F488041

General Info

Members Datasets Scaffolds Average Seq Length
1007 424 2014 161

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1311778|Ga0436365_1311778_8997_9476
Length 159
Sequence MKRNAVYPGTFDPITNGHQDLVRRAAGIFDRVIVAIAANPYKAPLFPLAKRVELARGVLADLPNVEVQGYDGLTVDFARRYSAVIVRGLRAVSDFEFEFQLANMSRHLDREFETVFLTPQEQFTFISSTLVREIAVLGGDVREFVHPLVEAELKKHRRP

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
179 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
180 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
200 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
243 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
244 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
245 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
246 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
247 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
248 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
249 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
250 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
251 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
252 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
253 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
254 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
255 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
256 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
257 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
260 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
261 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
262 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
263 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
264 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
265 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
266 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
267 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
268 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
269 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
270 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
275 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
276 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
295 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
296 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
307 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
308 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
318 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
319 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
320 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
323 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
324 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
325 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
330 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
379 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
380 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
381 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
382 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
383 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
384 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
388 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
398 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
399 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
400 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
401 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
402 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
403 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
404 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
405 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
406 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
407 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
410 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
411 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
412 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
413 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
414 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
415 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
416 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
417 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
418 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
419 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
420 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
423 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.08
Nodule 0
Rhizoplane 4.47
Rhizosphere 86.1
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1311778 3300039437 Bacteria 9617
2 Ga0070676_10059641 3300005328 Bacteria 2264
3 Ga0070683_100018504 3300005329 Bacteria 6172
4 Ga0070690_100032408 3300005330 Bacteria 3264
5 Ga0070690_100272676 3300005330 Bacteria 1204
6 Ga0070690_100538125 3300005330 Bacteria 879
7 Ga0070670_100034693 3300005331 Bacteria 4342
8 Ga0070670_100330055 3300005331 Bacteria 1338
9 Ga0070677_10049724 3300005333 Bacteria 1690
10 Ga0070677_10189239 3300005333 Bacteria 985
11 Ga0068869_100109697 3300005334 Bacteria 2098
12 Ga0068869_100133696 3300005334 Bacteria 1909
13 Ga0068869_100401934 3300005334 Bacteria 1127
14 Ga0068869_101207920 3300005334 Bacteria 665
15 Ga0070666_10020519 3300005335 Bacteria 4272
16 Ga0070666_10640677 3300005335 Bacteria 777
17 Ga0070666_11233348 3300005335 Bacteria 557
18 Ga0070680_100000968 3300005336 Bacteria 20318
19 Ga0070680_100023132 3300005336 Bacteria 4954
20 Ga0070680_100773082 3300005336 Bacteria 827
21 Ga0070682_100061248 3300005337 Bacteria 2382
22 Ga0070682_100066875 3300005337 Bacteria 2288
23 Ga0070682_100431172 3300005337 Bacteria 1004
24 Ga0068868_100485231 3300005338 Bacteria 1080
25 Ga0070689_100003519 3300005340 Bacteria 10415
26 Ga0070689_100104945 3300005340 Bacteria 2241
27 Ga0070691_10232450 3300005341 Bacteria 982
28 Ga0070661_101230832 3300005344 Bacteria 627
29 Ga0070661_101439008 3300005344 Bacteria 580
30 Ga0070668_100380040 3300005347 Bacteria 1202
31 Ga0070668_100602234 3300005347 Bacteria 961
32 Ga0070669_100183600 3300005353 Bacteria 1638
33 Ga0070669_100334463 3300005353 Bacteria 1226
34 Ga0070675_100004710 3300005354 Bacteria 10413
35 Ga0070675_100438038 3300005354 Bacteria 1171
36 Ga0070675_100709863 3300005354 Bacteria 916
37 Ga0070675_100753352 3300005354 Bacteria 889
38 Ga0070671_100088963 3300005355 Bacteria 2584
39 Ga0070671_100201924 3300005355 Bacteria 1686
40 Ga0070671_100567660 3300005355 Bacteria 979
41 Ga0070674_100031373 3300005356 Bacteria 3521
42 Ga0070674_100041631 3300005356 Bacteria 3115
43 Ga0070674_100196063 3300005356 Bacteria 1556
44 Ga0070673_100059868 3300005364 Bacteria 3016
45 Ga0070673_100104718 3300005364 Bacteria 2337
46 Ga0070673_100566882 3300005364 Bacteria 1033
47 Ga0070673_101206812 3300005364 Bacteria 709
48 Ga0070659_100181683 3300005366 Bacteria 1727
49 Ga0070667_100005254 3300005367 Bacteria 10827
50 Ga0070667_100041203 3300005367 Bacteria 3874
51 Ga0070667_100483489 3300005367 Bacteria 1134
52 Ga0070709_10397554 3300005434 Bacteria 1028
53 Ga0070709_10795717 3300005434 Bacteria 742
54 Ga0070713_100008265 3300005436 Bacteria 7377
55 Ga0070713_100063685 3300005436 Bacteria 3093
56 Ga0070713_100074838 3300005436 Bacteria 2870
57 Ga0070713_100206967 3300005436 Bacteria 1774
58 Ga0070713_100952283 3300005436 Bacteria 827
59 Ga0070710_10048728 3300005437 Bacteria 2367
60 Ga0070701_10039868 3300005438 Bacteria 2385
61 Ga0070711_100015720 3300005439 Bacteria 4792
62 Ga0070711_100031371 3300005439 Bacteria 3528
63 Ga0070711_100310571 3300005439 Bacteria 1257
64 Ga0070705_100385418 3300005440 Bacteria 1033
65 Ga0070705_100852803 3300005440 Bacteria 729
66 Ga0070700_100039274 3300005441 Bacteria 2890
67 Ga0070700_100042098 3300005441 Bacteria 2803
68 Ga0070700_100376932 3300005441 Bacteria 1060
69 Ga0070700_101495909 3300005441 Bacteria 574
70 Ga0070694_100199770 3300005444 Bacteria 1490
71 Ga0070663_100472475 3300005455 Bacteria 1037
72 Ga0070663_100889462 3300005455 Bacteria 769
73 Ga0070663_101106769 3300005455 Bacteria 693
74 Ga0070678_100097616 3300005456 Bacteria 2269
75 Ga0070678_100131843 3300005456 Bacteria 1987
76 Ga0070662_100164274 3300005457 Bacteria 1739
77 Ga0070662_100869756 3300005457 Bacteria 768
78 Ga0070681_10003465 3300005458 Bacteria 14778
79 Ga0070681_10005119 3300005458 Bacteria 12655
80 Ga0070681_10026451 3300005458 Bacteria 5830
81 Ga0070681_10057408 3300005458 Bacteria 3872
82 Ga0070681_10081733 3300005458 Bacteria 3187
83 Ga0070681_10212956 3300005458 Bacteria 1848
84 Ga0070681_10319999 3300005458 Bacteria 1461
85 Ga0070681_10496755 3300005458 Bacteria 1133
86 Ga0070681_11080631 3300005458 Bacteria 723
87 Ga0068867_100066038 3300005459 Bacteria 2694
88 Ga0068867_100147690 3300005459 Bacteria 1844
89 Ga0070685_10166632 3300005466 Bacteria 1409
90 Ga0070699_100133771 3300005518 Bacteria 2187
91 Ga0070679_100026143 3300005530 Bacteria 5731
92 Ga0070679_100071807 3300005530 Bacteria 3453
93 Ga0070679_100079665 3300005530 Bacteria 3265
94 Ga0070679_100133960 3300005530 Bacteria 2459
95 Ga0070679_100214429 3300005530 Bacteria 1888
96 Ga0070679_100263589 3300005530 Bacteria 1678
97 Ga0070679_100267623 3300005530 Bacteria 1664
98 Ga0070684_100063122 3300005535 Bacteria 3246
99 Ga0068853_100318914 3300005539 Bacteria 1440
100 Ga0068853_100636393 3300005539 Bacteria 1014
101 Ga0070672_100018864 3300005543 Bacteria 4996
102 Ga0070672_100138828 3300005543 Bacteria 2003
103 Ga0070686_100040720 3300005544 Bacteria 2900
104 Ga0070686_100075511 3300005544 Bacteria 2217
105 Ga0070686_100240435 3300005544 Bacteria 1318
106 Ga0070686_100458541 3300005544 Bacteria 981
107 Ga0070686_100519385 3300005544 Bacteria 927
108 Ga0070695_100095346 3300005545 Bacteria 1994
109 Ga0070695_100156284 3300005545 Bacteria 1596
110 Ga0070696_100011512 3300005546 Bacteria 5925
111 Ga0070696_100096560 3300005546 Bacteria 2112
112 Ga0070696_100215163 3300005546 Bacteria 1440
113 Ga0070696_100300554 3300005546 Bacteria 1229
114 Ga0070693_100197309 3300005547 Bacteria 1305
115 Ga0070693_100454102 3300005547 Bacteria 900
116 Ga0070665_100001792 3300005548 Bacteria 24413
117 Ga0070665_100006525 3300005548 Bacteria 11856
118 Ga0070665_100014256 3300005548 Bacteria 7982
119 Ga0070665_100017976 3300005548 Bacteria 7099
120 Ga0070665_100030686 3300005548 Bacteria 5408
121 Ga0070665_100049788 3300005548 Bacteria 4204
122 Ga0070665_100107726 3300005548 Bacteria 2789
123 Ga0070665_100647534 3300005548 Bacteria 1070
124 Ga0070665_100666866 3300005548 Bacteria 1053
125 Ga0070704_100207122 3300005549 Bacteria 1587
126 Ga0068855_100004111 3300005563 Bacteria 17752
127 Ga0068855_100007561 3300005563 Bacteria 13146
128 Ga0068855_100010659 3300005563 Bacteria 11087
129 Ga0068855_100052155 3300005563 Bacteria 4816
130 Ga0068855_100311930 3300005563 Bacteria 1740
131 Ga0070664_100021561 3300005564 Bacteria 5312
132 Ga0068857_100151222 3300005577 Bacteria 2103
133 Ga0068857_100456434 3300005577 Bacteria 1195
134 Ga0068854_100139110 3300005578 Bacteria 1861
135 Ga0068854_100521584 3300005578 Bacteria 1004
136 Ga0068856_100214570 3300005614 Bacteria 1940
137 Ga0068856_100266115 3300005614 Bacteria 1730
138 Ga0068856_100448067 3300005614 Bacteria 1311
139 Ga0068856_100464880 3300005614 Unclassified 1286
140 Ga0070702_100054766 3300005615 Bacteria 2296
141 Ga0068852_100617935 3300005616 Bacteria 1089
142 Ga0068859_100004119 3300005617 Bacteria 14828
143 Ga0068859_100198070 3300005617 Bacteria 2093
144 Ga0068859_100327927 3300005617 Bacteria 1625
145 Ga0068859_100430338 3300005617 Bacteria 1416
146 Ga0068859_100749426 3300005617 Bacteria 1066
147 Ga0068864_100012721 3300005618 Bacteria 6956
148 Ga0068866_10316910 3300005718 Bacteria 979
149 Ga0068861_100003440 3300005719 Bacteria 10510
150 Ga0068861_100004932 3300005719 Bacteria 8987
151 Ga0068861_100107896 3300005719 Bacteria 2226
152 Ga0068861_100178295 3300005719 Bacteria 1766
153 Ga0068861_100219749 3300005719 Bacteria 1605
154 Ga0068861_100229941 3300005719 Bacteria 1572
155 Ga0068861_100406858 3300005719 Bacteria 1209
156 Ga0068861_100893147 3300005719 Bacteria 841
157 Ga0068861_100912073 3300005719 Bacteria 833
158 Ga0068851_10190025 3300005834 Bacteria 1141
159 Ga0068870_10002932 3300005840 Bacteria 7187
160 Ga0068870_10424075 3300005840 Bacteria 871
161 Ga0068863_100001602 3300005841 Bacteria 22360
162 Ga0068863_100042144 3300005841 Bacteria 4337
163 Ga0068863_100196967 3300005841 Bacteria 1936
164 Ga0068863_100444362 3300005841 Bacteria 1272
165 Ga0068863_100623449 3300005841 Bacteria 1068
166 Ga0068863_101417686 3300005841 Bacteria 702
167 Ga0068858_100001047 3300005842 Bacteria 28582
168 Ga0068858_100003727 3300005842 Bacteria 15080
169 Ga0068858_100111814 3300005842 Bacteria 2551
170 Ga0068858_100246291 3300005842 Bacteria 1697
171 Ga0068858_100247977 3300005842 Bacteria 1691
172 Ga0068858_100267048 3300005842 Bacteria 1627
173 Ga0068860_100011257 3300005843 Bacteria 8815
174 Ga0068860_100080596 3300005843 Bacteria 3095
175 Ga0068860_100111333 3300005843 Bacteria 2617
176 Ga0068860_100264615 3300005843 Bacteria 1677
177 Ga0068860_101121708 3300005843 Bacteria 806
178 Ga0068862_100035494 3300005844 Bacteria 4223
179 Ga0068862_100073411 3300005844 Bacteria 2956
180 Ga0068862_100165484 3300005844 Bacteria 1977
181 Ga0068862_100578320 3300005844 Bacteria 1076
182 Ga0068862_101222130 3300005844 Bacteria 750
183 Ga0068862_101369490 3300005844 Bacteria 710
184 Ga0081455_10000812 3300005937 Bacteria 40224
185 Ga0081455_10004966 3300005937 Bacteria 14710
186 Ga0081539_10000007 3300005985 Bacteria 532790
187 Ga0070717_10067689 3300006028 Bacteria 2971
188 Ga0070715_10212742 3300006163 Bacteria 989
189 Ga0070715_10458577 3300006163 Bacteria 721
190 Ga0070716_100022541 3300006173 Bacteria 3330
191 Ga0070712_100085564 3300006175 Bacteria 2295
192 Ga0070712_100138588 3300006175 Bacteria 1853
193 Ga0097621_100024793 3300006237 Bacteria 4688
194 Ga0097621_100040528 3300006237 Bacteria 3745
195 Ga0097621_100103993 3300006237 Bacteria 2392
196 Ga0097621_100333498 3300006237 Bacteria 1346
197 Ga0097621_100375570 3300006237 Bacteria 1269
198 Ga0097621_100495507 3300006237 Bacteria 1106
199 Ga0097621_101058680 3300006237 Bacteria 760
200 Ga0097621_101187880 3300006237 Bacteria 718
201 Ga0068871_100013848 3300006358 Bacteria 5996
202 Ga0068871_100043523 3300006358 Bacteria 3607
203 Ga0068871_100141596 3300006358 Bacteria 2045
204 Ga0068871_100182633 3300006358 Bacteria 1803
205 Ga0068871_100428187 3300006358 Bacteria 1183
206 Ga0075428_100002675 3300006844 Bacteria 19362
207 Ga0075428_101101009 3300006844 Bacteria 839
208 Ga0075434_100206819 3300006871 Bacteria 1983
209 Ga0075429_100242266 3300006880 Bacteria 1579
210 Ga0075429_100687881 3300006880 Bacteria 896
211 Ga0068865_100110615 3300006881 Bacteria 2026
212 Ga0075436_100208625 3300006914 Bacteria 1385
213 Ga0097620_100004119 3300006931 Bacteria 14828
214 Ga0097620_100198067 3300006931 Bacteria 2093
215 Ga0097620_100327935 3300006931 Bacteria 1625
216 Ga0097620_100430277 3300006931 Bacteria 1416
217 Ga0097620_100749424 3300006931 Bacteria 1066
218 Ga0097620_100792301 3300006931 Bacteria 1036
219 Ga0099794_10085604 3300007265 Bacteria 1560
220 Ga0099795_10004148 3300007788 Bacteria 3702
221 Ga0099795_10068942 3300007788 Bacteria 1330
222 Ga0105240_10001173 3300009093 Bacteria 45933
223 Ga0105240_10008995 3300009093 Bacteria 14193
224 Ga0105240_10019130 3300009093 Bacteria 9157
225 Ga0105240_10064942 3300009093 Bacteria 4532
226 Ga0105240_10069156 3300009093 Bacteria 4371
227 Ga0105240_10108677 3300009093 Bacteria 3360
228 Ga0105240_10127100 3300009093 Bacteria 3062
229 Ga0105240_10200507 3300009093 Bacteria 2339
230 Ga0105240_10283278 3300009093 Bacteria 1903
231 Ga0105240_10303733 3300009093 Bacteria 1825
232 Ga0105240_10500134 3300009093 Bacteria 1352
233 Ga0105240_11746776 3300009093 Bacteria 649
234 Ga0111539_10005694 3300009094 Bacteria 16121
235 Ga0111539_10060190 3300009094 Bacteria 4500
236 Ga0111539_10615883 3300009094 Bacteria 1264
237 Ga0105245_10075271 3300009098 Bacteria 3073
238 Ga0105245_11337731 3300009098 Bacteria 766
239 Ga0105247_10000233 3300009101 Bacteria 52855
240 Ga0105247_10012403 3300009101 Bacteria 5118
241 Ga0105247_10202682 3300009101 Bacteria 1334
242 Ga0105247_11056090 3300009101 Bacteria 638
243 Ga0114129_10104189 3300009147 Bacteria 3920
244 Ga0105243_11809056 3300009148 Bacteria 642
245 Ga0105241_10429656 3300009174 Bacteria 1164
246 Ga0105241_10513062 3300009174 Bacteria 1071
247 Ga0105241_10757611 3300009174 Bacteria 891
248 Ga0105242_10010801 3300009176 Bacteria 7012
249 Ga0105242_10213676 3300009176 Bacteria 1720
250 Ga0105242_10365787 3300009176 Bacteria 1336
251 Ga0105242_10520623 3300009176 Bacteria 1135
252 Ga0105242_11079691 3300009176 Bacteria 815
253 Ga0105248_10005023 3300009177 Bacteria 14608
254 Ga0105248_10440185 3300009177 Bacteria 1468
255 Ga0105248_11538174 3300009177 Unclassified 753
256 Ga0105237_10064865 3300009545 Bacteria 3648
257 Ga0105237_10074879 3300009545 Bacteria 3377
258 Ga0105237_10135041 3300009545 Bacteria 2461
259 Ga0105237_10301187 3300009545 Bacteria 1606
260 Ga0105237_10346105 3300009545 Bacteria 1491
261 Ga0105238_10002316 3300009551 Bacteria 19144
262 Ga0105238_10019715 3300009551 Bacteria 6868
263 Ga0105238_10055950 3300009551 Bacteria 3958
264 Ga0105238_10113117 3300009551 Bacteria 2694
265 Ga0105238_10141644 3300009551 Bacteria 2381
266 Ga0105238_10227427 3300009551 Bacteria 1842
267 Ga0105238_10255452 3300009551 Bacteria 1732
268 Ga0105238_10580757 3300009551 Bacteria 1127
269 Ga0105249_10086181 3300009553 Bacteria 2929
270 Ga0105249_10095526 3300009553 Bacteria 2787
271 Ga0105249_10421450 3300009553 Bacteria 1369
272 Ga0105249_10475595 3300009553 Bacteria 1291
273 Ga0105249_10660702 3300009553 Bacteria 1103
274 Ga0105030_107969 3300009987 Bacteria 899
275 Ga0099796_10006870 3300010159 Bacteria 2940
276 Ga0105239_10373422 3300010375 Bacteria 1612
277 Ga0105239_10611511 3300010375 Bacteria 1243
278 Ga0105239_10692038 3300010375 Bacteria 1165
279 Ga0105239_11128953 3300010375 Bacteria 903
280 Ga0105246_11138257 3300011119 Bacteria 715
281 Ga0157370_10001000 3300013104 Bacteria 35671
282 Ga0157370_10769347 3300013104 Bacteria 877
283 Ga0157370_11166648 3300013104 Bacteria 695
284 Ga0157369_10012063 3300013105 Bacteria 9815
285 Ga0157369_10267051 3300013105 Bacteria 1784
286 Ga0157369_10364086 3300013105 Bacteria 1501
287 Ga0157369_10810287 3300013105 Bacteria 962
288 Ga0157369_10972713 3300013105 Bacteria 869
289 Ga0157369_11277983 3300013105 Bacteria 748
290 Ga0157374_10238699 3300013296 Bacteria 1787
291 Ga0157374_10416706 3300013296 Bacteria 1341
292 Ga0157374_10517772 3300013296 Bacteria 1198
293 Ga0157378_10040872 3300013297 Bacteria 4113
294 Ga0157378_10054988 3300013297 Bacteria 3545
295 Ga0163162_10107404 3300013306 Bacteria 2886
296 Ga0163162_10163682 3300013306 Bacteria 2347
297 Ga0163162_11059411 3300013306 Bacteria 918
298 Ga0157372_10061340 3300013307 Bacteria 4210
299 Ga0157372_10172800 3300013307 Bacteria 2500
300 Ga0157372_10641194 3300013307 Bacteria 1237
301 Ga0157372_10715392 3300013307 Bacteria 1165
302 Ga0157372_11193860 3300013307 Bacteria 879
303 Ga0157375_10006160 3300013308 Bacteria 10452
304 Ga0157375_10144830 3300013308 Bacteria 2506
305 Ga0163163_10062321 3300014325 Bacteria 3695
306 Ga0163163_10094096 3300014325 Bacteria 3014
307 Ga0163163_10098153 3300014325 Bacteria 2950
308 Ga0163163_10110396 3300014325 Bacteria 2778
309 Ga0163163_10271030 3300014325 Bacteria 1749
310 Ga0163163_10362033 3300014325 Bacteria 1507
311 Ga0163163_10447644 3300014325 Bacteria 1351
312 Ga0163163_10747810 3300014325 Bacteria 1041
313 Ga0157380_10006488 3300014326 Bacteria 8246
314 Ga0157380_10018385 3300014326 Bacteria 5186
315 Ga0157380_10019445 3300014326 Bacteria 5061
316 Ga0157380_10029531 3300014326 Bacteria 4190
317 Ga0157380_10034435 3300014326 Bacteria 3907
318 Ga0157380_10048541 3300014326 Bacteria 3344
319 Ga0157380_10113939 3300014326 Bacteria 2278
320 Ga0157380_10270079 3300014326 Bacteria 1550
321 Ga0157377_10184017 3300014745 Bacteria 1316
322 Ga0157379_10023361 3300014968 Bacteria 5486
323 Ga0157379_10054291 3300014968 Bacteria 3580
324 Ga0157379_10054721 3300014968 Bacteria 3565
325 Ga0157379_10129068 3300014968 Bacteria 2275
326 Ga0157379_10191037 3300014968 Unclassified 1850
327 Ga0157379_10752390 3300014968 Bacteria 917
328 Ga0157379_10898289 3300014968 Bacteria 840
329 Ga0157379_11064911 3300014968 Unclassified 773
330 Ga0157376_10042389 3300014969 Bacteria 3730
331 Ga0157376_10285966 3300014969 Bacteria 1555
332 Ga0157376_10367887 3300014969 Bacteria 1381
333 Ga0157376_11239439 3300014969 Bacteria 775
334 Ga0157376_12215256 3300014969 Bacteria 588
335 Ga0197907_10910721 3300020069 Bacteria 999
336 Ga0213872_10170418 3300021361 Bacteria 944
337 Ga0213874_10028837 3300021377 Bacteria 1588
338 Ga0213874_10079968 3300021377 Bacteria 1057
339 Ga0213874_10217635 3300021377 Bacteria 693
340 Ga0213876_10085012 3300021384 Bacteria 1674
341 Ga0213876_10209494 3300021384 Bacteria 1036
342 Ga0224712_10631440 3300022467 Unclassified 524
343 Ga0228598_1028368 3300024227 Bacteria 1101
344 Ga0207656_10241780 3300025321 Bacteria 882
345 Ga0207682_10003313 3300025893 Bacteria 7031
346 Ga0207682_10005611 3300025893 Bacteria 5103
347 Ga0207682_10379223 3300025893 Bacteria 667
348 Ga0207692_10379710 3300025898 Bacteria 877
349 Ga0207642_10055749 3300025899 Bacteria 1810
350 Ga0207642_10380908 3300025899 Bacteria 839
351 Ga0207642_10502936 3300025899 Bacteria 742
352 Ga0207710_10000201 3300025900 Bacteria 55939
353 Ga0207680_10247279 3300025903 Bacteria 1231
354 Ga0207680_10760287 3300025903 Bacteria 695
355 Ga0207685_10121858 3300025905 Bacteria 1146
356 Ga0207685_10142182 3300025905 Bacteria 1077
357 Ga0207685_10352875 3300025905 Bacteria 742
358 Ga0207699_10029870 3300025906 Bacteria 3044
359 Ga0207699_10034043 3300025906 Bacteria 2885
360 Ga0207699_10769382 3300025906 Bacteria 707
361 Ga0207699_10825005 3300025906 Bacteria 682
362 Ga0207699_10870939 3300025906 Bacteria 664
363 Ga0207645_10181840 3300025907 Bacteria 1379
364 Ga0207643_10011260 3300025908 Bacteria 4830
365 Ga0207643_10133989 3300025908 Bacteria 1476
366 Ga0207707_10002563 3300025912 Bacteria 16290
367 Ga0207707_10005125 3300025912 Bacteria 11488
368 Ga0207707_10034584 3300025912 Bacteria 4421
369 Ga0207707_10094049 3300025912 Bacteria 2619
370 Ga0207707_10188602 3300025912 Bacteria 1799
371 Ga0207707_10397706 3300025912 Bacteria 1183
372 Ga0207695_10008576 3300025913 Bacteria 12773
373 Ga0207695_10083482 3300025913 Bacteria 3227
374 Ga0207695_10119723 3300025913 Bacteria 2602
375 Ga0207695_10167856 3300025913 Bacteria 2122
376 Ga0207695_10297350 3300025913 Bacteria 1506
377 Ga0207695_10363688 3300025913 Bacteria 1333
378 Ga0207695_10589630 3300025913 Bacteria 993
379 Ga0207695_10985401 3300025913 Unclassified 723
380 Ga0207671_10125028 3300025914 Bacteria 1969
381 Ga0207671_10162008 3300025914 Bacteria 1733
382 Ga0207671_10268227 3300025914 Bacteria 1344
383 Ga0207693_10000504 3300025915 Bacteria 35283
384 Ga0207693_10085140 3300025915 Bacteria 2477
385 Ga0207663_10095173 3300025916 Bacteria 1986
386 Ga0207663_10262273 3300025916 Bacteria 1276
387 Ga0207663_10266286 3300025916 Bacteria 1268
388 Ga0207663_10520252 3300025916 Bacteria 926
389 Ga0207660_10034299 3300025917 Bacteria 3517
390 Ga0207660_10043141 3300025917 Bacteria 3169
391 Ga0207660_10066645 3300025917 Bacteria 2605
392 Ga0207660_11291684 3300025917 Bacteria 593
393 Ga0207657_10157492 3300025919 Bacteria 1846
394 Ga0207649_11083828 3300025920 Bacteria 632
395 Ga0207652_10005625 3300025921 Bacteria 10166
396 Ga0207652_10041710 3300025921 Bacteria 3903
397 Ga0207652_10059561 3300025921 Bacteria 3292
398 Ga0207652_10161919 3300025921 Bacteria 2006
399 Ga0207652_10295307 3300025921 Bacteria 1462
400 Ga0207652_10296029 3300025921 Bacteria 1460
401 Ga0207652_10301899 3300025921 Bacteria 1445
402 Ga0207652_10351894 3300025921 Bacteria 1329
403 Ga0207694_10310382 3300025924 Bacteria 1300
404 Ga0207694_10574763 3300025924 Bacteria 947
405 Ga0207694_10949198 3300025924 Unclassified 727
406 Ga0207650_10293741 3300025925 Bacteria 1326
407 Ga0207659_10038986 3300025926 Bacteria 3309
408 Ga0207659_10173280 3300025926 Bacteria 1704
409 Ga0207687_10113306 3300025927 Bacteria 2017
410 Ga0207687_10360615 3300025927 Bacteria 1186
411 Ga0207700_10035973 3300025928 Bacteria 3572
412 Ga0207700_10048329 3300025928 Bacteria 3159
413 Ga0207700_10223259 3300025928 Bacteria 1598
414 Ga0207700_10629090 3300025928 Bacteria 956
415 Ga0207664_10023491 3300025929 Bacteria 4621
416 Ga0207664_11309316 3300025929 Bacteria 644
417 Ga0207644_10019585 3300025931 Bacteria 4592
418 Ga0207644_10074500 3300025931 Bacteria 2491
419 Ga0207644_10505370 3300025931 Bacteria 997
420 Ga0207690_10697987 3300025932 Bacteria 834
421 Ga0207706_10186322 3300025933 Bacteria 1822
422 Ga0207686_10133587 3300025934 Bacteria 1705
423 Ga0207686_10237894 3300025934 Bacteria 1324
424 Ga0207709_10055774 3300025935 Bacteria 2443
425 Ga0207670_10219925 3300025936 Bacteria 1453
426 Ga0207670_10462434 3300025936 Bacteria 1025
427 Ga0207670_10710493 3300025936 Bacteria 833
428 Ga0207670_10991982 3300025936 Bacteria 706
429 Ga0207669_10011913 3300025937 Bacteria 4254
430 Ga0207669_10140071 3300025937 Bacteria 1677
431 Ga0207669_10401784 3300025937 Bacteria 1073
432 Ga0207704_10692614 3300025938 Bacteria 843
433 Ga0207665_10001101 3300025939 Bacteria 18193
434 Ga0207665_10024483 3300025939 Bacteria 3980
435 Ga0207665_10105960 3300025939 Bacteria 1969
436 Ga0207691_10003800 3300025940 Bacteria 14654
437 Ga0207691_10011067 3300025940 Bacteria 8660
438 Ga0207691_10450321 3300025940 Bacteria 1096
439 Ga0207711_10062553 3300025941 Bacteria 3210
440 Ga0207711_10365682 3300025941 Bacteria 1337
441 Ga0207711_10569001 3300025941 Bacteria 1057
442 Ga0207711_10684875 3300025941 Bacteria 956
443 Ga0207689_10125712 3300025942 Bacteria 2110
444 Ga0207689_10285138 3300025942 Bacteria 1367
445 Ga0207689_10394036 3300025942 Bacteria 1154
446 Ga0207689_11282875 3300025942 Bacteria 616
447 Ga0207661_10305127 3300025944 Bacteria 1428
448 Ga0207679_10308371 3300025945 Bacteria 1367
449 Ga0207679_10363017 3300025945 Bacteria 1265
450 Ga0207679_10581953 3300025945 Bacteria 1007
451 Ga0207679_11372584 3300025945 Bacteria 648
452 Ga0207667_10008439 3300025949 Bacteria 12236
453 Ga0207667_10022646 3300025949 Bacteria 6931
454 Ga0207667_10076501 3300025949 Bacteria 3473
455 Ga0207667_10222530 3300025949 Bacteria 1933
456 Ga0207667_11800497 3300025949 Bacteria 576
457 Ga0207651_10074944 3300025960 Bacteria 2412
458 Ga0207651_10301027 3300025960 Bacteria 1333
459 Ga0207651_10442318 3300025960 Bacteria 1114
460 Ga0207651_10990310 3300025960 Bacteria 751
461 Ga0207651_11093608 3300025960 Bacteria 714
462 Ga0207712_10078343 3300025961 Bacteria 2398
463 Ga0207712_10541867 3300025961 Bacteria 1000
464 Ga0207712_10695769 3300025961 Bacteria 887
465 Ga0207668_10218273 3300025972 Bacteria 1530
466 Ga0207668_10671333 3300025972 Bacteria 909
467 Ga0207668_11023663 3300025972 Bacteria 739
468 Ga0207658_10000303 3300025986 Bacteria 50872
469 Ga0207658_10024530 3300025986 Bacteria 4220
470 Ga0207658_10034700 3300025986 Bacteria 3607
471 Ga0207658_10205862 3300025986 Bacteria 1646
472 Ga0207658_11340156 3300025986 Bacteria 654
473 Ga0207677_10057464 3300026023 Bacteria 2672
474 Ga0207703_10003121 3300026035 Bacteria 13988
475 Ga0207703_10006615 3300026035 Bacteria 9248
476 Ga0207703_10092458 3300026035 Bacteria 2546
477 Ga0207703_10789439 3300026035 Bacteria 906
478 Ga0207703_11829831 3300026035 Bacteria 583
479 Ga0207639_10204555 3300026041 Bacteria 1695
480 Ga0207639_11083032 3300026041 Bacteria 751
481 Ga0207639_12019751 3300026041 Bacteria 538
482 Ga0207678_10144536 3300026067 Bacteria 2030
483 Ga0207678_10296965 3300026067 Bacteria 1388
484 Ga0207708_10016081 3300026075 Bacteria 5619
485 Ga0207708_10324412 3300026075 Bacteria 1257
486 Ga0207708_10355177 3300026075 Bacteria 1203
487 Ga0207708_10775517 3300026075 Bacteria 824
488 Ga0207708_10880885 3300026075 Bacteria 774
489 Ga0207702_10148678 3300026078 Bacteria 2129
490 Ga0207702_10629612 3300026078 Bacteria 1054
491 Ga0207641_10003475 3300026088 Bacteria 13958
492 Ga0207641_10004348 3300026088 Bacteria 12289
493 Ga0207641_10145565 3300026088 Bacteria 2142
494 Ga0207641_10344643 3300026088 Bacteria 1418
495 Ga0207641_10433822 3300026088 Bacteria 1267
496 Ga0207641_10630206 3300026088 Bacteria 1052
497 Ga0207641_10742867 3300026088 Bacteria 968
498 Ga0207641_12262864 3300026088 Bacteria 543
499 Ga0207648_10024833 3300026089 Bacteria 5345
500 Ga0207648_10048166 3300026089 Bacteria 3732
501 Ga0207648_10059568 3300026089 Bacteria 3330
502 Ga0207676_10007753 3300026095 Bacteria 7635
503 Ga0207676_10439291 3300026095 Bacteria 1228
504 Ga0207674_10273415 3300026116 Bacteria 1637
505 Ga0207675_100002742 3300026118 Bacteria 17331
506 Ga0207675_100018690 3300026118 Bacteria 6469
507 Ga0207675_100027461 3300026118 Bacteria 5301
508 Ga0207675_100096122 3300026118 Bacteria 2788
509 Ga0207675_100128928 3300026118 Bacteria 2398
510 Ga0207675_100434221 3300026118 Bacteria 1299
511 Ga0207675_100937085 3300026118 Bacteria 883
512 Ga0207683_10061481 3300026121 Bacteria 3306
513 Ga0207683_10123215 3300026121 Bacteria 2329
514 Ga0207683_10298547 3300026121 Bacteria 1474
515 Ga0207683_10766420 3300026121 Bacteria 895
516 Ga0207698_10516891 3300026142 Bacteria 1164
517 Ga0209996_1032536 3300027395 Bacteria 761
518 Ga0210002_1045303 3300027617 Bacteria 752
519 Ga0209588_1051957 3300027671 Bacteria 1325
520 Ga0209966_1104527 3300027695 Bacteria 642
521 Ga0209974_10087375 3300027876 Bacteria 1078
522 Ga0207428_10000990 3300027907 Bacteria 31474
523 Ga0265354_1000834 3300028016 Bacteria 4966
524 Ga0265356_1001137 3300028017 Bacteria 4102
525 Ga0265355_1007989 3300028036 Unclassified 843
526 Ga0268266_10002557 3300028379 Bacteria 19304
527 Ga0268266_10006072 3300028379 Bacteria 11131
528 Ga0268266_10006493 3300028379 Bacteria 10704
529 Ga0268266_10075426 3300028379 Bacteria 2929
530 Ga0268266_10080204 3300028379 Bacteria 2843
531 Ga0268266_10125135 3300028379 Bacteria 2293
532 Ga0268266_10140339 3300028379 Bacteria 2168
533 Ga0268266_10167606 3300028379 Bacteria 1991
534 Ga0268266_10900407 3300028379 Bacteria 855
535 Ga0268265_10038525 3300028380 Bacteria 3517
536 Ga0268265_10182138 3300028380 Bacteria 1806
537 Ga0268265_10198098 3300028380 Bacteria 1740
538 Ga0268265_10200532 3300028380 Bacteria 1731
539 Ga0268265_10421447 3300028380 Bacteria 1239
540 Ga0268265_11139119 3300028380 Bacteria 776
541 Ga0268264_10001238 3300028381 Bacteria 24491
542 Ga0268264_10030059 3300028381 Bacteria 4454
543 Ga0268264_10034163 3300028381 Bacteria 4181
544 Ga0268264_10252960 3300028381 Bacteria 1637
545 Ga0268264_11210140 3300028381 Bacteria 765
546 Ga0265318_10153719 3300028577 Bacteria 844
547 Ga0307515_10006279 3300028794 Bacteria 23844
548 Ga0265338_10565779 3300028800 Bacteria 794
549 Ga0307511_10000172 3300030521 Bacteria 63607
550 Ga0307511_10013004 3300030521 Bacteria 8146
551 Ga0307511_10114098 3300030521 Bacteria 1705
552 Ga0265770_1002356 3300030878 Bacteria 2567
553 Ga0265771_1000328 3300031010 Bacteria 1613
554 Ga0265773_1010374 3300031018 Bacteria 785
555 Ga0265760_10000462 3300031090 Bacteria 11486
556 Ga0265760_10246424 3300031090 Bacteria 617
557 Ga0265340_10007525 3300031247 Bacteria 5913
558 Ga0265339_10281921 3300031249 Bacteria 796
559 Ga0265339_10344780 3300031249 Bacteria 703
560 Ga0265331_10110405 3300031250 Bacteria 1261
561 Ga0307513_10009329 3300031456 Bacteria 12424
562 Ga0307513_10029412 3300031456 Bacteria 6264
563 Ga0307513_10034337 3300031456 Bacteria 5693
564 Ga0307513_10065152 3300031456 Bacteria 3834
565 Ga0307513_10324651 3300031456 Bacteria 1296
566 Ga0307509_10001027 3300031507 Bacteria 48002
567 Ga0307509_10156836 3300031507 Bacteria 2181
568 Ga0307509_10232468 3300031507 Bacteria 1645
569 Ga0307408_100067860 3300031548 Bacteria 2624
570 Ga0307408_100074277 3300031548 Bacteria 2522
571 Ga0307408_100122985 3300031548 Bacteria 2013
572 Ga0307408_100167946 3300031548 Bacteria 1749
573 Ga0307408_101430908 3300031548 Unclassified 652
574 Ga0307408_101742039 3300031548 Bacteria 594
575 Ga0265313_10041615 3300031595 Bacteria 2262
576 Ga0307514_10200908 3300031649 Bacteria 1253
577 Ga0316575_10009676 3300031665 Bacteria 3532
578 Ga0265314_10200051 3300031711 Bacteria 1182
579 Ga0265314_10292498 3300031711 Bacteria 917
580 Ga0316576_10030261 3300031727 Bacteria 3832
581 Ga0316578_10609274 3300031728 Bacteria 639
582 Ga0307516_10048270 3300031730 Bacteria 4189
583 Ga0307516_10434446 3300031730 Bacteria 970
584 Ga0307405_10007840 3300031731 Bacteria 5375
585 Ga0307405_10016044 3300031731 Bacteria 4074
586 Ga0307405_10799654 3300031731 Unclassified 790
587 Ga0316577_10048607 3300031733 Bacteria 2369
588 Ga0307413_10004099 3300031824 Bacteria 6274
589 Ga0307413_10022662 3300031824 Bacteria 3389
590 Ga0307410_10003481 3300031852 Bacteria 7904
591 Ga0307410_10014862 3300031852 Bacteria 4597
592 Ga0307410_10240121 3300031852 Bacteria 1403
593 Ga0307410_10661886 3300031852 Bacteria 877
594 Ga0307406_10752500 3300031901 Bacteria 818
595 Ga0307406_11044795 3300031901 Bacteria 703
596 Ga0307407_10009190 3300031903 Bacteria 4588
597 Ga0307407_10126846 3300031903 Bacteria 1626
598 Ga0307407_10540485 3300031903 Bacteria 860
599 Ga0307412_10015163 3300031911 Bacteria 4561
600 Ga0307412_10056917 3300031911 Bacteria 2608
601 Ga0307412_10307943 3300031911 Bacteria 1255
602 Ga0307409_100005159 3300031995 Bacteria 7466
603 Ga0307409_100062053 3300031995 Bacteria 2924
604 Ga0307409_100138477 3300031995 Bacteria 2093
605 Ga0307409_100148629 3300031995 Bacteria 2030
606 Ga0307409_100326915 3300031995 Bacteria 1437
607 Ga0307416_100018394 3300032002 Bacteria 4921
608 Ga0307416_100332688 3300032002 Bacteria 1527
609 Ga0307416_100521976 3300032002 Bacteria 1256
610 Ga0307416_100921045 3300032002 Bacteria 975
611 Ga0307416_101094738 3300032002 Bacteria 901
612 Ga0307416_101355486 3300032002 Bacteria 817
613 Ga0307414_10012857 3300032004 Bacteria 4967
614 Ga0307414_10111053 3300032004 Bacteria 2087
615 Ga0307414_11058530 3300032004 Bacteria 748
616 Ga0307411_10001043 3300032005 Bacteria 10725
617 Ga0307411_10017387 3300032005 Bacteria 4096
618 Ga0307411_10042910 3300032005 Bacteria 2890
619 Ga0307411_10792667 3300032005 Bacteria 834
620 Ga0307411_11291796 3300032005 Bacteria 664
621 Ga0307415_100041219 3300032126 Bacteria 3064
622 Ga0307415_100240380 3300032126 Bacteria 1464
623 Ga0307510_10000010 3300033180 Bacteria 377457
624 Ga0307510_10019615 3300033180 Bacteria 7924
625 Ga0316212_1027775 3300033547 Bacteria 794
626 Ga0373923_0332737 3300035111 Bacteria 723
627 Ga0373936_0014123 3300035113 Bacteria 3051
628 Ga0373936_0019053 3300035113 Bacteria 2657
629 Ga0373936_0096979 3300035113 Bacteria 1241
630 Ga0373936_0220327 3300035113 Bacteria 841
631 Ga0373953_0026671 3300035117 Bacteria 2215
632 Ga0373953_0134946 3300035117 Bacteria 1054
633 Ga0373953_0156694 3300035117 Bacteria 978
634 Ga0373954_0079775 3300035118 Bacteria 1563
635 Ga0373956_0142596 3300035119 Bacteria 1125
636 Ga0373956_0244541 3300035119 Bacteria 853
637 Ga0373943_0074814 3300035170 Bacteria 1723
638 Ga0373955_0143437 3300035172 Bacteria 1402
639 Ga0373955_0308838 3300035172 Bacteria 954
640 Ga0316574_0072750 3300035398 Bacteria 2173
641 Ga0373924_0159693 3300035410 Bacteria 988
642 Ga0373924_0206938 3300035410 Bacteria 866
643 Ga0373935_0696693 3300035692 Bacteria 747
644 Ga0373927_0026014 3300035695 Bacteria 3825
645 Ga0373927_0168559 3300035695 Bacteria 1435
646 Ga0373933_0012633 3300035724 Bacteria 4667
647 Ga0373933_0534519 3300035724 Bacteria 769
648 Ga0373947_0116053 3300035725 Bacteria 1697
649 Ga0373937_0203792 3300036401 Bacteria 1860
650 Ga0373937_0369215 3300036401 Bacteria 1360
651 Ga0373937_0445582 3300036401 Bacteria 1229
652 Ga0316584_0087069 3300036712 Bacteria 2338
653 Ga0373925_0072983 3300037068 Bacteria 2597
654 Ga0373925_0459402 3300037068 Bacteria 1043
655 Ga0373925_0477407 3300037068 Bacteria 1022
656 Ga0395900_0035103 3300037418 Bacteria 5166
657 Ga0395898_0028526 3300037466 Bacteria 5592
658 Ga0395898_0042737 3300037466 Bacteria 4470
659 Ga0395898_0046444 3300037466 Bacteria 4266
660 Ga0395898_0171233 3300037466 Bacteria 2076
661 Ga0395905_0731640 3300037471 Bacteria 892
662 Ga0395905_1575270 3300037471 Bacteria 562
663 Ga0436365_0303382 3300039437 Bacteria 5459
664 Ga0436365_0338742 3300039437 Bacteria 819
665 Ga0436365_0869677 3300039437 Bacteria 1160
666 Ga0436365_0908999 3300039437 Bacteria 4724
667 Ga0436360_0033999 3300039438 Bacteria 750
668 Ga0436360_0335434 3300039438 Bacteria 8420
669 Ga0436360_0928068 3300039438 Bacteria 705
670 Ga0436361_1016867 3300039447 Bacteria 1226
671 Ga0436361_1172308 3300039447 Bacteria 8529
672 Ga0436361_1176747 3300039447 Bacteria 1204
673 Ga0436363_0122084 3300039450 Bacteria 2553
674 Ga0436363_0268552 3300039450 Bacteria 6033
675 Ga0436363_0378144 3300039450 Bacteria 1793
676 Ga0436363_0861289 3300039450 Bacteria 1137
677 Ga0436363_1158081 3300039450 Bacteria 761
678 Ga0436363_1328184 3300039450 Bacteria 10036
679 Ga0436363_1591892 3300039450 Bacteria 1218
680 Ga0436362_0937886 3300039453 Unclassified 816
681 Ga0439439_0045723 3300041406 Bacteria 1142
682 Ga0439453_0011553 3300041408 Bacteria 1475
683 Ga0451787_417005 3300041441 Bacteria 636
684 Ga0451789_0579430 3300041443 Bacteria 1101
685 Ga0451791_1119097 3300041451 Bacteria 1358
686 Ga0451791_1750484 3300041451 Bacteria 621
687 Ga0451793_0229681 3300041452 Bacteria 587
688 Ga0451797_0553840 3300041453 Bacteria 624
689 Ga0451795_1018544 3300041456 Bacteria 1373
690 Ga0451800_0299913 3300041459 Bacteria 1229
691 Ga0451800_0510418 3300041459 Bacteria 596
692 Ga0451800_1642085 3300041459 Bacteria 1013
693 Ga0451802_0265411 3300041460 Bacteria 3311
694 Ga0451802_1746363 3300041460 Bacteria 2157
695 Ga0451804_0808277 3300041463 Bacteria 617
696 Ga0451804_0832309 3300041463 Bacteria 858
697 Ga0451807_0666976 3300041486 Bacteria 574
698 Ga0451807_1774474 3300041486 Bacteria 945
699 Ga0451833_0262536 3300041491 Bacteria 674
700 Ga0451837_0300169 3300041494 Bacteria 765
701 Ga0451839_0947681 3300041496 Bacteria 724
702 Ga0451851_0365422 3300041507 Bacteria 662
703 Ga0451853_0413289 3300041512 Bacteria 1548
704 Ga0451853_1200973 3300041512 Bacteria 584
705 Ga0439431_0027472 3300041997 Bacteria 1398
706 Ga0439433_0009397 3300041999 Bacteria 2128
707 Ga0439442_018200 3300042002 Bacteria 1453
708 Ga0439443_008288 3300042003 Bacteria 1464
709 Ga0439456_017772 3300042013 Bacteria 1491
710 Ga0450920_004346 3300042122 Bacteria 2486
711 Ga0450923_001623 3300042125 Bacteria 3034
712 Ga0450923_001799 3300042125 Bacteria 2938
713 Ga0450923_093410 3300042125 Bacteria 688
714 Ga0450923_097886 3300042125 Bacteria 674
715 Ga0450894_004282 3300042131 Bacteria 1858
716 Ga0450895_000816 3300042132 Bacteria 1972
717 Ga0450896_002134 3300042133 Bacteria 2526
718 Ga0450898_014493 3300042134 Bacteria 1326
719 Ga0450910_012031 3300042147 Bacteria 1247
720 Ga0450910_012345 3300042147 Bacteria 1234
721 Ga0439446_0000369 3300042156 Bacteria 8641
722 Ga0439446_0005318 3300042156 Bacteria 3309
723 Ga0439446_0032069 3300042156 Bacteria 1522
724 Ga0450908_004140 3300042184 Bacteria 2803
725 Ga0439434_0000893 3300042435 Bacteria 8601
726 Ga0439435_0000462 3300042436 Bacteria 6424
727 Ga0439444_0000456 3300042437 Bacteria 4556
728 Ga0439459_0040765 3300042438 Bacteria 986
729 Ga0439464_0162601 3300042439 Bacteria 702
730 Ga0450918_007153 3300042531 Bacteria 1983
731 Ga0451577_0097002 3300042876 Bacteria 2632
732 Ga0451577_0653005 3300042876 Bacteria 954
733 Ga0466969_0000982 3300044656 Bacteria 15393
734 Ga0466969_0001200 3300044656 Bacteria 14008
735 Ga0466969_0082749 3300044656 Bacteria 1529
736 Ga0466969_0101989 3300044656 Bacteria 1350
737 Ga0466965_0066072 3300044683 Bacteria 1813
738 Ga0466966_0030307 3300044684 Bacteria 3512
739 Ga0466966_0044847 3300044684 Bacteria 2829
740 Ga0466966_0094645 3300044684 Bacteria 1851
741 Ga0466961_0000578 3300044693 Bacteria 23292
742 Ga0466964_0000252 3300044706 Bacteria 15468
743 Ga0453684_0440648 3300044712 Bacteria 1452
744 Ga0466971_0000941 3300044719 Bacteria 11963
745 Ga0466970_0035215 3300044765 Bacteria 2652
746 Ga0466957_0064636 3300044842 Bacteria 2251
747 Ga0466960_0094798 3300044901 Bacteria 1527
748 Ga0466959_0014261 3300045049 Bacteria 5768
749 Ga0466959_0064687 3300045049 Bacteria 2655
750 Ga0466959_0205595 3300045049 Bacteria 1369
751 Ga0466959_0216794 3300045049 Bacteria 1328
752 Ga0466959_0518270 3300045049 Bacteria 805
753 Ga0451576_0068277 3300045051 Unclassified 3699
754 Ga0451576_1265543 3300045051 Bacteria 769
755 Ga0466958_0031544 3300045836 Bacteria 3150
756 Ga0466967_0437847 3300045976 Bacteria 1276
757 Ga0495617_096422 3300046452 Bacteria 963
758 Ga0495590_0057281 3300046457 Bacteria 1362
759 Ga0495590_0071514 3300046457 Bacteria 1217
760 Ga0495591_072580 3300046458 Bacteria 891
761 Ga0495629_0310940 3300046459 Bacteria 1078
762 Ga0495638_0001478 3300046460 Bacteria 21227
763 Ga0495638_0050101 3300046460 Bacteria 2609
764 Ga0495638_0142698 3300046460 Bacteria 1396
765 Ga0495638_0197188 3300046460 Bacteria 1139
766 Ga0495580_0006591 3300046472 Bacteria 9435
767 Ga0495580_0020718 3300046472 Bacteria 4861
768 Ga0495580_0041092 3300046472 Bacteria 3299
769 Ga0495580_0225236 3300046472 Bacteria 1288
770 Ga0495580_0395823 3300046472 Bacteria 932
771 Ga0495605_0208624 3300046474 Bacteria 849
772 Ga0495639_0353189 3300046475 Bacteria 738
773 Ga0495664_0381127 3300046477 Bacteria 848
774 Ga0495585_0115260 3300046492 Bacteria 1426
775 Ga0495606_0108932 3300046507 Bacteria 1674
776 Ga0495608_0260742 3300046511 Bacteria 1079
777 Ga0495616_0000953 3300046513 Bacteria 20793
778 Ga0495616_0052807 3300046513 Bacteria 2022
779 Ga0495618_0231002 3300046514 Bacteria 1165
780 Ga0495620_0081264 3300046515 Bacteria 1311
781 Ga0495628_0195959 3300046516 Bacteria 1524
782 Ga0495630_0149600 3300046517 Bacteria 1776
783 Ga0495632_0020802 3300046519 Bacteria 3546
784 Ga0495632_0044299 3300046519 Bacteria 2221
785 Ga0495643_0329515 3300046522 Bacteria 688
786 Ga0495644_0053648 3300046523 Bacteria 1514
787 Ga0495652_0620543 3300046529 Bacteria 735
788 Ga0495586_0489156 3300046535 Bacteria 710
789 Ga0495587_0430642 3300046536 Bacteria 732
790 Ga0495598_0113017 3300046537 Bacteria 912
791 Ga0495656_0077574 3300046615 Bacteria 1491
792 Ga0495668_0115392 3300046616 Bacteria 1469
793 Ga0495668_0475624 3300046616 Bacteria 688
794 Ga0495611_0075189 3300046648 Bacteria 1548
795 Ga0495625_0029944 3300046660 Bacteria 4065
796 Ga0495625_0081472 3300046660 Bacteria 2253
797 Ga0495625_0092738 3300046660 Bacteria 2086
798 Ga0495625_0097404 3300046660 Bacteria 2025
799 Ga0495625_0202321 3300046660 Bacteria 1310
800 Ga0495635_0463410 3300046663 Bacteria 837
801 Ga0495659_0134657 3300046664 Bacteria 982
802 Ga0495657_0351105 3300046675 Bacteria 873
803 Ga0495599_0177400 3300046678 Bacteria 1314
804 Ga0495599_0608715 3300046678 Bacteria 636
805 Ga0495647_0177246 3300046681 Bacteria 926
806 Ga0495658_0452817 3300046683 Bacteria 820
807 Ga0495658_0884994 3300046683 Bacteria 571
808 Ga0495613_0288223 3300046689 Bacteria 1139
809 Ga0495613_0521420 3300046689 Bacteria 798
810 Ga0495671_0523726 3300046692 Bacteria 565
811 Ga0495649_0047310 3300046694 Bacteria 2339
812 Ga0495649_0189790 3300046694 Bacteria 1070
813 Ga0495604_0545513 3300047317 Bacteria 748
814 Ga0495680_0173575 3300047322 Bacteria 1560
815 Ga0495687_040056 3300047443 Bacteria 2068
816 Ga0495687_074242 3300047443 Bacteria 1353
817 Ga0495681_0036130 3300047470 Bacteria 2446
818 Ga0495686_0064610 3300047472 Bacteria 2265
819 Ga0495686_0364049 3300047472 Bacteria 783
820 Ga0495602_0351646 3300048088 Bacteria 1063
821 Ga0496100_0133500 3300048903 Bacteria 1751
822 Ga0496100_0929492 3300048903 Bacteria 683
823 Ga0496101_0111028 3300048904 Bacteria 2064
824 Ga0496101_0290623 3300048904 Bacteria 1279
825 Ga0496101_0472422 3300048904 Bacteria 990
826 Ga0496102_0012586 3300048905 Bacteria 7328
827 Ga0496102_0025352 3300048905 Bacteria 5278
828 Ga0496102_0028547 3300048905 Bacteria 4984
829 Ga0496104_0021923 3300048907 Bacteria 5867
830 Ga0496104_0207214 3300048907 Bacteria 1872
831 Ga0496104_0230361 3300048907 Bacteria 1764
832 Ga0496105_0019756 3300048908 Bacteria 5435
833 Ga0496105_0183316 3300048908 Bacteria 1713
834 Ga0496105_0206325 3300048908 Bacteria 1603
835 Ga0496106_0095620 3300048909 Bacteria 2298
836 Ga0496106_0109593 3300048909 Bacteria 2148
837 Ga0496107_0136732 3300048910 Bacteria 1810
838 Ga0496107_0686813 3300048910 Bacteria 753
839 Ga0496108_0055001 3300048911 Bacteria 3341
840 Ga0496109_0672668 3300048912 Bacteria 972
841 Ga0496109_1300234 3300048912 Bacteria 663
842 Ga0496110_0033998 3300048913 Bacteria 4412
843 Ga0496111_0419988 3300048914 Bacteria 988
844 Ga0496112_0236706 3300048915 Bacteria 1779
845 Ga0496113_0285438 3300048916 Bacteria 1320
846 Ga0496114_0024321 3300048917 Bacteria 4943
847 Ga0496114_0112791 3300048917 Bacteria 2330
848 Ga0496114_0298917 3300048917 Bacteria 1421
849 Ga0496115_0014977 3300048918 Bacteria 5878
850 Ga0496116_0009539 3300048919 Bacteria 8267
851 Ga0496117_0000581 3300048920 Bacteria 60186
852 Ga0496118_0001068 3300048921 Bacteria 42766
853 Ga0496118_0042982 3300048921 Bacteria 3558
854 Ga0496119_0006293 3300048922 Bacteria 11072
855 Ga0496119_0022325 3300048922 Bacteria 4535
856 Ga0496120_0007212 3300048923 Bacteria 8320
857 Ga0496120_0018016 3300048923 Bacteria 4562
858 Ga0496121_0003828 3300048924 Bacteria 20935
859 Ga0496121_0039297 3300048924 Bacteria 4172
860 Ga0496121_0143634 3300048924 Bacteria 1767
861 Ga0496124_0159819 3300048927 Bacteria 1757
862 Ga0496125_0000553 3300048928 Bacteria 64496
863 Ga0496125_0008847 3300048928 Bacteria 10466
864 Ga0496125_0024657 3300048928 Bacteria 5525
865 Ga0496125_0402185 3300048928 Bacteria 800
866 Ga0496125_0417972 3300048928 Bacteria 778
867 Ga0496126_0010409 3300048929 Bacteria 9754
868 Ga0496126_0041287 3300048929 Bacteria 4271
869 Ga0496126_0055830 3300048929 Bacteria 3571
870 Ga0496126_0223740 3300048929 Bacteria 1579
871 Ga0496126_0597240 3300048929 Bacteria 870
872 Ga0496126_0630455 3300048929 Bacteria 841
873 Ga0501031_0015117 3300049568 Bacteria 5014
874 Ga0501032_0198905 3300049569 Bacteria 1308
875 Ga0501036_0146115 3300049572 Bacteria 1994
876 Ga0501036_0161723 3300049572 Bacteria 1887
877 Ga0501036_0377202 3300049572 Bacteria 1184
878 Ga0501036_1126164 3300049572 Bacteria 641
879 Ga0501037_0417099 3300049573 Bacteria 919
880 Ga0501038_0058049 3300049574 Bacteria 3319
881 Ga0501038_0758606 3300049574 Bacteria 723
882 Ga0501039_0000970 3300049575 Bacteria 20831
883 Ga0501039_0320378 3300049575 Bacteria 1219
884 Ga0501040_0044629 3300049576 Bacteria 3022
885 Ga0501040_0144164 3300049576 Bacteria 1678
886 Ga0501040_0357800 3300049576 Bacteria 1046
887 Ga0501041_0015807 3300049577 Bacteria 4484
888 Ga0501041_0043472 3300049577 Bacteria 2731
889 Ga0501042_0068228 3300049578 Bacteria 2542
890 Ga0501042_0206461 3300049578 Bacteria 1416
891 Ga0501042_0224338 3300049578 Bacteria 1355
892 Ga0501042_0854873 3300049578 Bacteria 662
893 Ga0501043_0026690 3300049579 Bacteria 4531
894 Ga0501046_0020094 3300049580 Bacteria 5530
895 Ga0501046_0559762 3300049580 Bacteria 814
896 Ga0501047_0172845 3300049581 Bacteria 2029
897 Ga0501047_0884226 3300049581 Bacteria 707
898 Ga0501047_1064472 3300049581 Bacteria 622
899 Ga0501048_0006642 3300049582 Bacteria 8793
900 Ga0501048_0028166 3300049582 Bacteria 4079
901 Ga0501048_0208287 3300049582 Bacteria 1387
902 Ga0501048_0271543 3300049582 Bacteria 1205
903 Ga0501067_0009497 3300049583 Bacteria 5388
904 Ga0501067_0016021 3300049583 Bacteria 4146
905 Ga0501068_0000877 3300049584 Bacteria 15682
906 Ga0501068_0015711 3300049584 Bacteria 4353
907 Ga0501069_0292162 3300049585 Bacteria 955
908 Ga0501070_0964995 3300049586 Bacteria 662
909 Ga0501071_0000217 3300049587 Bacteria 26317
910 Ga0501071_0003860 3300049587 Bacteria 9435
911 Ga0501071_0015529 3300049587 Bacteria 5229
912 Ga0501071_0149101 3300049587 Bacteria 1744
913 Ga0501072_0030680 3300049588 Bacteria 4206
914 Ga0501072_0091121 3300049588 Bacteria 2420
915 Ga0501073_0002934 3300049589 Bacteria 12799
916 Ga0501073_0036663 3300049589 Bacteria 3483
917 Ga0501073_0253118 3300049589 Bacteria 1216
918 Ga0501073_0323756 3300049589 Bacteria 1064
919 Ga0501073_0524211 3300049589 Bacteria 819
920 Ga0501074_0005690 3300049590 Bacteria 8981
921 Ga0501074_0040383 3300049590 Bacteria 3380
922 Ga0501074_0055774 3300049590 Bacteria 2847
923 Ga0501074_0106747 3300049590 Bacteria 2005
924 Ga0501075_0006246 3300049591 Bacteria 8190
925 Ga0501076_0000571 3300049592 Bacteria 23489
926 Ga0501076_0237794 3300049592 Bacteria 1489
927 Ga0501076_0308509 3300049592 Bacteria 1298
928 Ga0501076_0470952 3300049592 Bacteria 1035
929 Ga0501076_0798339 3300049592 Bacteria 779
930 Ga0501076_1155329 3300049592 Bacteria 637
931 Ga0501077_0061780 3300049593 Bacteria 2377
932 Ga0501077_0090215 3300049593 Bacteria 1942
933 Ga0501077_0181557 3300049593 Bacteria 1337
934 Ga0501077_0359010 3300049593 Bacteria 930
935 Ga0501079_0006287 3300049741 Bacteria 8906
936 Ga0501079_0047992 3300049741 Bacteria 3294
937 Ga0501079_0176423 3300049741 Bacteria 1666
938 Ga0501079_0355162 3300049741 Bacteria 1148
939 Ga0501079_1141123 3300049741 Bacteria 614
940 Ga0501080_0051988 3300049742 Bacteria 3813
941 Ga0501080_0064731 3300049742 Bacteria 3400
942 Ga0501080_0130907 3300049742 Bacteria 2323
943 Ga0501080_0186836 3300049742 Bacteria 1905
944 Ga0501080_0550258 3300049742 Bacteria 1028
945 Ga0501081_0001576 3300049743 Bacteria 14052
946 Ga0501081_0053945 3300049743 Bacteria 2776
947 Ga0501081_0291103 3300049743 Bacteria 1197
948 Ga0501083_0072663 3300049744 Bacteria 2286
949 Ga0501083_0215490 3300049744 Bacteria 1251
950 Ga0501035_0075026 3300049822 Bacteria 2991
951 Ga0501035_0249314 3300049822 Bacteria 1508
952 Ga0501035_0345593 3300049822 Bacteria 1246
953 Ga0501044_0660648 3300049823 Bacteria 934
954 Ga0501045_0000563 3300049824 Bacteria 23313
955 Ga0501045_0103998 3300049824 Bacteria 2103
956 Ga0501045_0308044 3300049824 Bacteria 1179
957 nmdc:mga05p37_143344_c1 3300050507 Bacteria 2926
958 nmdc:mga08y16_35804_c1 3300050511 Bacteria 5213
959 nmdc:mga08y16_493239_c1 3300050511 Bacteria 1245
960 nmdc:mga08y16_7354_c1 3300050511 Bacteria 11553
961 nmdc:mga0n895_199652_c1 3300050512 Bacteria 2031
962 nmdc:mga0rr50_11973_c1 3300050513 Bacteria 5581
963 nmdc:mga08x19_217680_c1 3300050514 Bacteria 1312
964 Ga0495612_0078887 3300053078 Bacteria 1382
965 Ga0495595_0399236 3300053084 Bacteria 697
966 Ga0500644_0075279 3300053088 Bacteria 1227
967 Ga0500644_0263268 3300053088 Bacteria 730
968 Ga0500646_0009703 3300053090 Bacteria 2464
969 Ga0500583_0008807 3300053092 Bacteria 3651
970 Ga0500583_0035077 3300053092 Bacteria 2235
971 Ga0500583_0061322 3300053092 Bacteria 1775
972 Ga0500651_0054681 3300053093 Bacteria 2501
973 Ga0500641_0017271 3300053096 Bacteria 2697
974 Ga0500641_0054606 3300053096 Bacteria 1652
975 Ga0500641_0197909 3300053096 Bacteria 858
976 Ga0500650_0499997 3300053098 Bacteria 517
977 Ga0500556_0000801 3300053104 Bacteria 18392
978 Ga0500556_0248461 3300053104 Bacteria 700
979 Ga0500562_020126 3300053108 Bacteria 1732
980 Ga0500591_063973 3300053115 Bacteria 1687
981 Ga0500595_018281 3300053119 Bacteria 2567
982 Ga0500614_164402 3300053123 Bacteria 674
983 Ga0500628_061724 3300053129 Bacteria 917
984 Ga0500652_197747 3300053131 Bacteria 817
985 Ga0500658_0136358 3300053134 Bacteria 1098
986 Ga0500568_0001263 3300053139 Bacteria 16721
987 Ga0500568_0049181 3300053139 Bacteria 1665
988 Ga0500577_0258285 3300053142 Bacteria 758
989 Ga0500590_149032 3300053148 Bacteria 1058
990 Ga0500616_0000092 3300053153 Bacteria 183860
991 Ga0500616_0021879 3300053153 Bacteria 3576
992 Ga0500616_0022231 3300053153 Bacteria 3544
993 Ga0500627_0323827 3300053158 Bacteria 669
994 Ga0500630_127871 3300053159 Bacteria 1115
995 Ga0500636_0232782 3300053177 Bacteria 952
996 Ga0500596_044456 3300053735 Bacteria 715
997 Ga0501084_0050268 3300054114 Bacteria 3489
998 Ga0501084_0064716 3300054114 Bacteria 3059
999 Ga0501084_0107580 3300054114 Bacteria 2343
1000 Ga0501084_0251930 3300054114 Bacteria 1490
1001 Ga0501084_0641237 3300054114 Bacteria 897
1002 Ga0501082_0000958 3300060353 Bacteria 25525
1003 Ga0501082_0197914 3300060353 Bacteria 1748
1004 Ga0501082_0686899 3300060353 Bacteria 896
1005 Ga0466962_0000530 3300061719 Bacteria 16710
1006 Ga0466962_0169473 3300061719 Bacteria 1063
1007 Ga0530510_0008083 3300061734 Bacteria 7336
1008 Ga0436365_1311778
1009 Ga0070676_10059641
1010 Ga0070683_100018504
1011 Ga0070690_100032408
1012 Ga0070690_100272676
1013 Ga0070690_100538125
1014 Ga0070670_100034693
1015 Ga0070670_100330055
1016 Ga0070677_10049724
1017 Ga0070677_10189239
1018 Ga0068869_100109697
1019 Ga0068869_100133696
1020 Ga0068869_100401934
1021 Ga0068869_101207920
1022 Ga0070666_10020519
1023 Ga0070666_10640677
1024 Ga0070666_11233348
1025 Ga0070680_100000968
1026 Ga0070680_100023132
1027 Ga0070680_100773082
1028 Ga0070682_100061248
1029 Ga0070682_100066875
1030 Ga0070682_100431172
1031 Ga0068868_100485231
1032 Ga0070689_100003519
1033 Ga0070689_100104945
1034 Ga0070691_10232450
1035 Ga0070661_101230832
1036 Ga0070661_101439008
1037 Ga0070668_100380040
1038 Ga0070668_100602234
1039 Ga0070669_100183600
1040 Ga0070669_100334463
1041 Ga0070675_100004710
1042 Ga0070675_100438038
1043 Ga0070675_100709863
1044 Ga0070675_100753352
1045 Ga0070671_100088963
1046 Ga0070671_100201924
1047 Ga0070671_100567660
1048 Ga0070674_100031373
1049 Ga0070674_100041631
1050 Ga0070674_100196063
1051 Ga0070673_100059868
1052 Ga0070673_100104718
1053 Ga0070673_100566882
1054 Ga0070673_101206812
1055 Ga0070659_100181683
1056 Ga0070667_100005254
1057 Ga0070667_100041203
1058 Ga0070667_100483489
1059 Ga0070709_10397554
1060 Ga0070709_10795717
1061 Ga0070713_100008265
1062 Ga0070713_100063685
1063 Ga0070713_100074838
1064 Ga0070713_100206967
1065 Ga0070713_100952283
1066 Ga0070710_10048728
1067 Ga0070701_10039868
1068 Ga0070711_100015720
1069 Ga0070711_100031371
1070 Ga0070711_100310571
1071 Ga0070705_100385418
1072 Ga0070705_100852803
1073 Ga0070700_100039274
1074 Ga0070700_100042098
1075 Ga0070700_100376932
1076 Ga0070700_101495909
1077 Ga0070694_100199770
1078 Ga0070663_100472475
1079 Ga0070663_100889462
1080 Ga0070663_101106769
1081 Ga0070678_100097616
1082 Ga0070678_100131843
1083 Ga0070662_100164274
1084 Ga0070662_100869756
1085 Ga0070681_10003465
1086 Ga0070681_10005119
1087 Ga0070681_10026451
1088 Ga0070681_10057408
1089 Ga0070681_10081733
1090 Ga0070681_10212956
1091 Ga0070681_10319999
1092 Ga0070681_10496755
1093 Ga0070681_11080631
1094 Ga0068867_100066038
1095 Ga0068867_100147690
1096 Ga0070685_10166632
1097 Ga0070699_100133771
1098 Ga0070679_100026143
1099 Ga0070679_100071807
1100 Ga0070679_100079665
1101 Ga0070679_100133960
1102 Ga0070679_100214429
1103 Ga0070679_100263589
1104 Ga0070679_100267623
1105 Ga0070684_100063122
1106 Ga0068853_100318914
1107 Ga0068853_100636393
1108 Ga0070672_100018864
1109 Ga0070672_100138828
1110 Ga0070686_100040720
1111 Ga0070686_100075511
1112 Ga0070686_100240435
1113 Ga0070686_100458541
1114 Ga0070686_100519385
1115 Ga0070695_100095346
1116 Ga0070695_100156284
1117 Ga0070696_100011512
1118 Ga0070696_100096560
1119 Ga0070696_100215163
1120 Ga0070696_100300554
1121 Ga0070693_100197309
1122 Ga0070693_100454102
1123 Ga0070665_100001792
1124 Ga0070665_100006525
1125 Ga0070665_100014256
1126 Ga0070665_100017976
1127 Ga0070665_100030686
1128 Ga0070665_100049788
1129 Ga0070665_100107726
1130 Ga0070665_100647534
1131 Ga0070665_100666866
1132 Ga0070704_100207122
1133 Ga0068855_100004111
1134 Ga0068855_100007561
1135 Ga0068855_100010659
1136 Ga0068855_100052155
1137 Ga0068855_100311930
1138 Ga0070664_100021561
1139 Ga0068857_100151222
1140 Ga0068857_100456434
1141 Ga0068854_100139110
1142 Ga0068854_100521584
1143 Ga0068856_100214570
1144 Ga0068856_100266115
1145 Ga0068856_100448067
1146 Ga0068856_100464880
1147 Ga0070702_100054766
1148 Ga0068852_100617935
1149 Ga0068859_100004119
1150 Ga0068859_100198070
1151 Ga0068859_100327927
1152 Ga0068859_100430338
1153 Ga0068859_100749426
1154 Ga0068864_100012721
1155 Ga0068866_10316910
1156 Ga0068861_100003440
1157 Ga0068861_100004932
1158 Ga0068861_100107896
1159 Ga0068861_100178295
1160 Ga0068861_100219749
1161 Ga0068861_100229941
1162 Ga0068861_100406858
1163 Ga0068861_100893147
1164 Ga0068861_100912073
1165 Ga0068851_10190025
1166 Ga0068870_10002932
1167 Ga0068870_10424075
1168 Ga0068863_100001602
1169 Ga0068863_100042144
1170 Ga0068863_100196967
1171 Ga0068863_100444362
1172 Ga0068863_100623449
1173 Ga0068863_101417686
1174 Ga0068858_100001047
1175 Ga0068858_100003727
1176 Ga0068858_100111814
1177 Ga0068858_100246291
1178 Ga0068858_100247977
1179 Ga0068858_100267048
1180 Ga0068860_100011257
1181 Ga0068860_100080596
1182 Ga0068860_100111333
1183 Ga0068860_100264615
1184 Ga0068860_101121708
1185 Ga0068862_100035494
1186 Ga0068862_100073411
1187 Ga0068862_100165484
1188 Ga0068862_100578320
1189 Ga0068862_101222130
1190 Ga0068862_101369490
1191 Ga0081455_10000812
1192 Ga0081455_10004966
1193 Ga0081539_10000007
1194 Ga0070717_10067689
1195 Ga0070715_10212742
1196 Ga0070715_10458577
1197 Ga0070716_100022541
1198 Ga0070712_100085564
1199 Ga0070712_100138588
1200 Ga0097621_100024793
1201 Ga0097621_100040528
1202 Ga0097621_100103993
1203 Ga0097621_100333498
1204 Ga0097621_100375570
1205 Ga0097621_100495507
1206 Ga0097621_101058680
1207 Ga0097621_101187880
1208 Ga0068871_100013848
1209 Ga0068871_100043523
1210 Ga0068871_100141596
1211 Ga0068871_100182633
1212 Ga0068871_100428187
1213 Ga0075428_100002675
1214 Ga0075428_101101009
1215 Ga0075434_100206819
1216 Ga0075429_100242266
1217 Ga0075429_100687881
1218 Ga0068865_100110615
1219 Ga0075436_100208625
1220 Ga0097620_100004119
1221 Ga0097620_100198067
1222 Ga0097620_100327935
1223 Ga0097620_100430277
1224 Ga0097620_100749424
1225 Ga0097620_100792301
1226 Ga0099794_10085604
1227 Ga0099795_10004148
1228 Ga0099795_10068942
1229 Ga0105240_10001173
1230 Ga0105240_10008995
1231 Ga0105240_10019130
1232 Ga0105240_10064942
1233 Ga0105240_10069156
1234 Ga0105240_10108677
1235 Ga0105240_10127100
1236 Ga0105240_10200507
1237 Ga0105240_10283278
1238 Ga0105240_10303733
1239 Ga0105240_10500134
1240 Ga0105240_11746776
1241 Ga0111539_10005694
1242 Ga0111539_10060190
1243 Ga0111539_10615883
1244 Ga0105245_10075271
1245 Ga0105245_11337731
1246 Ga0105247_10000233
1247 Ga0105247_10012403
1248 Ga0105247_10202682
1249 Ga0105247_11056090
1250 Ga0114129_10104189
1251 Ga0105243_11809056
1252 Ga0105241_10429656
1253 Ga0105241_10513062
1254 Ga0105241_10757611
1255 Ga0105242_10010801
1256 Ga0105242_10213676
1257 Ga0105242_10365787
1258 Ga0105242_10520623
1259 Ga0105242_11079691
1260 Ga0105248_10005023
1261 Ga0105248_10440185
1262 Ga0105248_11538174
1263 Ga0105237_10064865
1264 Ga0105237_10074879
1265 Ga0105237_10135041
1266 Ga0105237_10301187
1267 Ga0105237_10346105
1268 Ga0105238_10002316
1269 Ga0105238_10019715
1270 Ga0105238_10055950
1271 Ga0105238_10113117
1272 Ga0105238_10141644
1273 Ga0105238_10227427
1274 Ga0105238_10255452
1275 Ga0105238_10580757
1276 Ga0105249_10086181
1277 Ga0105249_10095526
1278 Ga0105249_10421450
1279 Ga0105249_10475595
1280 Ga0105249_10660702
1281 Ga0105030_107969
1282 Ga0099796_10006870
1283 Ga0105239_10373422
1284 Ga0105239_10611511
1285 Ga0105239_10692038
1286 Ga0105239_11128953
1287 Ga0105246_11138257
1288 Ga0157370_10001000
1289 Ga0157370_10769347
1290 Ga0157370_11166648
1291 Ga0157369_10012063
1292 Ga0157369_10267051
1293 Ga0157369_10364086
1294 Ga0157369_10810287
1295 Ga0157369_10972713
1296 Ga0157369_11277983
1297 Ga0157374_10238699
1298 Ga0157374_10416706
1299 Ga0157374_10517772
1300 Ga0157378_10040872
1301 Ga0157378_10054988
1302 Ga0163162_10107404
1303 Ga0163162_10163682
1304 Ga0163162_11059411
1305 Ga0157372_10061340
1306 Ga0157372_10172800
1307 Ga0157372_10641194
1308 Ga0157372_10715392
1309 Ga0157372_11193860
1310 Ga0157375_10006160
1311 Ga0157375_10144830
1312 Ga0163163_10062321
1313 Ga0163163_10094096
1314 Ga0163163_10098153
1315 Ga0163163_10110396
1316 Ga0163163_10271030
1317 Ga0163163_10362033
1318 Ga0163163_10447644
1319 Ga0163163_10747810
1320 Ga0157380_10006488
1321 Ga0157380_10018385
1322 Ga0157380_10019445
1323 Ga0157380_10029531
1324 Ga0157380_10034435
1325 Ga0157380_10048541
1326 Ga0157380_10113939
1327 Ga0157380_10270079
1328 Ga0157377_10184017
1329 Ga0157379_10023361
1330 Ga0157379_10054291
1331 Ga0157379_10054721
1332 Ga0157379_10129068
1333 Ga0157379_10191037
1334 Ga0157379_10752390
1335 Ga0157379_10898289
1336 Ga0157379_11064911
1337 Ga0157376_10042389
1338 Ga0157376_10285966
1339 Ga0157376_10367887
1340 Ga0157376_11239439
1341 Ga0157376_12215256
1342 Ga0197907_10910721
1343 Ga0213872_10170418
1344 Ga0213874_10028837
1345 Ga0213874_10079968
1346 Ga0213874_10217635
1347 Ga0213876_10085012
1348 Ga0213876_10209494
1349 Ga0224712_10631440
1350 Ga0228598_1028368
1351 Ga0207656_10241780
1352 Ga0207682_10003313
1353 Ga0207682_10005611
1354 Ga0207682_10379223
1355 Ga0207692_10379710
1356 Ga0207642_10055749
1357 Ga0207642_10380908
1358 Ga0207642_10502936
1359 Ga0207710_10000201
1360 Ga0207680_10247279
1361 Ga0207680_10760287
1362 Ga0207685_10121858
1363 Ga0207685_10142182
1364 Ga0207685_10352875
1365 Ga0207699_10029870
1366 Ga0207699_10034043
1367 Ga0207699_10769382
1368 Ga0207699_10825005
1369 Ga0207699_10870939
1370 Ga0207645_10181840
1371 Ga0207643_10011260
1372 Ga0207643_10133989
1373 Ga0207707_10002563
1374 Ga0207707_10005125
1375 Ga0207707_10034584
1376 Ga0207707_10094049
1377 Ga0207707_10188602
1378 Ga0207707_10397706
1379 Ga0207695_10008576
1380 Ga0207695_10083482
1381 Ga0207695_10119723
1382 Ga0207695_10167856
1383 Ga0207695_10297350
1384 Ga0207695_10363688
1385 Ga0207695_10589630
1386 Ga0207695_10985401
1387 Ga0207671_10125028
1388 Ga0207671_10162008
1389 Ga0207671_10268227
1390 Ga0207693_10000504
1391 Ga0207693_10085140
1392 Ga0207663_10095173
1393 Ga0207663_10262273
1394 Ga0207663_10266286
1395 Ga0207663_10520252
1396 Ga0207660_10034299
1397 Ga0207660_10043141
1398 Ga0207660_10066645
1399 Ga0207660_11291684
1400 Ga0207657_10157492
1401 Ga0207649_11083828
1402 Ga0207652_10005625
1403 Ga0207652_10041710
1404 Ga0207652_10059561
1405 Ga0207652_10161919
1406 Ga0207652_10295307
1407 Ga0207652_10296029
1408 Ga0207652_10301899
1409 Ga0207652_10351894
1410 Ga0207694_10310382
1411 Ga0207694_10574763
1412 Ga0207694_10949198
1413 Ga0207650_10293741
1414 Ga0207659_10038986
1415 Ga0207659_10173280
1416 Ga0207687_10113306
1417 Ga0207687_10360615
1418 Ga0207700_10035973
1419 Ga0207700_10048329
1420 Ga0207700_10223259
1421 Ga0207700_10629090
1422 Ga0207664_10023491
1423 Ga0207664_11309316
1424 Ga0207644_10019585
1425 Ga0207644_10074500
1426 Ga0207644_10505370
1427 Ga0207690_10697987
1428 Ga0207706_10186322
1429 Ga0207686_10133587
1430 Ga0207686_10237894
1431 Ga0207709_10055774
1432 Ga0207670_10219925
1433 Ga0207670_10462434
1434 Ga0207670_10710493
1435 Ga0207670_10991982
1436 Ga0207669_10011913
1437 Ga0207669_10140071
1438 Ga0207669_10401784
1439 Ga0207704_10692614
1440 Ga0207665_10001101
1441 Ga0207665_10024483
1442 Ga0207665_10105960
1443 Ga0207691_10003800
1444 Ga0207691_10011067
1445 Ga0207691_10450321
1446 Ga0207711_10062553
1447 Ga0207711_10365682
1448 Ga0207711_10569001
1449 Ga0207711_10684875
1450 Ga0207689_10125712
1451 Ga0207689_10285138
1452 Ga0207689_10394036
1453 Ga0207689_11282875
1454 Ga0207661_10305127
1455 Ga0207679_10308371
1456 Ga0207679_10363017
1457 Ga0207679_10581953
1458 Ga0207679_11372584
1459 Ga0207667_10008439
1460 Ga0207667_10022646
1461 Ga0207667_10076501
1462 Ga0207667_10222530
1463 Ga0207667_11800497
1464 Ga0207651_10074944
1465 Ga0207651_10301027
1466 Ga0207651_10442318
1467 Ga0207651_10990310
1468 Ga0207651_11093608
1469 Ga0207712_10078343
1470 Ga0207712_10541867
1471 Ga0207712_10695769
1472 Ga0207668_10218273
1473 Ga0207668_10671333
1474 Ga0207668_11023663
1475 Ga0207658_10000303
1476 Ga0207658_10024530
1477 Ga0207658_10034700
1478 Ga0207658_10205862
1479 Ga0207658_11340156
1480 Ga0207677_10057464
1481 Ga0207703_10003121
1482 Ga0207703_10006615
1483 Ga0207703_10092458
1484 Ga0207703_10789439
1485 Ga0207703_11829831
1486 Ga0207639_10204555
1487 Ga0207639_11083032
1488 Ga0207639_12019751
1489 Ga0207678_10144536
1490 Ga0207678_10296965
1491 Ga0207708_10016081
1492 Ga0207708_10324412
1493 Ga0207708_10355177
1494 Ga0207708_10775517
1495 Ga0207708_10880885
1496 Ga0207702_10148678
1497 Ga0207702_10629612
1498 Ga0207641_10003475
1499 Ga0207641_10004348
1500 Ga0207641_10145565
1501 Ga0207641_10344643
1502 Ga0207641_10433822
1503 Ga0207641_10630206
1504 Ga0207641_10742867
1505 Ga0207641_12262864
1506 Ga0207648_10024833
1507 Ga0207648_10048166
1508 Ga0207648_10059568
1509 Ga0207676_10007753
1510 Ga0207676_10439291
1511 Ga0207674_10273415
1512 Ga0207675_100002742
1513 Ga0207675_100018690
1514 Ga0207675_100027461
1515 Ga0207675_100096122
1516 Ga0207675_100128928
1517 Ga0207675_100434221
1518 Ga0207675_100937085
1519 Ga0207683_10061481
1520 Ga0207683_10123215
1521 Ga0207683_10298547
1522 Ga0207683_10766420
1523 Ga0207698_10516891
1524 Ga0209996_1032536
1525 Ga0210002_1045303
1526 Ga0209588_1051957
1527 Ga0209966_1104527
1528 Ga0209974_10087375
1529 Ga0207428_10000990
1530 Ga0265354_1000834
1531 Ga0265356_1001137
1532 Ga0265355_1007989
1533 Ga0268266_10002557
1534 Ga0268266_10006072
1535 Ga0268266_10006493
1536 Ga0268266_10075426
1537 Ga0268266_10080204
1538 Ga0268266_10125135
1539 Ga0268266_10140339
1540 Ga0268266_10167606
1541 Ga0268266_10900407
1542 Ga0268265_10038525
1543 Ga0268265_10182138
1544 Ga0268265_10198098
1545 Ga0268265_10200532
1546 Ga0268265_10421447
1547 Ga0268265_11139119
1548 Ga0268264_10001238
1549 Ga0268264_10030059
1550 Ga0268264_10034163
1551 Ga0268264_10252960
1552 Ga0268264_11210140
1553 Ga0265318_10153719
1554 Ga0307515_10006279
1555 Ga0265338_10565779
1556 Ga0307511_10000172
1557 Ga0307511_10013004
1558 Ga0307511_10114098
1559 Ga0265770_1002356
1560 Ga0265771_1000328
1561 Ga0265773_1010374
1562 Ga0265760_10000462
1563 Ga0265760_10246424
1564 Ga0265340_10007525
1565 Ga0265339_10281921
1566 Ga0265339_10344780
1567 Ga0265331_10110405
1568 Ga0307513_10009329
1569 Ga0307513_10029412
1570 Ga0307513_10034337
1571 Ga0307513_10065152
1572 Ga0307513_10324651
1573 Ga0307509_10001027
1574 Ga0307509_10156836
1575 Ga0307509_10232468
1576 Ga0307408_100067860
1577 Ga0307408_100074277
1578 Ga0307408_100122985
1579 Ga0307408_100167946
1580 Ga0307408_101430908
1581 Ga0307408_101742039
1582 Ga0265313_10041615
1583 Ga0307514_10200908
1584 Ga0316575_10009676
1585 Ga0265314_10200051
1586 Ga0265314_10292498
1587 Ga0316576_10030261
1588 Ga0316578_10609274
1589 Ga0307516_10048270
1590 Ga0307516_10434446
1591 Ga0307405_10007840
1592 Ga0307405_10016044
1593 Ga0307405_10799654
1594 Ga0316577_10048607
1595 Ga0307413_10004099
1596 Ga0307413_10022662
1597 Ga0307410_10003481
1598 Ga0307410_10014862
1599 Ga0307410_10240121
1600 Ga0307410_10661886
1601 Ga0307406_10752500
1602 Ga0307406_11044795
1603 Ga0307407_10009190
1604 Ga0307407_10126846
1605 Ga0307407_10540485
1606 Ga0307412_10015163
1607 Ga0307412_10056917
1608 Ga0307412_10307943
1609 Ga0307409_100005159
1610 Ga0307409_100062053
1611 Ga0307409_100138477
1612 Ga0307409_100148629
1613 Ga0307409_100326915
1614 Ga0307416_100018394
1615 Ga0307416_100332688
1616 Ga0307416_100521976
1617 Ga0307416_100921045
1618 Ga0307416_101094738
1619 Ga0307416_101355486
1620 Ga0307414_10012857
1621 Ga0307414_10111053
1622 Ga0307414_11058530
1623 Ga0307411_10001043
1624 Ga0307411_10017387
1625 Ga0307411_10042910
1626 Ga0307411_10792667
1627 Ga0307411_11291796
1628 Ga0307415_100041219
1629 Ga0307415_100240380
1630 Ga0307510_10000010
1631 Ga0307510_10019615
1632 Ga0316212_1027775
1633 Ga0373923_0332737
1634 Ga0373936_0014123
1635 Ga0373936_0019053
1636 Ga0373936_0096979
1637 Ga0373936_0220327
1638 Ga0373953_0026671
1639 Ga0373953_0134946
1640 Ga0373953_0156694
1641 Ga0373954_0079775
1642 Ga0373956_0142596
1643 Ga0373956_0244541
1644 Ga0373943_0074814
1645 Ga0373955_0143437
1646 Ga0373955_0308838
1647 Ga0316574_0072750
1648 Ga0373924_0159693
1649 Ga0373924_0206938
1650 Ga0373935_0696693
1651 Ga0373927_0026014
1652 Ga0373927_0168559
1653 Ga0373933_0012633
1654 Ga0373933_0534519
1655 Ga0373947_0116053
1656 Ga0373937_0203792
1657 Ga0373937_0369215
1658 Ga0373937_0445582
1659 Ga0316584_0087069
1660 Ga0373925_0072983
1661 Ga0373925_0459402
1662 Ga0373925_0477407
1663 Ga0395900_0035103
1664 Ga0395898_0028526
1665 Ga0395898_0042737
1666 Ga0395898_0046444
1667 Ga0395898_0171233
1668 Ga0395905_0731640
1669 Ga0395905_1575270
1670 Ga0436365_0303382
1671 Ga0436365_0338742
1672 Ga0436365_0869677
1673 Ga0436365_0908999
1674 Ga0436360_0033999
1675 Ga0436360_0335434
1676 Ga0436360_0928068
1677 Ga0436361_1016867
1678 Ga0436361_1172308
1679 Ga0436361_1176747
1680 Ga0436363_0122084
1681 Ga0436363_0268552
1682 Ga0436363_0378144
1683 Ga0436363_0861289
1684 Ga0436363_1158081
1685 Ga0436363_1328184
1686 Ga0436363_1591892
1687 Ga0436362_0937886
1688 Ga0439439_0045723
1689 Ga0439453_0011553
1690 Ga0451787_417005
1691 Ga0451789_0579430
1692 Ga0451791_1119097
1693 Ga0451791_1750484
1694 Ga0451793_0229681
1695 Ga0451797_0553840
1696 Ga0451795_1018544
1697 Ga0451800_0299913
1698 Ga0451800_0510418
1699 Ga0451800_1642085
1700 Ga0451802_0265411
1701 Ga0451802_1746363
1702 Ga0451804_0808277
1703 Ga0451804_0832309
1704 Ga0451807_0666976
1705 Ga0451807_1774474
1706 Ga0451833_0262536
1707 Ga0451837_0300169
1708 Ga0451839_0947681
1709 Ga0451851_0365422
1710 Ga0451853_0413289
1711 Ga0451853_1200973
1712 Ga0439431_0027472
1713 Ga0439433_0009397
1714 Ga0439442_018200
1715 Ga0439443_008288
1716 Ga0439456_017772
1717 Ga0450920_004346
1718 Ga0450923_001623
1719 Ga0450923_001799
1720 Ga0450923_093410
1721 Ga0450923_097886
1722 Ga0450894_004282
1723 Ga0450895_000816
1724 Ga0450896_002134
1725 Ga0450898_014493
1726 Ga0450910_012031
1727 Ga0450910_012345
1728 Ga0439446_0000369
1729 Ga0439446_0005318
1730 Ga0439446_0032069
1731 Ga0450908_004140
1732 Ga0439434_0000893
1733 Ga0439435_0000462
1734 Ga0439444_0000456
1735 Ga0439459_0040765
1736 Ga0439464_0162601
1737 Ga0450918_007153
1738 Ga0451577_0097002
1739 Ga0451577_0653005
1740 Ga0466969_0000982
1741 Ga0466969_0001200
1742 Ga0466969_0082749
1743 Ga0466969_0101989
1744 Ga0466965_0066072
1745 Ga0466966_0030307
1746 Ga0466966_0044847
1747 Ga0466966_0094645
1748 Ga0466961_0000578
1749 Ga0466964_0000252
1750 Ga0453684_0440648
1751 Ga0466971_0000941
1752 Ga0466970_0035215
1753 Ga0466957_0064636
1754 Ga0466960_0094798
1755 Ga0466959_0014261
1756 Ga0466959_0064687
1757 Ga0466959_0205595
1758 Ga0466959_0216794
1759 Ga0466959_0518270
1760 Ga0451576_0068277
1761 Ga0451576_1265543
1762 Ga0466958_0031544
1763 Ga0466967_0437847
1764 Ga0495617_096422
1765 Ga0495590_0057281
1766 Ga0495590_0071514
1767 Ga0495591_072580
1768 Ga0495629_0310940
1769 Ga0495638_0001478
1770 Ga0495638_0050101
1771 Ga0495638_0142698
1772 Ga0495638_0197188
1773 Ga0495580_0006591
1774 Ga0495580_0020718
1775 Ga0495580_0041092
1776 Ga0495580_0225236
1777 Ga0495580_0395823
1778 Ga0495605_0208624
1779 Ga0495639_0353189
1780 Ga0495664_0381127
1781 Ga0495585_0115260
1782 Ga0495606_0108932
1783 Ga0495608_0260742
1784 Ga0495616_0000953
1785 Ga0495616_0052807
1786 Ga0495618_0231002
1787 Ga0495620_0081264
1788 Ga0495628_0195959
1789 Ga0495630_0149600
1790 Ga0495632_0020802
1791 Ga0495632_0044299
1792 Ga0495643_0329515
1793 Ga0495644_0053648
1794 Ga0495652_0620543
1795 Ga0495586_0489156
1796 Ga0495587_0430642
1797 Ga0495598_0113017
1798 Ga0495656_0077574
1799 Ga0495668_0115392
1800 Ga0495668_0475624
1801 Ga0495611_0075189
1802 Ga0495625_0029944
1803 Ga0495625_0081472
1804 Ga0495625_0092738
1805 Ga0495625_0097404
1806 Ga0495625_0202321
1807 Ga0495635_0463410
1808 Ga0495659_0134657
1809 Ga0495657_0351105
1810 Ga0495599_0177400
1811 Ga0495599_0608715
1812 Ga0495647_0177246
1813 Ga0495658_0452817
1814 Ga0495658_0884994
1815 Ga0495613_0288223
1816 Ga0495613_0521420
1817 Ga0495671_0523726
1818 Ga0495649_0047310
1819 Ga0495649_0189790
1820 Ga0495604_0545513
1821 Ga0495680_0173575
1822 Ga0495687_040056
1823 Ga0495687_074242
1824 Ga0495681_0036130
1825 Ga0495686_0064610
1826 Ga0495686_0364049
1827 Ga0495602_0351646
1828 Ga0496100_0133500
1829 Ga0496100_0929492
1830 Ga0496101_0111028
1831 Ga0496101_0290623
1832 Ga0496101_0472422
1833 Ga0496102_0012586
1834 Ga0496102_0025352
1835 Ga0496102_0028547
1836 Ga0496104_0021923
1837 Ga0496104_0207214
1838 Ga0496104_0230361
1839 Ga0496105_0019756
1840 Ga0496105_0183316
1841 Ga0496105_0206325
1842 Ga0496106_0095620
1843 Ga0496106_0109593
1844 Ga0496107_0136732
1845 Ga0496107_0686813
1846 Ga0496108_0055001
1847 Ga0496109_0672668
1848 Ga0496109_1300234
1849 Ga0496110_0033998
1850 Ga0496111_0419988
1851 Ga0496112_0236706
1852 Ga0496113_0285438
1853 Ga0496114_0024321
1854 Ga0496114_0112791
1855 Ga0496114_0298917
1856 Ga0496115_0014977
1857 Ga0496116_0009539
1858 Ga0496117_0000581
1859 Ga0496118_0001068
1860 Ga0496118_0042982
1861 Ga0496119_0006293
1862 Ga0496119_0022325
1863 Ga0496120_0007212
1864 Ga0496120_0018016
1865 Ga0496121_0003828
1866 Ga0496121_0039297
1867 Ga0496121_0143634
1868 Ga0496124_0159819
1869 Ga0496125_0000553
1870 Ga0496125_0008847
1871 Ga0496125_0024657
1872 Ga0496125_0402185
1873 Ga0496125_0417972
1874 Ga0496126_0010409
1875 Ga0496126_0041287
1876 Ga0496126_0055830
1877 Ga0496126_0223740
1878 Ga0496126_0597240
1879 Ga0496126_0630455
1880 Ga0501031_0015117
1881 Ga0501032_0198905
1882 Ga0501036_0146115
1883 Ga0501036_0161723
1884 Ga0501036_0377202
1885 Ga0501036_1126164
1886 Ga0501037_0417099
1887 Ga0501038_0058049
1888 Ga0501038_0758606
1889 Ga0501039_0000970
1890 Ga0501039_0320378
1891 Ga0501040_0044629
1892 Ga0501040_0144164
1893 Ga0501040_0357800
1894 Ga0501041_0015807
1895 Ga0501041_0043472
1896 Ga0501042_0068228
1897 Ga0501042_0206461
1898 Ga0501042_0224338
1899 Ga0501042_0854873
1900 Ga0501043_0026690
1901 Ga0501046_0020094
1902 Ga0501046_0559762
1903 Ga0501047_0172845
1904 Ga0501047_0884226
1905 Ga0501047_1064472
1906 Ga0501048_0006642
1907 Ga0501048_0028166
1908 Ga0501048_0208287
1909 Ga0501048_0271543
1910 Ga0501067_0009497
1911 Ga0501067_0016021
1912 Ga0501068_0000877
1913 Ga0501068_0015711
1914 Ga0501069_0292162
1915 Ga0501070_0964995
1916 Ga0501071_0000217
1917 Ga0501071_0003860
1918 Ga0501071_0015529
1919 Ga0501071_0149101
1920 Ga0501072_0030680
1921 Ga0501072_0091121
1922 Ga0501073_0002934
1923 Ga0501073_0036663
1924 Ga0501073_0253118
1925 Ga0501073_0323756
1926 Ga0501073_0524211
1927 Ga0501074_0005690
1928 Ga0501074_0040383
1929 Ga0501074_0055774
1930 Ga0501074_0106747
1931 Ga0501075_0006246
1932 Ga0501076_0000571
1933 Ga0501076_0237794
1934 Ga0501076_0308509
1935 Ga0501076_0470952
1936 Ga0501076_0798339
1937 Ga0501076_1155329
1938 Ga0501077_0061780
1939 Ga0501077_0090215
1940 Ga0501077_0181557
1941 Ga0501077_0359010
1942 Ga0501079_0006287
1943 Ga0501079_0047992
1944 Ga0501079_0176423
1945 Ga0501079_0355162
1946 Ga0501079_1141123
1947 Ga0501080_0051988
1948 Ga0501080_0064731
1949 Ga0501080_0130907
1950 Ga0501080_0186836
1951 Ga0501080_0550258
1952 Ga0501081_0001576
1953 Ga0501081_0053945
1954 Ga0501081_0291103
1955 Ga0501083_0072663
1956 Ga0501083_0215490
1957 Ga0501035_0075026
1958 Ga0501035_0249314
1959 Ga0501035_0345593
1960 Ga0501044_0660648
1961 Ga0501045_0000563
1962 Ga0501045_0103998
1963 Ga0501045_0308044
1964 nmdc:mga05p37_143344_c1
1965 nmdc:mga08y16_35804_c1
1966 nmdc:mga08y16_493239_c1
1967 nmdc:mga08y16_7354_c1
1968 nmdc:mga0n895_199652_c1
1969 nmdc:mga0rr50_11973_c1
1970 nmdc:mga08x19_217680_c1
1971 Ga0495612_0078887
1972 Ga0495595_0399236
1973 Ga0500644_0075279
1974 Ga0500644_0263268
1975 Ga0500646_0009703
1976 Ga0500583_0008807
1977 Ga0500583_0035077
1978 Ga0500583_0061322
1979 Ga0500651_0054681
1980 Ga0500641_0017271
1981 Ga0500641_0054606
1982 Ga0500641_0197909
1983 Ga0500650_0499997
1984 Ga0500556_0000801
1985 Ga0500556_0248461
1986 Ga0500562_020126
1987 Ga0500591_063973
1988 Ga0500595_018281
1989 Ga0500614_164402
1990 Ga0500628_061724
1991 Ga0500652_197747
1992 Ga0500658_0136358
1993 Ga0500568_0001263
1994 Ga0500568_0049181
1995 Ga0500577_0258285
1996 Ga0500590_149032
1997 Ga0500616_0000092
1998 Ga0500616_0021879
1999 Ga0500616_0022231
2000 Ga0500627_0323827
2001 Ga0500630_127871
2002 Ga0500636_0232782
2003 Ga0500596_044456
2004 Ga0501084_0050268
2005 Ga0501084_0064716
2006 Ga0501084_0107580
2007 Ga0501084_0251930
2008 Ga0501084_0641237
2009 Ga0501082_0000958
2010 Ga0501082_0197914
2011 Ga0501082_0686899
2012 Ga0466962_0000530
2013 Ga0466962_0169473
2014 Ga0530510_0008083

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

6

134

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pxu-assembly1.cif.gz_A crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei bound to dephospho-coenzyme a 0.874 1 157
3l93-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from yersinia pestis. 0.8674 1 159
8i8j-assembly1.cif.gz_B error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8i8j 0.865 1 157
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.8634 1 158
3k9w-assembly1.cif.gz_A crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei with hydrolyzed 3'-dephospho coenzyme a 0.8625 1 157
ID Description Score Start End Superfamily
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8607 1 159 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8533 3 159 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8508 1 159 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8507 1 159 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8428 3 159 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A4R4AKA4-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.8786 3 157 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A7C5HWS1-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.8775 3 157 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A6L7MAV5-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.8771 4 157 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A5C7VCV9-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.8768 3 157 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A836WT33-F1-model_v4 deleted 0.8756 3 157

Map