F488102

General Info

Members Datasets Scaffolds Average Seq Length
1009 371 1006 106

Family's Representative Sequence

Representative Sequence 3300049683|Ga0501253_011091|Ga0501253_011091_147_530
Length 127
Sequence MSAAKIRKGDKVVVLSGRDKGKTGEIVSASPKDSKVVVSGVNIATRHKKATQTNPQGGLERREAPMHVSKVAIIDPKDGKATRALRDGRRQEGPRRCAVRGEDRWLKPTRRKRPTSRVCARIMTIAS

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
3 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
98 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
179 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
180 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
181 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
182 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
183 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
184 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
209 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
210 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
211 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
215 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
216 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
217 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
220 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
221 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
222 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
225 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
229 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
230 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
231 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
232 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
233 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
234 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
235 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
236 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
237 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
243 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
244 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
245 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
246 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
301 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
320 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
321 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
322 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
323 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
324 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
325 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
326 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
327 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
328 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
329 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
330 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
331 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
332 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
333 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
334 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
335 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
336 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
337 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
338 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
339 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
340 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
341 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
342 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
343 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
361 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
362 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
365 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
366 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
367 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
368 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
369 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
371 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 2.28
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0
Rhizoplane 1.98
Rhizosphere 95.14
Stem 0
Stem Tuber 0.1
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1012887 3300000549 Bacteria 986
2 ARCol0yngRDRAFT_1001879 3300000652 Bacteria 1643
3 JGI24737J22298_10105196 3300001990 Bacteria 836
4 JGI24735J21928_10253867 3300002067 Bacteria 513
5 JGI24750J21931_1006318 3300002070 Bacteria 1474
6 JGI24748J21848_1001483 3300002074 Bacteria 2593
7 JGI24035J26624_1015105 3300002126 Bacteria 790
8 JGI24033J26618_1047719 3300002155 Bacteria 609
9 JGI24742J22300_10007510 3300002244 Bacteria 1799
10 JGI24751J29686_10022529 3300002459 Bacteria 1307
11 JGI24751J29686_10039569 3300002459 Bacteria 976
12 Ga0065712_10037815 3300005290 Bacteria 1041
13 Ga0065712_10230156 3300005290 Bacteria 1011
14 Ga0065715_10000098 3300005293 Bacteria 2789
15 Ga0065715_10219721 3300005293 Bacteria 1277
16 Ga0065715_10373912 3300005293 Bacteria 917
17 Ga0065715_10395125 3300005293 Bacteria 889
18 Ga0065715_10910021 3300005293 Bacteria 568
19 Ga0065707_10477737 3300005295 Bacteria 750
20 Ga0070676_10010202 3300005328 Bacteria 5093
21 Ga0070676_10027273 3300005328 Bacteria 3237
22 Ga0070676_10051799 3300005328 Bacteria 2411
23 Ga0070676_11527306 3300005328 Bacteria 515
24 Ga0070690_101309456 3300005330 Bacteria 581
25 Ga0070670_100047139 3300005331 Bacteria 3707
26 Ga0070670_100296578 3300005331 Bacteria 1413
27 Ga0070670_100364193 3300005331 Bacteria 1272
28 Ga0070670_100533843 3300005331 Bacteria 1045
29 Ga0070670_100652050 3300005331 Bacteria 944
30 Ga0070677_10016266 3300005333 Bacteria 2646
31 Ga0070677_10018931 3300005333 Bacteria 2487
32 Ga0068869_100109201 3300005334 Bacteria 2102
33 Ga0068869_101102592 3300005334 Bacteria 694
34 Ga0068869_101383123 3300005334 Bacteria 623
35 Ga0068868_100133596 3300005338 Bacteria 2032
36 Ga0068868_100297235 3300005338 Bacteria 1370
37 Ga0070660_100151852 3300005339 Bacteria 1862
38 Ga0070660_100514385 3300005339 Bacteria 996
39 Ga0070691_11089721 3300005341 Bacteria 503
40 Ga0070687_100404902 3300005343 Bacteria 896
41 Ga0070687_100546187 3300005343 Bacteria 788
42 Ga0070661_100308934 3300005344 Bacteria 1232
43 Ga0070692_10038276 3300005345 Bacteria 2443
44 Ga0070668_100048313 3300005347 Bacteria 3272
45 Ga0070668_100105756 3300005347 Bacteria 2235
46 Ga0070668_100107439 3300005347 Bacteria 2218
47 Ga0070668_100165579 3300005347 Bacteria 1796
48 Ga0070668_100393760 3300005347 Bacteria 1181
49 Ga0070668_100560337 3300005347 Bacteria 995
50 Ga0070668_100691677 3300005347 Bacteria 899
51 Ga0070668_101016540 3300005347 Bacteria 745
52 Ga0070668_101111744 3300005347 Bacteria 713
53 Ga0070668_101772386 3300005347 Bacteria 567
54 Ga0070669_100014400 3300005353 Bacteria 5629
55 Ga0070669_100069493 3300005353 Bacteria 2601
56 Ga0070669_100259429 3300005353 Bacteria 1386
57 Ga0070669_100399911 3300005353 Bacteria 1123
58 Ga0070669_100406010 3300005353 Bacteria 1115
59 Ga0070669_100823875 3300005353 Bacteria 789
60 Ga0070669_100903125 3300005353 Bacteria 754
61 Ga0070669_100974610 3300005353 Bacteria 727
62 Ga0070669_101067692 3300005353 Bacteria 695
63 Ga0070669_101174155 3300005353 Bacteria 662
64 Ga0070669_101502259 3300005353 Bacteria 586
65 Ga0070669_101661144 3300005353 Bacteria 556
66 Ga0070675_100048237 3300005354 Bacteria 3491
67 Ga0070675_100108237 3300005354 Bacteria 2347
68 Ga0070675_100458797 3300005354 Bacteria 1143
69 Ga0070675_100479567 3300005354 Bacteria 1118
70 Ga0070675_100679650 3300005354 Bacteria 937
71 Ga0070675_101692367 3300005354 Bacteria 584
72 Ga0070671_100052885 3300005355 Bacteria 3376
73 Ga0070671_100214400 3300005355 Bacteria 1633
74 Ga0070671_100277720 3300005355 Bacteria 1424
75 Ga0070671_100400255 3300005355 Bacteria 1174
76 Ga0070671_100742586 3300005355 Bacteria 853
77 Ga0070674_100022854 3300005356 Bacteria 4036
78 Ga0070674_100214360 3300005356 Bacteria 1494
79 Ga0070674_100528176 3300005356 Bacteria 987
80 Ga0070674_101058136 3300005356 Bacteria 715
81 Ga0070674_101192319 3300005356 Bacteria 675
82 Ga0070674_101470859 3300005356 Bacteria 612
83 Ga0070674_101804373 3300005356 Bacteria 555
84 Ga0070673_100041643 3300005364 Bacteria 3535
85 Ga0070673_100061829 3300005364 Bacteria 2972
86 Ga0070673_100113379 3300005364 Bacteria 2251
87 Ga0070673_100337611 3300005364 Bacteria 1334
88 Ga0070673_100488405 3300005364 Bacteria 1112
89 Ga0070673_100598365 3300005364 Bacteria 1006
90 Ga0070673_101642507 3300005364 Bacteria 608
91 Ga0070673_101669902 3300005364 Bacteria 602
92 Ga0070659_100085064 3300005366 Bacteria 2529
93 Ga0070659_100147960 3300005366 Bacteria 1914
94 Ga0070659_100694277 3300005366 Bacteria 880
95 Ga0070667_100050290 3300005367 Bacteria 3512
96 Ga0070667_100087293 3300005367 Bacteria 2677
97 Ga0070667_100284964 3300005367 Bacteria 1484
98 Ga0070667_100450097 3300005367 Bacteria 1176
99 Ga0070701_10337157 3300005438 Bacteria 938
100 Ga0070705_100323221 3300005440 Bacteria 1115
101 Ga0070705_100378721 3300005440 Bacteria 1041
102 Ga0070700_100161545 3300005441 Bacteria 1543
103 Ga0070694_100046855 3300005444 Bacteria 2904
104 Ga0070694_101373582 3300005444 Bacteria 595
105 Ga0070708_101309207 3300005445 Bacteria 677
106 Ga0070663_100116425 3300005455 Bacteria 2014
107 Ga0070663_100154628 3300005455 Bacteria 1761
108 Ga0070663_100430002 3300005455 Bacteria 1084
109 Ga0070663_100613117 3300005455 Bacteria 917
110 Ga0070678_100020582 3300005456 Bacteria 4331
111 Ga0070678_100099383 3300005456 Bacteria 2251
112 Ga0070678_100301549 3300005456 Bacteria 1362
113 Ga0070678_100424540 3300005456 Bacteria 1160
114 Ga0070662_100102075 3300005457 Bacteria 2172
115 Ga0070662_100286323 3300005457 Bacteria 1335
116 Ga0070662_100305495 3300005457 Bacteria 1293
117 Ga0070662_100456267 3300005457 Bacteria 1061
118 Ga0070662_100567120 3300005457 Bacteria 952
119 Ga0070662_100872865 3300005457 Bacteria 767
120 Ga0070681_10185659 3300005458 Bacteria 2000
121 Ga0070681_11149784 3300005458 Bacteria 698
122 Ga0068867_100004535 3300005459 Bacteria 9763
123 Ga0068867_100091878 3300005459 Bacteria 2304
124 Ga0068867_101109587 3300005459 Bacteria 723
125 Ga0070679_101959082 3300005530 Bacteria 535
126 Ga0068853_100140615 3300005539 Bacteria 2167
127 Ga0068853_100143367 3300005539 Bacteria 2145
128 Ga0068853_100680256 3300005539 Bacteria 980
129 Ga0068853_101255935 3300005539 Bacteria 715
130 Ga0070672_100111378 3300005543 Bacteria 2231
131 Ga0070672_100167954 3300005543 Bacteria 1823
132 Ga0070672_100179493 3300005543 Bacteria 1764
133 Ga0070672_100224987 3300005543 Bacteria 1574
134 Ga0070672_100858471 3300005543 Bacteria 800
135 Ga0070686_101479710 3300005544 Bacteria 572
136 Ga0070695_101427466 3300005545 Bacteria 574
137 Ga0070696_100017763 3300005546 Bacteria 4802
138 Ga0070696_100322224 3300005546 Bacteria 1190
139 Ga0070665_100043393 3300005548 Bacteria 4519
140 Ga0070665_100093206 3300005548 Bacteria 3016
141 Ga0070665_100578818 3300005548 Bacteria 1136
142 Ga0070704_100588388 3300005549 Bacteria 977
143 Ga0070704_101037899 3300005549 Bacteria 743
144 Ga0068855_100383221 3300005563 Bacteria 1543
145 Ga0068855_101506168 3300005563 Bacteria 691
146 Ga0070664_100036985 3300005564 Bacteria 4103
147 Ga0070664_100341882 3300005564 Bacteria 1359
148 Ga0070664_100366566 3300005564 Bacteria 1313
149 Ga0070664_100439599 3300005564 Bacteria 1196
150 Ga0070664_101143950 3300005564 Bacteria 734
151 Ga0070664_101456881 3300005564 Bacteria 648
152 Ga0068857_100558037 3300005577 Bacteria 1079
153 Ga0068857_101414475 3300005577 Bacteria 677
154 Ga0068854_100107638 3300005578 Bacteria 2099
155 Ga0068852_101569414 3300005616 Bacteria 681
156 Ga0068859_100003314 3300005617 Bacteria 16364
157 Ga0068859_100056343 3300005617 Bacteria 3955
158 Ga0068859_100156934 3300005617 Bacteria 2353
159 Ga0068859_100159089 3300005617 Bacteria 2337
160 Ga0068864_100002491 3300005618 Bacteria 15219
161 Ga0068864_100039730 3300005618 Bacteria 4021
162 Ga0068864_100618311 3300005618 Bacteria 1053
163 Ga0068866_10160423 3300005718 Bacteria 1311
164 Ga0068866_10173232 3300005718 Bacteria 1268
165 Ga0068861_100079732 3300005719 Bacteria 2560
166 Ga0068861_100858086 3300005719 Bacteria 857
167 Ga0068870_10062197 3300005840 Bacteria 2010
168 Ga0068870_10490947 3300005840 Bacteria 817
169 Ga0068870_10633028 3300005840 Bacteria 731
170 Ga0068870_11247793 3300005840 Bacteria 540
171 Ga0068863_100021286 3300005841 Bacteria 6189
172 Ga0068863_100053086 3300005841 Bacteria 3841
173 Ga0068863_100121571 3300005841 Bacteria 2490
174 Ga0068863_100417823 3300005841 Bacteria 1313
175 Ga0068858_100004068 3300005842 Bacteria 14403
176 Ga0068858_100480250 3300005842 Bacteria 1199
177 Ga0068858_100620712 3300005842 Bacteria 1049
178 Ga0068860_100031635 3300005843 Bacteria 5086
179 Ga0068860_100126139 3300005843 Bacteria 2453
180 Ga0068860_100359305 3300005843 Bacteria 1434
181 Ga0068860_100390251 3300005843 Bacteria 1375
182 Ga0068860_101419385 3300005843 Bacteria 715
183 Ga0068862_100059849 3300005844 Bacteria 3271
184 Ga0068862_100101210 3300005844 Bacteria 2520
185 Ga0068862_100202295 3300005844 Bacteria 1791
186 Ga0068862_100237862 3300005844 Bacteria 1654
187 Ga0068862_100244321 3300005844 Bacteria 1633
188 Ga0068862_100368540 3300005844 Bacteria 1336
189 Ga0068862_100443406 3300005844 Bacteria 1222
190 Ga0068862_100742103 3300005844 Bacteria 954
191 Ga0068862_100805571 3300005844 Bacteria 917
192 Ga0068862_101687584 3300005844 Bacteria 642
193 Ga0081539_10019248 3300005985 Bacteria 4683
194 Ga0075368_10552403 3300006042 Bacteria 518
195 Ga0075364_11193312 3300006051 Bacteria 516
196 Ga0070712_100043947 3300006175 Bacteria 3078
197 Ga0075366_10078589 3300006195 Bacteria 1969
198 Ga0075366_10481337 3300006195 Bacteria 767
199 Ga0075366_10934023 3300006195 Bacteria 541
200 Ga0097621_100013419 3300006237 Bacteria 6107
201 Ga0097621_101256226 3300006237 Bacteria 698
202 Ga0097621_102319306 3300006237 Bacteria 514
203 Ga0075370_10092311 3300006353 Bacteria 1747
204 Ga0075370_10495879 3300006353 Bacteria 737
205 Ga0068871_100025733 3300006358 Bacteria 4582
206 Ga0075428_100136242 3300006844 Bacteria 2669
207 Ga0075428_100485419 3300006844 Bacteria 1322
208 Ga0075430_100620644 3300006846 Bacteria 892
209 Ga0075431_100135405 3300006847 Bacteria 2539
210 Ga0075434_100407578 3300006871 Bacteria 1380
211 Ga0075434_102079706 3300006871 Bacteria 572
212 Ga0068865_100522794 3300006881 Bacteria 992
213 Ga0068865_100902546 3300006881 Bacteria 768
214 Ga0068865_101600131 3300006881 Bacteria 586
215 Ga0097620_100003314 3300006931 Bacteria 16364
216 Ga0097620_100056349 3300006931 Bacteria 3955
217 Ga0097620_100156943 3300006931 Bacteria 2353
218 Ga0097620_100159093 3300006931 Bacteria 2337
219 Ga0075435_100293915 3300007076 Bacteria 1388
220 Ga0105250_10028500 3300009092 Bacteria 2248
221 Ga0105250_10249058 3300009092 Bacteria 759
222 Ga0105240_10551710 3300009093 Bacteria 1275
223 Ga0111539_10049029 3300009094 Bacteria 5039
224 Ga0111539_10732388 3300009094 Bacteria 1151
225 Ga0111539_11658830 3300009094 Bacteria 741
226 Ga0105245_10466695 3300009098 Bacteria 1274
227 Ga0105245_12060467 3300009098 Bacteria 624
228 Ga0105247_10184228 3300009101 Bacteria 1395
229 Ga0114129_10364296 3300009147 Bacteria 1912
230 Ga0105243_10177410 3300009148 Bacteria 1850
231 Ga0105243_10633423 3300009148 Bacteria 1034
232 Ga0105243_11471493 3300009148 Bacteria 704
233 Ga0105243_12081884 3300009148 Bacteria 603
234 Ga0105243_12090317 3300009148 Bacteria 602
235 Ga0105241_10998788 3300009174 Bacteria 783
236 Ga0105241_11224091 3300009174 Bacteria 712
237 Ga0105242_10440468 3300009176 Bacteria 1226
238 Ga0105242_11097517 3300009176 Bacteria 809
239 Ga0105242_11842400 3300009176 Bacteria 644
240 Ga0105248_10006714 3300009177 Bacteria 12621
241 Ga0105248_10160056 3300009177 Bacteria 2540
242 Ga0105248_10192438 3300009177 Bacteria 2298
243 Ga0105248_10384527 3300009177 Bacteria 1580
244 Ga0105248_10939619 3300009177 Bacteria 977
245 Ga0105248_11516711 3300009177 Bacteria 759
246 Ga0105237_11436505 3300009545 Bacteria 696
247 Ga0105249_10097841 3300009553 Bacteria 2755
248 Ga0105249_10536055 3300009553 Bacteria 1220
249 Ga0105249_11183069 3300009553 Bacteria 835
250 Ga0105249_11325169 3300009553 Bacteria 792
251 Ga0105032_117129 3300009979 Bacteria 570
252 Ga0105239_10558577 3300010375 Bacteria 1304
253 Ga0157325_1027496 3300012485 Bacteria 550
254 Ga0157315_1053009 3300012508 Bacteria 551
255 Ga0157327_1004904 3300012512 Bacteria 1060
256 Ga0157373_10141777 3300013100 Bacteria 1690
257 Ga0157373_10299516 3300013100 Bacteria 1141
258 Ga0157373_10651715 3300013100 Bacteria 769
259 Ga0157373_10955924 3300013100 Bacteria 638
260 Ga0157371_10594172 3300013102 Bacteria 823
261 Ga0157369_10006198 3300013105 Bacteria 13875
262 Ga0157369_11061297 3300013105 Bacteria 829
263 Ga0163162_10052322 3300013306 Bacteria 4101
264 Ga0163162_10336158 3300013306 Bacteria 1643
265 Ga0163162_10338001 3300013306 Bacteria 1638
266 Ga0163162_10344969 3300013306 Bacteria 1622
267 Ga0163162_11626712 3300013306 Bacteria 737
268 Ga0157375_10077381 3300013308 Bacteria 3356
269 Ga0157375_10194162 3300013308 Bacteria 2185
270 Ga0157375_10965695 3300013308 Bacteria 993
271 Ga0157375_11227466 3300013308 Bacteria 880
272 Ga0157375_11929267 3300013308 Bacteria 701
273 Ga0157375_12710477 3300013308 Bacteria 593
274 Ga0163163_10004858 3300014325 Bacteria 11551
275 Ga0157380_10338680 3300014326 Bacteria 1402
276 Ga0157380_10732531 3300014326 Bacteria 998
277 Ga0157380_11039521 3300014326 Bacteria 855
278 Ga0157377_10463159 3300014745 Bacteria 878
279 Ga0157377_10679824 3300014745 Bacteria 745
280 Ga0157379_10038791 3300014968 Bacteria 4249
281 Ga0157379_11002470 3300014968 Bacteria 796
282 Ga0157376_11568889 3300014969 Bacteria 692
283 Ga0163161_10299503 3300017792 Bacteria 1266
284 Ga0163161_10824666 3300017792 Bacteria 781
285 Ga0207666_1012243 3300025271 Bacteria 1193
286 Ga0207697_10001580 3300025315 Bacteria 12319
287 Ga0207697_10035806 3300025315 Bacteria 2033
288 Ga0207697_10067099 3300025315 Bacteria 1500
289 Ga0207697_10535790 3300025315 Bacteria 515
290 Ga0207696_1007651 3300025711 Bacteria 4210
291 Ga0207696_1132876 3300025711 Bacteria 668
292 Ga0207653_10375817 3300025885 Bacteria 556
293 Ga0207682_10006590 3300025893 Bacteria 4672
294 Ga0207682_10054106 3300025893 Bacteria 1667
295 Ga0207682_10072275 3300025893 Bacteria 1463
296 Ga0207682_10125454 3300025893 Bacteria 1142
297 Ga0207682_10282905 3300025893 Bacteria 776
298 Ga0207642_10060758 3300025899 Bacteria 1754
299 Ga0207642_10078048 3300025899 Bacteria 1599
300 Ga0207710_10168754 3300025900 Bacteria 1069
301 Ga0207688_10100962 3300025901 Bacteria 1666
302 Ga0207688_10162329 3300025901 Bacteria 1325
303 Ga0207688_10396505 3300025901 Bacteria 855
304 Ga0207647_10038196 3300025904 Bacteria 3037
305 Ga0207647_10196815 3300025904 Bacteria 1167
306 Ga0207647_10378421 3300025904 Bacteria 799
307 Ga0207645_10014351 3300025907 Bacteria 5302
308 Ga0207645_10062998 3300025907 Bacteria 2369
309 Ga0207645_10088987 3300025907 Bacteria 1985
310 Ga0207645_10094021 3300025907 Bacteria 1929
311 Ga0207645_10400732 3300025907 Bacteria 923
312 Ga0207645_10855819 3300025907 Bacteria 618
313 Ga0207643_10053194 3300025908 Bacteria 2300
314 Ga0207643_10242261 3300025908 Bacteria 1109
315 Ga0207643_10364529 3300025908 Bacteria 909
316 Ga0207643_10461573 3300025908 Bacteria 809
317 Ga0207643_11002433 3300025908 Bacteria 540
318 Ga0207654_10252074 3300025911 Bacteria 1184
319 Ga0207707_10082443 3300025912 Bacteria 2808
320 Ga0207671_10982750 3300025914 Bacteria 665
321 Ga0207693_10253115 3300025915 Bacteria 1382
322 Ga0207662_10323409 3300025918 Bacteria 1030
323 Ga0207657_10472898 3300025919 Bacteria 983
324 Ga0207657_10543695 3300025919 Bacteria 908
325 Ga0207657_11027366 3300025919 Bacteria 632
326 Ga0207649_10099638 3300025920 Bacteria 1920
327 Ga0207649_10694314 3300025920 Bacteria 789
328 Ga0207649_10790023 3300025920 Bacteria 740
329 Ga0207652_11289783 3300025921 Bacteria 633
330 Ga0207681_10001216 3300025923 Bacteria 16580
331 Ga0207681_10041111 3300025923 Bacteria 3080
332 Ga0207681_10518931 3300025923 Bacteria 977
333 Ga0207681_10522152 3300025923 Bacteria 974
334 Ga0207681_10549365 3300025923 Bacteria 950
335 Ga0207681_10562070 3300025923 Bacteria 940
336 Ga0207681_10900775 3300025923 Bacteria 741
337 Ga0207681_10974693 3300025923 Bacteria 711
338 Ga0207681_11062990 3300025923 Bacteria 679
339 Ga0207681_11072264 3300025923 Bacteria 676
340 Ga0207681_11305249 3300025923 Bacteria 609
341 Ga0207681_11855488 3300025923 Bacteria 502
342 Ga0207650_10012172 3300025925 Bacteria 5931
343 Ga0207650_10033934 3300025925 Bacteria 3699
344 Ga0207650_10084415 3300025925 Bacteria 2414
345 Ga0207650_10300150 3300025925 Bacteria 1312
346 Ga0207650_10369470 3300025925 Bacteria 1183
347 Ga0207650_10472425 3300025925 Bacteria 1046
348 Ga0207650_10704018 3300025925 Bacteria 853
349 Ga0207650_10713455 3300025925 Bacteria 847
350 Ga0207650_10783370 3300025925 Bacteria 808
351 Ga0207659_10001819 3300025926 Bacteria 12629
352 Ga0207659_10112471 3300025926 Bacteria 2072
353 Ga0207659_10482092 3300025926 Bacteria 1048
354 Ga0207659_10885959 3300025926 Bacteria 767
355 Ga0207659_11278510 3300025926 Bacteria 630
356 Ga0207659_11365502 3300025926 Bacteria 608
357 Ga0207644_10013980 3300025931 Bacteria 5364
358 Ga0207644_10111263 3300025931 Bacteria 2071
359 Ga0207644_10243859 3300025931 Bacteria 1431
360 Ga0207644_10724008 3300025931 Bacteria 830
361 Ga0207644_10896058 3300025931 Bacteria 743
362 Ga0207690_10014888 3300025932 Bacteria 4708
363 Ga0207690_10151034 3300025932 Bacteria 1722
364 Ga0207690_10350141 3300025932 Bacteria 1168
365 Ga0207706_10000284 3300025933 Bacteria 55240
366 Ga0207706_10303158 3300025933 Bacteria 1392
367 Ga0207706_10337505 3300025933 Bacteria 1311
368 Ga0207706_10347419 3300025933 Bacteria 1290
369 Ga0207706_10558457 3300025933 Bacteria 985
370 Ga0207706_10658424 3300025933 Bacteria 896
371 Ga0207706_10864893 3300025933 Bacteria 765
372 Ga0207706_11016931 3300025933 Bacteria 696
373 Ga0207706_11165885 3300025933 Bacteria 641
374 Ga0207686_11162733 3300025934 Bacteria 631
375 Ga0207709_10133892 3300025935 Bacteria 1693
376 Ga0207709_10143267 3300025935 Bacteria 1645
377 Ga0207709_10539830 3300025935 Bacteria 916
378 Ga0207709_11426508 3300025935 Bacteria 574
379 Ga0207669_10036225 3300025937 Bacteria 2817
380 Ga0207669_10176805 3300025937 Bacteria 1525
381 Ga0207669_10217707 3300025937 Bacteria 1399
382 Ga0207669_10330884 3300025937 Bacteria 1169
383 Ga0207669_10916008 3300025937 Bacteria 733
384 Ga0207669_11385341 3300025937 Bacteria 598
385 Ga0207704_10077052 3300025938 Bacteria 2139
386 Ga0207704_10148137 3300025938 Bacteria 1652
387 Ga0207704_10776914 3300025938 Bacteria 798
388 Ga0207691_10017921 3300025940 Bacteria 6710
389 Ga0207691_10098382 3300025940 Bacteria 2613
390 Ga0207691_10151074 3300025940 Bacteria 2042
391 Ga0207691_10209251 3300025940 Bacteria 1695
392 Ga0207691_10251286 3300025940 Bacteria 1526
393 Ga0207691_10383118 3300025940 Bacteria 1200
394 Ga0207691_10494545 3300025940 Bacteria 1039
395 Ga0207691_10527775 3300025940 Bacteria 1002
396 Ga0207691_10568742 3300025940 Bacteria 961
397 Ga0207711_10000187 3300025941 Bacteria 66307
398 Ga0207711_10002648 3300025941 Bacteria 15820
399 Ga0207711_10146986 3300025941 Bacteria 2124
400 Ga0207711_10311962 3300025941 Bacteria 1452
401 Ga0207711_10830241 3300025941 Bacteria 860
402 Ga0207689_10027620 3300025942 Bacteria 4749
403 Ga0207689_10273854 3300025942 Bacteria 1397
404 Ga0207689_10679147 3300025942 Bacteria 868
405 Ga0207689_10839995 3300025942 Bacteria 775
406 Ga0207679_10000847 3300025945 Bacteria 19669
407 Ga0207679_10178447 3300025945 Bacteria 1755
408 Ga0207679_10476415 3300025945 Bacteria 1111
409 Ga0207679_10690008 3300025945 Bacteria 926
410 Ga0207679_11034195 3300025945 Bacteria 753
411 Ga0207679_11311878 3300025945 Bacteria 664
412 Ga0207667_10844202 3300025949 Bacteria 910
413 Ga0207667_11974698 3300025949 Bacteria 544
414 Ga0207651_10051794 3300025960 Bacteria 2795
415 Ga0207651_10057032 3300025960 Bacteria 2691
416 Ga0207651_10149405 3300025960 Bacteria 1816
417 Ga0207651_10463917 3300025960 Bacteria 1089
418 Ga0207651_10653663 3300025960 Bacteria 923
419 Ga0207651_11490797 3300025960 Bacteria 609
420 Ga0207651_11906616 3300025960 Bacteria 534
421 Ga0207712_10000723 3300025961 Bacteria 25323
422 Ga0207712_10058661 3300025961 Bacteria 2720
423 Ga0207712_10528760 3300025961 Bacteria 1012
424 Ga0207712_11218363 3300025961 Bacteria 672
425 Ga0207668_10000062 3300025972 Bacteria 88123
426 Ga0207668_10005099 3300025972 Bacteria 7729
427 Ga0207668_10307609 3300025972 Bacteria 1310
428 Ga0207668_10489488 3300025972 Bacteria 1056
429 Ga0207668_10555107 3300025972 Bacteria 995
430 Ga0207668_10652594 3300025972 Bacteria 921
431 Ga0207668_11391155 3300025972 Bacteria 632
432 Ga0207668_11532923 3300025972 Bacteria 601
433 Ga0207668_11629839 3300025972 Bacteria 582
434 Ga0207668_11970300 3300025972 Bacteria 526
435 Ga0207640_10411255 3300025981 Bacteria 1104
436 Ga0207640_10507195 3300025981 Bacteria 1006
437 Ga0207640_10712610 3300025981 Bacteria 861
438 Ga0207640_10799406 3300025981 Bacteria 817
439 Ga0207658_10009384 3300025986 Bacteria 6636
440 Ga0207658_10097851 3300025986 Bacteria 2291
441 Ga0207658_10099440 3300025986 Bacteria 2275
442 Ga0207658_10100496 3300025986 Bacteria 2264
443 Ga0207658_10239370 3300025986 Bacteria 1536
444 Ga0207658_11115281 3300025986 Bacteria 721
445 Ga0207677_10161348 3300026023 Bacteria 1742
446 Ga0207677_10414289 3300026023 Bacteria 1146
447 Ga0207677_10819684 3300026023 Bacteria 834
448 Ga0207703_10001977 3300026035 Bacteria 18099
449 Ga0207703_10010836 3300026035 Bacteria 7111
450 Ga0207703_10599177 3300026035 Bacteria 1042
451 Ga0207639_10111479 3300026041 Bacteria 2230
452 Ga0207678_10370331 3300026067 Bacteria 1237
453 Ga0207678_10771868 3300026067 Bacteria 848
454 Ga0207678_11458363 3300026067 Bacteria 604
455 Ga0207678_11720542 3300026067 Bacteria 550
456 Ga0207708_10078244 3300026075 Bacteria 2539
457 Ga0207708_10417118 3300026075 Bacteria 1113
458 Ga0207641_10001914 3300026088 Bacteria 19977
459 Ga0207641_10048399 3300026088 Bacteria 3588
460 Ga0207641_10303995 3300026088 Bacteria 1507
461 Ga0207641_11644770 3300026088 Bacteria 644
462 Ga0207648_10008052 3300026089 Bacteria 10268
463 Ga0207648_10085028 3300026089 Bacteria 2759
464 Ga0207648_10528360 3300026089 Bacteria 1082
465 Ga0207648_11964576 3300026089 Bacteria 546
466 Ga0207676_10000887 3300026095 Bacteria 23213
467 Ga0207676_10136979 3300026095 Bacteria 2090
468 Ga0207674_10200772 3300026116 Bacteria 1943
469 Ga0207674_10248268 3300026116 Bacteria 1726
470 Ga0207674_10326381 3300026116 Bacteria 1484
471 Ga0207675_100058362 3300026118 Bacteria 3601
472 Ga0207675_100112244 3300026118 Bacteria 2572
473 Ga0207675_100427779 3300026118 Bacteria 1308
474 Ga0207675_100939393 3300026118 Bacteria 882
475 Ga0207675_101010232 3300026118 Bacteria 850
476 Ga0207683_10048556 3300026121 Bacteria 3716
477 Ga0207683_10062679 3300026121 Bacteria 3275
478 Ga0207683_10083383 3300026121 Bacteria 2841
479 Ga0207683_10195383 3300026121 Bacteria 1838
480 Ga0209973_1018889 3300027252 Bacteria 898
481 Ga0209967_1006839 3300027364 Bacteria 1554
482 Ga0209967_1019832 3300027364 Bacteria 978
483 Ga0209996_1039259 3300027395 Bacteria 701
484 Ga0210000_1085988 3300027462 Bacteria 517
485 Ga0209995_1021235 3300027471 Bacteria 1076
486 Ga0209999_1017123 3300027543 Bacteria 1320
487 Ga0209999_1018091 3300027543 Bacteria 1288
488 Ga0209982_1041017 3300027552 Bacteria 738
489 Ga0209970_1092736 3300027614 Bacteria 574
490 Ga0210002_1015203 3300027617 Bacteria 1211
491 Ga0210002_1044249 3300027617 Bacteria 760
492 Ga0209983_1004203 3300027665 Bacteria 3037
493 Ga0209983_1026942 3300027665 Bacteria 1217
494 Ga0209971_1008830 3300027682 Bacteria 2391
495 Ga0209971_1018387 3300027682 Bacteria 1658
496 Ga0209971_1099775 3300027682 Bacteria 711
497 Ga0209974_10006589 3300027876 Bacteria 4043
498 Ga0209974_10026176 3300027876 Bacteria 1931
499 Ga0207428_10035157 3300027907 Bacteria 4097
500 Ga0207428_11058933 3300027907 Bacteria 568
501 Ga0268266_10415156 3300028379 Bacteria 1275
502 Ga0268266_10454790 3300028379 Bacteria 1217
503 Ga0268265_10071746 3300028380 Bacteria 2698
504 Ga0268265_10174961 3300028380 Bacteria 1838
505 Ga0268265_10182671 3300028380 Bacteria 1803
506 Ga0268265_10244660 3300028380 Bacteria 1585
507 Ga0268265_10279378 3300028380 Bacteria 1493
508 Ga0268265_10607693 3300028380 Bacteria 1046
509 Ga0268265_11192780 3300028380 Bacteria 758
510 Ga0268265_12715020 3300028380 Bacteria 500
511 Ga0268264_10032595 3300028381 Bacteria 4275
512 Ga0268264_10049844 3300028381 Bacteria 3485
513 Ga0268264_10085501 3300028381 Bacteria 2707
514 Ga0268264_10181307 3300028381 Bacteria 1913
515 Ga0268264_12022403 3300028381 Bacteria 585
516 Ga0268264_12028648 3300028381 Bacteria 584
517 Ga0268264_12617168 3300028381 Bacteria 509
518 Ga0307515_10499480 3300028794 Bacteria 827
519 Ga0316177_1095584 3300030731 Bacteria 1544
520 Ga0316176_1032322 3300030732 Bacteria 949
521 Ga0314311_1156759 3300030733 Bacteria 566
522 Ga0316178_1181760 3300030735 Bacteria 978
523 Ga0316180_1044038 3300030736 Bacteria 632
524 Ga0316181_1190288 3300030744 Bacteria 567
525 Ga0316181_1197219 3300030744 Bacteria 931
526 Ga0316182_1336707 3300030745 Bacteria 670
527 Ga0316182_1382068 3300030745 Bacteria 827
528 Ga0307513_10080829 3300031456 Bacteria 3351
529 Ga0307408_100011902 3300031548 Bacteria 5756
530 Ga0307408_100029728 3300031548 Bacteria 3788
531 Ga0307408_100037962 3300031548 Bacteria 3396
532 Ga0307408_100156015 3300031548 Bacteria 1807
533 Ga0307408_100226414 3300031548 Bacteria 1529
534 Ga0307408_100259848 3300031548 Bacteria 1437
535 Ga0307408_100269957 3300031548 Bacteria 1412
536 Ga0307408_100316085 3300031548 Bacteria 1314
537 Ga0307408_100439960 3300031548 Bacteria 1128
538 Ga0307408_100720196 3300031548 Bacteria 898
539 Ga0307408_100810258 3300031548 Bacteria 850
540 Ga0307408_100935096 3300031548 Bacteria 795
541 Ga0307408_101245240 3300031548 Bacteria 695
542 Ga0307408_101606305 3300031548 Bacteria 617
543 Ga0307408_102087860 3300031548 Bacteria 546
544 Ga0307408_102205024 3300031548 Bacteria 532
545 Ga0307405_10010430 3300031731 Bacteria 4814
546 Ga0307405_10018478 3300031731 Bacteria 3846
547 Ga0307405_10023082 3300031731 Bacteria 3529
548 Ga0307405_10039649 3300031731 Bacteria 2848
549 Ga0307405_10155256 3300031731 Bacteria 1614
550 Ga0307405_10233894 3300031731 Bacteria 1356
551 Ga0307405_10334054 3300031731 Bacteria 1162
552 Ga0307405_10341844 3300031731 Bacteria 1151
553 Ga0307405_10437606 3300031731 Bacteria 1033
554 Ga0307405_10753482 3300031731 Bacteria 811
555 Ga0307405_10916131 3300031731 Bacteria 742
556 Ga0307405_10984772 3300031731 Bacteria 718
557 Ga0307405_11175338 3300031731 Bacteria 662
558 Ga0307405_11922413 3300031731 Bacteria 528
559 Ga0307405_12092790 3300031731 Bacteria 508
560 Ga0307413_10028039 3300031824 Bacteria 3129
561 Ga0307413_10030478 3300031824 Bacteria 3030
562 Ga0307413_10047616 3300031824 Bacteria 2557
563 Ga0307413_10093518 3300031824 Bacteria 1965
564 Ga0307413_10194343 3300031824 Bacteria 1459
565 Ga0307413_10231029 3300031824 Bacteria 1358
566 Ga0307413_10379675 3300031824 Bacteria 1100
567 Ga0307413_10570159 3300031824 Bacteria 921
568 Ga0307413_10740652 3300031824 Bacteria 820
569 Ga0307413_10823113 3300031824 Bacteria 782
570 Ga0307413_10846257 3300031824 Bacteria 772
571 Ga0307413_10906449 3300031824 Bacteria 749
572 Ga0307413_10918840 3300031824 Bacteria 745
573 Ga0307413_11128140 3300031824 Bacteria 678
574 Ga0307413_11790309 3300031824 Bacteria 549
575 Ga0307413_12117902 3300031824 Bacteria 509
576 Ga0307410_10035633 3300031852 Bacteria 3233
577 Ga0307410_10037070 3300031852 Bacteria 3181
578 Ga0307410_10058166 3300031852 Bacteria 2635
579 Ga0307410_10060845 3300031852 Bacteria 2582
580 Ga0307410_10082754 3300031852 Bacteria 2258
581 Ga0307410_10208325 3300031852 Bacteria 1496
582 Ga0307410_10208624 3300031852 Bacteria 1495
583 Ga0307410_10210448 3300031852 Bacteria 1489
584 Ga0307410_10234192 3300031852 Bacteria 1419
585 Ga0307410_10509222 3300031852 Bacteria 991
586 Ga0307410_10598937 3300031852 Bacteria 919
587 Ga0307410_10602380 3300031852 Bacteria 916
588 Ga0307410_10755548 3300031852 Bacteria 824
589 Ga0307410_10830731 3300031852 Bacteria 787
590 Ga0307410_11206431 3300031852 Bacteria 659
591 Ga0307410_11303930 3300031852 Bacteria 635
592 Ga0307406_10008913 3300031901 Bacteria 5608
593 Ga0307406_10064083 3300031901 Bacteria 2383
594 Ga0307406_10073030 3300031901 Bacteria 2254
595 Ga0307406_10240914 3300031901 Bacteria 1356
596 Ga0307406_10248456 3300031901 Bacteria 1338
597 Ga0307406_10388520 3300031901 Bacteria 1102
598 Ga0307406_10402491 3300031901 Bacteria 1085
599 Ga0307406_10433246 3300031901 Bacteria 1050
600 Ga0307406_10540709 3300031901 Bacteria 951
601 Ga0307406_10736089 3300031901 Bacteria 826
602 Ga0307406_10992212 3300031901 Bacteria 720
603 Ga0307406_12112191 3300031901 Bacteria 505
604 Ga0307407_10008290 3300031903 Bacteria 4761
605 Ga0307407_10009308 3300031903 Bacteria 4566
606 Ga0307407_10060756 3300031903 Bacteria 2206
607 Ga0307407_10167370 3300031903 Bacteria 1444
608 Ga0307407_10218009 3300031903 Bacteria 1288
609 Ga0307407_10335111 3300031903 Bacteria 1066
610 Ga0307407_10342109 3300031903 Bacteria 1056
611 Ga0307407_10464728 3300031903 Bacteria 921
612 Ga0307407_10473362 3300031903 Bacteria 913
613 Ga0307407_10525964 3300031903 Bacteria 871
614 Ga0307407_10703507 3300031903 Bacteria 761
615 Ga0307407_10742387 3300031903 Bacteria 742
616 Ga0307407_10823678 3300031903 Bacteria 707
617 Ga0307407_11005090 3300031903 Bacteria 644
618 Ga0307407_11116489 3300031903 Bacteria 613
619 Ga0307407_11227213 3300031903 Bacteria 586
620 Ga0307407_11296610 3300031903 Bacteria 571
621 Ga0307407_11407525 3300031903 Bacteria 549
622 Ga0307412_10006281 3300031911 Bacteria 6709
623 Ga0307412_10012926 3300031911 Bacteria 4879
624 Ga0307412_10036041 3300031911 Bacteria 3165
625 Ga0307412_10044633 3300031911 Bacteria 2892
626 Ga0307412_10047521 3300031911 Bacteria 2819
627 Ga0307412_10124407 3300031911 Bacteria 1862
628 Ga0307412_10277576 3300031911 Bacteria 1314
629 Ga0307412_10313154 3300031911 Bacteria 1245
630 Ga0307412_10450200 3300031911 Bacteria 1060
631 Ga0307412_10566574 3300031911 Bacteria 956
632 Ga0307412_10863396 3300031911 Bacteria 790
633 Ga0307412_11005137 3300031911 Bacteria 737
634 Ga0307412_11296586 3300031911 Bacteria 655
635 Ga0307412_11336188 3300031911 Bacteria 646
636 Ga0307412_11661722 3300031911 Bacteria 584
637 Ga0307412_11681117 3300031911 Bacteria 581
638 Ga0307412_11840221 3300031911 Bacteria 557
639 Ga0307412_12286736 3300031911 Bacteria 504
640 Ga0307409_100032709 3300031995 Bacteria 3774
641 Ga0307409_100057297 3300031995 Bacteria 3018
642 Ga0307409_100179988 3300031995 Bacteria 1870
643 Ga0307409_100220023 3300031995 Bacteria 1713
644 Ga0307409_100267166 3300031995 Bacteria 1573
645 Ga0307409_100289380 3300031995 Bacteria 1518
646 Ga0307409_100344246 3300031995 Bacteria 1404
647 Ga0307409_100395964 3300031995 Bacteria 1317
648 Ga0307409_100404232 3300031995 Bacteria 1305
649 Ga0307409_100434010 3300031995 Bacteria 1263
650 Ga0307409_100519938 3300031995 Bacteria 1162
651 Ga0307409_100563327 3300031995 Bacteria 1120
652 Ga0307409_100840037 3300031995 Bacteria 928
653 Ga0307409_101158821 3300031995 Bacteria 795
654 Ga0307409_101309987 3300031995 Bacteria 749
655 Ga0307409_101325463 3300031995 Bacteria 745
656 Ga0307409_101404314 3300031995 Bacteria 724
657 Ga0307409_101635272 3300031995 Bacteria 672
658 Ga0307409_101848383 3300031995 Bacteria 633
659 Ga0307409_102038076 3300031995 Bacteria 603
660 Ga0307409_102314326 3300031995 Bacteria 566
661 Ga0307416_100017376 3300032002 Bacteria 5032
662 Ga0307416_100022017 3300032002 Bacteria 4589
663 Ga0307416_100038293 3300032002 Bacteria 3698
664 Ga0307416_100096521 3300032002 Bacteria 2556
665 Ga0307416_100124968 3300032002 Bacteria 2302
666 Ga0307416_100380751 3300032002 Bacteria 1441
667 Ga0307416_100424701 3300032002 Bacteria 1374
668 Ga0307416_100566945 3300032002 Bacteria 1211
669 Ga0307416_100698249 3300032002 Bacteria 1103
670 Ga0307416_100745941 3300032002 Bacteria 1071
671 Ga0307416_101121299 3300032002 Bacteria 891
672 Ga0307416_101161505 3300032002 Bacteria 877
673 Ga0307416_101268871 3300032002 Bacteria 842
674 Ga0307416_101493342 3300032002 Bacteria 781
675 Ga0307416_102990679 3300032002 Bacteria 565
676 Ga0307414_10018742 3300032004 Bacteria 4270
677 Ga0307414_10022834 3300032004 Bacteria 3955
678 Ga0307414_10072274 3300032004 Bacteria 2491
679 Ga0307414_10320779 3300032004 Bacteria 1318
680 Ga0307414_10353189 3300032004 Bacteria 1262
681 Ga0307414_10433900 3300032004 Bacteria 1148
682 Ga0307414_10434621 3300032004 Bacteria 1147
683 Ga0307414_10439682 3300032004 Bacteria 1141
684 Ga0307414_10492079 3300032004 Bacteria 1083
685 Ga0307414_10528231 3300032004 Bacteria 1048
686 Ga0307414_10546737 3300032004 Bacteria 1031
687 Ga0307414_10602323 3300032004 Bacteria 985
688 Ga0307414_10668635 3300032004 Bacteria 937
689 Ga0307414_10787144 3300032004 Bacteria 866
690 Ga0307414_10860700 3300032004 Bacteria 829
691 Ga0307414_10897182 3300032004 Bacteria 812
692 Ga0307414_10961044 3300032004 Bacteria 785
693 Ga0307414_11044415 3300032004 Bacteria 753
694 Ga0307414_11125013 3300032004 Bacteria 726
695 Ga0307414_11163839 3300032004 Bacteria 713
696 Ga0307414_11675005 3300032004 Bacteria 593
697 Ga0307414_11910434 3300032004 Bacteria 554
698 Ga0307411_10031516 3300032005 Bacteria 3263
699 Ga0307411_10052995 3300032005 Bacteria 2655
700 Ga0307411_10062837 3300032005 Bacteria 2478
701 Ga0307411_10067691 3300032005 Bacteria 2404
702 Ga0307411_10243867 3300032005 Bacteria 1408
703 Ga0307411_10287202 3300032005 Bacteria 1312
704 Ga0307411_10319854 3300032005 Bacteria 1252
705 Ga0307411_10413340 3300032005 Bacteria 1118
706 Ga0307411_10506610 3300032005 Bacteria 1021
707 Ga0307411_10644191 3300032005 Bacteria 916
708 Ga0307411_10661518 3300032005 Bacteria 905
709 Ga0307411_10756839 3300032005 Bacteria 851
710 Ga0307411_10793363 3300032005 Bacteria 833
711 Ga0307411_10903904 3300032005 Bacteria 784
712 Ga0307411_10942350 3300032005 Bacteria 769
713 Ga0307411_10974947 3300032005 Bacteria 757
714 Ga0307411_11171978 3300032005 Bacteria 695
715 Ga0307411_11464693 3300032005 Bacteria 626
716 Ga0307411_11650413 3300032005 Bacteria 592
717 Ga0307411_11814352 3300032005 Bacteria 566
718 Ga0307411_11883005 3300032005 Bacteria 556
719 Ga0307411_12069499 3300032005 Bacteria 532
720 Ga0307415_100011564 3300032126 Bacteria 5056
721 Ga0307415_100013332 3300032126 Bacteria 4795
722 Ga0307415_100028587 3300032126 Bacteria 3549
723 Ga0307415_100036868 3300032126 Bacteria 3208
724 Ga0307415_100043471 3300032126 Bacteria 2997
725 Ga0307415_100270569 3300032126 Bacteria 1391
726 Ga0307415_100298498 3300032126 Bacteria 1333
727 Ga0307415_100301048 3300032126 Bacteria 1328
728 Ga0307415_100426629 3300032126 Bacteria 1139
729 Ga0307415_100531167 3300032126 Bacteria 1034
730 Ga0307415_100590757 3300032126 Bacteria 986
731 Ga0307415_100593777 3300032126 Bacteria 984
732 Ga0307415_100699337 3300032126 Bacteria 914
733 Ga0307415_100887487 3300032126 Bacteria 821
734 Ga0307415_101098635 3300032126 Bacteria 744
735 Ga0307415_101953376 3300032126 Bacteria 570
736 Ga0307415_101982843 3300032126 Bacteria 566
737 Ga0307415_102100374 3300032126 Bacteria 551
738 Ga0307415_102110096 3300032126 Bacteria 550
739 Ga0307415_102330520 3300032126 Bacteria 525
740 Ga0373932_0250958 3300035112 Bacteria 646
741 Ga0373943_0594593 3300035170 Bacteria 651
742 Ga0373931_1123587 3300035691 Bacteria 536
743 Ga0395899_0003333 3300037312 Bacteria 12734
744 Ga0395899_0140550 3300037312 Bacteria 1718
745 Ga0395899_0250955 3300037312 Bacteria 1214
746 Ga0395899_0263368 3300037312 Bacteria 1178
747 Ga0395900_0001654 3300037418 Bacteria 26100
748 Ga0395900_0015985 3300037418 Bacteria 7647
749 Ga0395900_0343221 3300037418 Bacteria 1468
750 Ga0395900_0460257 3300037418 Bacteria 1227
751 Ga0395900_0551353 3300037418 Bacteria 1097
752 Ga0395898_0004457 3300037466 Bacteria 15305
753 Ga0395905_0001805 3300037471 Bacteria 24778
754 Ga0395905_0044969 3300037471 Bacteria 4142
755 Ga0395905_0050764 3300037471 Bacteria 3885
756 Ga0395905_0068615 3300037471 Bacteria 3321
757 Ga0395905_0082015 3300037471 Bacteria 3022
758 Ga0395905_0158329 3300037471 Bacteria 2129
759 Ga0395905_0352281 3300037471 Bacteria 1364
760 Ga0395905_0440016 3300037471 Bacteria 1201
761 Ga0395905_0488828 3300037471 Bacteria 1130
762 Ga0395905_0592508 3300037471 Bacteria 1010
763 Ga0395905_1521906 3300037471 Bacteria 573
764 Ga0395901_0005009 3300038443 Bacteria 13375
765 Ga0395901_0014323 3300038443 Bacteria 8075
766 Ga0395901_0134888 3300038443 Bacteria 2594
767 Ga0395901_0693791 3300038443 Bacteria 1016
768 Ga0395901_0796333 3300038443 Bacteria 934
769 Ga0395901_1329930 3300038443 Bacteria 679
770 Ga0237819_00486 3300038705 Bacteria 13460
771 Ga0436363_1059172 3300039450 Bacteria 997
772 Ga0439436_0183483 3300041404 Bacteria 596
773 Ga0439438_057718 3300041405 Bacteria 976
774 Ga0439439_0175481 3300041406 Bacteria 616
775 Ga0439466_0145034 3300041411 Bacteria 728
776 Ga0439465_0156535 3300041413 Bacteria 816
777 Ga0439465_0251266 3300041413 Bacteria 654
778 Ga0451791_1790522 3300041451 Bacteria 538
779 Ga0451797_1562310 3300041453 Bacteria 509
780 Ga0451802_1688601 3300041460 Bacteria 505
781 Ga0451804_0932243 3300041463 Bacteria 812
782 Ga0451837_1573589 3300041494 Bacteria 779
783 Ga0439433_0015993 3300041999 Bacteria 1660
784 Ga0439437_002305 3300042000 Bacteria 2041
785 Ga0439442_144684 3300042002 Bacteria 527
786 Ga0439445_0002249 3300042004 Bacteria 4286
787 Ga0439432_029409 3300042006 Bacteria 1786
788 Ga0439432_094846 3300042006 Bacteria 896
789 Ga0439432_148528 3300042006 Bacteria 688
790 Ga0439449_0151340 3300042007 Bacteria 865
791 Ga0439449_0180434 3300042007 Bacteria 789
792 Ga0439449_0334257 3300042007 Bacteria 573
793 Ga0439449_0350808 3300042007 Bacteria 559
794 Ga0439452_082101 3300042010 Bacteria 702
795 Ga0439455_0070610 3300042012 Bacteria 938
796 Ga0439457_039742 3300042014 Bacteria 1048
797 Ga0439457_171302 3300042014 Bacteria 528
798 Ga0439462_0021174 3300042015 Bacteria 1698
799 Ga0439462_0120058 3300042015 Bacteria 731
800 Ga0450913_027735 3300042117 Bacteria 547
801 Ga0450917_012615 3300042120 Bacteria 689
802 Ga0450920_096264 3300042122 Bacteria 613
803 Ga0450921_008959 3300042123 Bacteria 821
804 Ga0450922_038535 3300042124 Bacteria 536
805 Ga0450890_002421 3300042127 Bacteria 2569
806 Ga0450891_004475 3300042129 Bacteria 1307
807 Ga0450892_010176 3300042130 Bacteria 822
808 Ga0450889_001840 3300042144 Bacteria 2142
809 Ga0450889_006019 3300042144 Bacteria 1214
810 Ga0450906_057620 3300042145 Bacteria 689
811 Ga0439446_0061998 3300042156 Bacteria 1132
812 Ga0439446_0098894 3300042156 Bacteria 921
813 Ga0439458_0046507 3300042157 Bacteria 1063
814 Ga0439434_0019308 3300042435 Bacteria 2044
815 Ga0439434_0243697 3300042435 Bacteria 614
816 Ga0439435_0301583 3300042436 Bacteria 549
817 Ga0439464_0032905 3300042439 Bacteria 1458
818 Ga0439460_0020435 3300042461 Bacteria 1800
819 Ga0450916_020927 3300042530 Bacteria 897
820 Ga0450918_009803 3300042531 Bacteria 1676
821 Ga0450893_0026458 3300042532 Bacteria 1020
822 Ga0450893_0064368 3300042532 Bacteria 705
823 Ga0451577_1298692 3300042876 Bacteria 647
824 Ga0466969_0054413 3300044656 Bacteria 1960
825 Ga0466966_0021881 3300044684 Bacteria 4198
826 Ga0466966_0093437 3300044684 Bacteria 1865
827 Ga0466961_0411205 3300044693 Bacteria 820
828 Ga0466970_0154144 3300044765 Bacteria 1269
829 Ga0466970_0157153 3300044765 Bacteria 1257
830 Ga0466960_0042638 3300044901 Bacteria 2155
831 Ga0466960_0549996 3300044901 Bacteria 681
832 Ga0466959_0182707 3300045049 Bacteria 1466
833 Ga0466967_1994837 3300045976 Bacteria 577
834 Ga0495639_0073520 3300046475 Bacteria 1583
835 Ga0495585_0446307 3300046492 Bacteria 619
836 Ga0495585_0548424 3300046492 Bacteria 546
837 Ga0495620_0051440 3300046515 Bacteria 1753
838 Ga0495620_0101581 3300046515 Bacteria 1146
839 Ga0495631_0406331 3300046518 Bacteria 580
840 Ga0495637_0020520 3300046520 Bacteria 3041
841 Ga0495643_0098437 3300046522 Bacteria 1501
842 Ga0495644_0182568 3300046523 Bacteria 807
843 Ga0495644_0313718 3300046523 Bacteria 615
844 Ga0495648_0420692 3300046524 Bacteria 592
845 Ga0495663_0011738 3300046525 Bacteria 2439
846 Ga0495663_0051618 3300046525 Bacteria 1274
847 Ga0495663_0086663 3300046525 Bacteria 1015
848 Ga0495663_0102635 3300046525 Bacteria 943
849 Ga0495663_0275085 3300046525 Bacteria 602
850 Ga0495642_0006927 3300046528 Bacteria 4348
851 Ga0495598_0001912 3300046537 Bacteria 4214
852 Ga0495598_0026244 3300046537 Bacteria 1595
853 Ga0495598_0142123 3300046537 Bacteria 831
854 Ga0495598_0263710 3300046537 Bacteria 642
855 Ga0495609_0292440 3300046538 Bacteria 664
856 Ga0495621_0001529 3300046539 Bacteria 6017
857 Ga0495621_0011525 3300046539 Bacteria 2738
858 Ga0495621_0024686 3300046539 Bacteria 2010
859 Ga0495621_0195853 3300046539 Bacteria 811
860 Ga0495621_0329202 3300046539 Bacteria 637
861 Ga0495633_0001763 3300046558 Bacteria 16049
862 Ga0495633_0006943 3300046558 Bacteria 6620
863 Ga0495668_0010177 3300046616 Bacteria 5716
864 Ga0495668_0032702 3300046616 Bacteria 2925
865 Ga0495668_0054103 3300046616 Bacteria 2219
866 Ga0495668_0635583 3300046616 Bacteria 590
867 Ga0495625_0053293 3300046660 Bacteria 2894
868 Ga0495625_0533467 3300046660 Bacteria 713
869 Ga0495659_0051088 3300046664 Bacteria 1505
870 Ga0495659_0167995 3300046664 Bacteria 888
871 Ga0495661_0229064 3300046665 Bacteria 959
872 Ga0495661_0279995 3300046665 Bacteria 841
873 Ga0495647_0015704 3300046681 Bacteria 2658
874 Ga0495669_0054353 3300046684 Bacteria 1802
875 Ga0495669_0059366 3300046684 Bacteria 1727
876 Ga0495669_0062935 3300046684 Bacteria 1682
877 Ga0495669_0138767 3300046684 Bacteria 1147
878 Ga0495669_0241253 3300046684 Bacteria 867
879 Ga0495670_0139924 3300046691 Bacteria 1265
880 Ga0495670_0663255 3300046691 Bacteria 568
881 Ga0495660_0153059 3300046810 Bacteria 1137
882 Ga0495636_0034127 3300047318 Bacteria 2093
883 Ga0495636_0273544 3300047318 Bacteria 785
884 Ga0495672_0137127 3300047320 Bacteria 1282
885 Ga0495683_0316836 3300047323 Bacteria 666
886 Ga0495677_0032597 3300047445 Bacteria 1898
887 Ga0495677_0410523 3300047445 Bacteria 536
888 Ga0495681_0113591 3300047470 Bacteria 1170
889 Ga0495626_0277920 3300048091 Bacteria 666
890 Ga0496100_1009858 3300048903 Bacteria 655
891 Ga0496101_0105642 3300048904 Bacteria 2113
892 Ga0496101_1053437 3300048904 Bacteria 639
893 Ga0496102_0073258 3300048905 Bacteria 3148
894 Ga0496102_1195712 3300048905 Bacteria 680
895 Ga0496103_0099525 3300048906 Bacteria 1839
896 Ga0496106_0610295 3300048909 Bacteria 873
897 Ga0496107_0017654 3300048910 Bacteria 5019
898 Ga0496109_0273399 3300048912 Bacteria 1592
899 Ga0496109_0572791 3300048912 Bacteria 1064
900 Ga0496110_0017526 3300048913 Bacteria 5991
901 Ga0496111_0488148 3300048914 Bacteria 907
902 Ga0496111_0517612 3300048914 Bacteria 877
903 Ga0496112_0183306 3300048915 Bacteria 2057
904 Ga0496114_0029773 3300048917 Bacteria 4488
905 Ga0496115_0076021 3300048918 Bacteria 2729
906 Ga0501306_043570 3300049127 Bacteria 702
907 Ga0501306_052369 3300049127 Bacteria 657
908 Ga0501308_007173 3300049128 Bacteria 1161
909 Ga0501308_028918 3300049128 Bacteria 734
910 Ga0501308_081980 3300049128 Bacteria 515
911 Ga0501309_011894 3300049129 Bacteria 1140
912 Ga0501309_029350 3300049129 Bacteria 806
913 Ga0501305_036942 3300049161 Bacteria 783
914 Ga0501307_078880 3300049162 Bacteria 535
915 Ga0501296_052740 3300049519 Bacteria 599
916 Ga0501311_006508 3300049527 Bacteria 1318
917 Ga0501312_019954 3300049528 Bacteria 988
918 Ga0501312_021406 3300049528 Bacteria 963
919 Ga0501312_114104 3300049528 Bacteria 518
920 Ga0501313_006405 3300049529 Bacteria 1274
921 Ga0501314_017158 3300049530 Bacteria 727
922 Ga0501315_082851 3300049531 Bacteria 547
923 Ga0501316_046553 3300049532 Bacteria 616
924 Ga0501317_008465 3300049533 Bacteria 1185
925 Ga0501320_033315 3300049536 Bacteria 650
926 Ga0501322_001181 3300049538 Bacteria 1422
927 Ga0501324_006512 3300049540 Bacteria 986
928 Ga0501336_000759 3300049552 Bacteria 1734
929 Ga0501038_1366848 3300049574 Bacteria 510
930 Ga0501039_0917407 3300049575 Bacteria 682
931 Ga0501041_0307832 3300049577 Bacteria 999
932 Ga0501042_0277754 3300049578 Bacteria 1210
933 Ga0501042_1128401 3300049578 Bacteria 572
934 Ga0501067_0138597 3300049583 Bacteria 1354
935 Ga0501069_0077653 3300049585 Bacteria 1867
936 Ga0501069_0378964 3300049585 Bacteria 836
937 Ga0501071_0347988 3300049587 Bacteria 1128
938 Ga0501071_0763467 3300049587 Bacteria 745
939 Ga0501202_119011 3300049652 Bacteria 662
940 Ga0501207_137258 3300049654 Bacteria 518
941 Ga0501217_180279 3300049661 Bacteria 648
942 Ga0501227_023780 3300049665 Bacteria 1426
943 Ga0501235_007961 3300049669 Bacteria 2309
944 Ga0501238_018422 3300049671 Bacteria 977
945 Ga0501242_079603 3300049674 Bacteria 524
946 Ga0501243_004591 3300049675 Bacteria 2073
947 Ga0501247_025857 3300049677 Bacteria 782
948 Ga0501249_035773 3300049679 Bacteria 1117
949 Ga0501249_152099 3300049679 Bacteria 583
950 Ga0501252_084100 3300049682 Bacteria 531
951 Ga0501253_011091 3300049683 Bacteria 1375
952 Ga0501253_060926 3300049683 Bacteria 813
953 Ga0501258_008068 3300049687 Bacteria 1076
954 Ga0501258_030401 3300049687 Bacteria 680
955 Ga0501245_100939 3300049708 Bacteria 585
956 Ga0501232_026318 3300049757 Bacteria 783
957 Ga0501262_050043 3300049759 Bacteria 645
958 Ga0501266_006451 3300049763 Bacteria 1459
959 Ga0501267_001469 3300049764 Bacteria 2031
960 Ga0501268_001854 3300049765 Bacteria 2694
961 Ga0501268_002791 3300049765 Bacteria 2332
962 Ga0501268_100512 3300049765 Bacteria 619
963 Ga0501268_123907 3300049765 Bacteria 575
964 Ga0501270_025070 3300049767 Bacteria 942
965 Ga0501271_008700 3300049768 Bacteria 1046
966 Ga0501272_005184 3300049769 Bacteria 1368
967 Ga0501272_054087 3300049769 Bacteria 563
968 Ga0501273_018923 3300049770 Bacteria 920
969 Ga0501273_022962 3300049770 Bacteria 854
970 Ga0501275_088441 3300049772 Bacteria 512
971 Ga0501279_007329 3300049775 Bacteria 1465
972 Ga0501035_0732855 3300049822 Bacteria 795
973 Ga0501044_0037302 3300049823 Bacteria 5081
974 Ga0501045_1367344 3300049824 Bacteria 515
975 Ga0501212_020814 3300049851 Bacteria 1014
976 nmdc:mga0yw44_459926_c1 3300050492 Bacteria 862
977 nmdc:mga0k408_299190_c1 3300050493 Bacteria 960
978 nmdc:mga07m45_828407_c1 3300050496 Bacteria 530
979 nmdc:mga05p37_239566_c1 3300050507 Bacteria 2182
980 nmdc:mga09592_404177_c1 3300050508 Bacteria 1180
981 nmdc:mga09592_781511_c1 3300050508 Bacteria 808
982 nmdc:mga0qj67_1389098_c1 3300050509 Bacteria 542
983 nmdc:mga06r32_830292_c1 3300050510 Bacteria 883
984 nmdc:mga08y16_132375_c1 3300050511 Bacteria 2592
985 nmdc:mga08y16_1608448_c1 3300050511 Bacteria 607
986 nmdc:mga08y16_41479_c1 3300050511 Bacteria 4821
987 nmdc:mga0n895_460363_c1 3300050512 Bacteria 1284
988 nmdc:mga0rr50_264675_c1 3300050513 Bacteria 1431
989 Ga0500647_0106045 3300053091 Bacteria 1339
990 Ga0500651_0084712 3300053093 Bacteria 1960
991 Ga0500651_0120654 3300053093 Bacteria 1592
992 Ga0500618_088286 3300053125 Bacteria 696
993 Ga0500642_0283850 3300053130 Bacteria 751
994 Ga0500655_000265 3300053133 Bacteria 12247
995 Ga0500658_0000023 3300053134 Bacteria 123176
996 Ga0500658_0037508 3300053134 Bacteria 1928
997 Ga0500590_015132 3300053148 Bacteria 3982
998 Ga0500622_0124956 3300053156 Bacteria 1243
999 Ga0500639_106017 3300053163 Bacteria 1375
1000 Ga0500636_0211402 3300053177 Bacteria 1018
1001 Ga0500570_047027 3300053724 Bacteria 2203
1002 Ga0590071_048015 3300059421 Bacteria 1033
1003 Ga0590071_147793 3300059421 Bacteria 608
1004 Ga0590074_058671 3300059423 Bacteria 713
1005 Ga0590074_076986 3300059423 Bacteria 634
1006 Ga0587092_056635 3300059512 Bacteria 724

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049683 Ga0501253_011091 Ga0501253_011091_147_530 101
2 3300049763 Ga0501266_006451 Ga0501266_006451_499_810 102
3 iso_pu_bacteria 2582581305 2585262480 102
4 iso_pu_bacteria 2885427238 2885427581 102
5 iso_pu_bacteria 2896429255 2896431117 102
6 3300006195 Ga0075366_10078589 Ga0075366_100785893 104
7 3300013105 Ga0157369_11061297 Ga0157369_110612972 104
8 3300044684 Ga0466966_0093437 Ga0466966_0093437_640_957 104
9 3300053093 Ga0500651_0084712 Ga0500651_0084712_474_788 104
10 3300000549 LJQas_1012887 LJQas_10128872 105
11 3300000652 ARCol0yngRDRAFT_1001879 ARCol0yngRDRAFT_10018792 105
12 3300001990 JGI24737J22298_10105196 JGI24737J22298_101051961 105
13 3300002067 JGI24735J21928_10253867 JGI24735J21928_102538671 105
14 3300002070 JGI24750J21931_1006318 JGI24750J21931_10063184 105
15 3300002074 JGI24748J21848_1001483 JGI24748J21848_10014833 105
16 3300002126 JGI24035J26624_1015105 JGI24035J26624_10151052 105
17 3300002155 JGI24033J26618_1047719 JGI24033J26618_10477192 105
18 3300002244 JGI24742J22300_10007510 JGI24742J22300_100075104 105
19 3300002459 JGI24751J29686_10022529 JGI24751J29686_100225293 105
20 3300002459 JGI24751J29686_10039569 JGI24751J29686_100395692 105
21 3300005290 Ga0065712_10037815 Ga0065712_100378152 105
22 3300005290 Ga0065712_10230156 Ga0065712_102301562 105
23 3300005293 Ga0065715_10000098 Ga0065715_100000987 105
24 3300005293 Ga0065715_10219721 Ga0065715_102197212 105
25 3300005293 Ga0065715_10373912 Ga0065715_103739122 105
26 3300005293 Ga0065715_10395125 Ga0065715_103951252 105
27 3300005293 Ga0065715_10910021 Ga0065715_109100212 105
28 3300005295 Ga0065707_10477737 Ga0065707_104777371 105
29 3300005328 Ga0070676_10010202 Ga0070676_100102025 105
30 3300005328 Ga0070676_10027273 Ga0070676_100272736 105
31 3300005328 Ga0070676_10051799 Ga0070676_100517991 105
32 3300005328 Ga0070676_11527306 Ga0070676_115273061 105
33 3300005330 Ga0070690_101309456 Ga0070690_1013094561 105
34 3300005331 Ga0070670_100047139 Ga0070670_1000471392 105
35 3300005331 Ga0070670_100296578 Ga0070670_1002965782 105
36 3300005331 Ga0070670_100364193 Ga0070670_1003641932 105
37 3300005331 Ga0070670_100533843 Ga0070670_1005338431 105
38 3300005331 Ga0070670_100652050 Ga0070670_1006520502 105
39 3300005333 Ga0070677_10016266 Ga0070677_100162663 105
40 3300005333 Ga0070677_10018931 Ga0070677_100189312 105
41 3300005334 Ga0068869_100109201 Ga0068869_1001092012 105
42 3300005334 Ga0068869_101102592 Ga0068869_1011025922 105
43 3300005334 Ga0068869_101383123 Ga0068869_1013831232 105
44 3300005338 Ga0068868_100133596 Ga0068868_1001335962 105
45 3300005338 Ga0068868_100297235 Ga0068868_1002972352 105
46 3300005339 Ga0070660_100151852 Ga0070660_1001518523 105
47 3300005339 Ga0070660_100514385 Ga0070660_1005143852 105
48 3300005341 Ga0070691_11089721 Ga0070691_110897211 105
49 3300005343 Ga0070687_100404902 Ga0070687_1004049022 105
50 3300005343 Ga0070687_100546187 Ga0070687_1005461871 105
51 3300005344 Ga0070661_100308934 Ga0070661_1003089342 105
52 3300005345 Ga0070692_10038276 Ga0070692_100382766 105
53 3300005347 Ga0070668_100048313 Ga0070668_1000483132 105
54 3300005347 Ga0070668_100105756 Ga0070668_1001057562 105
55 3300005347 Ga0070668_100107439 Ga0070668_1001074395 105
56 3300005347 Ga0070668_100165579 Ga0070668_1001655794 105
57 3300005347 Ga0070668_100393760 Ga0070668_1003937603 105
58 3300005347 Ga0070668_100560337 Ga0070668_1005603372 105
59 3300005347 Ga0070668_100691677 Ga0070668_1006916772 105
60 3300005347 Ga0070668_101016540 Ga0070668_1010165402 105
61 3300005347 Ga0070668_101111744 Ga0070668_1011117442 105
62 3300005347 Ga0070668_101772386 Ga0070668_1017723861 105
63 3300005353 Ga0070669_100014400 Ga0070669_1000144009 105
64 3300005353 Ga0070669_100069493 Ga0070669_1000694936 105
65 3300005353 Ga0070669_100259429 Ga0070669_1002594292 105
66 3300005353 Ga0070669_100399911 Ga0070669_1003999112 105
67 3300005353 Ga0070669_100406010 Ga0070669_1004060103 105
68 3300005353 Ga0070669_100823875 Ga0070669_1008238752 105
69 3300005353 Ga0070669_100903125 Ga0070669_1009031251 105
70 3300005353 Ga0070669_100974610 Ga0070669_1009746102 105
71 3300005353 Ga0070669_101067692 Ga0070669_1010676921 105
72 3300005353 Ga0070669_101174155 Ga0070669_1011741552 105
73 3300005353 Ga0070669_101502259 Ga0070669_1015022592 105
74 3300005353 Ga0070669_101661144 Ga0070669_1016611442 105
75 3300005354 Ga0070675_100048237 Ga0070675_1000482375 105
76 3300005354 Ga0070675_100108237 Ga0070675_1001082372 105
77 3300005354 Ga0070675_100458797 Ga0070675_1004587971 105
78 3300005354 Ga0070675_100479567 Ga0070675_1004795672 105
79 3300005354 Ga0070675_100679650 Ga0070675_1006796502 105
80 3300005354 Ga0070675_101692367 Ga0070675_1016923672 105
81 3300005355 Ga0070671_100052885 Ga0070671_1000528852 105
82 3300005355 Ga0070671_100214400 Ga0070671_1002144003 105
83 3300005355 Ga0070671_100277720 Ga0070671_1002777202 105
84 3300005355 Ga0070671_100400255 Ga0070671_1004002551 105
85 3300005355 Ga0070671_100742586 Ga0070671_1007425862 105
86 3300005356 Ga0070674_100022854 Ga0070674_1000228547 105
87 3300005356 Ga0070674_100214360 Ga0070674_1002143602 105
88 3300005356 Ga0070674_100528176 Ga0070674_1005281763 105
89 3300005356 Ga0070674_101058136 Ga0070674_1010581362 105
90 3300005356 Ga0070674_101192319 Ga0070674_1011923192 105
91 3300005356 Ga0070674_101470859 Ga0070674_1014708592 105
92 3300005356 Ga0070674_101804373 Ga0070674_1018043732 105
93 3300005364 Ga0070673_100041643 Ga0070673_1000416435 105
94 3300005364 Ga0070673_100061829 Ga0070673_1000618295 105
95 3300005364 Ga0070673_100113379 Ga0070673_1001133792 105
96 3300005364 Ga0070673_100337611 Ga0070673_1003376112 105
97 3300005364 Ga0070673_100488405 Ga0070673_1004884053 105
98 3300005364 Ga0070673_100598365 Ga0070673_1005983652 105
99 3300005364 Ga0070673_101642507 Ga0070673_1016425071 105
100 3300005364 Ga0070673_101669902 Ga0070673_1016699022 105
101 3300005366 Ga0070659_100085064 Ga0070659_1000850644 105
102 3300005366 Ga0070659_100147960 Ga0070659_1001479602 105
103 3300005366 Ga0070659_100694277 Ga0070659_1006942772 105
104 3300005367 Ga0070667_100050290 Ga0070667_1000502902 105
105 3300005367 Ga0070667_100087293 Ga0070667_1000872932 105
106 3300005367 Ga0070667_100284964 Ga0070667_1002849642 105
107 3300005367 Ga0070667_100450097 Ga0070667_1004500972 105
108 3300005438 Ga0070701_10337157 Ga0070701_103371572 105
109 3300005440 Ga0070705_100323221 Ga0070705_1003232212 105
110 3300005440 Ga0070705_100378721 Ga0070705_1003787212 105
111 3300005441 Ga0070700_100161545 Ga0070700_1001615452 105
112 3300005444 Ga0070694_100046855 Ga0070694_1000468557 105
113 3300005444 Ga0070694_101373582 Ga0070694_1013735821 105
114 3300005445 Ga0070708_101309207 Ga0070708_1013092072 105
115 3300005455 Ga0070663_100116425 Ga0070663_1001164255 105
116 3300005455 Ga0070663_100154628 Ga0070663_1001546285 105
117 3300005455 Ga0070663_100430002 Ga0070663_1004300022 105
118 3300005455 Ga0070663_100613117 Ga0070663_1006131172 105
119 3300005456 Ga0070678_100020582 Ga0070678_1000205829 105
120 3300005456 Ga0070678_100099383 Ga0070678_1000993832 105
121 3300005456 Ga0070678_100301549 Ga0070678_1003015493 105
122 3300005456 Ga0070678_100424540 Ga0070678_1004245402 105
123 3300005457 Ga0070662_100102075 Ga0070662_1001020753 105
124 3300005457 Ga0070662_100286323 Ga0070662_1002863231 105
125 3300005457 Ga0070662_100305495 Ga0070662_1003054952 105
126 3300005457 Ga0070662_100456267 Ga0070662_1004562672 105
127 3300005457 Ga0070662_100567120 Ga0070662_1005671202 105
128 3300005457 Ga0070662_100872865 Ga0070662_1008728652 105
129 3300005458 Ga0070681_10185659 Ga0070681_101856592 105
130 3300005458 Ga0070681_11149784 Ga0070681_111497842 105
131 3300005459 Ga0068867_100004535 Ga0068867_10000453511 105
132 3300005459 Ga0068867_100091878 Ga0068867_1000918782 105
133 3300005459 Ga0068867_101109587 Ga0068867_1011095872 105
134 3300005530 Ga0070679_101959082 Ga0070679_1019590822 105
135 3300005539 Ga0068853_100140615 Ga0068853_1001406152 105
136 3300005539 Ga0068853_100143367 Ga0068853_1001433672 105
137 3300005539 Ga0068853_100680256 Ga0068853_1006802562 105
138 3300005539 Ga0068853_101255935 Ga0068853_1012559352 105
139 3300005543 Ga0070672_100111378 Ga0070672_1001113785 105
140 3300005543 Ga0070672_100167954 Ga0070672_1001679542 105
141 3300005543 Ga0070672_100179493 Ga0070672_1001794933 105
142 3300005543 Ga0070672_100224987 Ga0070672_1002249872 105
143 3300005543 Ga0070672_100858471 Ga0070672_1008584711 105
144 3300005544 Ga0070686_101479710 Ga0070686_1014797102 105
145 3300005545 Ga0070695_101427466 Ga0070695_1014274662 105
146 3300005546 Ga0070696_100017763 Ga0070696_10001776311 105
147 3300005546 Ga0070696_100322224 Ga0070696_1003222242 105
148 3300005548 Ga0070665_100043393 Ga0070665_1000433938 105
149 3300005548 Ga0070665_100093206 Ga0070665_1000932065 105
150 3300005548 Ga0070665_100578818 Ga0070665_1005788182 105
151 3300005549 Ga0070704_100588388 Ga0070704_1005883881 105
152 3300005549 Ga0070704_101037899 Ga0070704_1010378991 105
153 3300005563 Ga0068855_100383221 Ga0068855_1003832213 105
154 3300005563 Ga0068855_101506168 Ga0068855_1015061682 105
155 3300005564 Ga0070664_100036985 Ga0070664_1000369853 105
156 3300005564 Ga0070664_100341882 Ga0070664_1003418822 105
157 3300005564 Ga0070664_100366566 Ga0070664_1003665663 105
158 3300005564 Ga0070664_100439599 Ga0070664_1004395991 105
159 3300005564 Ga0070664_101143950 Ga0070664_1011439502 105
160 3300005564 Ga0070664_101456881 Ga0070664_1014568811 105
161 3300005577 Ga0068857_100558037 Ga0068857_1005580372 105
162 3300005577 Ga0068857_101414475 Ga0068857_1014144751 105
163 3300005578 Ga0068854_100107638 Ga0068854_1001076382 105
164 3300005616 Ga0068852_101569414 Ga0068852_1015694142 105
165 3300005617 Ga0068859_100003314 Ga0068859_10000331417 105
166 3300005617 Ga0068859_100056343 Ga0068859_1000563439 105
167 3300005617 Ga0068859_100156934 Ga0068859_1001569345 105
168 3300005617 Ga0068859_100159089 Ga0068859_1001590893 105
169 3300005618 Ga0068864_100002491 Ga0068864_10000249115 105
170 3300005618 Ga0068864_100039730 Ga0068864_1000397304 105
171 3300005618 Ga0068864_100618311 Ga0068864_1006183112 105
172 3300005718 Ga0068866_10160423 Ga0068866_101604232 105
173 3300005718 Ga0068866_10173232 Ga0068866_101732322 105
174 3300005719 Ga0068861_100079732 Ga0068861_1000797325 105
175 3300005719 Ga0068861_100858086 Ga0068861_1008580862 105
176 3300005840 Ga0068870_10062197 Ga0068870_100621972 105
177 3300005840 Ga0068870_10490947 Ga0068870_104909472 105
178 3300005840 Ga0068870_10633028 Ga0068870_106330281 105
179 3300005840 Ga0068870_11247793 Ga0068870_112477932 105
180 3300005841 Ga0068863_100021286 Ga0068863_1000212864 105
181 3300005841 Ga0068863_100053086 Ga0068863_1000530862 105
182 3300005841 Ga0068863_100121571 Ga0068863_1001215712 105
183 3300005841 Ga0068863_100417823 Ga0068863_1004178232 105
184 3300005842 Ga0068858_100004068 Ga0068858_10000406812 105
185 3300005842 Ga0068858_100480250 Ga0068858_1004802502 105
186 3300005842 Ga0068858_100620712 Ga0068858_1006207122 105
187 3300005843 Ga0068860_100031635 Ga0068860_1000316355 105
188 3300005843 Ga0068860_100126139 Ga0068860_1001261393 105
189 3300005843 Ga0068860_100359305 Ga0068860_1003593053 105
190 3300005843 Ga0068860_100390251 Ga0068860_1003902512 105
191 3300005843 Ga0068860_101419385 Ga0068860_1014193852 105
192 3300005844 Ga0068862_100059849 Ga0068862_1000598494 105
193 3300005844 Ga0068862_100101210 Ga0068862_1001012105 105
194 3300005844 Ga0068862_100202295 Ga0068862_1002022953 105
195 3300005844 Ga0068862_100237862 Ga0068862_1002378624 105
196 3300005844 Ga0068862_100244321 Ga0068862_1002443212 105
197 3300005844 Ga0068862_100368540 Ga0068862_1003685402 105
198 3300005844 Ga0068862_100443406 Ga0068862_1004434062 105
199 3300005844 Ga0068862_100742103 Ga0068862_1007421032 105
200 3300005844 Ga0068862_100805571 Ga0068862_1008055712 105
201 3300005844 Ga0068862_101687584 Ga0068862_1016875841 105
202 3300005985 Ga0081539_10019248 Ga0081539_100192486 105
203 3300006042 Ga0075368_10552403 Ga0075368_105524032 105
204 3300006051 Ga0075364_11193312 Ga0075364_111933121 105
205 3300006175 Ga0070712_100043947 Ga0070712_1000439472 105
206 3300006195 Ga0075366_10481337 Ga0075366_104813372 105
207 3300006195 Ga0075366_10934023 Ga0075366_109340232 105
208 3300006237 Ga0097621_100013419 Ga0097621_1000134196 105
209 3300006237 Ga0097621_101256226 Ga0097621_1012562262 105
210 3300006237 Ga0097621_102319306 Ga0097621_1023193062 105
211 3300006353 Ga0075370_10092311 Ga0075370_100923112 105
212 3300006353 Ga0075370_10495879 Ga0075370_104958792 105
213 3300006358 Ga0068871_100025733 Ga0068871_1000257333 105
214 3300006844 Ga0075428_100136242 Ga0075428_1001362425 105
215 3300006844 Ga0075428_100485419 Ga0075428_1004854192 105
216 3300006846 Ga0075430_100620644 Ga0075430_1006206442 105
217 3300006847 Ga0075431_100135405 Ga0075431_1001354052 105
218 3300006871 Ga0075434_100407578 Ga0075434_1004075782 105
219 3300006871 Ga0075434_102079706 Ga0075434_1020797061 105
220 3300006881 Ga0068865_100522794 Ga0068865_1005227942 105
221 3300006881 Ga0068865_100902546 Ga0068865_1009025462 105
222 3300006881 Ga0068865_101600131 Ga0068865_1016001312 105
223 3300006931 Ga0097620_100003314 Ga0097620_10000331417 105
224 3300006931 Ga0097620_100056349 Ga0097620_1000563492 105
225 3300006931 Ga0097620_100156943 Ga0097620_1001569435 105
226 3300006931 Ga0097620_100159093 Ga0097620_1001590933 105
227 3300007076 Ga0075435_100293915 Ga0075435_1002939152 105
228 3300009092 Ga0105250_10028500 Ga0105250_100285002 105
229 3300009092 Ga0105250_10249058 Ga0105250_102490582 105
230 3300009093 Ga0105240_10551710 Ga0105240_105517103 105
231 3300009094 Ga0111539_10049029 Ga0111539_100490296 105
232 3300009094 Ga0111539_10732388 Ga0111539_107323882 105
233 3300009094 Ga0111539_11658830 Ga0111539_116588301 105
234 3300009098 Ga0105245_10466695 Ga0105245_104666952 105
235 3300009098 Ga0105245_12060467 Ga0105245_120604672 105
236 3300009101 Ga0105247_10184228 Ga0105247_101842284 105
237 3300009147 Ga0114129_10364296 Ga0114129_103642964 105
238 3300009148 Ga0105243_10177410 Ga0105243_101774104 105
239 3300009148 Ga0105243_10633423 Ga0105243_106334232 105
240 3300009148 Ga0105243_11471493 Ga0105243_114714932 105
241 3300009148 Ga0105243_12081884 Ga0105243_120818841 105
242 3300009148 Ga0105243_12090317 Ga0105243_120903172 105
243 3300009174 Ga0105241_10998788 Ga0105241_109987882 105
244 3300009174 Ga0105241_11224091 Ga0105241_112240912 105
245 3300009176 Ga0105242_10440468 Ga0105242_104404682 105
246 3300009176 Ga0105242_11097517 Ga0105242_110975171 105
247 3300009176 Ga0105242_11842400 Ga0105242_118424002 105
248 3300009177 Ga0105248_10006714 Ga0105248_1000671416 105
249 3300009177 Ga0105248_10160056 Ga0105248_101600565 105
250 3300009177 Ga0105248_10192438 Ga0105248_101924385 105
251 3300009177 Ga0105248_10384527 Ga0105248_103845273 105
252 3300009177 Ga0105248_10939619 Ga0105248_109396192 105
253 3300009177 Ga0105248_11516711 Ga0105248_115167112 105
254 3300009545 Ga0105237_11436505 Ga0105237_114365052 105
255 3300009553 Ga0105249_10097841 Ga0105249_100978415 105
256 3300009553 Ga0105249_10536055 Ga0105249_105360552 105
257 3300009553 Ga0105249_11183069 Ga0105249_111830692 105
258 3300009553 Ga0105249_11325169 Ga0105249_113251692 105
259 3300009979 Ga0105032_117129 Ga0105032_1171292 105
260 3300010375 Ga0105239_10558577 Ga0105239_105585772 105
261 3300012485 Ga0157325_1027496 Ga0157325_10274961 105
262 3300012508 Ga0157315_1053009 Ga0157315_10530092 105
263 3300012512 Ga0157327_1004904 Ga0157327_10049042 105
264 3300013100 Ga0157373_10141777 Ga0157373_101417772 105
265 3300013100 Ga0157373_10299516 Ga0157373_102995162 105
266 3300013100 Ga0157373_10651715 Ga0157373_106517152 105
267 3300013100 Ga0157373_10955924 Ga0157373_109559242 105
268 3300013102 Ga0157371_10594172 Ga0157371_105941722 105
269 3300013105 Ga0157369_10006198 Ga0157369_1000619815 105
270 3300013306 Ga0163162_10052322 Ga0163162_100523225 105
271 3300013306 Ga0163162_10336158 Ga0163162_103361582 105
272 3300013306 Ga0163162_10338001 Ga0163162_103380012 105
273 3300013306 Ga0163162_10344969 Ga0163162_103449692 105
274 3300013306 Ga0163162_11626712 Ga0163162_116267122 105
275 3300013308 Ga0157375_10077381 Ga0157375_100773818 105
276 3300013308 Ga0157375_10194162 Ga0157375_101941622 105
277 3300013308 Ga0157375_10965695 Ga0157375_109656952 105
278 3300013308 Ga0157375_11227466 Ga0157375_112274662 105
279 3300013308 Ga0157375_11929267 Ga0157375_119292672 105
280 3300013308 Ga0157375_12710477 Ga0157375_127104772 105
281 3300014325 Ga0163163_10004858 Ga0163163_100048587 105
282 3300014326 Ga0157380_10338680 Ga0157380_103386803 105
283 3300014326 Ga0157380_10732531 Ga0157380_107325312 105
284 3300014326 Ga0157380_11039521 Ga0157380_110395212 105
285 3300014745 Ga0157377_10463159 Ga0157377_104631592 105
286 3300014745 Ga0157377_10679824 Ga0157377_106798242 105
287 3300014968 Ga0157379_10038791 Ga0157379_100387918 105
288 3300014968 Ga0157379_11002470 Ga0157379_110024702 105
289 3300014969 Ga0157376_11568889 Ga0157376_115688892 105
290 3300017792 Ga0163161_10299503 Ga0163161_102995032 105
291 3300017792 Ga0163161_10824666 Ga0163161_108246662 105
292 3300025271 Ga0207666_1012243 Ga0207666_10122433 105
293 3300025315 Ga0207697_10001580 Ga0207697_100015809 105
294 3300025315 Ga0207697_10035806 Ga0207697_100358064 105
295 3300025315 Ga0207697_10067099 Ga0207697_100670993 105
296 3300025315 Ga0207697_10535790 Ga0207697_105357902 105
297 3300025711 Ga0207696_1007651 Ga0207696_10076519 105
298 3300025711 Ga0207696_1132876 Ga0207696_11328762 105
299 3300025885 Ga0207653_10375817 Ga0207653_103758172 105
300 3300025893 Ga0207682_10006590 Ga0207682_100065907 105
301 3300025893 Ga0207682_10054106 Ga0207682_100541062 105
302 3300025893 Ga0207682_10072275 Ga0207682_100722753 105
303 3300025893 Ga0207682_10125454 Ga0207682_101254542 105
304 3300025893 Ga0207682_10282905 Ga0207682_102829052 105
305 3300025899 Ga0207642_10060758 Ga0207642_100607584 105
306 3300025899 Ga0207642_10078048 Ga0207642_100780482 105
307 3300025900 Ga0207710_10168754 Ga0207710_101687542 105
308 3300025901 Ga0207688_10100962 Ga0207688_101009625 105
309 3300025901 Ga0207688_10162329 Ga0207688_101623292 105
310 3300025901 Ga0207688_10396505 Ga0207688_103965052 105
311 3300025904 Ga0207647_10038196 Ga0207647_100381966 105
312 3300025904 Ga0207647_10196815 Ga0207647_101968152 105
313 3300025904 Ga0207647_10378421 Ga0207647_103784212 105
314 3300025907 Ga0207645_10014351 Ga0207645_100143515 105
315 3300025907 Ga0207645_10062998 Ga0207645_100629983 105
316 3300025907 Ga0207645_10088987 Ga0207645_100889875 105
317 3300025907 Ga0207645_10094021 Ga0207645_100940214 105
318 3300025907 Ga0207645_10400732 Ga0207645_104007322 105
319 3300025907 Ga0207645_10855819 Ga0207645_108558192 105
320 3300025908 Ga0207643_10053194 Ga0207643_100531945 105
321 3300025908 Ga0207643_10242261 Ga0207643_102422612 105
322 3300025908 Ga0207643_10364529 Ga0207643_103645292 105
323 3300025908 Ga0207643_10461573 Ga0207643_104615732 105
324 3300025908 Ga0207643_11002433 Ga0207643_110024332 105
325 3300025911 Ga0207654_10252074 Ga0207654_102520742 105
326 3300025912 Ga0207707_10082443 Ga0207707_100824436 105
327 3300025914 Ga0207671_10982750 Ga0207671_109827501 105
328 3300025915 Ga0207693_10253115 Ga0207693_102531153 105
329 3300025918 Ga0207662_10323409 Ga0207662_103234092 105
330 3300025919 Ga0207657_10472898 Ga0207657_104728982 105
331 3300025919 Ga0207657_10543695 Ga0207657_105436951 105
332 3300025919 Ga0207657_11027366 Ga0207657_110273662 105
333 3300025920 Ga0207649_10099638 Ga0207649_100996384 105
334 3300025920 Ga0207649_10694314 Ga0207649_106943141 105
335 3300025920 Ga0207649_10790023 Ga0207649_107900231 105
336 3300025921 Ga0207652_11289783 Ga0207652_112897832 105
337 3300025923 Ga0207681_10001216 Ga0207681_1000121620 105
338 3300025923 Ga0207681_10041111 Ga0207681_100411114 105
339 3300025923 Ga0207681_10518931 Ga0207681_105189313 105
340 3300025923 Ga0207681_10522152 Ga0207681_105221522 105
341 3300025923 Ga0207681_10549365 Ga0207681_105493652 105
342 3300025923 Ga0207681_10562070 Ga0207681_105620702 105
343 3300025923 Ga0207681_10900775 Ga0207681_109007752 105
344 3300025923 Ga0207681_10974693 Ga0207681_109746932 105
345 3300025923 Ga0207681_11062990 Ga0207681_110629902 105
346 3300025923 Ga0207681_11072264 Ga0207681_110722642 105
347 3300025923 Ga0207681_11305249 Ga0207681_113052492 105
348 3300025923 Ga0207681_11855488 Ga0207681_118554882 105
349 3300025925 Ga0207650_10012172 Ga0207650_100121728 105
350 3300025925 Ga0207650_10033934 Ga0207650_100339346 105
351 3300025925 Ga0207650_10084415 Ga0207650_100844152 105
352 3300025925 Ga0207650_10300150 Ga0207650_103001502 105
353 3300025925 Ga0207650_10369470 Ga0207650_103694702 105
354 3300025925 Ga0207650_10472425 Ga0207650_104724252 105
355 3300025925 Ga0207650_10704018 Ga0207650_107040182 105
356 3300025925 Ga0207650_10713455 Ga0207650_107134552 105
357 3300025925 Ga0207650_10783370 Ga0207650_107833702 105
358 3300025926 Ga0207659_10001819 Ga0207659_1000181910 105
359 3300025926 Ga0207659_10112471 Ga0207659_101124713 105
360 3300025926 Ga0207659_10482092 Ga0207659_104820922 105
361 3300025926 Ga0207659_10885959 Ga0207659_108859592 105
362 3300025926 Ga0207659_11278510 Ga0207659_112785101 105
363 3300025926 Ga0207659_11365502 Ga0207659_113655022 105
364 3300025931 Ga0207644_10013980 Ga0207644_100139805 105
365 3300025931 Ga0207644_10111263 Ga0207644_101112632 105
366 3300025931 Ga0207644_10243859 Ga0207644_102438593 105
367 3300025931 Ga0207644_10724008 Ga0207644_107240082 105
368 3300025931 Ga0207644_10896058 Ga0207644_108960582 105
369 3300025932 Ga0207690_10014888 Ga0207690_100148887 105
370 3300025932 Ga0207690_10151034 Ga0207690_101510342 105
371 3300025932 Ga0207690_10350141 Ga0207690_103501412 105
372 3300025933 Ga0207706_10000284 Ga0207706_100002842 105
373 3300025933 Ga0207706_10303158 Ga0207706_103031582 105
374 3300025933 Ga0207706_10337505 Ga0207706_103375053 105
375 3300025933 Ga0207706_10347419 Ga0207706_103474191 105
376 3300025933 Ga0207706_10558457 Ga0207706_105584572 105
377 3300025933 Ga0207706_10658424 Ga0207706_106584242 105
378 3300025933 Ga0207706_10864893 Ga0207706_108648932 105
379 3300025933 Ga0207706_11016931 Ga0207706_110169312 105
380 3300025933 Ga0207706_11165885 Ga0207706_111658851 105
381 3300025934 Ga0207686_11162733 Ga0207686_111627331 105
382 3300025935 Ga0207709_10133892 Ga0207709_101338923 105
383 3300025935 Ga0207709_10143267 Ga0207709_101432671 105
384 3300025935 Ga0207709_10539830 Ga0207709_105398302 105
385 3300025935 Ga0207709_11426508 Ga0207709_114265082 105
386 3300025937 Ga0207669_10036225 Ga0207669_100362255 105
387 3300025937 Ga0207669_10176805 Ga0207669_101768054 105
388 3300025937 Ga0207669_10217707 Ga0207669_102177074 105
389 3300025937 Ga0207669_10330884 Ga0207669_103308842 105
390 3300025937 Ga0207669_10916008 Ga0207669_109160082 105
391 3300025937 Ga0207669_11385341 Ga0207669_113853412 105
392 3300025938 Ga0207704_10077052 Ga0207704_100770523 105
393 3300025938 Ga0207704_10148137 Ga0207704_101481375 105
394 3300025938 Ga0207704_10776914 Ga0207704_107769142 105
395 3300025940 Ga0207691_10017921 Ga0207691_100179214 105
396 3300025940 Ga0207691_10098382 Ga0207691_100983822 105
397 3300025940 Ga0207691_10151074 Ga0207691_101510742 105
398 3300025940 Ga0207691_10209251 Ga0207691_102092513 105
399 3300025940 Ga0207691_10251286 Ga0207691_102512862 105
400 3300025940 Ga0207691_10383118 Ga0207691_103831182 105
401 3300025940 Ga0207691_10494545 Ga0207691_104945452 105
402 3300025940 Ga0207691_10527775 Ga0207691_105277752 105
403 3300025940 Ga0207691_10568742 Ga0207691_105687422 105
404 3300025941 Ga0207711_10000187 Ga0207711_1000018767 105
405 3300025941 Ga0207711_10002648 Ga0207711_1000264821 105
406 3300025941 Ga0207711_10146986 Ga0207711_101469865 105
407 3300025941 Ga0207711_10311962 Ga0207711_103119622 105
408 3300025941 Ga0207711_10830241 Ga0207711_108302412 105
409 3300025942 Ga0207689_10027620 Ga0207689_100276207 105
410 3300025942 Ga0207689_10273854 Ga0207689_102738542 105
411 3300025942 Ga0207689_10679147 Ga0207689_106791472 105
412 3300025942 Ga0207689_10839995 Ga0207689_108399952 105
413 3300025945 Ga0207679_10000847 Ga0207679_1000084715 105
414 3300025945 Ga0207679_10178447 Ga0207679_101784475 105
415 3300025945 Ga0207679_10476415 Ga0207679_104764151 105
416 3300025945 Ga0207679_10690008 Ga0207679_106900082 105
417 3300025945 Ga0207679_11034195 Ga0207679_110341952 105
418 3300025945 Ga0207679_11311878 Ga0207679_113118782 105
419 3300025949 Ga0207667_10844202 Ga0207667_108442022 105
420 3300025949 Ga0207667_11974698 Ga0207667_119746982 105
421 3300025960 Ga0207651_10051794 Ga0207651_100517945 105
422 3300025960 Ga0207651_10057032 Ga0207651_100570326 105
423 3300025960 Ga0207651_10149405 Ga0207651_101494055 105
424 3300025960 Ga0207651_10463917 Ga0207651_104639173 105
425 3300025960 Ga0207651_10653663 Ga0207651_106536633 105
426 3300025960 Ga0207651_11490797 Ga0207651_114907972 105
427 3300025960 Ga0207651_11906616 Ga0207651_119066161 105
428 3300025961 Ga0207712_10000723 Ga0207712_1000072332 105
429 3300025961 Ga0207712_10058661 Ga0207712_100586612 105
430 3300025961 Ga0207712_10528760 Ga0207712_105287602 105
431 3300025961 Ga0207712_11218363 Ga0207712_112183632 105
432 3300025972 Ga0207668_10000062 Ga0207668_1000006226 105
433 3300025972 Ga0207668_10005099 Ga0207668_1000509914 105
434 3300025972 Ga0207668_10307609 Ga0207668_103076093 105
435 3300025972 Ga0207668_10489488 Ga0207668_104894882 105
436 3300025972 Ga0207668_10555107 Ga0207668_105551072 105
437 3300025972 Ga0207668_10652594 Ga0207668_106525942 105
438 3300025972 Ga0207668_11391155 Ga0207668_113911552 105
439 3300025972 Ga0207668_11532923 Ga0207668_115329232 105
440 3300025972 Ga0207668_11629839 Ga0207668_116298392 105
441 3300025972 Ga0207668_11970300 Ga0207668_119703002 105
442 3300025981 Ga0207640_10411255 Ga0207640_104112552 105
443 3300025981 Ga0207640_10507195 Ga0207640_105071952 105
444 3300025981 Ga0207640_10712610 Ga0207640_107126101 105
445 3300025981 Ga0207640_10799406 Ga0207640_107994062 105
446 3300025986 Ga0207658_10009384 Ga0207658_100093849 105
447 3300025986 Ga0207658_10097851 Ga0207658_100978512 105
448 3300025986 Ga0207658_10099440 Ga0207658_100994405 105
449 3300025986 Ga0207658_10100496 Ga0207658_101004964 105
450 3300025986 Ga0207658_10239370 Ga0207658_102393702 105
451 3300025986 Ga0207658_11115281 Ga0207658_111152812 105
452 3300026023 Ga0207677_10161348 Ga0207677_101613482 105
453 3300026023 Ga0207677_10414289 Ga0207677_104142893 105
454 3300026023 Ga0207677_10819684 Ga0207677_108196841 105
455 3300026035 Ga0207703_10001977 Ga0207703_1000197717 105
456 3300026035 Ga0207703_10010836 Ga0207703_1001083614 105
457 3300026035 Ga0207703_10599177 Ga0207703_105991772 105
458 3300026041 Ga0207639_10111479 Ga0207639_101114794 105
459 3300026067 Ga0207678_10370331 Ga0207678_103703313 105
460 3300026067 Ga0207678_10771868 Ga0207678_107718681 105
461 3300026067 Ga0207678_11458363 Ga0207678_114583632 105
462 3300026067 Ga0207678_11720542 Ga0207678_117205422 105
463 3300026075 Ga0207708_10078244 Ga0207708_100782442 105
464 3300026075 Ga0207708_10417118 Ga0207708_104171182 105
465 3300026088 Ga0207641_10001914 Ga0207641_1000191420 105
466 3300026088 Ga0207641_10048399 Ga0207641_100483997 105
467 3300026088 Ga0207641_10303995 Ga0207641_103039953 105
468 3300026088 Ga0207641_11644770 Ga0207641_116447701 105
469 3300026089 Ga0207648_10008052 Ga0207648_1000805214 105
470 3300026089 Ga0207648_10085028 Ga0207648_100850282 105
471 3300026089 Ga0207648_10528360 Ga0207648_105283602 105
472 3300026089 Ga0207648_11964576 Ga0207648_119645762 105
473 3300026095 Ga0207676_10000887 Ga0207676_1000088721 105
474 3300026095 Ga0207676_10136979 Ga0207676_101369792 105
475 3300026116 Ga0207674_10200772 Ga0207674_102007722 105
476 3300026116 Ga0207674_10248268 Ga0207674_102482684 105
477 3300026116 Ga0207674_10326381 Ga0207674_103263811 105
478 3300026118 Ga0207675_100058362 Ga0207675_1000583625 105
479 3300026118 Ga0207675_100112244 Ga0207675_1001122442 105
480 3300026118 Ga0207675_100427779 Ga0207675_1004277792 105
481 3300026118 Ga0207675_100939393 Ga0207675_1009393932 105
482 3300026118 Ga0207675_101010232 Ga0207675_1010102322 105
483 3300026121 Ga0207683_10048556 Ga0207683_100485567 105
484 3300026121 Ga0207683_10062679 Ga0207683_100626795 105
485 3300026121 Ga0207683_10083383 Ga0207683_100833835 105
486 3300026121 Ga0207683_10195383 Ga0207683_101953832 105
487 3300027252 Ga0209973_1018889 Ga0209973_10188891 105
488 3300027364 Ga0209967_1006839 Ga0209967_10068392 105
489 3300027364 Ga0209967_1019832 Ga0209967_10198322 105
490 3300027395 Ga0209996_1039259 Ga0209996_10392591 105
491 3300027462 Ga0210000_1085988 Ga0210000_10859881 105
492 3300027471 Ga0209995_1021235 Ga0209995_10212352 105
493 3300027543 Ga0209999_1017123 Ga0209999_10171232 105
494 3300027543 Ga0209999_1018091 Ga0209999_10180913 105
495 3300027552 Ga0209982_1041017 Ga0209982_10410172 105
496 3300027614 Ga0209970_1092736 Ga0209970_10927361 105
497 3300027617 Ga0210002_1015203 Ga0210002_10152032 105
498 3300027617 Ga0210002_1044249 Ga0210002_10442492 105
499 3300027665 Ga0209983_1004203 Ga0209983_10042037 105
500 3300027665 Ga0209983_1026942 Ga0209983_10269422 105
501 3300027682 Ga0209971_1008830 Ga0209971_10088306 105
502 3300027682 Ga0209971_1018387 Ga0209971_10183872 105
503 3300027682 Ga0209971_1099775 Ga0209971_10997752 105
504 3300027876 Ga0209974_10006589 Ga0209974_100065897 105
505 3300027876 Ga0209974_10026176 Ga0209974_100261762 105
506 3300027907 Ga0207428_10035157 Ga0207428_100351575 105
507 3300027907 Ga0207428_11058933 Ga0207428_110589332 105
508 3300028379 Ga0268266_10415156 Ga0268266_104151562 105
509 3300028379 Ga0268266_10454790 Ga0268266_104547902 105
510 3300028380 Ga0268265_10071746 Ga0268265_100717466 105
511 3300028380 Ga0268265_10174961 Ga0268265_101749612 105
512 3300028380 Ga0268265_10182671 Ga0268265_101826714 105
513 3300028380 Ga0268265_10244660 Ga0268265_102446602 105
514 3300028380 Ga0268265_10279378 Ga0268265_102793783 105
515 3300028380 Ga0268265_10607693 Ga0268265_106076932 105
516 3300028380 Ga0268265_11192780 Ga0268265_111927801 105
517 3300028380 Ga0268265_12715020 Ga0268265_127150202 105
518 3300028381 Ga0268264_10032595 Ga0268264_100325955 105
519 3300028381 Ga0268264_10049844 Ga0268264_100498447 105
520 3300028381 Ga0268264_10085501 Ga0268264_100855013 105
521 3300028381 Ga0268264_10181307 Ga0268264_101813074 105
522 3300028381 Ga0268264_12022403 Ga0268264_120224032 105
523 3300028381 Ga0268264_12028648 Ga0268264_120286482 105
524 3300028381 Ga0268264_12617168 Ga0268264_126171682 105
525 3300028794 Ga0307515_10499480 Ga0307515_104994802 105
526 3300030731 Ga0316177_1095584 Ga0316177_10955842 105
527 3300030732 Ga0316176_1032322 Ga0316176_10323222 105
528 3300030733 Ga0314311_1156759 Ga0314311_11567592 105
529 3300030735 Ga0316178_1181760 Ga0316178_11817602 105
530 3300030736 Ga0316180_1044038 Ga0316180_10440381 105
531 3300030744 Ga0316181_1190288 Ga0316181_11902882 105
532 3300030744 Ga0316181_1197219 Ga0316181_11972192 105
533 3300030745 Ga0316182_1336707 Ga0316182_13367072 105
534 3300030745 Ga0316182_1382068 Ga0316182_13820682 105
535 3300031456 Ga0307513_10080829 Ga0307513_100808292 105
536 3300031548 Ga0307408_100011902 Ga0307408_1000119025 105
537 3300031548 Ga0307408_100029728 Ga0307408_1000297282 105
538 3300031548 Ga0307408_100037962 Ga0307408_1000379625 105
539 3300031548 Ga0307408_100156015 Ga0307408_1001560152 105
540 3300031548 Ga0307408_100226414 Ga0307408_1002264143 105
541 3300031548 Ga0307408_100259848 Ga0307408_1002598483 105
542 3300031548 Ga0307408_100269957 Ga0307408_1002699574 105
543 3300031548 Ga0307408_100316085 Ga0307408_1003160853 105
544 3300031548 Ga0307408_100439960 Ga0307408_1004399603 105
545 3300031548 Ga0307408_100720196 Ga0307408_1007201962 105
546 3300031548 Ga0307408_100810258 Ga0307408_1008102581 105
547 3300031548 Ga0307408_100935096 Ga0307408_1009350962 105
548 3300031548 Ga0307408_101245240 Ga0307408_1012452401 105
549 3300031548 Ga0307408_101606305 Ga0307408_1016063052 105
550 3300031548 Ga0307408_102087860 Ga0307408_1020878601 105
551 3300031548 Ga0307408_102205024 Ga0307408_1022050242 105
552 3300031731 Ga0307405_10010430 Ga0307405_100104306 105
553 3300031731 Ga0307405_10018478 Ga0307405_100184783 105
554 3300031731 Ga0307405_10023082 Ga0307405_100230827 105
555 3300031731 Ga0307405_10039649 Ga0307405_100396496 105
556 3300031731 Ga0307405_10155256 Ga0307405_101552562 105
557 3300031731 Ga0307405_10233894 Ga0307405_102338943 105
558 3300031731 Ga0307405_10334054 Ga0307405_103340542 105
559 3300031731 Ga0307405_10341844 Ga0307405_103418443 105
560 3300031731 Ga0307405_10437606 Ga0307405_104376062 105
561 3300031731 Ga0307405_10753482 Ga0307405_107534822 105
562 3300031731 Ga0307405_10916131 Ga0307405_109161312 105
563 3300031731 Ga0307405_10984772 Ga0307405_109847721 105
564 3300031731 Ga0307405_11175338 Ga0307405_111753382 105
565 3300031731 Ga0307405_11922413 Ga0307405_119224132 105
566 3300031731 Ga0307405_12092790 Ga0307405_120927902 105
567 3300031824 Ga0307413_10028039 Ga0307413_100280395 105
568 3300031824 Ga0307413_10030478 Ga0307413_100304782 105
569 3300031824 Ga0307413_10047616 Ga0307413_100476166 105
570 3300031824 Ga0307413_10093518 Ga0307413_100935185 105
571 3300031824 Ga0307413_10194343 Ga0307413_101943434 105
572 3300031824 Ga0307413_10231029 Ga0307413_102310293 105
573 3300031824 Ga0307413_10379675 Ga0307413_103796752 105
574 3300031824 Ga0307413_10570159 Ga0307413_105701592 105
575 3300031824 Ga0307413_10740652 Ga0307413_107406522 105
576 3300031824 Ga0307413_10823113 Ga0307413_108231132 105
577 3300031824 Ga0307413_10846257 Ga0307413_108462572 105
578 3300031824 Ga0307413_10906449 Ga0307413_109064491 105
579 3300031824 Ga0307413_10918840 Ga0307413_109188402 105
580 3300031824 Ga0307413_11128140 Ga0307413_111281402 105
581 3300031824 Ga0307413_11790309 Ga0307413_117903091 105
582 3300031824 Ga0307413_12117902 Ga0307413_121179021 105
583 3300031852 Ga0307410_10035633 Ga0307410_100356337 105
584 3300031852 Ga0307410_10037070 Ga0307410_100370705 105
585 3300031852 Ga0307410_10058166 Ga0307410_100581662 105
586 3300031852 Ga0307410_10060845 Ga0307410_100608455 105
587 3300031852 Ga0307410_10082754 Ga0307410_100827542 105
588 3300031852 Ga0307410_10208325 Ga0307410_102083253 105
589 3300031852 Ga0307410_10208624 Ga0307410_102086242 105
590 3300031852 Ga0307410_10210448 Ga0307410_102104483 105
591 3300031852 Ga0307410_10234192 Ga0307410_102341922 105
592 3300031852 Ga0307410_10509222 Ga0307410_105092223 105
593 3300031852 Ga0307410_10598937 Ga0307410_105989372 105
594 3300031852 Ga0307410_10602380 Ga0307410_106023802 105
595 3300031852 Ga0307410_10755548 Ga0307410_107555482 105
596 3300031852 Ga0307410_10830731 Ga0307410_108307312 105
597 3300031852 Ga0307410_11206431 Ga0307410_112064312 105
598 3300031852 Ga0307410_11303930 Ga0307410_113039301 105
599 3300031901 Ga0307406_10008913 Ga0307406_100089138 105
600 3300031901 Ga0307406_10064083 Ga0307406_100640832 105
601 3300031901 Ga0307406_10073030 Ga0307406_100730304 105
602 3300031901 Ga0307406_10240914 Ga0307406_102409143 105
603 3300031901 Ga0307406_10248456 Ga0307406_102484563 105
604 3300031901 Ga0307406_10388520 Ga0307406_103885202 105
605 3300031901 Ga0307406_10402491 Ga0307406_104024912 105
606 3300031901 Ga0307406_10433246 Ga0307406_104332462 105
607 3300031901 Ga0307406_10540709 Ga0307406_105407091 105
608 3300031901 Ga0307406_10736089 Ga0307406_107360892 105
609 3300031901 Ga0307406_10992212 Ga0307406_109922122 105
610 3300031901 Ga0307406_12112191 Ga0307406_121121912 105
611 3300031903 Ga0307407_10008290 Ga0307407_1000829010 105
612 3300031903 Ga0307407_10009308 Ga0307407_1000930810 105
613 3300031903 Ga0307407_10060756 Ga0307407_100607565 105
614 3300031903 Ga0307407_10167370 Ga0307407_101673702 105
615 3300031903 Ga0307407_10218009 Ga0307407_102180092 105
616 3300031903 Ga0307407_10335111 Ga0307407_103351113 105
617 3300031903 Ga0307407_10342109 Ga0307407_103421092 105
618 3300031903 Ga0307407_10464728 Ga0307407_104647282 105
619 3300031903 Ga0307407_10473362 Ga0307407_104733623 105
620 3300031903 Ga0307407_10525964 Ga0307407_105259642 105
621 3300031903 Ga0307407_10703507 Ga0307407_107035072 105
622 3300031903 Ga0307407_10742387 Ga0307407_107423872 105
623 3300031903 Ga0307407_10823678 Ga0307407_108236782 105
624 3300031903 Ga0307407_11005090 Ga0307407_110050902 105
625 3300031903 Ga0307407_11116489 Ga0307407_111164892 105
626 3300031903 Ga0307407_11227213 Ga0307407_112272132 105
627 3300031903 Ga0307407_11296610 Ga0307407_112966101 105
628 3300031903 Ga0307407_11407525 Ga0307407_114075252 105
629 3300031911 Ga0307412_10006281 Ga0307412_1000628114 105
630 3300031911 Ga0307412_10012926 Ga0307412_100129267 105
631 3300031911 Ga0307412_10036041 Ga0307412_100360416 105
632 3300031911 Ga0307412_10044633 Ga0307412_100446332 105
633 3300031911 Ga0307412_10047521 Ga0307412_100475212 105
634 3300031911 Ga0307412_10124407 Ga0307412_101244072 105
635 3300031911 Ga0307412_10277576 Ga0307412_102775763 105
636 3300031911 Ga0307412_10313154 Ga0307412_103131542 105
637 3300031911 Ga0307412_10450200 Ga0307412_104502002 105
638 3300031911 Ga0307412_10566574 Ga0307412_105665742 105
639 3300031911 Ga0307412_10863396 Ga0307412_108633962 105
640 3300031911 Ga0307412_11005137 Ga0307412_110051372 105
641 3300031911 Ga0307412_11296586 Ga0307412_112965862 105
642 3300031911 Ga0307412_11336188 Ga0307412_113361882 105
643 3300031911 Ga0307412_11661722 Ga0307412_116617222 105
644 3300031911 Ga0307412_11681117 Ga0307412_116811172 105
645 3300031911 Ga0307412_11840221 Ga0307412_118402212 105
646 3300031911 Ga0307412_12286736 Ga0307412_122867361 105
647 3300031995 Ga0307409_100032709 Ga0307409_1000327097 105
648 3300031995 Ga0307409_100057297 Ga0307409_1000572975 105
649 3300031995 Ga0307409_100179988 Ga0307409_1001799882 105
650 3300031995 Ga0307409_100220023 Ga0307409_1002200232 105
651 3300031995 Ga0307409_100267166 Ga0307409_1002671662 105
652 3300031995 Ga0307409_100289380 Ga0307409_1002893801 105
653 3300031995 Ga0307409_100344246 Ga0307409_1003442462 105
654 3300031995 Ga0307409_100395964 Ga0307409_1003959642 105
655 3300031995 Ga0307409_100404232 Ga0307409_1004042322 105
656 3300031995 Ga0307409_100434010 Ga0307409_1004340102 105
657 3300031995 Ga0307409_100519938 Ga0307409_1005199383 105
658 3300031995 Ga0307409_100563327 Ga0307409_1005633271 105
659 3300031995 Ga0307409_100840037 Ga0307409_1008400372 105
660 3300031995 Ga0307409_101158821 Ga0307409_1011588212 105
661 3300031995 Ga0307409_101309987 Ga0307409_1013099872 105
662 3300031995 Ga0307409_101325463 Ga0307409_1013254632 105
663 3300031995 Ga0307409_101404314 Ga0307409_1014043142 105
664 3300031995 Ga0307409_101635272 Ga0307409_1016352722 105
665 3300031995 Ga0307409_101848383 Ga0307409_1018483832 105
666 3300031995 Ga0307409_102038076 Ga0307409_1020380761 105
667 3300031995 Ga0307409_102314326 Ga0307409_1023143261 105
668 3300032002 Ga0307416_100017376 Ga0307416_1000173762 105
669 3300032002 Ga0307416_100022017 Ga0307416_1000220179 105
670 3300032002 Ga0307416_100038293 Ga0307416_1000382938 105
671 3300032002 Ga0307416_100096521 Ga0307416_1000965214 105
672 3300032002 Ga0307416_100124968 Ga0307416_1001249682 105
673 3300032002 Ga0307416_100380751 Ga0307416_1003807512 105
674 3300032002 Ga0307416_100424701 Ga0307416_1004247012 105
675 3300032002 Ga0307416_100566945 Ga0307416_1005669453 105
676 3300032002 Ga0307416_100698249 Ga0307416_1006982492 105
677 3300032002 Ga0307416_100745941 Ga0307416_1007459413 105
678 3300032002 Ga0307416_101121299 Ga0307416_1011212992 105
679 3300032002 Ga0307416_101161505 Ga0307416_1011615052 105
680 3300032002 Ga0307416_101268871 Ga0307416_1012688712 105
681 3300032002 Ga0307416_101493342 Ga0307416_1014933422 105
682 3300032002 Ga0307416_102990679 Ga0307416_1029906792 105
683 3300032004 Ga0307414_10018742 Ga0307414_100187428 105
684 3300032004 Ga0307414_10022834 Ga0307414_100228348 105
685 3300032004 Ga0307414_10072274 Ga0307414_100722745 105
686 3300032004 Ga0307414_10320779 Ga0307414_103207793 105
687 3300032004 Ga0307414_10353189 Ga0307414_103531892 105
688 3300032004 Ga0307414_10433900 Ga0307414_104339002 105
689 3300032004 Ga0307414_10434621 Ga0307414_104346212 105
690 3300032004 Ga0307414_10439682 Ga0307414_104396822 105
691 3300032004 Ga0307414_10492079 Ga0307414_104920792 105
692 3300032004 Ga0307414_10528231 Ga0307414_105282312 105
693 3300032004 Ga0307414_10546737 Ga0307414_105467372 105
694 3300032004 Ga0307414_10602323 Ga0307414_106023231 105
695 3300032004 Ga0307414_10668635 Ga0307414_106686351 105
696 3300032004 Ga0307414_10787144 Ga0307414_107871442 105
697 3300032004 Ga0307414_10860700 Ga0307414_108607002 105
698 3300032004 Ga0307414_10897182 Ga0307414_108971822 105
699 3300032004 Ga0307414_10961044 Ga0307414_109610442 105
700 3300032004 Ga0307414_11044415 Ga0307414_110444152 105
701 3300032004 Ga0307414_11125013 Ga0307414_111250131 105
702 3300032004 Ga0307414_11163839 Ga0307414_111638392 105
703 3300032004 Ga0307414_11675005 Ga0307414_116750052 105
704 3300032004 Ga0307414_11910434 Ga0307414_119104342 105
705 3300032005 Ga0307411_10031516 Ga0307411_100315165 105
706 3300032005 Ga0307411_10052995 Ga0307411_100529954 105
707 3300032005 Ga0307411_10062837 Ga0307411_100628374 105
708 3300032005 Ga0307411_10067691 Ga0307411_100676913 105
709 3300032005 Ga0307411_10243867 Ga0307411_102438672 105
710 3300032005 Ga0307411_10287202 Ga0307411_102872022 105
711 3300032005 Ga0307411_10319854 Ga0307411_103198542 105
712 3300032005 Ga0307411_10413340 Ga0307411_104133402 105
713 3300032005 Ga0307411_10506610 Ga0307411_105066103 105
714 3300032005 Ga0307411_10644191 Ga0307411_106441911 105
715 3300032005 Ga0307411_10661518 Ga0307411_106615182 105
716 3300032005 Ga0307411_10756839 Ga0307411_107568392 105
717 3300032005 Ga0307411_10793363 Ga0307411_107933632 105
718 3300032005 Ga0307411_10903904 Ga0307411_109039041 105
719 3300032005 Ga0307411_10942350 Ga0307411_109423502 105
720 3300032005 Ga0307411_10974947 Ga0307411_109749472 105
721 3300032005 Ga0307411_11171978 Ga0307411_111719782 105
722 3300032005 Ga0307411_11464693 Ga0307411_114646932 105
723 3300032005 Ga0307411_11650413 Ga0307411_116504132 105
724 3300032005 Ga0307411_11814352 Ga0307411_118143522 105
725 3300032005 Ga0307411_11883005 Ga0307411_118830052 105
726 3300032005 Ga0307411_12069499 Ga0307411_120694992 105
727 3300032126 Ga0307415_100011564 Ga0307415_1000115649 105
728 3300032126 Ga0307415_100013332 Ga0307415_1000133325 105
729 3300032126 Ga0307415_100028587 Ga0307415_1000285875 105
730 3300032126 Ga0307415_100036868 Ga0307415_1000368687 105
731 3300032126 Ga0307415_100043471 Ga0307415_1000434711 105
732 3300032126 Ga0307415_100270569 Ga0307415_1002705692 105
733 3300032126 Ga0307415_100298498 Ga0307415_1002984981 105
734 3300032126 Ga0307415_100301048 Ga0307415_1003010482 105
735 3300032126 Ga0307415_100426629 Ga0307415_1004266292 105
736 3300032126 Ga0307415_100531167 Ga0307415_1005311672 105
737 3300032126 Ga0307415_100590757 Ga0307415_1005907572 105
738 3300032126 Ga0307415_100593777 Ga0307415_1005937772 105
739 3300032126 Ga0307415_100699337 Ga0307415_1006993372 105
740 3300032126 Ga0307415_100887487 Ga0307415_1008874871 105
741 3300032126 Ga0307415_101098635 Ga0307415_1010986352 105
742 3300032126 Ga0307415_101953376 Ga0307415_1019533762 105
743 3300032126 Ga0307415_101982843 Ga0307415_1019828432 105
744 3300032126 Ga0307415_102100374 Ga0307415_1021003742 105
745 3300032126 Ga0307415_102110096 Ga0307415_1021100962 105
746 3300032126 Ga0307415_102330520 Ga0307415_1023305201 105
747 3300035112 Ga0373932_0250958 Ga0373932_0250958_109_429 105
748 3300035170 Ga0373943_0594593 Ga0373943_0594593_51_371 105
749 3300035691 Ga0373931_1123587 Ga0373931_1123587_189_509 105
750 3300037312 Ga0395899_0003333 Ga0395899_0003333_6380_6700 105
751 3300037312 Ga0395899_0140550 Ga0395899_0140550_334_654 105
752 3300037312 Ga0395899_0250955 Ga0395899_0250955_522_842 105
753 3300037312 Ga0395899_0263368 Ga0395899_0263368_163_483 105
754 3300037418 Ga0395900_0001654 Ga0395900_0001654_22480_22800 105
755 3300037418 Ga0395900_0015985 Ga0395900_0015985_1293_1613 105
756 3300037418 Ga0395900_0343221 Ga0395900_0343221_805_1125 105
757 3300037418 Ga0395900_0460257 Ga0395900_0460257_199_519 105
758 3300037418 Ga0395900_0551353 Ga0395900_0551353_37_357 105
759 3300037466 Ga0395898_0004457 Ga0395898_0004457_9474_9794 105
760 3300037471 Ga0395905_0001805 Ga0395905_0001805_19422_19742 105
761 3300037471 Ga0395905_0044969 Ga0395905_0044969_1184_1504 105
762 3300037471 Ga0395905_0050764 Ga0395905_0050764_833_1153 105
763 3300037471 Ga0395905_0068615 Ga0395905_0068615_339_659 105
764 3300037471 Ga0395905_0082015 Ga0395905_0082015_822_1142 105
765 3300037471 Ga0395905_0158329 Ga0395905_0158329_45_365 105
766 3300037471 Ga0395905_0352281 Ga0395905_0352281_886_1206 105
767 3300037471 Ga0395905_0440016 Ga0395905_0440016_223_543 105
768 3300037471 Ga0395905_0488828 Ga0395905_0488828_483_803 105
769 3300037471 Ga0395905_0592508 Ga0395905_0592508_493_813 105
770 3300037471 Ga0395905_1521906 Ga0395905_1521906_227_547 105
771 3300038443 Ga0395901_0005009 Ga0395901_0005009_6995_7315 105
772 3300038443 Ga0395901_0014323 Ga0395901_0014323_1998_2318 105
773 3300038443 Ga0395901_0134888 Ga0395901_0134888_1870_2190 105
774 3300038443 Ga0395901_0693791 Ga0395901_0693791_296_616 105
775 3300038443 Ga0395901_0796333 Ga0395901_0796333_294_614 105
776 3300038443 Ga0395901_1329930 Ga0395901_1329930_32_352 105
777 3300038705 Ga0237819_00486 Ga0237819_00486_11285_11605 105
778 3300039450 Ga0436363_1059172 Ga0436363_1059172_608_925 105
779 3300041404 Ga0439436_0183483 Ga0439436_0183483_78_398 105
780 3300041405 Ga0439438_057718 Ga0439438_057718_527_847 105
781 3300041406 Ga0439439_0175481 Ga0439439_0175481_73_393 105
782 3300041411 Ga0439466_0145034 Ga0439466_0145034_343_663 105
783 3300041413 Ga0439465_0156535 Ga0439465_0156535_22_342 105
784 3300041413 Ga0439465_0251266 Ga0439465_0251266_120_443 105
785 3300041451 Ga0451791_1790522 Ga0451791_1790522_182_502 105
786 3300041453 Ga0451797_1562310 Ga0451797_1562310_14_334 105
787 3300041460 Ga0451802_1688601 Ga0451802_1688601_152_472 105
788 3300041463 Ga0451804_0932243 Ga0451804_0932243_49_369 105
789 3300041494 Ga0451837_1573589 Ga0451837_1573589_172_492 105
790 3300041999 Ga0439433_0015993 Ga0439433_0015993_539_859 105
791 3300042000 Ga0439437_002305 Ga0439437_002305_329_649 105
792 3300042002 Ga0439442_144684 Ga0439442_144684_133_453 105
793 3300042004 Ga0439445_0002249 Ga0439445_0002249_3263_3583 105
794 3300042006 Ga0439432_029409 Ga0439432_029409_612_932 105
795 3300042006 Ga0439432_094846 Ga0439432_094846_306_626 105
796 3300042006 Ga0439432_148528 Ga0439432_148528_69_389 105
797 3300042007 Ga0439449_0151340 Ga0439449_0151340_202_522 105
798 3300042007 Ga0439449_0180434 Ga0439449_0180434_455_775 105
799 3300042007 Ga0439449_0334257 Ga0439449_0334257_101_421 105
800 3300042007 Ga0439449_0350808 Ga0439449_0350808_113_433 105
801 3300042010 Ga0439452_082101 Ga0439452_082101_302_622 105
802 3300042012 Ga0439455_0070610 Ga0439455_0070610_586_906 105
803 3300042014 Ga0439457_039742 Ga0439457_039742_47_367 105
804 3300042014 Ga0439457_171302 Ga0439457_171302_63_383 105
805 3300042015 Ga0439462_0021174 Ga0439462_0021174_502_822 105
806 3300042015 Ga0439462_0120058 Ga0439462_0120058_144_464 105
807 3300042117 Ga0450913_027735 Ga0450913_027735_34_354 105
808 3300042120 Ga0450917_012615 Ga0450917_012615_123_443 105
809 3300042122 Ga0450920_096264 Ga0450920_096264_92_412 105
810 3300042123 Ga0450921_008959 Ga0450921_008959_485_805 105
811 3300042124 Ga0450922_038535 Ga0450922_038535_42_362 105
812 3300042127 Ga0450890_002421 Ga0450890_002421_1585_1905 105
813 3300042129 Ga0450891_004475 Ga0450891_004475_428_748 105
814 3300042130 Ga0450892_010176 Ga0450892_010176_83_403 105
815 3300042144 Ga0450889_001840 Ga0450889_001840_422_742 105
816 3300042144 Ga0450889_006019 Ga0450889_006019_545_865 105
817 3300042145 Ga0450906_057620 Ga0450906_057620_265_585 105
818 3300042156 Ga0439446_0061998 Ga0439446_0061998_397_717 105
819 3300042156 Ga0439446_0098894 Ga0439446_0098894_222_542 105
820 3300042157 Ga0439458_0046507 Ga0439458_0046507_603_923 105
821 3300042435 Ga0439434_0019308 Ga0439434_0019308_886_1206 105
822 3300042435 Ga0439434_0243697 Ga0439434_0243697_217_537 105
823 3300042436 Ga0439435_0301583 Ga0439435_0301583_147_467 105
824 3300042439 Ga0439464_0032905 Ga0439464_0032905_330_650 105
825 3300042461 Ga0439460_0020435 Ga0439460_0020435_161_481 105
826 3300042530 Ga0450916_020927 Ga0450916_020927_499_819 105
827 3300042531 Ga0450918_009803 Ga0450918_009803_330_650 105
828 3300042532 Ga0450893_0026458 Ga0450893_0026458_15_335 105
829 3300042532 Ga0450893_0064368 Ga0450893_0064368_229_549 105
830 3300042876 Ga0451577_1298692 Ga0451577_1298692_17_337 105
831 3300044656 Ga0466969_0054413 Ga0466969_0054413_925_1245 105
832 3300044684 Ga0466966_0021881 Ga0466966_0021881_541_861 105
833 3300044693 Ga0466961_0411205 Ga0466961_0411205_313_633 105
834 3300044765 Ga0466970_0154144 Ga0466970_0154144_238_558 105
835 3300044765 Ga0466970_0157153 Ga0466970_0157153_21_341 105
836 3300044901 Ga0466960_0042638 Ga0466960_0042638_39_359 105
837 3300044901 Ga0466960_0549996 Ga0466960_0549996_113_433 105
838 3300045049 Ga0466959_0182707 Ga0466959_0182707_490_810 105
839 3300045976 Ga0466967_1994837 Ga0466967_1994837_124_444 105
840 3300046475 Ga0495639_0073520 Ga0495639_0073520_277_597 105
841 3300046492 Ga0495585_0446307 Ga0495585_0446307_68_388 105
842 3300046492 Ga0495585_0548424 Ga0495585_0548424_128_448 105
843 3300046515 Ga0495620_0051440 Ga0495620_0051440_593_913 105
844 3300046515 Ga0495620_0101581 Ga0495620_0101581_500_820 105
845 3300046518 Ga0495631_0406331 Ga0495631_0406331_244_564 105
846 3300046520 Ga0495637_0020520 Ga0495637_0020520_142_462 105
847 3300046522 Ga0495643_0098437 Ga0495643_0098437_926_1246 105
848 3300046523 Ga0495644_0182568 Ga0495644_0182568_148_468 105
849 3300046523 Ga0495644_0313718 Ga0495644_0313718_205_525 105
850 3300046524 Ga0495648_0420692 Ga0495648_0420692_114_434 105
851 3300046525 Ga0495663_0011738 Ga0495663_0011738_888_1208 105
852 3300046525 Ga0495663_0051618 Ga0495663_0051618_387_707 105
853 3300046525 Ga0495663_0086663 Ga0495663_0086663_537_857 105
854 3300046525 Ga0495663_0102635 Ga0495663_0102635_309_629 105
855 3300046525 Ga0495663_0275085 Ga0495663_0275085_238_558 105
856 3300046528 Ga0495642_0006927 Ga0495642_0006927_1019_1339 105
857 3300046537 Ga0495598_0001912 Ga0495598_0001912_2770_3090 105
858 3300046537 Ga0495598_0026244 Ga0495598_0026244_152_472 105
859 3300046537 Ga0495598_0142123 Ga0495598_0142123_180_500 105
860 3300046537 Ga0495598_0263710 Ga0495598_0263710_195_518 105
861 3300046538 Ga0495609_0292440 Ga0495609_0292440_135_455 105
862 3300046539 Ga0495621_0001529 Ga0495621_0001529_3304_3624 105
863 3300046539 Ga0495621_0011525 Ga0495621_0011525_220_540 105
864 3300046539 Ga0495621_0024686 Ga0495621_0024686_369_689 105
865 3300046539 Ga0495621_0195853 Ga0495621_0195853_385_705 105
866 3300046539 Ga0495621_0329202 Ga0495621_0329202_208_531 105
867 3300046558 Ga0495633_0001763 Ga0495633_0001763_8962_9282 105
868 3300046558 Ga0495633_0006943 Ga0495633_0006943_3694_4014 105
869 3300046616 Ga0495668_0010177 Ga0495668_0010177_5212_5532 105
870 3300046616 Ga0495668_0032702 Ga0495668_0032702_1743_2063 105
871 3300046616 Ga0495668_0054103 Ga0495668_0054103_1628_1948 105
872 3300046616 Ga0495668_0635583 Ga0495668_0635583_148_468 105
873 3300046660 Ga0495625_0053293 Ga0495625_0053293_1552_1872 105
874 3300046660 Ga0495625_0533467 Ga0495625_0533467_256_576 105
875 3300046664 Ga0495659_0051088 Ga0495659_0051088_156_476 105
876 3300046664 Ga0495659_0167995 Ga0495659_0167995_178_498 105
877 3300046665 Ga0495661_0229064 Ga0495661_0229064_592_912 105
878 3300046665 Ga0495661_0279995 Ga0495661_0279995_447_767 105
879 3300046681 Ga0495647_0015704 Ga0495647_0015704_1899_2219 105
880 3300046684 Ga0495669_0054353 Ga0495669_0054353_1312_1632 105
881 3300046684 Ga0495669_0059366 Ga0495669_0059366_1397_1717 105
882 3300046684 Ga0495669_0062935 Ga0495669_0062935_199_519 105
883 3300046684 Ga0495669_0138767 Ga0495669_0138767_534_854 105
884 3300046684 Ga0495669_0241253 Ga0495669_0241253_249_569 105
885 3300046691 Ga0495670_0139924 Ga0495670_0139924_279_599 105
886 3300046691 Ga0495670_0663255 Ga0495670_0663255_75_395 105
887 3300046810 Ga0495660_0153059 Ga0495660_0153059_758_1078 105
888 3300047318 Ga0495636_0034127 Ga0495636_0034127_792_1112 105
889 3300047318 Ga0495636_0273544 Ga0495636_0273544_374_694 105
890 3300047320 Ga0495672_0137127 Ga0495672_0137127_497_817 105
891 3300047323 Ga0495683_0316836 Ga0495683_0316836_119_439 105
892 3300047445 Ga0495677_0032597 Ga0495677_0032597_416_736 105
893 3300047445 Ga0495677_0410523 Ga0495677_0410523_194_514 105
894 3300047470 Ga0495681_0113591 Ga0495681_0113591_158_478 105
895 3300048091 Ga0495626_0277920 Ga0495626_0277920_206_526 105
896 3300048903 Ga0496100_1009858 Ga0496100_1009858_272_592 105
897 3300048904 Ga0496101_0105642 Ga0496101_0105642_1506_1826 105
898 3300048904 Ga0496101_1053437 Ga0496101_1053437_262_582 105
899 3300048905 Ga0496102_0073258 Ga0496102_0073258_1698_2018 105
900 3300048905 Ga0496102_1195712 Ga0496102_1195712_324_644 105
901 3300048906 Ga0496103_0099525 Ga0496103_0099525_1367_1687 105
902 3300048909 Ga0496106_0610295 Ga0496106_0610295_285_605 105
903 3300048910 Ga0496107_0017654 Ga0496107_0017654_3299_3619 105
904 3300048912 Ga0496109_0273399 Ga0496109_0273399_228_548 105
905 3300048912 Ga0496109_0572791 Ga0496109_0572791_585_905 105
906 3300048913 Ga0496110_0017526 Ga0496110_0017526_116_436 105
907 3300048914 Ga0496111_0488148 Ga0496111_0488148_332_652 105
908 3300048914 Ga0496111_0517612 Ga0496111_0517612_269_589 105
909 3300048915 Ga0496112_0183306 Ga0496112_0183306_1382_1702 105
910 3300048917 Ga0496114_0029773 Ga0496114_0029773_432_752 105
911 3300048918 Ga0496115_0076021 Ga0496115_0076021_2048_2368 105
912 3300049127 Ga0501306_043570 Ga0501306_043570_184_504 105
913 3300049127 Ga0501306_052369 Ga0501306_052369_295_615 105
914 3300049128 Ga0501308_007173 Ga0501308_007173_823_1143 105
915 3300049128 Ga0501308_028918 Ga0501308_028918_370_690 105
916 3300049128 Ga0501308_081980 Ga0501308_081980_35_355 105
917 3300049129 Ga0501309_011894 Ga0501309_011894_743_1063 105
918 3300049129 Ga0501309_029350 Ga0501309_029350_448_768 105
919 3300049161 Ga0501305_036942 Ga0501305_036942_305_625 105
920 3300049162 Ga0501307_078880 Ga0501307_078880_57_377 105
921 3300049519 Ga0501296_052740 Ga0501296_052740_34_354 105
922 3300049527 Ga0501311_006508 Ga0501311_006508_459_779 105
923 3300049528 Ga0501312_019954 Ga0501312_019954_38_358 105
924 3300049528 Ga0501312_021406 Ga0501312_021406_163_483 105
925 3300049528 Ga0501312_114104 Ga0501312_114104_55_375 105
926 3300049529 Ga0501313_006405 Ga0501313_006405_759_1079 105
927 3300049530 Ga0501314_017158 Ga0501314_017158_16_336 105
928 3300049531 Ga0501315_082851 Ga0501315_082851_184_504 105
929 3300049532 Ga0501316_046553 Ga0501316_046553_269_589 105
930 3300049533 Ga0501317_008465 Ga0501317_008465_247_567 105
931 3300049536 Ga0501320_033315 Ga0501320_033315_235_555 105
932 3300049538 Ga0501322_001181 Ga0501322_001181_341_661 105
933 3300049540 Ga0501324_006512 Ga0501324_006512_392_712 105
934 3300049552 Ga0501336_000759 Ga0501336_000759_492_812 105
935 3300049574 Ga0501038_1366848 Ga0501038_1366848_179_499 105
936 3300049575 Ga0501039_0917407 Ga0501039_0917407_199_519 105
937 3300049577 Ga0501041_0307832 Ga0501041_0307832_216_536 105
938 3300049578 Ga0501042_0277754 Ga0501042_0277754_727_1047 105
939 3300049578 Ga0501042_1128401 Ga0501042_1128401_134_454 105
940 3300049583 Ga0501067_0138597 Ga0501067_0138597_891_1211 105
941 3300049585 Ga0501069_0077653 Ga0501069_0077653_940_1260 105
942 3300049585 Ga0501069_0378964 Ga0501069_0378964_394_714 105
943 3300049587 Ga0501071_0347988 Ga0501071_0347988_418_738 105
944 3300049587 Ga0501071_0763467 Ga0501071_0763467_128_448 105
945 3300049652 Ga0501202_119011 Ga0501202_119011_235_555 105
946 3300049654 Ga0501207_137258 Ga0501207_137258_55_375 105
947 3300049661 Ga0501217_180279 Ga0501217_180279_135_455 105
948 3300049665 Ga0501227_023780 Ga0501227_023780_875_1195 105
949 3300049669 Ga0501235_007961 Ga0501235_007961_277_597 105
950 3300049671 Ga0501238_018422 Ga0501238_018422_510_830 105
951 3300049674 Ga0501242_079603 Ga0501242_079603_167_487 105
952 3300049675 Ga0501243_004591 Ga0501243_004591_1079_1399 105
953 3300049677 Ga0501247_025857 Ga0501247_025857_277_597 105
954 3300049679 Ga0501249_035773 Ga0501249_035773_538_861 105
955 3300049679 Ga0501249_152099 Ga0501249_152099_138_458 105
956 3300049682 Ga0501252_084100 Ga0501252_084100_135_455 105
957 3300049683 Ga0501253_060926 Ga0501253_060926_292_612 105
958 3300049687 Ga0501258_008068 Ga0501258_008068_192_512 105
959 3300049687 Ga0501258_030401 Ga0501258_030401_184_504 105
960 3300049708 Ga0501245_100939 Ga0501245_100939_34_354 105
961 3300049757 Ga0501232_026318 Ga0501232_026318_443_763 105
962 3300049759 Ga0501262_050043 Ga0501262_050043_190_510 105
963 3300049764 Ga0501267_001469 Ga0501267_001469_709_1029 105
964 3300049765 Ga0501268_001854 Ga0501268_001854_89_409 105
965 3300049765 Ga0501268_002791 Ga0501268_002791_1701_2021 105
966 3300049765 Ga0501268_100512 Ga0501268_100512_255_575 105
967 3300049765 Ga0501268_123907 Ga0501268_123907_100_420 105
968 3300049767 Ga0501270_025070 Ga0501270_025070_488_808 105
969 3300049768 Ga0501271_008700 Ga0501271_008700_463_783 105
970 3300049769 Ga0501272_005184 Ga0501272_005184_845_1165 105
971 3300049769 Ga0501272_054087 Ga0501272_054087_158_478 105
972 3300049770 Ga0501273_018923 Ga0501273_018923_41_361 105
973 3300049770 Ga0501273_022962 Ga0501273_022962_457_780 105
974 3300049772 Ga0501275_088441 Ga0501275_088441_11_331 105
975 3300049775 Ga0501279_007329 Ga0501279_007329_496_816 105
976 3300049822 Ga0501035_0732855 Ga0501035_0732855_217_537 105
977 3300049823 Ga0501044_0037302 Ga0501044_0037302_629_949 105
978 3300049824 Ga0501045_1367344 Ga0501045_1367344_11_331 105
979 3300049851 Ga0501212_020814 Ga0501212_020814_70_390 105
980 3300050492 nmdc:mga0yw44_459926_c1 nmdc:mga0yw44_459926_c1_148_471 105
981 3300050493 nmdc:mga0k408_299190_c1 nmdc:mga0k408_299190_c1_45_365 105
982 3300050496 nmdc:mga07m45_828407_c1 nmdc:mga07m45_828407_c1_10_330 105
983 3300050507 nmdc:mga05p37_239566_c1 nmdc:mga05p37_239566_c1_1498_1818 105
984 3300050508 nmdc:mga09592_404177_c1 nmdc:mga09592_404177_c1_182_502 105
985 3300050508 nmdc:mga09592_781511_c1 nmdc:mga09592_781511_c1_241_561 105
986 3300050509 nmdc:mga0qj67_1389098_c1 nmdc:mga0qj67_1389098_c1_146_466 105
987 3300050510 nmdc:mga06r32_830292_c1 nmdc:mga06r32_830292_c1_418_738 105
988 3300050511 nmdc:mga08y16_132375_c1 nmdc:mga08y16_132375_c1_1217_1534 105
989 3300050511 nmdc:mga08y16_1608448_c1 nmdc:mga08y16_1608448_c1_22_342 105
990 3300050511 nmdc:mga08y16_41479_c1 nmdc:mga08y16_41479_c1_2867_3187 105
991 3300050512 nmdc:mga0n895_460363_c1 nmdc:mga0n895_460363_c1_916_1236 105
992 3300050513 nmdc:mga0rr50_264675_c1 nmdc:mga0rr50_264675_c1_973_1293 105
993 3300053091 Ga0500647_0106045 Ga0500647_0106045_897_1217 105
994 3300053093 Ga0500651_0120654 Ga0500651_0120654_976_1296 105
995 3300053125 Ga0500618_088286 Ga0500618_088286_209_529 105
996 3300053130 Ga0500642_0283850 Ga0500642_0283850_260_580 105
997 3300053133 Ga0500655_000265 Ga0500655_000265_10362_10682 105
998 3300053134 Ga0500658_0000023 Ga0500658_0000023_67258_67578 105
999 3300053134 Ga0500658_0037508 Ga0500658_0037508_1574_1894 105
1000 3300053148 Ga0500590_015132 Ga0500590_015132_919_1239 105
1001 3300053156 Ga0500622_0124956 Ga0500622_0124956_183_503 105
1002 3300053163 Ga0500639_106017 Ga0500639_106017_186_506 105
1003 3300053177 Ga0500636_0211402 Ga0500636_0211402_471_791 105
1004 3300053724 Ga0500570_047027 Ga0500570_047027_1062_1382 105
1005 3300059421 Ga0590071_048015 Ga0590071_048015_355_675 105
1006 3300059421 Ga0590071_147793 Ga0590071_147793_119_439 105
1007 3300059423 Ga0590074_058671 Ga0590074_058671_212_532 105
1008 3300059423 Ga0590074_076986 Ga0590074_076986_12_332 105
1009 3300059512 Ga0587092_056635 Ga0587092_056635_384_704 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

8

39

0.97

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

41

103

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9213 5 72
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.9199 5 103
6ddg-assembly1.cif.gz_G structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.9118 5 103
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.9101 4 103
8cgv-assembly1.cif.gz_t tiamulin bound to the 50s subunit 0.9055 5 103
ID Description Score Start End Superfamily
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9119 5 101 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9001 4 100 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8998 5 101 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8993 5 101 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8965 5 101 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A498IIN3-F1-model_v4 Protein kinase domain-containing protein 0.9376 5 105 GO:0003723
GO:0003735
GO:0004672
GO:0005524
GO:0005840
GO:0006412
GO:0016020
GO:1990904
AF-A0A812J439-F1-model_v4 Large ribosomal subunit protein uL24c 0.9314 5 102 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2H0VBG5-F1-model_v4 Large ribosomal subunit protein uL24 0.9258 4 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0G1V3V8-F1-model_v4 Large ribosomal subunit protein uL24 0.9236 4 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-T0HKV9-F1-model_v4 Large ribosomal subunit protein uL24 0.9225 4 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
87.39 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map