0070662_100305495 | Ga0070662_1003054952 | 105 |
| 126 | 3300005457 | Ga0070662_100456267 | Ga0070662_1004562672 | 105 |
| 127 | 3300005457 | Ga0070662_100567120 | Ga0070662_1005671202 | 105 |
| 128 | 3300005457 | Ga0070662_100872865 | Ga0070662_1008728652 | 105 |
| 129 | 3300005458 | Ga0070681_10185659 | Ga0070681_101856592 | 105 |
| 130 | 3300005458 | Ga0070681_11149784 | Ga0070681_111497842 | 105 |
| 131 | 3300005459 | Ga0068867_100004535 | Ga0068867_10000453511 | 105 |
| 132 | 3300005459 | Ga0068867_100091878 | Ga0068867_1000918782 | 105 |
| 133 | 3300005459 | Ga0068867_101109587 | Ga0068867_1011095872 | 105 |
| 134 | 3300005530 | Ga0070679_101959082 | Ga0070679_1019590822 | 105 |
| 135 | 3300005539 | Ga0068853_100140615 | Ga0068853_1001406152 | 105 |
| 136 | 3300005539 | Ga0068853_100143367 | Ga0068853_1001433672 | 105 |
| 137 | 3300005539 | Ga0068853_100680256 | Ga0068853_1006802562 | 105 |
| 138 | 3300005539 | Ga0068853_101255935 | Ga0068853_1012559352 | 105 |
| 139 | 3300005543 | Ga0070672_100111378 | Ga0070672_1001113785 | 105 |
| 140 | 3300005543 | Ga0070672_100167954 | Ga0070672_1001679542 | 105 |
| 141 | 3300005543 | Ga0070672_100179493 | Ga0070672_1001794933 | 105 |
| 142 | 3300005543 | Ga0070672_100224987 | Ga0070672_1002249872 | 105 |
| 143 | 3300005543 | Ga0070672_100858471 | Ga0070672_1008584711 | 105 |
| 144 | 3300005544 | Ga0070686_101479710 | Ga0070686_1014797102 | 105 |
| 145 | 3300005545 | Ga0070695_101427466 | Ga0070695_1014274662 | 105 |
| 146 | 3300005546 | Ga0070696_100017763 | Ga0070696_10001776311 | 105 |
| 147 | 3300005546 | Ga0070696_100322224 | Ga0070696_1003222242 | 105 |
| 148 | 3300005548 | Ga0070665_100043393 | Ga0070665_1000433938 | 105 |
| 149 | 3300005548 | Ga0070665_100093206 | Ga0070665_1000932065 | 105 |
| 150 | 3300005548 | Ga0070665_100578818 | Ga0070665_1005788182 | 105 |
| 151 | 3300005549 | Ga0070704_100588388 | Ga0070704_1005883881 | 105 |
| 152 | 3300005549 | Ga0070704_101037899 | Ga0070704_1010378991 | 105 |
| 153 | 3300005563 | Ga0068855_100383221 | Ga0068855_1003832213 | 105 |
| 154 | 3300005563 | Ga0068855_101506168 | Ga0068855_1015061682 | 105 |
| 155 | 3300005564 | Ga0070664_100036985 | Ga0070664_1000369853 | 105 |
| 156 | 3300005564 | Ga0070664_100341882 | Ga0070664_1003418822 | 105 |
| 157 | 3300005564 | Ga0070664_100366566 | Ga0070664_1003665663 | 105 |
| 158 | 3300005564 | Ga0070664_100439599 | Ga0070664_1004395991 | 105 |
| 159 | 3300005564 | Ga0070664_101143950 | Ga0070664_1011439502 | 105 |
| 160 | 3300005564 | Ga0070664_101456881 | Ga0070664_1014568811 | 105 |
| 161 | 3300005577 | Ga0068857_100558037 | Ga0068857_1005580372 | 105 |
| 162 | 3300005577 | Ga0068857_101414475 | Ga0068857_1014144751 | 105 |
| 163 | 3300005578 | Ga0068854_100107638 | Ga0068854_1001076382 | 105 |
| 164 | 3300005616 | Ga0068852_101569414 | Ga0068852_1015694142 | 105 |
| 165 | 3300005617 | Ga0068859_100003314 | Ga0068859_10000331417 | 105 |
| 166 | 3300005617 | Ga0068859_100056343 | Ga0068859_1000563439 | 105 |
| 167 | 3300005617 | Ga0068859_100156934 | Ga0068859_1001569345 | 105 |
| 168 | 3300005617 | Ga0068859_100159089 | Ga0068859_1001590893 | 105 |
| 169 | 3300005618 | Ga0068864_100002491 | Ga0068864_10000249115 | 105 |
| 170 | 3300005618 | Ga0068864_100039730 | Ga0068864_1000397304 | 105 |
| 171 | 3300005618 | Ga0068864_100618311 | Ga0068864_1006183112 | 105 |
| 172 | 3300005718 | Ga0068866_10160423 | Ga0068866_101604232 | 105 |
| 173 | 3300005718 | Ga0068866_10173232 | Ga0068866_101732322 | 105 |
| 174 | 3300005719 | Ga0068861_100079732 | Ga0068861_1000797325 | 105 |
| 175 | 3300005719 | Ga0068861_100858086 | Ga0068861_1008580862 | 105 |
| 176 | 3300005840 | Ga0068870_10062197 | Ga0068870_100621972 | 105 |
| 177 | 3300005840 | Ga0068870_10490947 | Ga0068870_104909472 | 105 |
| 178 | 3300005840 | Ga0068870_10633028 | Ga0068870_106330281 | 105 |
| 179 | 3300005840 | Ga0068870_11247793 | Ga0068870_112477932 | 105 |
| 180 | 3300005841 | Ga0068863_100021286 | Ga0068863_1000212864 | 105 |
| 181 | 3300005841 | Ga0068863_100053086 | Ga0068863_1000530862 | 105 |
| 182 | 3300005841 | Ga0068863_100121571 | Ga0068863_1001215712 | 105 |
| 183 | 3300005841 | Ga0068863_100417823 | Ga0068863_1004178232 | 105 |
| 184 | 3300005842 | Ga0068858_100004068 | Ga0068858_10000406812 | 105 |
| 185 | 3300005842 | Ga0068858_100480250 | Ga0068858_1004802502 | 105 |
| 186 | 3300005842 | Ga0068858_100620712 | Ga0068858_1006207122 | 105 |
| 187 | 3300005843 | Ga0068860_100031635 | Ga0068860_1000316355 | 105 |
| 188 | 3300005843 | Ga0068860_100126139 | Ga0068860_1001261393 | 105 |
| 189 | 3300005843 | Ga0068860_100359305 | Ga0068860_1003593053 | 105 |
| 190 | 3300005843 | Ga0068860_100390251 | Ga0068860_1003902512 | 105 |
| 191 | 3300005843 | Ga0068860_101419385 | Ga0068860_1014193852 | 105 |
| 192 | 3300005844 | Ga0068862_100059849 | Ga0068862_1000598494 | 105 |
| 193 | 3300005844 | Ga0068862_100101210 | Ga0068862_1001012105 | 105 |
| 194 | 3300005844 | Ga0068862_100202295 | Ga0068862_1002022953 | 105 |
| 195 | 3300005844 | Ga0068862_100237862 | Ga0068862_1002378624 | 105 |
| 196 | 3300005844 | Ga0068862_100244321 | Ga0068862_1002443212 | 105 |
| 197 | 3300005844 | Ga0068862_100368540 | Ga0068862_1003685402 | 105 |
| 198 | 3300005844 | Ga0068862_100443406 | Ga0068862_1004434062 | 105 |
| 199 | 3300005844 | Ga0068862_100742103 | Ga0068862_1007421032 | 105 |
| 200 | 3300005844 | Ga0068862_100805571 | Ga0068862_1008055712 | 105 |
| 201 | 3300005844 | Ga0068862_101687584 | Ga0068862_1016875841 | 105 |
| 202 | 3300005985 | Ga0081539_10019248 | Ga0081539_100192486 | 105 |
| 203 | 3300006042 | Ga0075368_10552403 | Ga0075368_105524032 | 105 |
| 204 | 3300006051 | Ga0075364_11193312 | Ga0075364_111933121 | 105 |
| 205 | 3300006175 | Ga0070712_100043947 | Ga0070712_1000439472 | 105 |
| 206 | 3300006195 | Ga0075366_10481337 | Ga0075366_104813372 | 105 |
| 207 | 3300006195 | Ga0075366_10934023 | Ga0075366_109340232 | 105 |
| 208 | 3300006237 | Ga0097621_100013419 | Ga0097621_1000134196 | 105 |
| 209 | 3300006237 | Ga0097621_101256226 | Ga0097621_1012562262 | 105 |
| 210 | 3300006237 | Ga0097621_102319306 | Ga0097621_1023193062 | 105 |
| 211 | 3300006353 | Ga0075370_10092311 | Ga0075370_100923112 | 105 |
| 212 | 3300006353 | Ga0075370_10495879 | Ga0075370_104958792 | 105 |
| 213 | 3300006358 | Ga0068871_100025733 | Ga0068871_1000257333 | 105 |
| 214 | 3300006844 | Ga0075428_100136242 | Ga0075428_1001362425 | 105 |
| 215 | 3300006844 | Ga0075428_100485419 | Ga0075428_1004854192 | 105 |
| 216 | 3300006846 | Ga0075430_100620644 | Ga0075430_1006206442 | 105 |
| 217 | 3300006847 | Ga0075431_100135405 | Ga0075431_1001354052 | 105 |
| 218 | 3300006871 | Ga0075434_100407578 | Ga0075434_1004075782 | 105 |
| 219 | 3300006871 | Ga0075434_102079706 | Ga0075434_1020797061 | 105 |
| 220 | 3300006881 | Ga0068865_100522794 | Ga0068865_1005227942 | 105 |
| 221 | 3300006881 | Ga0068865_100902546 | Ga0068865_1009025462 | 105 |
| 222 | 3300006881 | Ga0068865_101600131 | Ga0068865_1016001312 | 105 |
| 223 | 3300006931 | Ga0097620_100003314 | Ga0097620_10000331417 | 105 |
| 224 | 3300006931 | Ga0097620_100056349 | Ga0097620_1000563492 | 105 |
| 225 | 3300006931 | Ga0097620_100156943 | Ga0097620_1001569435 | 105 |
| 226 | 3300006931 | Ga0097620_100159093 | Ga0097620_1001590933 | 105 |
| 227 | 3300007076 | Ga0075435_100293915 | Ga0075435_1002939152 | 105 |
| 228 | 3300009092 | Ga0105250_10028500 | Ga0105250_100285002 | 105 |
| 229 | 3300009092 | Ga0105250_10249058 | Ga0105250_102490582 | 105 |
| 230 | 3300009093 | Ga0105240_10551710 | Ga0105240_105517103 | 105 |
| 231 | 3300009094 | Ga0111539_10049029 | Ga0111539_100490296 | 105 |
| 232 | 3300009094 | Ga0111539_10732388 | Ga0111539_107323882 | 105 |
| 233 | 3300009094 | Ga0111539_11658830 | Ga0111539_116588301 | 105 |
| 234 | 3300009098 | Ga0105245_10466695 | Ga0105245_104666952 | 105 |
| 235 | 3300009098 | Ga0105245_12060467 | Ga0105245_120604672 | 105 |
| 236 | 3300009101 | Ga0105247_10184228 | Ga0105247_101842284 | 105 |
| 237 | 3300009147 | Ga0114129_10364296 | Ga0114129_103642964 | 105 |
| 238 | 3300009148 | Ga0105243_10177410 | Ga0105243_101774104 | 105 |
| 239 | 3300009148 | Ga0105243_10633423 | Ga0105243_106334232 | 105 |
| 240 | 3300009148 | Ga0105243_11471493 | Ga0105243_114714932 | 105 |
| 241 | 3300009148 | Ga0105243_12081884 | Ga0105243_120818841 | 105 |
| 242 | 3300009148 | Ga0105243_12090317 | Ga0105243_120903172 | 105 |
| 243 | 3300009174 | Ga0105241_10998788 | Ga0105241_109987882 | 105 |
| 244 | 3300009174 | Ga0105241_11224091 | Ga0105241_112240912 | 105 |
| 245 | 3300009176 | Ga0105242_10440468 | Ga0105242_104404682 | 105 |
| 246 | 3300009176 | Ga0105242_11097517 | Ga0105242_110975171 | 105 |
| 247 | 3300009176 | Ga0105242_11842400 | Ga0105242_118424002 | 105 |
| 248 | 3300009177 | Ga0105248_10006714 | Ga0105248_1000671416 | 105 |
| 249 | 3300009177 | Ga0105248_10160056 | Ga0105248_101600565 | 105 |
| 250 | 3300009177 | Ga0105248_10192438 | Ga0105248_101924385 | 105 |
| 251 | 3300009177 | Ga0105248_10384527 | Ga0105248_103845273 | 105 |
| 252 | 3300009177 | Ga0105248_10939619 | Ga0105248_109396192 | 105 |
| 253 | 3300009177 | Ga0105248_11516711 | Ga0105248_115167112 | 105 |
| 254 | 3300009545 | Ga0105237_11436505 | Ga0105237_114365052 | 105 |
| 255 | 3300009553 | Ga0105249_10097841 | Ga0105249_100978415 | 105 |
| 256 | 3300009553 | Ga0105249_10536055 | Ga0105249_105360552 | 105 |
| 257 | 3300009553 | Ga0105249_11183069 | Ga0105249_111830692 | 105 |
| 258 | 3300009553 | Ga0105249_11325169 | Ga0105249_113251692 | 105 |
| 259 | 3300009979 | Ga0105032_117129 | Ga0105032_1171292 | 105 |
| 260 | 3300010375 | Ga0105239_10558577 | Ga0105239_105585772 | 105 |
| 261 | 3300012485 | Ga0157325_1027496 | Ga0157325_10274961 | 105 |
| 262 | 3300012508 | Ga0157315_1053009 | Ga0157315_10530092 | 105 |
| 263 | 3300012512 | Ga0157327_1004904 | Ga0157327_10049042 | 105 |
| 264 | 3300013100 | Ga0157373_10141777 | Ga0157373_101417772 | 105 |
| 265 | 3300013100 | Ga0157373_10299516 | Ga0157373_102995162 | 105 |
| 266 | 3300013100 | Ga0157373_10651715 | Ga0157373_106517152 | 105 |
| 267 | 3300013100 | Ga0157373_10955924 | Ga0157373_109559242 | 105 |
| 268 | 3300013102 | Ga0157371_10594172 | Ga0157371_105941722 | 105 |
| 269 | 3300013105 | Ga0157369_10006198 | Ga0157369_1000619815 | 105 |
| 270 | 3300013306 | Ga0163162_10052322 | Ga0163162_100523225 | 105 |
| 271 | 3300013306 | Ga0163162_10336158 | Ga0163162_103361582 | 105 |
| 272 | 3300013306 | Ga0163162_10338001 | Ga0163162_103380012 | 105 |
| 273 | 3300013306 | Ga0163162_10344969 | Ga0163162_103449692 | 105 |
| 274 | 3300013306 | Ga0163162_11626712 | Ga0163162_116267122 | 105 |
| 275 | 3300013308 | Ga0157375_10077381 | Ga0157375_100773818 | 105 |
| 276 | 3300013308 | Ga0157375_10194162 | Ga0157375_101941622 | 105 |
| 277 | 3300013308 | Ga0157375_10965695 | Ga0157375_109656952 | 105 |
| 278 | 3300013308 | Ga0157375_11227466 | Ga0157375_112274662 | 105 |
| 279 | 3300013308 | Ga0157375_11929267 | Ga0157375_119292672 | 105 |
| 280 | 3300013308 | Ga0157375_12710477 | Ga0157375_127104772 | 105 |
| 281 | 3300014325 | Ga0163163_10004858 | Ga0163163_100048587 | 105 |
| 282 | 3300014326 | Ga0157380_10338680 | Ga0157380_103386803 | 105 |
| 283 | 3300014326 | Ga0157380_10732531 | Ga0157380_107325312 | 105 |
| 284 | 3300014326 | Ga0157380_11039521 | Ga0157380_110395212 | 105 |
| 285 | 3300014745 | Ga0157377_10463159 | Ga0157377_104631592 | 105 |
| 286 | 3300014745 | Ga0157377_10679824 | Ga0157377_106798242 | 105 |
| 287 | 3300014968 | Ga0157379_10038791 | Ga0157379_100387918 | 105 |
| 288 | 3300014968 | Ga0157379_11002470 | Ga0157379_110024702 | 105 |
| 289 | 3300014969 | Ga0157376_11568889 | Ga0157376_115688892 | 105 |
| 290 | 3300017792 | Ga0163161_10299503 | Ga0163161_102995032 | 105 |
| 291 | 3300017792 | Ga0163161_10824666 | Ga0163161_108246662 | 105 |
| 292 | 3300025271 | Ga0207666_1012243 | Ga0207666_10122433 | 105 |
| 293 | 3300025315 | Ga0207697_10001580 | Ga0207697_100015809 | 105 |
| 294 | 3300025315 | Ga0207697_10035806 | Ga0207697_100358064 | 105 |
| 295 | 3300025315 | Ga0207697_10067099 | Ga0207697_100670993 | 105 |
| 296 | 3300025315 | Ga0207697_10535790 | Ga0207697_105357902 | 105 |
| 297 | 3300025711 | Ga0207696_1007651 | Ga0207696_10076519 | 105 |
| 298 | 3300025711 | Ga0207696_1132876 | Ga0207696_11328762 | 105 |
| 299 | 3300025885 | Ga0207653_10375817 | Ga0207653_103758172 | 105 |
| 300 | 3300025893 | Ga0207682_10006590 | Ga0207682_100065907 | 105 |
| 301 | 3300025893 | Ga0207682_10054106 | Ga0207682_100541062 | 105 |
| 302 | 3300025893 | Ga0207682_10072275 | Ga0207682_100722753 | 105 |
| 303 | 3300025893 | Ga0207682_10125454 | Ga0207682_101254542 | 105 |
| 304 | 3300025893 | Ga0207682_10282905 | Ga0207682_102829052 | 105 |
| 305 | 3300025899 | Ga0207642_10060758 | Ga0207642_100607584 | 105 |
| 306 | 3300025899 | Ga0207642_10078048 | Ga0207642_100780482 | 105 |
| 307 | 3300025900 | Ga0207710_10168754 | Ga0207710_101687542 | 105 |
| 308 | 3300025901 | Ga0207688_10100962 | Ga0207688_101009625 | 105 |
| 309 | 3300025901 | Ga0207688_10162329 | Ga0207688_101623292 | 105 |
| 310 | 3300025901 | Ga0207688_10396505 | Ga0207688_103965052 | 105 |
| 311 | 3300025904 | Ga0207647_10038196 | Ga0207647_100381966 | 105 |
| 312 | 3300025904 | Ga0207647_10196815 | Ga0207647_101968152 | 105 |
| 313 | 3300025904 | Ga0207647_10378421 | Ga0207647_103784212 | 105 |
| 314 | 3300025907 | Ga0207645_10014351 | Ga0207645_100143515 | 105 |
| 315 | 3300025907 | Ga0207645_10062998 | Ga0207645_100629983 | 105 |
| 316 | 3300025907 | Ga0207645_10088987 | Ga0207645_100889875 | 105 |
| 317 | 3300025907 | Ga0207645_10094021 | Ga0207645_100940214 | 105 |
| 318 | 3300025907 | Ga0207645_10400732 | Ga0207645_104007322 | 105 |
| 319 | 3300025907 | Ga0207645_10855819 | Ga0207645_108558192 | 105 |
| 320 | 3300025908 | Ga0207643_10053194 | Ga0207643_100531945 | 105 |
| 321 | 3300025908 | Ga0207643_10242261 | Ga0207643_102422612 | 105 |
| 322 | 3300025908 | Ga0207643_10364529 | Ga0207643_103645292 | 105 |
| 323 | 3300025908 | Ga0207643_10461573 | Ga0207643_104615732 | 105 |
| 324 | 3300025908 | Ga0207643_11002433 | Ga0207643_110024332 | 105 |
| 325 | 3300025911 | Ga0207654_10252074 | Ga0207654_102520742 | 105 |
| 326 | 3300025912 | Ga0207707_10082443 | Ga0207707_100824436 | 105 |
| 327 | 3300025914 | Ga0207671_10982750 | Ga0207671_109827501 | 105 |
| 328 | 3300025915 | Ga0207693_10253115 | Ga0207693_102531153 | 105 |
| 329 | 3300025918 | Ga0207662_10323409 | Ga0207662_103234092 | 105 |
| 330 | 3300025919 | Ga0207657_10472898 | Ga0207657_104728982 | 105 |
| 331 | 3300025919 | Ga0207657_10543695 | Ga0207657_105436951 | 105 |
| 332 | 3300025919 | Ga0207657_11027366 | Ga0207657_110273662 | 105 |
| 333 | 3300025920 | Ga0207649_10099638 | Ga0207649_100996384 | 105 |
| 334 | 3300025920 | Ga0207649_10694314 | Ga0207649_106943141 | 105 |
| 335 | 3300025920 | Ga0207649_10790023 | Ga0207649_107900231 | 105 |
| 336 | 3300025921 | Ga0207652_11289783 | Ga0207652_112897832 | 105 |
| 337 | 3300025923 | Ga0207681_10001216 | Ga0207681_1000121620 | 105 |
| 338 | 3300025923 | Ga0207681_10041111 | Ga0207681_100411114 | 105 |
| 339 | 3300025923 | Ga0207681_10518931 | Ga0207681_105189313 | 105 |
| 340 | 3300025923 | Ga0207681_10522152 | Ga0207681_105221522 | 105 |
| 341 | 3300025923 | Ga0207681_10549365 | Ga0207681_105493652 | 105 |
| 342 | 3300025923 | Ga0207681_10562070 | Ga0207681_105620702 | 105 |
| 343 | 3300025923 | Ga0207681_10900775 | Ga0207681_109007752 | 105 |
| 344 | 3300025923 | Ga0207681_10974693 | Ga0207681_109746932 | 105 |
| 345 | 3300025923 | Ga0207681_11062990 | Ga0207681_110629902 | 105 |
| 346 | 3300025923 | Ga0207681_11072264 | Ga0207681_110722642 | 105 |
| 347 | 3300025923 | Ga0207681_11305249 | Ga0207681_113052492 | 105 |
| 348 | 3300025923 | Ga0207681_11855488 | Ga0207681_118554882 | 105 |
| 349 | 3300025925 | Ga0207650_10012172 | Ga0207650_100121728 | 105 |
| 350 | 3300025925 | Ga0207650_10033934 | Ga0207650_100339346 | 105 |
| 351 | 3300025925 | Ga0207650_10084415 | Ga0207650_100844152 | 105 |
| 352 | 3300025925 | Ga0207650_10300150 | Ga0207650_103001502 | 105 |
| 353 | 3300025925 | Ga0207650_10369470 | Ga0207650_103694702 | 105 |
| 354 | 3300025925 | Ga0207650_10472425 | Ga0207650_104724252 | 105 |
| 355 | 3300025925 | Ga0207650_10704018 | Ga0207650_107040182 | 105 |
| 356 | 3300025925 | Ga0207650_10713455 | Ga0207650_107134552 | 105 |
| 357 | 3300025925 | Ga0207650_10783370 | Ga0207650_107833702 | 105 |
| 358 | 3300025926 | Ga0207659_10001819 | Ga0207659_1000181910 | 105 |
| 359 | 3300025926 | Ga0207659_10112471 | Ga0207659_101124713 | 105 |
| 360 | 3300025926 | Ga0207659_10482092 | Ga0207659_104820922 | 105 |
| 361 | 3300025926 | Ga0207659_10885959 | Ga0207659_108859592 | 105 |
| 362 | 3300025926 | Ga0207659_11278510 | Ga0207659_112785101 | 105 |
| 363 | 3300025926 | Ga0207659_11365502 | Ga0207659_113655022 | 105 |
| 364 | 3300025931 | Ga0207644_10013980 | Ga0207644_100139805 | 105 |
| 365 | 3300025931 | Ga0207644_10111263 | Ga0207644_101112632 | 105 |
| 366 | 3300025931 | Ga0207644_10243859 | Ga0207644_102438593 | 105 |
| 367 | 3300025931 | Ga0207644_10724008 | Ga0207644_107240082 | 105 |
| 368 | 3300025931 | Ga0207644_10896058 | Ga0207644_108960582 | 105 |
| 369 | 3300025932 | Ga0207690_10014888 | Ga0207690_100148887 | 105 |
| 370 | 3300025932 | Ga0207690_10151034 | Ga0207690_101510342 | 105 |
| 371 | 3300025932 | Ga0207690_10350141 | Ga0207690_103501412 | 105 |
| 372 | 3300025933 | Ga0207706_10000284 | Ga0207706_100002842 | 105 |
| 373 | 3300025933 | Ga0207706_10303158 | Ga0207706_103031582 | 105 |
| 374 | 3300025933 | Ga0207706_10337505 | Ga0207706_103375053 | 105 |
| 375 | 3300025933 | Ga0207706_10347419 | Ga0207706_103474191 | 105 |
| 376 | 3300025933 | Ga0207706_10558457 | Ga0207706_105584572 | 105 |
| 377 | 3300025933 | Ga0207706_10658424 | Ga0207706_106584242 | 105 |
| 378 | 3300025933 | Ga0207706_10864893 | Ga0207706_108648932 | 105 |
| 379 | 3300025933 | Ga0207706_11016931 | Ga0207706_110169312 | 105 |
| 380 | 3300025933 | Ga0207706_11165885 | Ga0207706_111658851 | 105 |
| 381 | 3300025934 | Ga0207686_11162733 | Ga0207686_111627331 | 105 |
| 382 | 3300025935 | Ga0207709_10133892 | Ga0207709_101338923 | 105 |
| 383 | 3300025935 | Ga0207709_10143267 | Ga0207709_101432671 | 105 |
| 384 | 3300025935 | Ga0207709_10539830 | Ga0207709_105398302 | 105 |
| 385 | 3300025935 | Ga0207709_11426508 | Ga0207709_114265082 | 105 |
| 386 | 3300025937 | Ga0207669_10036225 | Ga0207669_100362255 | 105 |
| 387 | 3300025937 | Ga0207669_10176805 | Ga0207669_101768054 | 105 |
| 388 | 3300025937 | Ga0207669_10217707 | Ga0207669_102177074 | 105 |
| 389 | 3300025937 | Ga0207669_10330884 | Ga0207669_103308842 | 105 |
| 390 | 3300025937 | Ga0207669_10916008 | Ga0207669_109160082 | 105 |
| 391 | 3300025937 | Ga0207669_11385341 | Ga0207669_113853412 | 105 |
| 392 | 3300025938 | Ga0207704_10077052 | Ga0207704_100770523 | 105 |
| 393 | 3300025938 | Ga0207704_10148137 | Ga0207704_101481375 | 105 |
| 394 | 3300025938 | Ga0207704_10776914 | Ga0207704_107769142 | 105 |
| 395 | 3300025940 | Ga0207691_10017921 | Ga0207691_100179214 | 105 |
| 396 | 3300025940 | Ga0207691_10098382 | Ga0207691_100983822 | 105 |
| 397 | 3300025940 | Ga0207691_10151074 | Ga0207691_101510742 | 105 |
| 398 | 3300025940 | Ga0207691_10209251 | Ga0207691_102092513 | 105 |
| 399 | 3300025940 | Ga0207691_10251286 | Ga0207691_102512862 | 105 |
| 400 | 3300025940 | Ga0207691_10383118 | Ga0207691_103831182 | 105 |
| 401 | 3300025940 | Ga0207691_10494545 | Ga0207691_104945452 | 105 |
| 402 | 3300025940 | Ga0207691_10527775 | Ga0207691_105277752 | 105 |
| 403 | 3300025940 | Ga0207691_10568742 | Ga0207691_105687422 | 105 |
| 404 | 3300025941 | Ga0207711_10000187 | Ga0207711_1000018767 | 105 |
| 405 | 3300025941 | Ga0207711_10002648 | Ga0207711_1000264821 | 105 |
| 406 | 3300025941 | Ga0207711_10146986 | Ga0207711_101469865 | 105 |
| 407 | 3300025941 | Ga0207711_10311962 | Ga0207711_103119622 | 105 |
| 408 | 3300025941 | Ga0207711_10830241 | Ga0207711_108302412 | 105 |
| 409 | 3300025942 | Ga0207689_10027620 | Ga0207689_100276207 | 105 |
| 410 | 3300025942 | Ga0207689_10273854 | Ga0207689_102738542 | 105 |
| 411 | 3300025942 | Ga0207689_10679147 | Ga0207689_106791472 | 105 |
| 412 | 3300025942 | Ga0207689_10839995 | Ga0207689_108399952 | 105 |
| 413 | 3300025945 | Ga0207679_10000847 | Ga0207679_1000084715 | 105 |
| 414 | 3300025945 | Ga0207679_10178447 | Ga0207679_101784475 | 105 |
| 415 | 3300025945 | Ga0207679_10476415 | Ga0207679_104764151 | 105 |
| 416 | 3300025945 | Ga0207679_10690008 | Ga0207679_106900082 | 105 |
| 417 | 3300025945 | Ga0207679_11034195 | Ga0207679_110341952 | 105 |
| 418 | 3300025945 | Ga0207679_11311878 | Ga0207679_113118782 | 105 |
| 419 | 3300025949 | Ga0207667_10844202 | Ga0207667_108442022 | 105 |
| 420 | 3300025949 | Ga0207667_11974698 | Ga0207667_119746982 | 105 |
| 421 | 3300025960 | Ga0207651_10051794 | Ga0207651_100517945 | 105 |
| 422 | 3300025960 | Ga0207651_10057032 | Ga0207651_100570326 | 105 |
| 423 | 3300025960 | Ga0207651_10149405 | Ga0207651_101494055 | 105 |
| 424 | 3300025960 | Ga0207651_10463917 | Ga0207651_104639173 | 105 |
| 425 | 3300025960 | Ga0207651_10653663 | Ga0207651_106536633 | 105 |
| 426 | 3300025960 | Ga0207651_11490797 | Ga0207651_114907972 | 105 |
| 427 | 3300025960 | Ga0207651_11906616 | Ga0207651_119066161 | 105 |
| 428 | 3300025961 | Ga0207712_10000723 | Ga0207712_1000072332 | 105 |
| 429 | 3300025961 | Ga0207712_10058661 | Ga0207712_100586612 | 105 |
| 430 | 3300025961 | Ga0207712_10528760 | Ga0207712_105287602 | 105 |
| 431 | 3300025961 | Ga0207712_11218363 | Ga0207712_112183632 | 105 |
| 432 | 3300025972 | Ga0207668_10000062 | Ga0207668_1000006226 | 105 |
| 433 | 3300025972 | Ga0207668_10005099 | Ga0207668_1000509914 | 105 |
| 434 | 3300025972 | Ga0207668_10307609 | Ga0207668_103076093 | 105 |
| 435 | 3300025972 | Ga0207668_10489488 | Ga0207668_104894882 | 105 |
| 436 | 3300025972 | Ga0207668_10555107 | Ga0207668_105551072 | 105 |
| 437 | 3300025972 | Ga0207668_10652594 | Ga0207668_106525942 | 105 |
| 438 | 3300025972 | Ga0207668_11391155 | Ga0207668_113911552 | 105 |
| 439 | 3300025972 | Ga0207668_11532923 | Ga0207668_115329232 | 105 |
| 440 | 3300025972 | Ga0207668_11629839 | Ga0207668_116298392 | 105 |
| 441 | 3300025972 | Ga0207668_11970300 | Ga0207668_119703002 | 105 |
| 442 | 3300025981 | Ga0207640_10411255 | Ga0207640_104112552 | 105 |
| 443 | 3300025981 | Ga0207640_10507195 | Ga0207640_105071952 | 105 |
| 444 | 3300025981 | Ga0207640_10712610 | Ga0207640_107126101 | 105 |
| 445 | 3300025981 | Ga0207640_10799406 | Ga0207640_107994062 | 105 |
| 446 | 3300025986 | Ga0207658_10009384 | Ga0207658_100093849 | 105 |
| 447 | 3300025986 | Ga0207658_10097851 | Ga0207658_100978512 | 105 |
| 448 | 3300025986 | Ga0207658_10099440 | Ga0207658_100994405 | 105 |
| 449 | 3300025986 | Ga0207658_10100496 | Ga0207658_101004964 | 105 |
| 450 | 3300025986 | Ga0207658_10239370 | Ga0207658_102393702 | 105 |
| 451 | 3300025986 | Ga0207658_11115281 | Ga0207658_111152812 | 105 |
| 452 | 3300026023 | Ga0207677_10161348 | Ga0207677_101613482 | 105 |
| 453 | 3300026023 | Ga0207677_10414289 | Ga0207677_104142893 | 105 |
| 454 | 3300026023 | Ga0207677_10819684 | Ga0207677_108196841 | 105 |
| 455 | 3300026035 | Ga0207703_10001977 | Ga0207703_1000197717 | 105 |
| 456 | 3300026035 | Ga0207703_10010836 | Ga0207703_1001083614 | 105 |
| 457 | 3300026035 | Ga0207703_10599177 | Ga0207703_105991772 | 105 |
| 458 | 3300026041 | Ga0207639_10111479 | Ga0207639_101114794 | 105 |
| 459 | 3300026067 | Ga0207678_10370331 | Ga0207678_103703313 | 105 |
| 460 | 3300026067 | Ga0207678_10771868 | Ga0207678_107718681 | 105 |
| 461 | 3300026067 | Ga0207678_11458363 | Ga0207678_114583632 | 105 |
| 462 | 3300026067 | Ga0207678_11720542 | Ga0207678_117205422 | 105 |
| 463 | 3300026075 | Ga0207708_10078244 | Ga0207708_100782442 | 105 |
| 464 | 3300026075 | Ga0207708_10417118 | Ga0207708_104171182 | 105 |
| 465 | 3300026088 | Ga0207641_10001914 | Ga0207641_1000191420 | 105 |
| 466 | 3300026088 | Ga0207641_10048399 | Ga0207641_100483997 | 105 |
| 467 | 3300026088 | Ga0207641_10303995 | Ga0207641_103039953 | 105 |
| 468 | 3300026088 | Ga0207641_11644770 | Ga0207641_116447701 | 105 |
| 469 | 3300026089 | Ga0207648_10008052 | Ga0207648_1000805214 | 105 |
| 470 | 3300026089 | Ga0207648_10085028 | Ga0207648_100850282 | 105 |
| 471 | 3300026089 | Ga0207648_10528360 | Ga0207648_105283602 | 105 |
| 472 | 3300026089 | Ga0207648_11964576 | Ga0207648_119645762 | 105 |
| 473 | 3300026095 | Ga0207676_10000887 | Ga0207676_1000088721 | 105 |
| 474 | 3300026095 | Ga0207676_10136979 | Ga0207676_101369792 | 105 |
| 475 | 3300026116 | Ga0207674_10200772 | Ga0207674_102007722 | 105 |
| 476 | 3300026116 | Ga0207674_10248268 | Ga0207674_102482684 | 105 |
| 477 | 3300026116 | Ga0207674_10326381 | Ga0207674_103263811 | 105 |
| 478 | 3300026118 | Ga0207675_100058362 | Ga0207675_1000583625 | 105 |
| 479 | 3300026118 | Ga0207675_100112244 | Ga0207675_1001122442 | 105 |
| 480 | 3300026118 | Ga0207675_100427779 | Ga0207675_1004277792 | 105 |
| 481 | 3300026118 | Ga0207675_100939393 | Ga0207675_1009393932 | 105 |
| 482 | 3300026118 | Ga0207675_101010232 | Ga0207675_1010102322 | 105 |
| 483 | 3300026121 | Ga0207683_10048556 | Ga0207683_100485567 | 105 |
| 484 | 3300026121 | Ga0207683_10062679 | Ga0207683_100626795 | 105 |
| 485 | 3300026121 | Ga0207683_10083383 | Ga0207683_100833835 | 105 |
| 486 | 3300026121 | Ga0207683_10195383 | Ga0207683_101953832 | 105 |
| 487 | 3300027252 | Ga0209973_1018889 | Ga0209973_10188891 | 105 |
| 488 | 3300027364 | Ga0209967_1006839 | Ga0209967_10068392 | 105 |
| 489 | 3300027364 | Ga0209967_1019832 | Ga0209967_10198322 | 105 |
| 490 | 3300027395 | Ga0209996_1039259 | Ga0209996_10392591 | 105 |
| 491 | 3300027462 | Ga0210000_1085988 | Ga0210000_10859881 | 105 |
| 492 | 3300027471 | Ga0209995_1021235 | Ga0209995_10212352 | 105 |
| 493 | 3300027543 | Ga0209999_1017123 | Ga0209999_10171232 | 105 |
| 494 | 3300027543 | Ga0209999_1018091 | Ga0209999_10180913 | 105 |
| 495 | 3300027552 | Ga0209982_1041017 | Ga0209982_10410172 | 105 |
| 496 | 3300027614 | Ga0209970_1092736 | Ga0209970_10927361 | 105 |
| 497 | 3300027617 | Ga0210002_1015203 | Ga0210002_10152032 | 105 |
| 498 | 3300027617 | Ga0210002_1044249 | Ga0210002_10442492 | 105 |
| 499 | 3300027665 | Ga0209983_1004203 | Ga0209983_10042037 | 105 |
| 500 | 3300027665 | Ga0209983_1026942 | Ga0209983_10269422 | 105 |
| 501 | 3300027682 | Ga0209971_1008830 | Ga0209971_10088306 | 105 |
| 502 | 3300027682 | Ga0209971_1018387 | Ga0209971_10183872 | 105 |
| 503 | 3300027682 | Ga0209971_1099775 | Ga0209971_10997752 | 105 |
| 504 | 3300027876 | Ga0209974_10006589 | Ga0209974_100065897 | 105 |
| 505 | 3300027876 | Ga0209974_10026176 | Ga0209974_100261762 | 105 |
| 506 | 3300027907 | Ga0207428_10035157 | Ga0207428_100351575 | 105 |
| 507 | 3300027907 | Ga0207428_11058933 | Ga0207428_110589332 | 105 |
| 508 | 3300028379 | Ga0268266_10415156 | Ga0268266_104151562 | 105 |
| 509 | 3300028379 | Ga0268266_10454790 | Ga0268266_104547902 | 105 |
| 510 | 3300028380 | Ga0268265_10071746 | Ga0268265_100717466 | 105 |
| 511 | 3300028380 | Ga0268265_10174961 | Ga0268265_101749612 | 105 |
| 512 | 3300028380 | Ga0268265_10182671 | Ga0268265_101826714 | 105 |
| 513 | 3300028380 | Ga0268265_10244660 | Ga0268265_102446602 | 105 |
| 514 | 3300028380 | Ga0268265_10279378 | Ga0268265_102793783 | 105 |
| 515 | 3300028380 | Ga0268265_10607693 | Ga0268265_106076932 | 105 |
| 516 | 3300028380 | Ga0268265_11192780 | Ga0268265_111927801 | 105 |
| 517 | 3300028380 | Ga0268265_12715020 | Ga0268265_127150202 | 105 |
| 518 | 3300028381 | Ga0268264_10032595 | Ga0268264_100325955 | 105 |
| 519 | 3300028381 | Ga0268264_10049844 | Ga0268264_100498447 | 105 |
| 520 | 3300028381 | Ga0268264_10085501 | Ga0268264_100855013 | 105 |
| 521 | 3300028381 | Ga0268264_10181307 | Ga0268264_101813074 | 105 |
| 522 | 3300028381 | Ga0268264_12022403 | Ga0268264_120224032 | 105 |
| 523 | 3300028381 | Ga0268264_12028648 | Ga0268264_120286482 | 105 |
| 524 | 3300028381 | Ga0268264_12617168 | Ga0268264_126171682 | 105 |
| 525 | 3300028794 | Ga0307515_10499480 | Ga0307515_104994802 | 105 |
| 526 | 3300030731 | Ga0316177_1095584 | Ga0316177_10955842 | 105 |
| 527 | 3300030732 | Ga0316176_1032322 | Ga0316176_10323222 | 105 |
| 528 | 3300030733 | Ga0314311_1156759 | Ga0314311_11567592 | 105 |
| 529 | 3300030735 | Ga0316178_1181760 | Ga0316178_11817602 | 105 |
| 530 | 3300030736 | Ga0316180_1044038 | Ga0316180_10440381 | 105 |
| 531 | 3300030744 | Ga0316181_1190288 | Ga0316181_11902882 | 105 |
| 532 | 3300030744 | Ga0316181_1197219 | Ga0316181_11972192 | 105 |
| 533 | 3300030745 | Ga0316182_1336707 | Ga0316182_13367072 | 105 |
| 534 | 3300030745 | Ga0316182_1382068 | Ga0316182_13820682 | 105 |
| 535 | 3300031456 | Ga0307513_10080829 | Ga0307513_100808292 | 105 |
| 536 | 3300031548 | Ga0307408_100011902 | Ga0307408_1000119025 | 105 |
| 537 | 3300031548 | Ga0307408_100029728 | Ga0307408_1000297282 | 105 |
| 538 | 3300031548 | Ga0307408_100037962 | Ga0307408_1000379625 | 105 |
| 539 | 3300031548 | Ga0307408_100156015 | Ga0307408_1001560152 | 105 |
| 540 | 3300031548 | Ga0307408_100226414 | Ga0307408_1002264143 | 105 |
| 541 | 3300031548 | Ga0307408_100259848 | Ga0307408_1002598483 | 105 |
| 542 | 3300031548 | Ga0307408_100269957 | Ga0307408_1002699574 | 105 |
| 543 | 3300031548 | Ga0307408_100316085 | Ga0307408_1003160853 | 105 |
| 544 | 3300031548 | Ga0307408_100439960 | Ga0307408_1004399603 | 105 |
| 545 | 3300031548 | Ga0307408_100720196 | Ga0307408_1007201962 | 105 |
| 546 | 3300031548 | Ga0307408_100810258 | Ga0307408_1008102581 | 105 |
| 547 | 3300031548 | Ga0307408_100935096 | Ga0307408_1009350962 | 105 |
| 548 | 3300031548 | Ga0307408_101245240 | Ga0307408_1012452401 | 105 |
| 549 | 3300031548 | Ga0307408_101606305 | Ga0307408_1016063052 | 105 |
| 550 | 3300031548 | Ga0307408_102087860 | Ga0307408_1020878601 | 105 |
| 551 | 3300031548 | Ga0307408_102205024 | Ga0307408_1022050242 | 105 |
| 552 | 3300031731 | Ga0307405_10010430 | Ga0307405_100104306 | 105 |
| 553 | 3300031731 | Ga0307405_10018478 | Ga0307405_100184783 | 105 |
| 554 | 3300031731 | Ga0307405_10023082 | Ga0307405_100230827 | 105 |
| 555 | 3300031731 | Ga0307405_10039649 | Ga0307405_100396496 | 105 |
| 556 | 3300031731 | Ga0307405_10155256 | Ga0307405_101552562 | 105 |
| 557 | 3300031731 | Ga0307405_10233894 | Ga0307405_102338943 | 105 |
| 558 | 3300031731 | Ga0307405_10334054 | Ga0307405_103340542 | 105 |
| 559 | 3300031731 | Ga0307405_10341844 | Ga0307405_103418443 | 105 |
| 560 | 3300031731 | Ga0307405_10437606 | Ga0307405_104376062 | 105 |
| 561 | 3300031731 | Ga0307405_10753482 | Ga0307405_107534822 | 105 |
| 562 | 3300031731 | Ga0307405_10916131 | Ga0307405_109161312 | 105 |
| 563 | 3300031731 | Ga0307405_10984772 | Ga0307405_109847721 | 105 |
| 564 | 3300031731 | Ga0307405_11175338 | Ga0307405_111753382 | 105 |
| 565 | 3300031731 | Ga0307405_11922413 | Ga0307405_119224132 | 105 |
| 566 | 3300031731 | Ga0307405_12092790 | Ga0307405_120927902 | 105 |
| 567 | 3300031824 | Ga0307413_10028039 | Ga0307413_100280395 | 105 |
| 568 | 3300031824 | Ga0307413_10030478 | Ga0307413_100304782 | 105 |
| 569 | 3300031824 | Ga0307413_10047616 | Ga0307413_100476166 | 105 |
| 570 | 3300031824 | Ga0307413_10093518 | Ga0307413_100935185 | 105 |
| 571 | 3300031824 | Ga0307413_10194343 | Ga0307413_101943434 | 105 |
| 572 | 3300031824 | Ga0307413_10231029 | Ga0307413_102310293 | 105 |
| 573 | 3300031824 | Ga0307413_10379675 | Ga0307413_103796752 | 105 |
| 574 | 3300031824 | Ga0307413_10570159 | Ga0307413_105701592 | 105 |
| 575 | 3300031824 | Ga0307413_10740652 | Ga0307413_107406522 | 105 |
| 576 | 3300031824 | Ga0307413_10823113 | Ga0307413_108231132 | 105 |
| 577 | 3300031824 | Ga0307413_10846257 | Ga0307413_108462572 | 105 |
| 578 | 3300031824 | Ga0307413_10906449 | Ga0307413_109064491 | 105 |
| 579 | 3300031824 | Ga0307413_10918840 | Ga0307413_109188402 | 105 |
| 580 | 3300031824 | Ga0307413_11128140 | Ga0307413_111281402 | 105 |
| 581 | 3300031824 | Ga0307413_11790309 | Ga0307413_117903091 | 105 |
| 582 | 3300031824 | Ga0307413_12117902 | Ga0307413_121179021 | 105 |
| 583 | 3300031852 | Ga0307410_10035633 | Ga0307410_100356337 | 105 |
| 584 | 3300031852 | Ga0307410_10037070 | Ga0307410_100370705 | 105 |
| 585 | 3300031852 | Ga0307410_10058166 | Ga0307410_100581662 | 105 |
| 586 | 3300031852 | Ga0307410_10060845 | Ga0307410_100608455 | 105 |
| 587 | 3300031852 | Ga0307410_10082754 | Ga0307410_100827542 | 105 |
| 588 | 3300031852 | Ga0307410_10208325 | Ga0307410_102083253 | 105 |
| 589 | 3300031852 | Ga0307410_10208624 | Ga0307410_102086242 | 105 |
| 590 | 3300031852 | Ga0307410_10210448 | Ga0307410_102104483 | 105 |
| 591 | 3300031852 | Ga0307410_10234192 | Ga0307410_102341922 | 105 |
| 592 | 3300031852 | Ga0307410_10509222 | Ga0307410_105092223 | 105 |
| 593 | 3300031852 | Ga0307410_10598937 | Ga0307410_105989372 | 105 |
| 594 | 3300031852 | Ga0307410_10602380 | Ga0307410_106023802 | 105 |
| 595 | 3300031852 | Ga0307410_10755548 | Ga0307410_107555482 | 105 |
| 596 | 3300031852 | Ga0307410_10830731 | Ga0307410_108307312 | 105 |
| 597 | 3300031852 | Ga0307410_11206431 | Ga0307410_112064312 | 105 |
| 598 | 3300031852 | Ga0307410_11303930 | Ga0307410_113039301 | 105 |
| 599 | 3300031901 | Ga0307406_10008913 | Ga0307406_100089138 | 105 |
| 600 | 3300031901 | Ga0307406_10064083 | Ga0307406_100640832 | 105 |
| 601 | 3300031901 | Ga0307406_10073030 | Ga0307406_100730304 | 105 |
| 602 | 3300031901 | Ga0307406_10240914 | Ga0307406_102409143 | 105 |
| 603 | 3300031901 | Ga0307406_10248456 | Ga0307406_102484563 | 105 |
| 604 | 3300031901 | Ga0307406_10388520 | Ga0307406_103885202 | 105 |
| 605 | 3300031901 | Ga0307406_10402491 | Ga0307406_104024912 | 105 |
| 606 | 3300031901 | Ga0307406_10433246 | Ga0307406_104332462 | 105 |
| 607 | 3300031901 | Ga0307406_10540709 | Ga0307406_105407091 | 105 |
| 608 | 3300031901 | Ga0307406_10736089 | Ga0307406_107360892 | 105 |
| 609 | 3300031901 | Ga0307406_10992212 | Ga0307406_109922122 | 105 |
| 610 | 3300031901 | Ga0307406_12112191 | Ga0307406_121121912 | 105 |
| 611 | 3300031903 | Ga0307407_10008290 | Ga0307407_1000829010 | 105 |
| 612 | 3300031903 | Ga0307407_10009308 | Ga0307407_1000930810 | 105 |
| 613 | 3300031903 | Ga0307407_10060756 | Ga0307407_100607565 | 105 |
| 614 | 3300031903 | Ga0307407_10167370 | Ga0307407_101673702 | 105 |
| 615 | 3300031903 | Ga0307407_10218009 | Ga0307407_102180092 | 105 |
| 616 | 3300031903 | Ga0307407_10335111 | Ga0307407_103351113 | 105 |
| 617 | 3300031903 | Ga0307407_10342109 | Ga0307407_103421092 | 105 |
| 618 | 3300031903 | Ga0307407_10464728 | Ga0307407_104647282 | 105 |
| 619 | 3300031903 | Ga0307407_10473362 | Ga0307407_104733623 | 105 |
| 620 | 3300031903 | Ga0307407_10525964 | Ga0307407_105259642 | 105 |
| 621 | 3300031903 | Ga0307407_10703507 | Ga0307407_107035072 | 105 |
| 622 | 3300031903 | Ga0307407_10742387 | Ga0307407_107423872 | 105 |
| 623 | 3300031903 | Ga0307407_10823678 | Ga0307407_108236782 | 105 |
| 624 | 3300031903 | Ga0307407_11005090 | Ga0307407_110050902 | 105 |
| 625 | 3300031903 | Ga0307407_11116489 | Ga0307407_111164892 | 105 |
| 626 | 3300031903 | Ga0307407_11227213 | Ga0307407_112272132 | 105 |
| 627 | 3300031903 | Ga0307407_11296610 | Ga0307407_112966101 | 105 |
| 628 | 3300031903 | Ga0307407_11407525 | Ga0307407_114075252 | 105 |
| 629 | 3300031911 | Ga0307412_10006281 | Ga0307412_1000628114 | 105 |
| 630 | 3300031911 | Ga0307412_10012926 | Ga0307412_100129267 | 105 |
| 631 | 3300031911 | Ga0307412_10036041 | Ga0307412_100360416 | 105 |
| 632 | 3300031911 | Ga0307412_10044633 | Ga0307412_100446332 | 105 |
| 633 | 3300031911 | Ga0307412_10047521 | Ga0307412_100475212 | 105 |
| 634 | 3300031911 | Ga0307412_10124407 | Ga0307412_101244072 | 105 |
| 635 | 3300031911 | Ga0307412_10277576 | Ga0307412_102775763 | 105 |
| 636 | 3300031911 | Ga0307412_10313154 | Ga0307412_103131542 | 105 |
| 637 | 3300031911 | Ga0307412_10450200 | Ga0307412_104502002 | 105 |
| 638 | 3300031911 | Ga0307412_10566574 | Ga0307412_105665742 | 105 |
| 639 | 3300031911 | Ga0307412_10863396 | Ga0307412_108633962 | 105 |
| 640 | 3300031911 | Ga0307412_11005137 | Ga0307412_110051372 | 105 |
| 641 | 3300031911 | Ga0307412_11296586 | Ga0307412_112965862 | 105 |
| 642 | 3300031911 | Ga0307412_11336188 | Ga0307412_113361882 | 105 |
| 643 | 3300031911 | Ga0307412_11661722 | Ga0307412_116617222 | 105 |
| 644 | 3300031911 | Ga0307412_11681117 | Ga0307412_116811172 | 105 |
| 645 | 3300031911 | Ga0307412_11840221 | Ga0307412_118402212 | 105 |
| 646 | 3300031911 | Ga0307412_12286736 | Ga0307412_122867361 | 105 |
| 647 | 3300031995 | Ga0307409_100032709 | Ga0307409_1000327097 | 105 |
| 648 | 3300031995 | Ga0307409_100057297 | Ga0307409_1000572975 | 105 |
| 649 | 3300031995 | Ga0307409_100179988 | Ga0307409_1001799882 | 105 |
| 650 | 3300031995 | Ga0307409_100220023 | Ga0307409_1002200232 | 105 |
| 651 | 3300031995 | Ga0307409_100267166 | Ga0307409_1002671662 | 105 |
| 652 | 3300031995 | Ga0307409_100289380 | Ga0307409_1002893801 | 105 |
| 653 | 3300031995 | Ga0307409_100344246 | Ga0307409_1003442462 | 105 |
| 654 | 3300031995 | Ga0307409_100395964 | Ga0307409_1003959642 | 105 |
| 655 | 3300031995 | Ga0307409_100404232 | Ga0307409_1004042322 | 105 |
| 656 | 3300031995 | Ga0307409_100434010 | Ga0307409_1004340102 | 105 |
| 657 | 3300031995 | Ga0307409_100519938 | Ga0307409_1005199383 | 105 |
| 658 | 3300031995 | Ga0307409_100563327 | Ga0307409_1005633271 | 105 |
| 659 | 3300031995 | Ga0307409_100840037 | Ga0307409_1008400372 | 105 |
| 660 | 3300031995 | Ga0307409_101158821 | Ga0307409_1011588212 | 105 |
| 661 | 3300031995 | Ga0307409_101309987 | Ga0307409_1013099872 | 105 |
| 662 | 3300031995 | Ga0307409_101325463 | Ga0307409_1013254632 | 105 |
| 663 | 3300031995 | Ga0307409_101404314 | Ga0307409_1014043142 | 105 |
| 664 | 3300031995 | Ga0307409_101635272 | Ga0307409_1016352722 | 105 |
| 665 | 3300031995 | Ga0307409_101848383 | Ga0307409_1018483832 | 105 |
| 666 | 3300031995 | Ga0307409_102038076 | Ga0307409_1020380761 | 105 |
| 667 | 3300031995 | Ga0307409_102314326 | Ga0307409_1023143261 | 105 |
| 668 | 3300032002 | Ga0307416_100017376 | Ga0307416_1000173762 | 105 |
| 669 | 3300032002 | Ga0307416_100022017 | Ga0307416_1000220179 | 105 |
| 670 | 3300032002 | Ga0307416_100038293 | Ga0307416_1000382938 | 105 |
| 671 | 3300032002 | Ga0307416_100096521 | Ga0307416_1000965214 | 105 |
| 672 | 3300032002 | Ga0307416_100124968 | Ga0307416_1001249682 | 105 |
| 673 | 3300032002 | Ga0307416_100380751 | Ga0307416_1003807512 | 105 |
| 674 | 3300032002 | Ga0307416_100424701 | Ga0307416_1004247012 | 105 |
| 675 | 3300032002 | Ga0307416_100566945 | Ga0307416_1005669453 | 105 |
| 676 | 3300032002 | Ga0307416_100698249 | Ga0307416_1006982492 | 105 |
| 677 | 3300032002 | Ga0307416_100745941 | Ga0307416_1007459413 | 105 |
| 678 | 3300032002 | Ga0307416_101121299 | Ga0307416_1011212992 | 105 |
| 679 | 3300032002 | Ga0307416_101161505 | Ga0307416_1011615052 | 105 |
| 680 | 3300032002 | Ga0307416_101268871 | Ga0307416_1012688712 | 105 |
| 681 | 3300032002 | Ga0307416_101493342 | Ga0307416_1014933422 | 105 |
| 682 | 3300032002 | Ga0307416_102990679 | Ga0307416_1029906792 | 105 |
| 683 | 3300032004 | Ga0307414_10018742 | Ga0307414_100187428 | 105 |
| 684 | 3300032004 | Ga0307414_10022834 | Ga0307414_100228348 | 105 |
| 685 | 3300032004 | Ga0307414_10072274 | Ga0307414_100722745 | 105 |
| 686 | 3300032004 | Ga0307414_10320779 | Ga0307414_103207793 | 105 |
| 687 | 3300032004 | Ga0307414_10353189 | Ga0307414_103531892 | 105 |
| 688 | 3300032004 | Ga0307414_10433900 | Ga0307414_104339002 | 105 |
| 689 | 3300032004 | Ga0307414_10434621 | Ga0307414_104346212 | 105 |
| 690 | 3300032004 | Ga0307414_10439682 | Ga0307414_104396822 | 105 |
| 691 | 3300032004 | Ga0307414_10492079 | Ga0307414_104920792 | 105 |
| 692 | 3300032004 | Ga0307414_10528231 | Ga0307414_105282312 | 105 |
| 693 | 3300032004 | Ga0307414_10546737 | Ga0307414_105467372 | 105 |
| 694 | 3300032004 | Ga0307414_10602323 | Ga0307414_106023231 | 105 |
| 695 | 3300032004 | Ga0307414_10668635 | Ga0307414_106686351 | 105 |
| 696 | 3300032004 | Ga0307414_10787144 | Ga0307414_107871442 | 105 |
| 697 | 3300032004 | Ga0307414_10860700 | Ga0307414_108607002 | 105 |
| 698 | 3300032004 | Ga0307414_10897182 | Ga0307414_108971822 | 105 |
| 699 | 3300032004 | Ga0307414_10961044 | Ga0307414_109610442 | 105 |
| 700 | 3300032004 | Ga0307414_11044415 | Ga0307414_110444152 | 105 |
| 701 | 3300032004 | Ga0307414_11125013 | Ga0307414_111250131 | 105 |
| 702 | 3300032004 | Ga0307414_11163839 | Ga0307414_111638392 | 105 |
| 703 | 3300032004 | Ga0307414_11675005 | Ga0307414_116750052 | 105 |
| 704 | 3300032004 | Ga0307414_11910434 | Ga0307414_119104342 | 105 |
| 705 | 3300032005 | Ga0307411_10031516 | Ga0307411_100315165 | 105 |
| 706 | 3300032005 | Ga0307411_10052995 | Ga0307411_100529954 | 105 |
| 707 | 3300032005 | Ga0307411_10062837 | Ga0307411_100628374 | 105 |
| 708 | 3300032005 | Ga0307411_10067691 | Ga0307411_100676913 | 105 |
| 709 | 3300032005 | Ga0307411_10243867 | Ga0307411_102438672 | 105 |
| 710 | 3300032005 | Ga0307411_10287202 | Ga0307411_102872022 | 105 |
| 711 | 3300032005 | Ga0307411_10319854 | Ga0307411_103198542 | 105 |
| 712 | 3300032005 | Ga0307411_10413340 | Ga0307411_104133402 | 105 |
| 713 | 3300032005 | Ga0307411_10506610 | Ga0307411_105066103 | 105 |
| 714 | 3300032005 | Ga0307411_10644191 | Ga0307411_106441911 | 105 |
| 715 | 3300032005 | Ga0307411_10661518 | Ga0307411_106615182 | 105 |
| 716 | 3300032005 | Ga0307411_10756839 | Ga0307411_107568392 | 105 |
| 717 | 3300032005 | Ga0307411_10793363 | Ga0307411_107933632 | 105 |
| 718 | 3300032005 | Ga0307411_10903904 | Ga0307411_109039041 | 105 |
| 719 | 3300032005 | Ga0307411_10942350 | Ga0307411_109423502 | 105 |
| 720 | 3300032005 | Ga0307411_10974947 | Ga0307411_109749472 | 105 |
| 721 | 3300032005 | Ga0307411_11171978 | Ga0307411_111719782 | 105 |
| 722 | 3300032005 | Ga0307411_11464693 | Ga0307411_114646932 | 105 |
| 723 | 3300032005 | Ga0307411_11650413 | Ga0307411_116504132 | 105 |
| 724 | 3300032005 | Ga0307411_11814352 | Ga0307411_118143522 | 105 |
| 725 | 3300032005 | Ga0307411_11883005 | Ga0307411_118830052 | 105 |
| 726 | 3300032005 | Ga0307411_12069499 | Ga0307411_120694992 | 105 |
| 727 | 3300032126 | Ga0307415_100011564 | Ga0307415_1000115649 | 105 |
| 728 | 3300032126 | Ga0307415_100013332 | Ga0307415_1000133325 | 105 |
| 729 | 3300032126 | Ga0307415_100028587 | Ga0307415_1000285875 | 105 |
| 730 | 3300032126 | Ga0307415_100036868 | Ga0307415_1000368687 | 105 |
| 731 | 3300032126 | Ga0307415_100043471 | Ga0307415_1000434711 | 105 |
| 732 | 3300032126 | Ga0307415_100270569 | Ga0307415_1002705692 | 105 |
| 733 | 3300032126 | Ga0307415_100298498 | Ga0307415_1002984981 | 105 |
| 734 | 3300032126 | Ga0307415_100301048 | Ga0307415_1003010482 | 105 |
| 735 | 3300032126 | Ga0307415_100426629 | Ga0307415_1004266292 | 105 |
| 736 | 3300032126 | Ga0307415_100531167 | Ga0307415_1005311672 | 105 |
| 737 | 3300032126 | Ga0307415_100590757 | Ga0307415_1005907572 | 105 |
| 738 | 3300032126 | Ga0307415_100593777 | Ga0307415_1005937772 | 105 |
| 739 | 3300032126 | Ga0307415_100699337 | Ga0307415_1006993372 | 105 |
| 740 | 3300032126 | Ga0307415_100887487 | Ga0307415_1008874871 | 105 |
| 741 | 3300032126 | Ga0307415_101098635 | Ga0307415_1010986352 | 105 |
| 742 | 3300032126 | Ga0307415_101953376 | Ga0307415_1019533762 | 105 |
| 743 | 3300032126 | Ga0307415_101982843 | Ga0307415_1019828432 | 105 |
| 744 | 3300032126 | Ga0307415_102100374 | Ga0307415_1021003742 | 105 |
| 745 | 3300032126 | Ga0307415_102110096 | Ga0307415_1021100962 | 105 |
| 746 | 3300032126 | Ga0307415_102330520 | Ga0307415_1023305201 | 105 |
| 747 | 3300035112 | Ga0373932_0250958 | Ga0373932_0250958_109_429 | 105 |
| 748 | 3300035170 | Ga0373943_0594593 | Ga0373943_0594593_51_371 | 105 |
| 749 | 3300035691 | Ga0373931_1123587 | Ga0373931_1123587_189_509 | 105 |
| 750 | 3300037312 | Ga0395899_0003333 | Ga0395899_0003333_6380_6700 | 105 |
| 751 | 3300037312 | Ga0395899_0140550 | Ga0395899_0140550_334_654 | 105 |
| 752 | 3300037312 | Ga0395899_0250955 | Ga0395899_0250955_522_842 | 105 |
| 753 | 3300037312 | Ga0395899_0263368 | Ga0395899_0263368_163_483 | 105 |
| 754 | 3300037418 | Ga0395900_0001654 | Ga0395900_0001654_22480_22800 | 105 |
| 755 | 3300037418 | Ga0395900_0015985 | Ga0395900_0015985_1293_1613 | 105 |
| 756 | 3300037418 | Ga0395900_0343221 | Ga0395900_0343221_805_1125 | 105 |
| 757 | 3300037418 | Ga0395900_0460257 | Ga0395900_0460257_199_519 | 105 |
| 758 | 3300037418 | Ga0395900_0551353 | Ga0395900_0551353_37_357 | 105 |
| 759 | 3300037466 | Ga0395898_0004457 | Ga0395898_0004457_9474_9794 | 105 |
| 760 | 3300037471 | Ga0395905_0001805 | Ga0395905_0001805_19422_19742 | 105 |
| 761 | 3300037471 | Ga0395905_0044969 | Ga0395905_0044969_1184_1504 | 105 |
| 762 | 3300037471 | Ga0395905_0050764 | Ga0395905_0050764_833_1153 | 105 |
| 763 | 3300037471 | Ga0395905_0068615 | Ga0395905_0068615_339_659 | 105 |
| 764 | 3300037471 | Ga0395905_0082015 | Ga0395905_0082015_822_1142 | 105 |
| 765 | 3300037471 | Ga0395905_0158329 | Ga0395905_0158329_45_365 | 105 |
| 766 | 3300037471 | Ga0395905_0352281 | Ga0395905_0352281_886_1206 | 105 |
| 767 | 3300037471 | Ga0395905_0440016 | Ga0395905_0440016_223_543 | 105 |
| 768 | 3300037471 | Ga0395905_0488828 | Ga0395905_0488828_483_803 | 105 |
| 769 | 3300037471 | Ga0395905_0592508 | Ga0395905_0592508_493_813 | 105 |
| 770 | 3300037471 | Ga0395905_1521906 | Ga0395905_1521906_227_547 | 105 |
| 771 | 3300038443 | Ga0395901_0005009 | Ga0395901_0005009_6995_7315 | 105 |
| 772 | 3300038443 | Ga0395901_0014323 | Ga0395901_0014323_1998_2318 | 105 |
| 773 | 3300038443 | Ga0395901_0134888 | Ga0395901_0134888_1870_2190 | 105 |
| 774 | 3300038443 | Ga0395901_0693791 | Ga0395901_0693791_296_616 | 105 |
| 775 | 3300038443 | Ga0395901_0796333 | Ga0395901_0796333_294_614 | 105 |
| 776 | 3300038443 | Ga0395901_1329930 | Ga0395901_1329930_32_352 | 105 |
| 777 | 3300038705 | Ga0237819_00486 | Ga0237819_00486_11285_11605 | 105 |
| 778 | 3300039450 | Ga0436363_1059172 | Ga0436363_1059172_608_925 | 105 |
| 779 | 3300041404 | Ga0439436_0183483 | Ga0439436_0183483_78_398 | 105 |
| 780 | 3300041405 | Ga0439438_057718 | Ga0439438_057718_527_847 | 105 |
| 781 | 3300041406 | Ga0439439_0175481 | Ga0439439_0175481_73_393 | 105 |
| 782 | 3300041411 | Ga0439466_0145034 | Ga0439466_0145034_343_663 | 105 |
| 783 | 3300041413 | Ga0439465_0156535 | Ga0439465_0156535_22_342 | 105 |
| 784 | 3300041413 | Ga0439465_0251266 | Ga0439465_0251266_120_443 | 105 |
| 785 | 3300041451 | Ga0451791_1790522 | Ga0451791_1790522_182_502 | 105 |
| 786 | 3300041453 | Ga0451797_1562310 | Ga0451797_1562310_14_334 | 105 |
| 787 | 3300041460 | Ga0451802_1688601 | Ga0451802_1688601_152_472 | 105 |
| 788 | 3300041463 | Ga0451804_0932243 | Ga0451804_0932243_49_369 | 105 |
| 789 | 3300041494 | Ga0451837_1573589 | Ga0451837_1573589_172_492 | 105 |
| 790 | 3300041999 | Ga0439433_0015993 | Ga0439433_0015993_539_859 | 105 |
| 791 | 3300042000 | Ga0439437_002305 | Ga0439437_002305_329_649 | 105 |
| 792 | 3300042002 | Ga0439442_144684 | Ga0439442_144684_133_453 | 105 |
| 793 | 3300042004 | Ga0439445_0002249 | Ga0439445_0002249_3263_3583 | 105 |
| 794 | 3300042006 | Ga0439432_029409 | Ga0439432_029409_612_932 | 105 |
| 795 | 3300042006 | Ga0439432_094846 | Ga0439432_094846_306_626 | 105 |
| 796 | 3300042006 | Ga0439432_148528 | Ga0439432_148528_69_389 | 105 |
| 797 | 3300042007 | Ga0439449_0151340 | Ga0439449_0151340_202_522 | 105 |
| 798 | 3300042007 | Ga0439449_0180434 | Ga0439449_0180434_455_775 | 105 |
| 799 | 3300042007 | Ga0439449_0334257 | Ga0439449_0334257_101_421 | 105 |
| 800 | 3300042007 | Ga0439449_0350808 | Ga0439449_0350808_113_433 | 105 |
| 801 | 3300042010 | Ga0439452_082101 | Ga0439452_082101_302_622 | 105 |
| 802 | 3300042012 | Ga0439455_0070610 | Ga0439455_0070610_586_906 | 105 |
| 803 | 3300042014 | Ga0439457_039742 | Ga0439457_039742_47_367 | 105 |
| 804 | 3300042014 | Ga0439457_171302 | Ga0439457_171302_63_383 | 105 |
| 805 | 3300042015 | Ga0439462_0021174 | Ga0439462_0021174_502_822 | 105 |
| 806 | 3300042015 | Ga0439462_0120058 | Ga0439462_0120058_144_464 | 105 |
| 807 | 3300042117 | Ga0450913_027735 | Ga0450913_027735_34_354 | 105 |
| 808 | 3300042120 | Ga0450917_012615 | Ga0450917_012615_123_443 | 105 |
| 809 | 3300042122 | Ga0450920_096264 | Ga0450920_096264_92_412 | 105 |
| 810 | 3300042123 | Ga0450921_008959 | Ga0450921_008959_485_805 | 105 |
| 811 | 3300042124 | Ga0450922_038535 | Ga0450922_038535_42_362 | 105 |
| 812 | 3300042127 | Ga0450890_002421 | Ga0450890_002421_1585_1905 | 105 |
| 813 | 3300042129 | Ga0450891_004475 | Ga0450891_004475_428_748 | 105 |
| 814 | 3300042130 | Ga0450892_010176 | Ga0450892_010176_83_403 | 105 |
| 815 | 3300042144 | Ga0450889_001840 | Ga0450889_001840_422_742 | 105 |
| 816 | 3300042144 | Ga0450889_006019 | Ga0450889_006019_545_865 | 105 |
| 817 | 3300042145 | Ga0450906_057620 | Ga0450906_057620_265_585 | 105 |
| 818 | 3300042156 | Ga0439446_0061998 | Ga0439446_0061998_397_717 | 105 |
| 819 | 3300042156 | Ga0439446_0098894 | Ga0439446_0098894_222_542 | 105 |
| 820 | 3300042157 | Ga0439458_0046507 | Ga0439458_0046507_603_923 | 105 |
| 821 | 3300042435 | Ga0439434_0019308 | Ga0439434_0019308_886_1206 | 105 |
| 822 | 3300042435 | Ga0439434_0243697 | Ga0439434_0243697_217_537 | 105 |
| 823 | 3300042436 | Ga0439435_0301583 | Ga0439435_0301583_147_467 | 105 |
| 824 | 3300042439 | Ga0439464_0032905 | Ga0439464_0032905_330_650 | 105 |
| 825 | 3300042461 | Ga0439460_0020435 | Ga0439460_0020435_161_481 | 105 |
| 826 | 3300042530 | Ga0450916_020927 | Ga0450916_020927_499_819 | 105 |
| 827 | 3300042531 | Ga0450918_009803 | Ga0450918_009803_330_650 | 105 |
| 828 | 3300042532 | Ga0450893_0026458 | Ga0450893_0026458_15_335 | 105 |
| 829 | 3300042532 | Ga0450893_0064368 | Ga0450893_0064368_229_549 | 105 |
| 830 | 3300042876 | Ga0451577_1298692 | Ga0451577_1298692_17_337 | 105 |
| 831 | 3300044656 | Ga0466969_0054413 | Ga0466969_0054413_925_1245 | 105 |
| 832 | 3300044684 | Ga0466966_0021881 | Ga0466966_0021881_541_861 | 105 |
| 833 | 3300044693 | Ga0466961_0411205 | Ga0466961_0411205_313_633 | 105 |
| 834 | 3300044765 | Ga0466970_0154144 | Ga0466970_0154144_238_558 | 105 |
| 835 | 3300044765 | Ga0466970_0157153 | Ga0466970_0157153_21_341 | 105 |
| 836 | 3300044901 | Ga0466960_0042638 | Ga0466960_0042638_39_359 | 105 |
| 837 | 3300044901 | Ga0466960_0549996 | Ga0466960_0549996_113_433 | 105 |
| 838 | 3300045049 | Ga0466959_0182707 | Ga0466959_0182707_490_810 | 105 |
| 839 | 3300045976 | Ga0466967_1994837 | Ga0466967_1994837_124_444 | 105 |
| 840 | 3300046475 | Ga0495639_0073520 | Ga0495639_0073520_277_597 | 105 |
| 841 | 3300046492 | Ga0495585_0446307 | Ga0495585_0446307_68_388 | 105 |
| 842 | 3300046492 | Ga0495585_0548424 | Ga0495585_0548424_128_448 | 105 |
| 843 | 3300046515 | Ga0495620_0051440 | Ga0495620_0051440_593_913 | 105 |
| 844 | 3300046515 | Ga0495620_0101581 | Ga0495620_0101581_500_820 | 105 |
| 845 | 3300046518 | Ga0495631_0406331 | Ga0495631_0406331_244_564 | 105 |
| 846 | 3300046520 | Ga0495637_0020520 | Ga0495637_0020520_142_462 | 105 |
| 847 | 3300046522 | Ga0495643_0098437 | Ga0495643_0098437_926_1246 | 105 |
| 848 | 3300046523 | Ga0495644_0182568 | Ga0495644_0182568_148_468 | 105 |
| 849 | 3300046523 | Ga0495644_0313718 | Ga0495644_0313718_205_525 | 105 |
| 850 | 3300046524 | Ga0495648_0420692 | Ga0495648_0420692_114_434 | 105 |
| 851 | 3300046525 | Ga0495663_0011738 | Ga0495663_0011738_888_1208 | 105 |
| 852 | 3300046525 | Ga0495663_0051618 | Ga0495663_0051618_387_707 | 105 |
| 853 | 3300046525 | Ga0495663_0086663 | Ga0495663_0086663_537_857 | 105 |
| 854 | 3300046525 | Ga0495663_0102635 | Ga0495663_0102635_309_629 | 105 |
| 855 | 3300046525 | Ga0495663_0275085 | Ga0495663_0275085_238_558 | 105 |
| 856 | 3300046528 | Ga0495642_0006927 | Ga0495642_0006927_1019_1339 | 105 |
| 857 | 3300046537 | Ga0495598_0001912 | Ga0495598_0001912_2770_3090 | 105 |
| 858 | 3300046537 | Ga0495598_0026244 | Ga0495598_0026244_152_472 | 105 |
| 859 | 3300046537 | Ga0495598_0142123 | Ga0495598_0142123_180_500 | 105 |
| 860 | 3300046537 | Ga0495598_0263710 | Ga0495598_0263710_195_518 | 105 |
| 861 | 3300046538 | Ga0495609_0292440 | Ga0495609_0292440_135_455 | 105 |
| 862 | 3300046539 | Ga0495621_0001529 | Ga0495621_0001529_3304_3624 | 105 |
| 863 | 3300046539 | Ga0495621_0011525 | Ga0495621_0011525_220_540 | 105 |
| 864 | 3300046539 | Ga0495621_0024686 | Ga0495621_0024686_369_689 | 105 |
| 865 | 3300046539 | Ga0495621_0195853 | Ga0495621_0195853_385_705 | 105 |
| 866 | 3300046539 | Ga0495621_0329202 | Ga0495621_0329202_208_531 | 105 |
| 867 | 3300046558 | Ga0495633_0001763 | Ga0495633_0001763_8962_9282 | 105 |
| 868 | 3300046558 | Ga0495633_0006943 | Ga0495633_0006943_3694_4014 | 105 |
| 869 | 3300046616 | Ga0495668_0010177 | Ga0495668_0010177_5212_5532 | 105 |
| 870 | 3300046616 | Ga0495668_0032702 | Ga0495668_0032702_1743_2063 | 105 |
| 871 | 3300046616 | Ga0495668_0054103 | Ga0495668_0054103_1628_1948 | 105 |
| 872 | 3300046616 | Ga0495668_0635583 | Ga0495668_0635583_148_468 | 105 |
| 873 | 3300046660 | Ga0495625_0053293 | Ga0495625_0053293_1552_1872 | 105 |
| 874 | 3300046660 | Ga0495625_0533467 | Ga0495625_0533467_256_576 | 105 |
| 875 | 3300046664 | Ga0495659_0051088 | Ga0495659_0051088_156_476 | 105 |
| 876 | 3300046664 | Ga0495659_0167995 | Ga0495659_0167995_178_498 | 105 |
| 877 | 3300046665 | Ga0495661_0229064 | Ga0495661_0229064_592_912 | 105 |
| 878 | 3300046665 | Ga0495661_0279995 | Ga0495661_0279995_447_767 | 105 |
| 879 | 3300046681 | Ga0495647_0015704 | Ga0495647_0015704_1899_2219 | 105 |
| 880 | 3300046684 | Ga0495669_0054353 | Ga0495669_0054353_1312_1632 | 105 |
| 881 | 3300046684 | Ga0495669_0059366 | Ga0495669_0059366_1397_1717 | 105 |
| 882 | 3300046684 | Ga0495669_0062935 | Ga0495669_0062935_199_519 | 105 |
| 883 | 3300046684 | Ga0495669_0138767 | Ga0495669_0138767_534_854 | 105 |
| 884 | 3300046684 | Ga0495669_0241253 | Ga0495669_0241253_249_569 | 105 |
| 885 | 3300046691 | Ga0495670_0139924 | Ga0495670_0139924_279_599 | 105 |
| 886 | 3300046691 | Ga0495670_0663255 | Ga0495670_0663255_75_395 | 105 |
| 887 | 3300046810 | Ga0495660_0153059 | Ga0495660_0153059_758_1078 | 105 |
| 888 | 3300047318 | Ga0495636_0034127 | Ga0495636_0034127_792_1112 | 105 |
| 889 | 3300047318 | Ga0495636_0273544 | Ga0495636_0273544_374_694 | 105 |
| 890 | 3300047320 | Ga0495672_0137127 | Ga0495672_0137127_497_817 | 105 |
| 891 | 3300047323 | Ga0495683_0316836 | Ga0495683_0316836_119_439 | 105 |
| 892 | 3300047445 | Ga0495677_0032597 | Ga0495677_0032597_416_736 | 105 |
| 893 | 3300047445 | Ga0495677_0410523 | Ga0495677_0410523_194_514 | 105 |
| 894 | 3300047470 | Ga0495681_0113591 | Ga0495681_0113591_158_478 | 105 |
| 895 | 3300048091 | Ga0495626_0277920 | Ga0495626_0277920_206_526 | 105 |
| 896 | 3300048903 | Ga0496100_1009858 | Ga0496100_1009858_272_592 | 105 |
| 897 | 3300048904 | Ga0496101_0105642 | Ga0496101_0105642_1506_1826 | 105 |
| 898 | 3300048904 | Ga0496101_1053437 | Ga0496101_1053437_262_582 | 105 |
| 899 | 3300048905 | Ga0496102_0073258 | Ga0496102_0073258_1698_2018 | 105 |
| 900 | 3300048905 | Ga0496102_1195712 | Ga0496102_1195712_324_644 | 105 |
| 901 | 3300048906 | Ga0496103_0099525 | Ga0496103_0099525_1367_1687 | 105 |
| 902 | 3300048909 | Ga0496106_0610295 | Ga0496106_0610295_285_605 | 105 |
| 903 | 3300048910 | Ga0496107_0017654 | Ga0496107_0017654_3299_3619 | 105 |
| 904 | 3300048912 | Ga0496109_0273399 | Ga0496109_0273399_228_548 | 105 |
| 905 | 3300048912 | Ga0496109_0572791 | Ga0496109_0572791_585_905 | 105 |
| 906 | 3300048913 | Ga0496110_0017526 | Ga0496110_0017526_116_436 | 105 |
| 907 | 3300048914 | Ga0496111_0488148 | Ga0496111_0488148_332_652 | 105 |
| 908 | 3300048914 | Ga0496111_0517612 | Ga0496111_0517612_269_589 | 105 |
| 909 | 3300048915 | Ga0496112_0183306 | Ga0496112_0183306_1382_1702 | 105 |
| 910 | 3300048917 | Ga0496114_0029773 | Ga0496114_0029773_432_752 | 105 |
| 911 | 3300048918 | Ga0496115_0076021 | Ga0496115_0076021_2048_2368 | 105 |
| 912 | 3300049127 | Ga0501306_043570 | Ga0501306_043570_184_504 | 105 |
| 913 | 3300049127 | Ga0501306_052369 | Ga0501306_052369_295_615 | 105 |
| 914 | 3300049128 | Ga0501308_007173 | Ga0501308_007173_823_1143 | 105 |
| 915 | 3300049128 | Ga0501308_028918 | Ga0501308_028918_370_690 | 105 |
| 916 | 3300049128 | Ga0501308_081980 | Ga0501308_081980_35_355 | 105 |
| 917 | 3300049129 | Ga0501309_011894 | Ga0501309_011894_743_1063 | 105 |
| 918 | 3300049129 | Ga0501309_029350 | Ga0501309_029350_448_768 | 105 |
| 919 | 3300049161 | Ga0501305_036942 | Ga0501305_036942_305_625 | 105 |
| 920 | 3300049162 | Ga0501307_078880 | Ga0501307_078880_57_377 | 105 |
| 921 | 3300049519 | Ga0501296_052740 | Ga0501296_052740_34_354 | 105 |
| 922 | 3300049527 | Ga0501311_006508 | Ga0501311_006508_459_779 | 105 |
| 923 | 3300049528 | Ga0501312_019954 | Ga0501312_019954_38_358 | 105 |
| 924 | 3300049528 | Ga0501312_021406 | Ga0501312_021406_163_483 | 105 |
| 925 | 3300049528 | Ga0501312_114104 | Ga0501312_114104_55_375 | 105 |
| 926 | 3300049529 | Ga0501313_006405 | Ga0501313_006405_759_1079 | 105 |
| 927 | 3300049530 | Ga0501314_017158 | Ga0501314_017158_16_336 | 105 |
| 928 | 3300049531 | Ga0501315_082851 | Ga0501315_082851_184_504 | 105 |
| 929 | 3300049532 | Ga0501316_046553 | Ga0501316_046553_269_589 | 105 |
| 930 | 3300049533 | Ga0501317_008465 | Ga0501317_008465_247_567 | 105 |
| 931 | 3300049536 | Ga0501320_033315 | Ga0501320_033315_235_555 | 105 |
| 932 | 3300049538 | Ga0501322_001181 | Ga0501322_001181_341_661 | 105 |
| 933 | 3300049540 | Ga0501324_006512 | Ga0501324_006512_392_712 | 105 |
| 934 | 3300049552 | Ga0501336_000759 | Ga0501336_000759_492_812 | 105 |
| 935 | 3300049574 | Ga0501038_1366848 | Ga0501038_1366848_179_499 | 105 |
| 936 | 3300049575 | Ga0501039_0917407 | Ga0501039_0917407_199_519 | 105 |
| 937 | 3300049577 | Ga0501041_0307832 | Ga0501041_0307832_216_536 | 105 |
| 938 | 3300049578 | Ga0501042_0277754 | Ga0501042_0277754_727_1047 | 105 |
| 939 | 3300049578 | Ga0501042_1128401 | Ga0501042_1128401_134_454 | 105 |
| 940 | 3300049583 | Ga0501067_0138597 | Ga0501067_0138597_891_1211 | 105 |
| 941 | 3300049585 | Ga0501069_0077653 | Ga0501069_0077653_940_1260 | 105 |
| 942 | 3300049585 | Ga0501069_0378964 | Ga0501069_0378964_394_714 | 105 |
| 943 | 3300049587 | Ga0501071_0347988 | Ga0501071_0347988_418_738 | 105 |
| 944 | 3300049587 | Ga0501071_0763467 | Ga0501071_0763467_128_448 | 105 |
| 945 | 3300049652 | Ga0501202_119011 | Ga0501202_119011_235_555 | 105 |
| 946 | 3300049654 | Ga0501207_137258 | Ga0501207_137258_55_375 | 105 |
| 947 | 3300049661 | Ga0501217_180279 | Ga0501217_180279_135_455 | 105 |
| 948 | 3300049665 | Ga0501227_023780 | Ga0501227_023780_875_1195 | 105 |
| 949 | 3300049669 | Ga0501235_007961 | Ga0501235_007961_277_597 | 105 |
| 950 | 3300049671 | Ga0501238_018422 | Ga0501238_018422_510_830 | 105 |
| 951 | 3300049674 | Ga0501242_079603 | Ga0501242_079603_167_487 | 105 |
| 952 | 3300049675 | Ga0501243_004591 | Ga0501243_004591_1079_1399 | 105 |
| 953 | 3300049677 | Ga0501247_025857 | Ga0501247_025857_277_597 | 105 |
| 954 | 3300049679 | Ga0501249_035773 | Ga0501249_035773_538_861 | 105 |
| 955 | 3300049679 | Ga0501249_152099 | Ga0501249_152099_138_458 | 105 |
| 956 | 3300049682 | Ga0501252_084100 | Ga0501252_084100_135_455 | 105 |
| 957 | 3300049683 | Ga0501253_060926 | Ga0501253_060926_292_612 | 105 |
| 958 | 3300049687 | Ga0501258_008068 | Ga0501258_008068_192_512 | 105 |
| 959 | 3300049687 | Ga0501258_030401 | Ga0501258_030401_184_504 | 105 |
| 960 | 3300049708 | Ga0501245_100939 | Ga0501245_100939_34_354 | 105 |
| 961 | 3300049757 | Ga0501232_026318 | Ga0501232_026318_443_763 | 105 |
| 962 | 3300049759 | Ga0501262_050043 | Ga0501262_050043_190_510 | 105 |
| 963 | 3300049764 | Ga0501267_001469 | Ga0501267_001469_709_1029 | 105 |
| 964 | 3300049765 | Ga0501268_001854 | Ga0501268_001854_89_409 | 105 |
| 965 | 3300049765 | Ga0501268_002791 | Ga0501268_002791_1701_2021 | 105 |
| 966 | 3300049765 | Ga0501268_100512 | Ga0501268_100512_255_575 | 105 |
| 967 | 3300049765 | Ga0501268_123907 | Ga0501268_123907_100_420 | 105 |
| 968 | 3300049767 | Ga0501270_025070 | Ga0501270_025070_488_808 | 105 |
| 969 | 3300049768 | Ga0501271_008700 | Ga0501271_008700_463_783 | 105 |
| 970 | 3300049769 | Ga0501272_005184 | Ga0501272_005184_845_1165 | 105 |
| 971 | 3300049769 | Ga0501272_054087 | Ga0501272_054087_158_478 | 105 |
| 972 | 3300049770 | Ga0501273_018923 | Ga0501273_018923_41_361 | 105 |
| 973 | 3300049770 | Ga0501273_022962 | Ga0501273_022962_457_780 | 105 |
| 974 | 3300049772 | Ga0501275_088441 | Ga0501275_088441_11_331 | 105 |
| 975 | 3300049775 | Ga0501279_007329 | Ga0501279_007329_496_816 | 105 |
| 976 | 3300049822 | Ga0501035_0732855 | Ga0501035_0732855_217_537 | 105 |
| 977 | 3300049823 | Ga0501044_0037302 | Ga0501044_0037302_629_949 | 105 |
| 978 | 3300049824 | Ga0501045_1367344 | Ga0501045_1367344_11_331 | 105 |
| 979 | 3300049851 | Ga0501212_020814 | Ga0501212_020814_70_390 | 105 |
| 980 | 3300050492 | nmdc:mga0yw44_459926_c1 | nmdc:mga0yw44_459926_c1_148_471 | 105 |
| 981 | 3300050493 | nmdc:mga0k408_299190_c1 | nmdc:mga0k408_299190_c1_45_365 | 105 |
| 982 | 3300050496 | nmdc:mga07m45_828407_c1 | nmdc:mga07m45_828407_c1_10_330 | 105 |
| 983 | 3300050507 | nmdc:mga05p37_239566_c1 | nmdc:mga05p37_239566_c1_1498_1818 | 105 |
| 984 | 3300050508 | nmdc:mga09592_404177_c1 | nmdc:mga09592_404177_c1_182_502 | 105 |
| 985 | 3300050508 | nmdc:mga09592_781511_c1 | nmdc:mga09592_781511_c1_241_561 | 105 |
| 986 | 3300050509 | nmdc:mga0qj67_1389098_c1 | nmdc:mga0qj67_1389098_c1_146_466 | 105 |
| 987 | 3300050510 | nmdc:mga06r32_830292_c1 | nmdc:mga06r32_830292_c1_418_738 | 105 |
| 988 | 3300050511 | nmdc:mga08y16_132375_c1 | nmdc:mga08y16_132375_c1_1217_1534 | 105 |
| 989 | 3300050511 | nmdc:mga08y16_1608448_c1 | nmdc:mga08y16_1608448_c1_22_342 | 105 |
| 990 | 3300050511 | nmdc:mga08y16_41479_c1 | nmdc:mga08y16_41479_c1_2867_3187 | 105 |
| 991 | 3300050512 | nmdc:mga0n895_460363_c1 | nmdc:mga0n895_460363_c1_916_1236 | 105 |
| 992 | 3300050513 | nmdc:mga0rr50_264675_c1 | nmdc:mga0rr50_264675_c1_973_1293 | 105 |
| 993 | 3300053091 | Ga0500647_0106045 | Ga0500647_0106045_897_1217 | 105 |
| 994 | 3300053093 | Ga0500651_0120654 | Ga0500651_0120654_976_1296 | 105 |
| 995 | 3300053125 | Ga0500618_088286 | Ga0500618_088286_209_529 | 105 |
| 996 | 3300053130 | Ga0500642_0283850 | Ga0500642_0283850_260_580 | 105 |
| 997 | 3300053133 | Ga0500655_000265 | Ga0500655_000265_10362_10682 | 105 |
| 998 | 3300053134 | Ga0500658_0000023 | Ga0500658_0000023_67258_67578 | 105 |
| 999 | 3300053134 | Ga0500658_0037508 | Ga0500658_0037508_1574_1894 | 105 |
| 1000 | 3300053148 | Ga0500590_015132 | Ga0500590_015132_919_1239 | 105 |
| 1001 | 3300053156 | Ga0500622_0124956 | Ga0500622_0124956_183_503 | 105 |
| 1002 | 3300053163 | Ga0500639_106017 | Ga0500639_106017_186_506 | 105 |
| 1003 | 3300053177 | Ga0500636_0211402 | Ga0500636_0211402_471_791 | 105 |
| 1004 | 3300053724 | Ga0500570_047027 | Ga0500570_047027_1062_1382 | 105 |
| 1005 | 3300059421 | Ga0590071_048015 | Ga0590071_048015_355_675 | 105 |
| 1006 | 3300059421 | Ga0590071_147793 | Ga0590071_147793_119_439 | 105 |
| 1007 | 3300059423 | Ga0590074_058671 | Ga0590074_058671_212_532 | 105 |
| 1008 | 3300059423 | Ga0590074_076986 | Ga0590074_076986_12_332 | 105 |
| 1009 | 3300059512 | Ga0587092_056635 | Ga0587092_056635_384_704 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.9213 | 5 | 72 |
| 6wru-assembly1.cif.gz_G | structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid | 0.9199 | 5 | 103 |
| 6ddg-assembly1.cif.gz_G | structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 | 0.9118 | 5 | 103 |
| 8cam-assembly1.cif.gz_t | evernimicin bound to the 50s subunit | 0.9101 | 4 | 103 |
| 8cgv-assembly1.cif.gz_t | tiamulin bound to the 50s subunit | 0.9055 | 5 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FW17_1_100_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9119 | 5 | 101 | 2.30.30.30 |
| af_Q8I5H8_47_152_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9001 | 4 | 100 | 2.30.30.30 |
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8998 | 5 | 101 | 2.30.30.30 |
| af_Q653V9_69_173_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8993 | 5 | 101 | 2.30.30.30 |
| af_Q96A35_47_153_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8965 | 5 | 101 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A498IIN3-F1-model_v4 | Protein kinase domain-containing protein | 0.9376 | 5 | 105 |
GO:0003723
GO:0003735 GO:0004672 GO:0005524 GO:0005840 GO:0006412 GO:0016020 GO:1990904 |
| AF-A0A812J439-F1-model_v4 | Large ribosomal subunit protein uL24c | 0.9314 | 5 | 102 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2H0VBG5-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9258 | 4 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0G1V3V8-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9236 | 4 | 104 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-T0HKV9-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9225 | 4 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar