F488041
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 424 | 2014 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1311778|Ga0436365_1311778_8997_9476 |
| Length | 159 |
| Sequence | MKRNAVYPGTFDPITNGHQDLVRRAAGIFDRVIVAIAANPYKAPLFPLAKRVELARGVLADLPNVEVQGYDGLTVDFARRYSAVIVRGLRAVSDFEFEFQLANMSRHLDREFETVFLTPQEQFTFISSTLVREIAVLGGDVREFVHPLVEAELKKHRRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 111 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 179 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 180 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 200 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 207 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 208 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 239 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 243 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 244 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 255 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 256 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 257 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 260 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 261 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 262 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 263 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 264 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 265 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 266 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 267 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 268 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 269 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 270 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 271 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 272 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 273 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 274 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 275 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 276 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 287 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 290 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 293 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 294 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 343 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 344 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 349 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 350 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 351 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 352 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 353 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 354 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 355 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 356 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 359 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 360 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 401 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 402 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 403 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 408 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 410 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 411 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 412 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 415 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 416 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 418 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 419 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0.7 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.08 |
| Nodule | 0 |
| Rhizoplane | 4.47 |
| Rhizosphere | 86.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436365_1311778 | 3300039437 | Bacteria | 9617 |
| 2 | Ga0070676_10059641 | 3300005328 | Bacteria | 2264 |
| 3 | Ga0070683_100018504 | 3300005329 | Bacteria | 6172 |
| 4 | Ga0070690_100032408 | 3300005330 | Bacteria | 3264 |
| 5 | Ga0070690_100272676 | 3300005330 | Bacteria | 1204 |
| 6 | Ga0070690_100538125 | 3300005330 | Bacteria | 879 |
| 7 | Ga0070670_100034693 | 3300005331 | Bacteria | 4342 |
| 8 | Ga0070670_100330055 | 3300005331 | Bacteria | 1338 |
| 9 | Ga0070677_10049724 | 3300005333 | Bacteria | 1690 |
| 10 | Ga0070677_10189239 | 3300005333 | Bacteria | 985 |
| 11 | Ga0068869_100109697 | 3300005334 | Bacteria | 2098 |
| 12 | Ga0068869_100133696 | 3300005334 | Bacteria | 1909 |
| 13 | Ga0068869_100401934 | 3300005334 | Bacteria | 1127 |
| 14 | Ga0068869_101207920 | 3300005334 | Bacteria | 665 |
| 15 | Ga0070666_10020519 | 3300005335 | Bacteria | 4272 |
| 16 | Ga0070666_10640677 | 3300005335 | Bacteria | 777 |
| 17 | Ga0070666_11233348 | 3300005335 | Bacteria | 557 |
| 18 | Ga0070680_100000968 | 3300005336 | Bacteria | 20318 |
| 19 | Ga0070680_100023132 | 3300005336 | Bacteria | 4954 |
| 20 | Ga0070680_100773082 | 3300005336 | Bacteria | 827 |
| 21 | Ga0070682_100061248 | 3300005337 | Bacteria | 2382 |
| 22 | Ga0070682_100066875 | 3300005337 | Bacteria | 2288 |
| 23 | Ga0070682_100431172 | 3300005337 | Bacteria | 1004 |
| 24 | Ga0068868_100485231 | 3300005338 | Bacteria | 1080 |
| 25 | Ga0070689_100003519 | 3300005340 | Bacteria | 10415 |
| 26 | Ga0070689_100104945 | 3300005340 | Bacteria | 2241 |
| 27 | Ga0070691_10232450 | 3300005341 | Bacteria | 982 |
| 28 | Ga0070661_101230832 | 3300005344 | Bacteria | 627 |
| 29 | Ga0070661_101439008 | 3300005344 | Bacteria | 580 |
| 30 | Ga0070668_100380040 | 3300005347 | Bacteria | 1202 |
| 31 | Ga0070668_100602234 | 3300005347 | Bacteria | 961 |
| 32 | Ga0070669_100183600 | 3300005353 | Bacteria | 1638 |
| 33 | Ga0070669_100334463 | 3300005353 | Bacteria | 1226 |
| 34 | Ga0070675_100004710 | 3300005354 | Bacteria | 10413 |
| 35 | Ga0070675_100438038 | 3300005354 | Bacteria | 1171 |
| 36 | Ga0070675_100709863 | 3300005354 | Bacteria | 916 |
| 37 | Ga0070675_100753352 | 3300005354 | Bacteria | 889 |
| 38 | Ga0070671_100088963 | 3300005355 | Bacteria | 2584 |
| 39 | Ga0070671_100201924 | 3300005355 | Bacteria | 1686 |
| 40 | Ga0070671_100567660 | 3300005355 | Bacteria | 979 |
| 41 | Ga0070674_100031373 | 3300005356 | Bacteria | 3521 |
| 42 | Ga0070674_100041631 | 3300005356 | Bacteria | 3115 |
| 43 | Ga0070674_100196063 | 3300005356 | Bacteria | 1556 |
| 44 | Ga0070673_100059868 | 3300005364 | Bacteria | 3016 |
| 45 | Ga0070673_100104718 | 3300005364 | Bacteria | 2337 |
| 46 | Ga0070673_100566882 | 3300005364 | Bacteria | 1033 |
| 47 | Ga0070673_101206812 | 3300005364 | Bacteria | 709 |
| 48 | Ga0070659_100181683 | 3300005366 | Bacteria | 1727 |
| 49 | Ga0070667_100005254 | 3300005367 | Bacteria | 10827 |
| 50 | Ga0070667_100041203 | 3300005367 | Bacteria | 3874 |
| 51 | Ga0070667_100483489 | 3300005367 | Bacteria | 1134 |
| 52 | Ga0070709_10397554 | 3300005434 | Bacteria | 1028 |
| 53 | Ga0070709_10795717 | 3300005434 | Bacteria | 742 |
| 54 | Ga0070713_100008265 | 3300005436 | Bacteria | 7377 |
| 55 | Ga0070713_100063685 | 3300005436 | Bacteria | 3093 |
| 56 | Ga0070713_100074838 | 3300005436 | Bacteria | 2870 |
| 57 | Ga0070713_100206967 | 3300005436 | Bacteria | 1774 |
| 58 | Ga0070713_100952283 | 3300005436 | Bacteria | 827 |
| 59 | Ga0070710_10048728 | 3300005437 | Bacteria | 2367 |
| 60 | Ga0070701_10039868 | 3300005438 | Bacteria | 2385 |
| 61 | Ga0070711_100015720 | 3300005439 | Bacteria | 4792 |
| 62 | Ga0070711_100031371 | 3300005439 | Bacteria | 3528 |
| 63 | Ga0070711_100310571 | 3300005439 | Bacteria | 1257 |
| 64 | Ga0070705_100385418 | 3300005440 | Bacteria | 1033 |
| 65 | Ga0070705_100852803 | 3300005440 | Bacteria | 729 |
| 66 | Ga0070700_100039274 | 3300005441 | Bacteria | 2890 |
| 67 | Ga0070700_100042098 | 3300005441 | Bacteria | 2803 |
| 68 | Ga0070700_100376932 | 3300005441 | Bacteria | 1060 |
| 69 | Ga0070700_101495909 | 3300005441 | Bacteria | 574 |
| 70 | Ga0070694_100199770 | 3300005444 | Bacteria | 1490 |
| 71 | Ga0070663_100472475 | 3300005455 | Bacteria | 1037 |
| 72 | Ga0070663_100889462 | 3300005455 | Bacteria | 769 |
| 73 | Ga0070663_101106769 | 3300005455 | Bacteria | 693 |
| 74 | Ga0070678_100097616 | 3300005456 | Bacteria | 2269 |
| 75 | Ga0070678_100131843 | 3300005456 | Bacteria | 1987 |
| 76 | Ga0070662_100164274 | 3300005457 | Bacteria | 1739 |
| 77 | Ga0070662_100869756 | 3300005457 | Bacteria | 768 |
| 78 | Ga0070681_10003465 | 3300005458 | Bacteria | 14778 |
| 79 | Ga0070681_10005119 | 3300005458 | Bacteria | 12655 |
| 80 | Ga0070681_10026451 | 3300005458 | Bacteria | 5830 |
| 81 | Ga0070681_10057408 | 3300005458 | Bacteria | 3872 |
| 82 | Ga0070681_10081733 | 3300005458 | Bacteria | 3187 |
| 83 | Ga0070681_10212956 | 3300005458 | Bacteria | 1848 |
| 84 | Ga0070681_10319999 | 3300005458 | Bacteria | 1461 |
| 85 | Ga0070681_10496755 | 3300005458 | Bacteria | 1133 |
| 86 | Ga0070681_11080631 | 3300005458 | Bacteria | 723 |
| 87 | Ga0068867_100066038 | 3300005459 | Bacteria | 2694 |
| 88 | Ga0068867_100147690 | 3300005459 | Bacteria | 1844 |
| 89 | Ga0070685_10166632 | 3300005466 | Bacteria | 1409 |
| 90 | Ga0070699_100133771 | 3300005518 | Bacteria | 2187 |
| 91 | Ga0070679_100026143 | 3300005530 | Bacteria | 5731 |
| 92 | Ga0070679_100071807 | 3300005530 | Bacteria | 3453 |
| 93 | Ga0070679_100079665 | 3300005530 | Bacteria | 3265 |
| 94 | Ga0070679_100133960 | 3300005530 | Bacteria | 2459 |
| 95 | Ga0070679_100214429 | 3300005530 | Bacteria | 1888 |
| 96 | Ga0070679_100263589 | 3300005530 | Bacteria | 1678 |
| 97 | Ga0070679_100267623 | 3300005530 | Bacteria | 1664 |
| 98 | Ga0070684_100063122 | 3300005535 | Bacteria | 3246 |
| 99 | Ga0068853_100318914 | 3300005539 | Bacteria | 1440 |
| 100 | Ga0068853_100636393 | 3300005539 | Bacteria | 1014 |
| 101 | Ga0070672_100018864 | 3300005543 | Bacteria | 4996 |
| 102 | Ga0070672_100138828 | 3300005543 | Bacteria | 2003 |
| 103 | Ga0070686_100040720 | 3300005544 | Bacteria | 2900 |
| 104 | Ga0070686_100075511 | 3300005544 | Bacteria | 2217 |
| 105 | Ga0070686_100240435 | 3300005544 | Bacteria | 1318 |
| 106 | Ga0070686_100458541 | 3300005544 | Bacteria | 981 |
| 107 | Ga0070686_100519385 | 3300005544 | Bacteria | 927 |
| 108 | Ga0070695_100095346 | 3300005545 | Bacteria | 1994 |
| 109 | Ga0070695_100156284 | 3300005545 | Bacteria | 1596 |
| 110 | Ga0070696_100011512 | 3300005546 | Bacteria | 5925 |
| 111 | Ga0070696_100096560 | 3300005546 | Bacteria | 2112 |
| 112 | Ga0070696_100215163 | 3300005546 | Bacteria | 1440 |
| 113 | Ga0070696_100300554 | 3300005546 | Bacteria | 1229 |
| 114 | Ga0070693_100197309 | 3300005547 | Bacteria | 1305 |
| 115 | Ga0070693_100454102 | 3300005547 | Bacteria | 900 |
| 116 | Ga0070665_100001792 | 3300005548 | Bacteria | 24413 |
| 117 | Ga0070665_100006525 | 3300005548 | Bacteria | 11856 |
| 118 | Ga0070665_100014256 | 3300005548 | Bacteria | 7982 |
| 119 | Ga0070665_100017976 | 3300005548 | Bacteria | 7099 |
| 120 | Ga0070665_100030686 | 3300005548 | Bacteria | 5408 |
| 121 | Ga0070665_100049788 | 3300005548 | Bacteria | 4204 |
| 122 | Ga0070665_100107726 | 3300005548 | Bacteria | 2789 |
| 123 | Ga0070665_100647534 | 3300005548 | Bacteria | 1070 |
| 124 | Ga0070665_100666866 | 3300005548 | Bacteria | 1053 |
| 125 | Ga0070704_100207122 | 3300005549 | Bacteria | 1587 |
| 126 | Ga0068855_100004111 | 3300005563 | Bacteria | 17752 |
| 127 | Ga0068855_100007561 | 3300005563 | Bacteria | 13146 |
| 128 | Ga0068855_100010659 | 3300005563 | Bacteria | 11087 |
| 129 | Ga0068855_100052155 | 3300005563 | Bacteria | 4816 |
| 130 | Ga0068855_100311930 | 3300005563 | Bacteria | 1740 |
| 131 | Ga0070664_100021561 | 3300005564 | Bacteria | 5312 |
| 132 | Ga0068857_100151222 | 3300005577 | Bacteria | 2103 |
| 133 | Ga0068857_100456434 | 3300005577 | Bacteria | 1195 |
| 134 | Ga0068854_100139110 | 3300005578 | Bacteria | 1861 |
| 135 | Ga0068854_100521584 | 3300005578 | Bacteria | 1004 |
| 136 | Ga0068856_100214570 | 3300005614 | Bacteria | 1940 |
| 137 | Ga0068856_100266115 | 3300005614 | Bacteria | 1730 |
| 138 | Ga0068856_100448067 | 3300005614 | Bacteria | 1311 |
| 139 | Ga0068856_100464880 | 3300005614 | Unclassified | 1286 |
| 140 | Ga0070702_100054766 | 3300005615 | Bacteria | 2296 |
| 141 | Ga0068852_100617935 | 3300005616 | Bacteria | 1089 |
| 142 | Ga0068859_100004119 | 3300005617 | Bacteria | 14828 |
| 143 | Ga0068859_100198070 | 3300005617 | Bacteria | 2093 |
| 144 | Ga0068859_100327927 | 3300005617 | Bacteria | 1625 |
| 145 | Ga0068859_100430338 | 3300005617 | Bacteria | 1416 |
| 146 | Ga0068859_100749426 | 3300005617 | Bacteria | 1066 |
| 147 | Ga0068864_100012721 | 3300005618 | Bacteria | 6956 |
| 148 | Ga0068866_10316910 | 3300005718 | Bacteria | 979 |
| 149 | Ga0068861_100003440 | 3300005719 | Bacteria | 10510 |
| 150 | Ga0068861_100004932 | 3300005719 | Bacteria | 8987 |
| 151 | Ga0068861_100107896 | 3300005719 | Bacteria | 2226 |
| 152 | Ga0068861_100178295 | 3300005719 | Bacteria | 1766 |
| 153 | Ga0068861_100219749 | 3300005719 | Bacteria | 1605 |
| 154 | Ga0068861_100229941 | 3300005719 | Bacteria | 1572 |
| 155 | Ga0068861_100406858 | 3300005719 | Bacteria | 1209 |
| 156 | Ga0068861_100893147 | 3300005719 | Bacteria | 841 |
| 157 | Ga0068861_100912073 | 3300005719 | Bacteria | 833 |
| 158 | Ga0068851_10190025 | 3300005834 | Bacteria | 1141 |
| 159 | Ga0068870_10002932 | 3300005840 | Bacteria | 7187 |
| 160 | Ga0068870_10424075 | 3300005840 | Bacteria | 871 |
| 161 | Ga0068863_100001602 | 3300005841 | Bacteria | 22360 |
| 162 | Ga0068863_100042144 | 3300005841 | Bacteria | 4337 |
| 163 | Ga0068863_100196967 | 3300005841 | Bacteria | 1936 |
| 164 | Ga0068863_100444362 | 3300005841 | Bacteria | 1272 |
| 165 | Ga0068863_100623449 | 3300005841 | Bacteria | 1068 |
| 166 | Ga0068863_101417686 | 3300005841 | Bacteria | 702 |
| 167 | Ga0068858_100001047 | 3300005842 | Bacteria | 28582 |
| 168 | Ga0068858_100003727 | 3300005842 | Bacteria | 15080 |
| 169 | Ga0068858_100111814 | 3300005842 | Bacteria | 2551 |
| 170 | Ga0068858_100246291 | 3300005842 | Bacteria | 1697 |
| 171 | Ga0068858_100247977 | 3300005842 | Bacteria | 1691 |
| 172 | Ga0068858_100267048 | 3300005842 | Bacteria | 1627 |
| 173 | Ga0068860_100011257 | 3300005843 | Bacteria | 8815 |
| 174 | Ga0068860_100080596 | 3300005843 | Bacteria | 3095 |
| 175 | Ga0068860_100111333 | 3300005843 | Bacteria | 2617 |
| 176 | Ga0068860_100264615 | 3300005843 | Bacteria | 1677 |
| 177 | Ga0068860_101121708 | 3300005843 | Bacteria | 806 |
| 178 | Ga0068862_100035494 | 3300005844 | Bacteria | 4223 |
| 179 | Ga0068862_100073411 | 3300005844 | Bacteria | 2956 |
| 180 | Ga0068862_100165484 | 3300005844 | Bacteria | 1977 |
| 181 | Ga0068862_100578320 | 3300005844 | Bacteria | 1076 |
| 182 | Ga0068862_101222130 | 3300005844 | Bacteria | 750 |
| 183 | Ga0068862_101369490 | 3300005844 | Bacteria | 710 |
| 184 | Ga0081455_10000812 | 3300005937 | Bacteria | 40224 |
| 185 | Ga0081455_10004966 | 3300005937 | Bacteria | 14710 |
| 186 | Ga0081539_10000007 | 3300005985 | Bacteria | 532790 |
| 187 | Ga0070717_10067689 | 3300006028 | Bacteria | 2971 |
| 188 | Ga0070715_10212742 | 3300006163 | Bacteria | 989 |
| 189 | Ga0070715_10458577 | 3300006163 | Bacteria | 721 |
| 190 | Ga0070716_100022541 | 3300006173 | Bacteria | 3330 |
| 191 | Ga0070712_100085564 | 3300006175 | Bacteria | 2295 |
| 192 | Ga0070712_100138588 | 3300006175 | Bacteria | 1853 |
| 193 | Ga0097621_100024793 | 3300006237 | Bacteria | 4688 |
| 194 | Ga0097621_100040528 | 3300006237 | Bacteria | 3745 |
| 195 | Ga0097621_100103993 | 3300006237 | Bacteria | 2392 |
| 196 | Ga0097621_100333498 | 3300006237 | Bacteria | 1346 |
| 197 | Ga0097621_100375570 | 3300006237 | Bacteria | 1269 |
| 198 | Ga0097621_100495507 | 3300006237 | Bacteria | 1106 |
| 199 | Ga0097621_101058680 | 3300006237 | Bacteria | 760 |
| 200 | Ga0097621_101187880 | 3300006237 | Bacteria | 718 |
| 201 | Ga0068871_100013848 | 3300006358 | Bacteria | 5996 |
| 202 | Ga0068871_100043523 | 3300006358 | Bacteria | 3607 |
| 203 | Ga0068871_100141596 | 3300006358 | Bacteria | 2045 |
| 204 | Ga0068871_100182633 | 3300006358 | Bacteria | 1803 |
| 205 | Ga0068871_100428187 | 3300006358 | Bacteria | 1183 |
| 206 | Ga0075428_100002675 | 3300006844 | Bacteria | 19362 |
| 207 | Ga0075428_101101009 | 3300006844 | Bacteria | 839 |
| 208 | Ga0075434_100206819 | 3300006871 | Bacteria | 1983 |
| 209 | Ga0075429_100242266 | 3300006880 | Bacteria | 1579 |
| 210 | Ga0075429_100687881 | 3300006880 | Bacteria | 896 |
| 211 | Ga0068865_100110615 | 3300006881 | Bacteria | 2026 |
| 212 | Ga0075436_100208625 | 3300006914 | Bacteria | 1385 |
| 213 | Ga0097620_100004119 | 3300006931 | Bacteria | 14828 |
| 214 | Ga0097620_100198067 | 3300006931 | Bacteria | 2093 |
| 215 | Ga0097620_100327935 | 3300006931 | Bacteria | 1625 |
| 216 | Ga0097620_100430277 | 3300006931 | Bacteria | 1416 |
| 217 | Ga0097620_100749424 | 3300006931 | Bacteria | 1066 |
| 218 | Ga0097620_100792301 | 3300006931 | Bacteria | 1036 |
| 219 | Ga0099794_10085604 | 3300007265 | Bacteria | 1560 |
| 220 | Ga0099795_10004148 | 3300007788 | Bacteria | 3702 |
| 221 | Ga0099795_10068942 | 3300007788 | Bacteria | 1330 |
| 222 | Ga0105240_10001173 | 3300009093 | Bacteria | 45933 |
| 223 | Ga0105240_10008995 | 3300009093 | Bacteria | 14193 |
| 224 | Ga0105240_10019130 | 3300009093 | Bacteria | 9157 |
| 225 | Ga0105240_10064942 | 3300009093 | Bacteria | 4532 |
| 226 | Ga0105240_10069156 | 3300009093 | Bacteria | 4371 |
| 227 | Ga0105240_10108677 | 3300009093 | Bacteria | 3360 |
| 228 | Ga0105240_10127100 | 3300009093 | Bacteria | 3062 |
| 229 | Ga0105240_10200507 | 3300009093 | Bacteria | 2339 |
| 230 | Ga0105240_10283278 | 3300009093 | Bacteria | 1903 |
| 231 | Ga0105240_10303733 | 3300009093 | Bacteria | 1825 |
| 232 | Ga0105240_10500134 | 3300009093 | Bacteria | 1352 |
| 233 | Ga0105240_11746776 | 3300009093 | Bacteria | 649 |
| 234 | Ga0111539_10005694 | 3300009094 | Bacteria | 16121 |
| 235 | Ga0111539_10060190 | 3300009094 | Bacteria | 4500 |
| 236 | Ga0111539_10615883 | 3300009094 | Bacteria | 1264 |
| 237 | Ga0105245_10075271 | 3300009098 | Bacteria | 3073 |
| 238 | Ga0105245_11337731 | 3300009098 | Bacteria | 766 |
| 239 | Ga0105247_10000233 | 3300009101 | Bacteria | 52855 |
| 240 | Ga0105247_10012403 | 3300009101 | Bacteria | 5118 |
| 241 | Ga0105247_10202682 | 3300009101 | Bacteria | 1334 |
| 242 | Ga0105247_11056090 | 3300009101 | Bacteria | 638 |
| 243 | Ga0114129_10104189 | 3300009147 | Bacteria | 3920 |
| 244 | Ga0105243_11809056 | 3300009148 | Bacteria | 642 |
| 245 | Ga0105241_10429656 | 3300009174 | Bacteria | 1164 |
| 246 | Ga0105241_10513062 | 3300009174 | Bacteria | 1071 |
| 247 | Ga0105241_10757611 | 3300009174 | Bacteria | 891 |
| 248 | Ga0105242_10010801 | 3300009176 | Bacteria | 7012 |
| 249 | Ga0105242_10213676 | 3300009176 | Bacteria | 1720 |
| 250 | Ga0105242_10365787 | 3300009176 | Bacteria | 1336 |
| 251 | Ga0105242_10520623 | 3300009176 | Bacteria | 1135 |
| 252 | Ga0105242_11079691 | 3300009176 | Bacteria | 815 |
| 253 | Ga0105248_10005023 | 3300009177 | Bacteria | 14608 |
| 254 | Ga0105248_10440185 | 3300009177 | Bacteria | 1468 |
| 255 | Ga0105248_11538174 | 3300009177 | Unclassified | 753 |
| 256 | Ga0105237_10064865 | 3300009545 | Bacteria | 3648 |
| 257 | Ga0105237_10074879 | 3300009545 | Bacteria | 3377 |
| 258 | Ga0105237_10135041 | 3300009545 | Bacteria | 2461 |
| 259 | Ga0105237_10301187 | 3300009545 | Bacteria | 1606 |
| 260 | Ga0105237_10346105 | 3300009545 | Bacteria | 1491 |
| 261 | Ga0105238_10002316 | 3300009551 | Bacteria | 19144 |
| 262 | Ga0105238_10019715 | 3300009551 | Bacteria | 6868 |
| 263 | Ga0105238_10055950 | 3300009551 | Bacteria | 3958 |
| 264 | Ga0105238_10113117 | 3300009551 | Bacteria | 2694 |
| 265 | Ga0105238_10141644 | 3300009551 | Bacteria | 2381 |
| 266 | Ga0105238_10227427 | 3300009551 | Bacteria | 1842 |
| 267 | Ga0105238_10255452 | 3300009551 | Bacteria | 1732 |
| 268 | Ga0105238_10580757 | 3300009551 | Bacteria | 1127 |
| 269 | Ga0105249_10086181 | 3300009553 | Bacteria | 2929 |
| 270 | Ga0105249_10095526 | 3300009553 | Bacteria | 2787 |
| 271 | Ga0105249_10421450 | 3300009553 | Bacteria | 1369 |
| 272 | Ga0105249_10475595 | 3300009553 | Bacteria | 1291 |
| 273 | Ga0105249_10660702 | 3300009553 | Bacteria | 1103 |
| 274 | Ga0105030_107969 | 3300009987 | Bacteria | 899 |
| 275 | Ga0099796_10006870 | 3300010159 | Bacteria | 2940 |
| 276 | Ga0105239_10373422 | 3300010375 | Bacteria | 1612 |
| 277 | Ga0105239_10611511 | 3300010375 | Bacteria | 1243 |
| 278 | Ga0105239_10692038 | 3300010375 | Bacteria | 1165 |
| 279 | Ga0105239_11128953 | 3300010375 | Bacteria | 903 |
| 280 | Ga0105246_11138257 | 3300011119 | Bacteria | 715 |
| 281 | Ga0157370_10001000 | 3300013104 | Bacteria | 35671 |
| 282 | Ga0157370_10769347 | 3300013104 | Bacteria | 877 |
| 283 | Ga0157370_11166648 | 3300013104 | Bacteria | 695 |
| 284 | Ga0157369_10012063 | 3300013105 | Bacteria | 9815 |
| 285 | Ga0157369_10267051 | 3300013105 | Bacteria | 1784 |
| 286 | Ga0157369_10364086 | 3300013105 | Bacteria | 1501 |
| 287 | Ga0157369_10810287 | 3300013105 | Bacteria | 962 |
| 288 | Ga0157369_10972713 | 3300013105 | Bacteria | 869 |
| 289 | Ga0157369_11277983 | 3300013105 | Bacteria | 748 |
| 290 | Ga0157374_10238699 | 3300013296 | Bacteria | 1787 |
| 291 | Ga0157374_10416706 | 3300013296 | Bacteria | 1341 |
| 292 | Ga0157374_10517772 | 3300013296 | Bacteria | 1198 |
| 293 | Ga0157378_10040872 | 3300013297 | Bacteria | 4113 |
| 294 | Ga0157378_10054988 | 3300013297 | Bacteria | 3545 |
| 295 | Ga0163162_10107404 | 3300013306 | Bacteria | 2886 |
| 296 | Ga0163162_10163682 | 3300013306 | Bacteria | 2347 |
| 297 | Ga0163162_11059411 | 3300013306 | Bacteria | 918 |
| 298 | Ga0157372_10061340 | 3300013307 | Bacteria | 4210 |
| 299 | Ga0157372_10172800 | 3300013307 | Bacteria | 2500 |
| 300 | Ga0157372_10641194 | 3300013307 | Bacteria | 1237 |
| 301 | Ga0157372_10715392 | 3300013307 | Bacteria | 1165 |
| 302 | Ga0157372_11193860 | 3300013307 | Bacteria | 879 |
| 303 | Ga0157375_10006160 | 3300013308 | Bacteria | 10452 |
| 304 | Ga0157375_10144830 | 3300013308 | Bacteria | 2506 |
| 305 | Ga0163163_10062321 | 3300014325 | Bacteria | 3695 |
| 306 | Ga0163163_10094096 | 3300014325 | Bacteria | 3014 |
| 307 | Ga0163163_10098153 | 3300014325 | Bacteria | 2950 |
| 308 | Ga0163163_10110396 | 3300014325 | Bacteria | 2778 |
| 309 | Ga0163163_10271030 | 3300014325 | Bacteria | 1749 |
| 310 | Ga0163163_10362033 | 3300014325 | Bacteria | 1507 |
| 311 | Ga0163163_10447644 | 3300014325 | Bacteria | 1351 |
| 312 | Ga0163163_10747810 | 3300014325 | Bacteria | 1041 |
| 313 | Ga0157380_10006488 | 3300014326 | Bacteria | 8246 |
| 314 | Ga0157380_10018385 | 3300014326 | Bacteria | 5186 |
| 315 | Ga0157380_10019445 | 3300014326 | Bacteria | 5061 |
| 316 | Ga0157380_10029531 | 3300014326 | Bacteria | 4190 |
| 317 | Ga0157380_10034435 | 3300014326 | Bacteria | 3907 |
| 318 | Ga0157380_10048541 | 3300014326 | Bacteria | 3344 |
| 319 | Ga0157380_10113939 | 3300014326 | Bacteria | 2278 |
| 320 | Ga0157380_10270079 | 3300014326 | Bacteria | 1550 |
| 321 | Ga0157377_10184017 | 3300014745 | Bacteria | 1316 |
| 322 | Ga0157379_10023361 | 3300014968 | Bacteria | 5486 |
| 323 | Ga0157379_10054291 | 3300014968 | Bacteria | 3580 |
| 324 | Ga0157379_10054721 | 3300014968 | Bacteria | 3565 |
| 325 | Ga0157379_10129068 | 3300014968 | Bacteria | 2275 |
| 326 | Ga0157379_10191037 | 3300014968 | Unclassified | 1850 |
| 327 | Ga0157379_10752390 | 3300014968 | Bacteria | 917 |
| 328 | Ga0157379_10898289 | 3300014968 | Bacteria | 840 |
| 329 | Ga0157379_11064911 | 3300014968 | Unclassified | 773 |
| 330 | Ga0157376_10042389 | 3300014969 | Bacteria | 3730 |
| 331 | Ga0157376_10285966 | 3300014969 | Bacteria | 1555 |
| 332 | Ga0157376_10367887 | 3300014969 | Bacteria | 1381 |
| 333 | Ga0157376_11239439 | 3300014969 | Bacteria | 775 |
| 334 | Ga0157376_12215256 | 3300014969 | Bacteria | 588 |
| 335 | Ga0197907_10910721 | 3300020069 | Bacteria | 999 |
| 336 | Ga0213872_10170418 | 3300021361 | Bacteria | 944 |
| 337 | Ga0213874_10028837 | 3300021377 | Bacteria | 1588 |
| 338 | Ga0213874_10079968 | 3300021377 | Bacteria | 1057 |
| 339 | Ga0213874_10217635 | 3300021377 | Bacteria | 693 |
| 340 | Ga0213876_10085012 | 3300021384 | Bacteria | 1674 |
| 341 | Ga0213876_10209494 | 3300021384 | Bacteria | 1036 |
| 342 | Ga0224712_10631440 | 3300022467 | Unclassified | 524 |
| 343 | Ga0228598_1028368 | 3300024227 | Bacteria | 1101 |
| 344 | Ga0207656_10241780 | 3300025321 | Bacteria | 882 |
| 345 | Ga0207682_10003313 | 3300025893 | Bacteria | 7031 |
| 346 | Ga0207682_10005611 | 3300025893 | Bacteria | 5103 |
| 347 | Ga0207682_10379223 | 3300025893 | Bacteria | 667 |
| 348 | Ga0207692_10379710 | 3300025898 | Bacteria | 877 |
| 349 | Ga0207642_10055749 | 3300025899 | Bacteria | 1810 |
| 350 | Ga0207642_10380908 | 3300025899 | Bacteria | 839 |
| 351 | Ga0207642_10502936 | 3300025899 | Bacteria | 742 |
| 352 | Ga0207710_10000201 | 3300025900 | Bacteria | 55939 |
| 353 | Ga0207680_10247279 | 3300025903 | Bacteria | 1231 |
| 354 | Ga0207680_10760287 | 3300025903 | Bacteria | 695 |
| 355 | Ga0207685_10121858 | 3300025905 | Bacteria | 1146 |
| 356 | Ga0207685_10142182 | 3300025905 | Bacteria | 1077 |
| 357 | Ga0207685_10352875 | 3300025905 | Bacteria | 742 |
| 358 | Ga0207699_10029870 | 3300025906 | Bacteria | 3044 |
| 359 | Ga0207699_10034043 | 3300025906 | Bacteria | 2885 |
| 360 | Ga0207699_10769382 | 3300025906 | Bacteria | 707 |
| 361 | Ga0207699_10825005 | 3300025906 | Bacteria | 682 |
| 362 | Ga0207699_10870939 | 3300025906 | Bacteria | 664 |
| 363 | Ga0207645_10181840 | 3300025907 | Bacteria | 1379 |
| 364 | Ga0207643_10011260 | 3300025908 | Bacteria | 4830 |
| 365 | Ga0207643_10133989 | 3300025908 | Bacteria | 1476 |
| 366 | Ga0207707_10002563 | 3300025912 | Bacteria | 16290 |
| 367 | Ga0207707_10005125 | 3300025912 | Bacteria | 11488 |
| 368 | Ga0207707_10034584 | 3300025912 | Bacteria | 4421 |
| 369 | Ga0207707_10094049 | 3300025912 | Bacteria | 2619 |
| 370 | Ga0207707_10188602 | 3300025912 | Bacteria | 1799 |
| 371 | Ga0207707_10397706 | 3300025912 | Bacteria | 1183 |
| 372 | Ga0207695_10008576 | 3300025913 | Bacteria | 12773 |
| 373 | Ga0207695_10083482 | 3300025913 | Bacteria | 3227 |
| 374 | Ga0207695_10119723 | 3300025913 | Bacteria | 2602 |
| 375 | Ga0207695_10167856 | 3300025913 | Bacteria | 2122 |
| 376 | Ga0207695_10297350 | 3300025913 | Bacteria | 1506 |
| 377 | Ga0207695_10363688 | 3300025913 | Bacteria | 1333 |
| 378 | Ga0207695_10589630 | 3300025913 | Bacteria | 993 |
| 379 | Ga0207695_10985401 | 3300025913 | Unclassified | 723 |
| 380 | Ga0207671_10125028 | 3300025914 | Bacteria | 1969 |
| 381 | Ga0207671_10162008 | 3300025914 | Bacteria | 1733 |
| 382 | Ga0207671_10268227 | 3300025914 | Bacteria | 1344 |
| 383 | Ga0207693_10000504 | 3300025915 | Bacteria | 35283 |
| 384 | Ga0207693_10085140 | 3300025915 | Bacteria | 2477 |
| 385 | Ga0207663_10095173 | 3300025916 | Bacteria | 1986 |
| 386 | Ga0207663_10262273 | 3300025916 | Bacteria | 1276 |
| 387 | Ga0207663_10266286 | 3300025916 | Bacteria | 1268 |
| 388 | Ga0207663_10520252 | 3300025916 | Bacteria | 926 |
| 389 | Ga0207660_10034299 | 3300025917 | Bacteria | 3517 |
| 390 | Ga0207660_10043141 | 3300025917 | Bacteria | 3169 |
| 391 | Ga0207660_10066645 | 3300025917 | Bacteria | 2605 |
| 392 | Ga0207660_11291684 | 3300025917 | Bacteria | 593 |
| 393 | Ga0207657_10157492 | 3300025919 | Bacteria | 1846 |
| 394 | Ga0207649_11083828 | 3300025920 | Bacteria | 632 |
| 395 | Ga0207652_10005625 | 3300025921 | Bacteria | 10166 |
| 396 | Ga0207652_10041710 | 3300025921 | Bacteria | 3903 |
| 397 | Ga0207652_10059561 | 3300025921 | Bacteria | 3292 |
| 398 | Ga0207652_10161919 | 3300025921 | Bacteria | 2006 |
| 399 | Ga0207652_10295307 | 3300025921 | Bacteria | 1462 |
| 400 | Ga0207652_10296029 | 3300025921 | Bacteria | 1460 |
| 401 | Ga0207652_10301899 | 3300025921 | Bacteria | 1445 |
| 402 | Ga0207652_10351894 | 3300025921 | Bacteria | 1329 |
| 403 | Ga0207694_10310382 | 3300025924 | Bacteria | 1300 |
| 404 | Ga0207694_10574763 | 3300025924 | Bacteria | 947 |
| 405 | Ga0207694_10949198 | 3300025924 | Unclassified | 727 |
| 406 | Ga0207650_10293741 | 3300025925 | Bacteria | 1326 |
| 407 | Ga0207659_10038986 | 3300025926 | Bacteria | 3309 |
| 408 | Ga0207659_10173280 | 3300025926 | Bacteria | 1704 |
| 409 | Ga0207687_10113306 | 3300025927 | Bacteria | 2017 |
| 410 | Ga0207687_10360615 | 3300025927 | Bacteria | 1186 |
| 411 | Ga0207700_10035973 | 3300025928 | Bacteria | 3572 |
| 412 | Ga0207700_10048329 | 3300025928 | Bacteria | 3159 |
| 413 | Ga0207700_10223259 | 3300025928 | Bacteria | 1598 |
| 414 | Ga0207700_10629090 | 3300025928 | Bacteria | 956 |
| 415 | Ga0207664_10023491 | 3300025929 | Bacteria | 4621 |
| 416 | Ga0207664_11309316 | 3300025929 | Bacteria | 644 |
| 417 | Ga0207644_10019585 | 3300025931 | Bacteria | 4592 |
| 418 | Ga0207644_10074500 | 3300025931 | Bacteria | 2491 |
| 419 | Ga0207644_10505370 | 3300025931 | Bacteria | 997 |
| 420 | Ga0207690_10697987 | 3300025932 | Bacteria | 834 |
| 421 | Ga0207706_10186322 | 3300025933 | Bacteria | 1822 |
| 422 | Ga0207686_10133587 | 3300025934 | Bacteria | 1705 |
| 423 | Ga0207686_10237894 | 3300025934 | Bacteria | 1324 |
| 424 | Ga0207709_10055774 | 3300025935 | Bacteria | 2443 |
| 425 | Ga0207670_10219925 | 3300025936 | Bacteria | 1453 |
| 426 | Ga0207670_10462434 | 3300025936 | Bacteria | 1025 |
| 427 | Ga0207670_10710493 | 3300025936 | Bacteria | 833 |
| 428 | Ga0207670_10991982 | 3300025936 | Bacteria | 706 |
| 429 | Ga0207669_10011913 | 3300025937 | Bacteria | 4254 |
| 430 | Ga0207669_10140071 | 3300025937 | Bacteria | 1677 |
| 431 | Ga0207669_10401784 | 3300025937 | Bacteria | 1073 |
| 432 | Ga0207704_10692614 | 3300025938 | Bacteria | 843 |
| 433 | Ga0207665_10001101 | 3300025939 | Bacteria | 18193 |
| 434 | Ga0207665_10024483 | 3300025939 | Bacteria | 3980 |
| 435 | Ga0207665_10105960 | 3300025939 | Bacteria | 1969 |
| 436 | Ga0207691_10003800 | 3300025940 | Bacteria | 14654 |
| 437 | Ga0207691_10011067 | 3300025940 | Bacteria | 8660 |
| 438 | Ga0207691_10450321 | 3300025940 | Bacteria | 1096 |
| 439 | Ga0207711_10062553 | 3300025941 | Bacteria | 3210 |
| 440 | Ga0207711_10365682 | 3300025941 | Bacteria | 1337 |
| 441 | Ga0207711_10569001 | 3300025941 | Bacteria | 1057 |
| 442 | Ga0207711_10684875 | 3300025941 | Bacteria | 956 |
| 443 | Ga0207689_10125712 | 3300025942 | Bacteria | 2110 |
| 444 | Ga0207689_10285138 | 3300025942 | Bacteria | 1367 |
| 445 | Ga0207689_10394036 | 3300025942 | Bacteria | 1154 |
| 446 | Ga0207689_11282875 | 3300025942 | Bacteria | 616 |
| 447 | Ga0207661_10305127 | 3300025944 | Bacteria | 1428 |
| 448 | Ga0207679_10308371 | 3300025945 | Bacteria | 1367 |
| 449 | Ga0207679_10363017 | 3300025945 | Bacteria | 1265 |
| 450 | Ga0207679_10581953 | 3300025945 | Bacteria | 1007 |
| 451 | Ga0207679_11372584 | 3300025945 | Bacteria | 648 |
| 452 | Ga0207667_10008439 | 3300025949 | Bacteria | 12236 |
| 453 | Ga0207667_10022646 | 3300025949 | Bacteria | 6931 |
| 454 | Ga0207667_10076501 | 3300025949 | Bacteria | 3473 |
| 455 | Ga0207667_10222530 | 3300025949 | Bacteria | 1933 |
| 456 | Ga0207667_11800497 | 3300025949 | Bacteria | 576 |
| 457 | Ga0207651_10074944 | 3300025960 | Bacteria | 2412 |
| 458 | Ga0207651_10301027 | 3300025960 | Bacteria | 1333 |
| 459 | Ga0207651_10442318 | 3300025960 | Bacteria | 1114 |
| 460 | Ga0207651_10990310 | 3300025960 | Bacteria | 751 |
| 461 | Ga0207651_11093608 | 3300025960 | Bacteria | 714 |
| 462 | Ga0207712_10078343 | 3300025961 | Bacteria | 2398 |
| 463 | Ga0207712_10541867 | 3300025961 | Bacteria | 1000 |
| 464 | Ga0207712_10695769 | 3300025961 | Bacteria | 887 |
| 465 | Ga0207668_10218273 | 3300025972 | Bacteria | 1530 |
| 466 | Ga0207668_10671333 | 3300025972 | Bacteria | 909 |
| 467 | Ga0207668_11023663 | 3300025972 | Bacteria | 739 |
| 468 | Ga0207658_10000303 | 3300025986 | Bacteria | 50872 |
| 469 | Ga0207658_10024530 | 3300025986 | Bacteria | 4220 |
| 470 | Ga0207658_10034700 | 3300025986 | Bacteria | 3607 |
| 471 | Ga0207658_10205862 | 3300025986 | Bacteria | 1646 |
| 472 | Ga0207658_11340156 | 3300025986 | Bacteria | 654 |
| 473 | Ga0207677_10057464 | 3300026023 | Bacteria | 2672 |
| 474 | Ga0207703_10003121 | 3300026035 | Bacteria | 13988 |
| 475 | Ga0207703_10006615 | 3300026035 | Bacteria | 9248 |
| 476 | Ga0207703_10092458 | 3300026035 | Bacteria | 2546 |
| 477 | Ga0207703_10789439 | 3300026035 | Bacteria | 906 |
| 478 | Ga0207703_11829831 | 3300026035 | Bacteria | 583 |
| 479 | Ga0207639_10204555 | 3300026041 | Bacteria | 1695 |
| 480 | Ga0207639_11083032 | 3300026041 | Bacteria | 751 |
| 481 | Ga0207639_12019751 | 3300026041 | Bacteria | 538 |
| 482 | Ga0207678_10144536 | 3300026067 | Bacteria | 2030 |
| 483 | Ga0207678_10296965 | 3300026067 | Bacteria | 1388 |
| 484 | Ga0207708_10016081 | 3300026075 | Bacteria | 5619 |
| 485 | Ga0207708_10324412 | 3300026075 | Bacteria | 1257 |
| 486 | Ga0207708_10355177 | 3300026075 | Bacteria | 1203 |
| 487 | Ga0207708_10775517 | 3300026075 | Bacteria | 824 |
| 488 | Ga0207708_10880885 | 3300026075 | Bacteria | 774 |
| 489 | Ga0207702_10148678 | 3300026078 | Bacteria | 2129 |
| 490 | Ga0207702_10629612 | 3300026078 | Bacteria | 1054 |
| 491 | Ga0207641_10003475 | 3300026088 | Bacteria | 13958 |
| 492 | Ga0207641_10004348 | 3300026088 | Bacteria | 12289 |
| 493 | Ga0207641_10145565 | 3300026088 | Bacteria | 2142 |
| 494 | Ga0207641_10344643 | 3300026088 | Bacteria | 1418 |
| 495 | Ga0207641_10433822 | 3300026088 | Bacteria | 1267 |
| 496 | Ga0207641_10630206 | 3300026088 | Bacteria | 1052 |
| 497 | Ga0207641_10742867 | 3300026088 | Bacteria | 968 |
| 498 | Ga0207641_12262864 | 3300026088 | Bacteria | 543 |
| 499 | Ga0207648_10024833 | 3300026089 | Bacteria | 5345 |
| 500 | Ga0207648_10048166 | 3300026089 | Bacteria | 3732 |
| 501 | Ga0207648_10059568 | 3300026089 | Bacteria | 3330 |
| 502 | Ga0207676_10007753 | 3300026095 | Bacteria | 7635 |
| 503 | Ga0207676_10439291 | 3300026095 | Bacteria | 1228 |
| 504 | Ga0207674_10273415 | 3300026116 | Bacteria | 1637 |
| 505 | Ga0207675_100002742 | 3300026118 | Bacteria | 17331 |
| 506 | Ga0207675_100018690 | 3300026118 | Bacteria | 6469 |
| 507 | Ga0207675_100027461 | 3300026118 | Bacteria | 5301 |
| 508 | Ga0207675_100096122 | 3300026118 | Bacteria | 2788 |
| 509 | Ga0207675_100128928 | 3300026118 | Bacteria | 2398 |
| 510 | Ga0207675_100434221 | 3300026118 | Bacteria | 1299 |
| 511 | Ga0207675_100937085 | 3300026118 | Bacteria | 883 |
| 512 | Ga0207683_10061481 | 3300026121 | Bacteria | 3306 |
| 513 | Ga0207683_10123215 | 3300026121 | Bacteria | 2329 |
| 514 | Ga0207683_10298547 | 3300026121 | Bacteria | 1474 |
| 515 | Ga0207683_10766420 | 3300026121 | Bacteria | 895 |
| 516 | Ga0207698_10516891 | 3300026142 | Bacteria | 1164 |
| 517 | Ga0209996_1032536 | 3300027395 | Bacteria | 761 |
| 518 | Ga0210002_1045303 | 3300027617 | Bacteria | 752 |
| 519 | Ga0209588_1051957 | 3300027671 | Bacteria | 1325 |
| 520 | Ga0209966_1104527 | 3300027695 | Bacteria | 642 |
| 521 | Ga0209974_10087375 | 3300027876 | Bacteria | 1078 |
| 522 | Ga0207428_10000990 | 3300027907 | Bacteria | 31474 |
| 523 | Ga0265354_1000834 | 3300028016 | Bacteria | 4966 |
| 524 | Ga0265356_1001137 | 3300028017 | Bacteria | 4102 |
| 525 | Ga0265355_1007989 | 3300028036 | Unclassified | 843 |
| 526 | Ga0268266_10002557 | 3300028379 | Bacteria | 19304 |
| 527 | Ga0268266_10006072 | 3300028379 | Bacteria | 11131 |
| 528 | Ga0268266_10006493 | 3300028379 | Bacteria | 10704 |
| 529 | Ga0268266_10075426 | 3300028379 | Bacteria | 2929 |
| 530 | Ga0268266_10080204 | 3300028379 | Bacteria | 2843 |
| 531 | Ga0268266_10125135 | 3300028379 | Bacteria | 2293 |
| 532 | Ga0268266_10140339 | 3300028379 | Bacteria | 2168 |
| 533 | Ga0268266_10167606 | 3300028379 | Bacteria | 1991 |
| 534 | Ga0268266_10900407 | 3300028379 | Bacteria | 855 |
| 535 | Ga0268265_10038525 | 3300028380 | Bacteria | 3517 |
| 536 | Ga0268265_10182138 | 3300028380 | Bacteria | 1806 |
| 537 | Ga0268265_10198098 | 3300028380 | Bacteria | 1740 |
| 538 | Ga0268265_10200532 | 3300028380 | Bacteria | 1731 |
| 539 | Ga0268265_10421447 | 3300028380 | Bacteria | 1239 |
| 540 | Ga0268265_11139119 | 3300028380 | Bacteria | 776 |
| 541 | Ga0268264_10001238 | 3300028381 | Bacteria | 24491 |
| 542 | Ga0268264_10030059 | 3300028381 | Bacteria | 4454 |
| 543 | Ga0268264_10034163 | 3300028381 | Bacteria | 4181 |
| 544 | Ga0268264_10252960 | 3300028381 | Bacteria | 1637 |
| 545 | Ga0268264_11210140 | 3300028381 | Bacteria | 765 |
| 546 | Ga0265318_10153719 | 3300028577 | Bacteria | 844 |
| 547 | Ga0307515_10006279 | 3300028794 | Bacteria | 23844 |
| 548 | Ga0265338_10565779 | 3300028800 | Bacteria | 794 |
| 549 | Ga0307511_10000172 | 3300030521 | Bacteria | 63607 |
| 550 | Ga0307511_10013004 | 3300030521 | Bacteria | 8146 |
| 551 | Ga0307511_10114098 | 3300030521 | Bacteria | 1705 |
| 552 | Ga0265770_1002356 | 3300030878 | Bacteria | 2567 |
| 553 | Ga0265771_1000328 | 3300031010 | Bacteria | 1613 |
| 554 | Ga0265773_1010374 | 3300031018 | Bacteria | 785 |
| 555 | Ga0265760_10000462 | 3300031090 | Bacteria | 11486 |
| 556 | Ga0265760_10246424 | 3300031090 | Bacteria | 617 |
| 557 | Ga0265340_10007525 | 3300031247 | Bacteria | 5913 |
| 558 | Ga0265339_10281921 | 3300031249 | Bacteria | 796 |
| 559 | Ga0265339_10344780 | 3300031249 | Bacteria | 703 |
| 560 | Ga0265331_10110405 | 3300031250 | Bacteria | 1261 |
| 561 | Ga0307513_10009329 | 3300031456 | Bacteria | 12424 |
| 562 | Ga0307513_10029412 | 3300031456 | Bacteria | 6264 |
| 563 | Ga0307513_10034337 | 3300031456 | Bacteria | 5693 |
| 564 | Ga0307513_10065152 | 3300031456 | Bacteria | 3834 |
| 565 | Ga0307513_10324651 | 3300031456 | Bacteria | 1296 |
| 566 | Ga0307509_10001027 | 3300031507 | Bacteria | 48002 |
| 567 | Ga0307509_10156836 | 3300031507 | Bacteria | 2181 |
| 568 | Ga0307509_10232468 | 3300031507 | Bacteria | 1645 |
| 569 | Ga0307408_100067860 | 3300031548 | Bacteria | 2624 |
| 570 | Ga0307408_100074277 | 3300031548 | Bacteria | 2522 |
| 571 | Ga0307408_100122985 | 3300031548 | Bacteria | 2013 |
| 572 | Ga0307408_100167946 | 3300031548 | Bacteria | 1749 |
| 573 | Ga0307408_101430908 | 3300031548 | Unclassified | 652 |
| 574 | Ga0307408_101742039 | 3300031548 | Bacteria | 594 |
| 575 | Ga0265313_10041615 | 3300031595 | Bacteria | 2262 |
| 576 | Ga0307514_10200908 | 3300031649 | Bacteria | 1253 |
| 577 | Ga0316575_10009676 | 3300031665 | Bacteria | 3532 |
| 578 | Ga0265314_10200051 | 3300031711 | Bacteria | 1182 |
| 579 | Ga0265314_10292498 | 3300031711 | Bacteria | 917 |
| 580 | Ga0316576_10030261 | 3300031727 | Bacteria | 3832 |
| 581 | Ga0316578_10609274 | 3300031728 | Bacteria | 639 |
| 582 | Ga0307516_10048270 | 3300031730 | Bacteria | 4189 |
| 583 | Ga0307516_10434446 | 3300031730 | Bacteria | 970 |
| 584 | Ga0307405_10007840 | 3300031731 | Bacteria | 5375 |
| 585 | Ga0307405_10016044 | 3300031731 | Bacteria | 4074 |
| 586 | Ga0307405_10799654 | 3300031731 | Unclassified | 790 |
| 587 | Ga0316577_10048607 | 3300031733 | Bacteria | 2369 |
| 588 | Ga0307413_10004099 | 3300031824 | Bacteria | 6274 |
| 589 | Ga0307413_10022662 | 3300031824 | Bacteria | 3389 |
| 590 | Ga0307410_10003481 | 3300031852 | Bacteria | 7904 |
| 591 | Ga0307410_10014862 | 3300031852 | Bacteria | 4597 |
| 592 | Ga0307410_10240121 | 3300031852 | Bacteria | 1403 |
| 593 | Ga0307410_10661886 | 3300031852 | Bacteria | 877 |
| 594 | Ga0307406_10752500 | 3300031901 | Bacteria | 818 |
| 595 | Ga0307406_11044795 | 3300031901 | Bacteria | 703 |
| 596 | Ga0307407_10009190 | 3300031903 | Bacteria | 4588 |
| 597 | Ga0307407_10126846 | 3300031903 | Bacteria | 1626 |
| 598 | Ga0307407_10540485 | 3300031903 | Bacteria | 860 |
| 599 | Ga0307412_10015163 | 3300031911 | Bacteria | 4561 |
| 600 | Ga0307412_10056917 | 3300031911 | Bacteria | 2608 |
| 601 | Ga0307412_10307943 | 3300031911 | Bacteria | 1255 |
| 602 | Ga0307409_100005159 | 3300031995 | Bacteria | 7466 |
| 603 | Ga0307409_100062053 | 3300031995 | Bacteria | 2924 |
| 604 | Ga0307409_100138477 | 3300031995 | Bacteria | 2093 |
| 605 | Ga0307409_100148629 | 3300031995 | Bacteria | 2030 |
| 606 | Ga0307409_100326915 | 3300031995 | Bacteria | 1437 |
| 607 | Ga0307416_100018394 | 3300032002 | Bacteria | 4921 |
| 608 | Ga0307416_100332688 | 3300032002 | Bacteria | 1527 |
| 609 | Ga0307416_100521976 | 3300032002 | Bacteria | 1256 |
| 610 | Ga0307416_100921045 | 3300032002 | Bacteria | 975 |
| 611 | Ga0307416_101094738 | 3300032002 | Bacteria | 901 |
| 612 | Ga0307416_101355486 | 3300032002 | Bacteria | 817 |
| 613 | Ga0307414_10012857 | 3300032004 | Bacteria | 4967 |
| 614 | Ga0307414_10111053 | 3300032004 | Bacteria | 2087 |
| 615 | Ga0307414_11058530 | 3300032004 | Bacteria | 748 |
| 616 | Ga0307411_10001043 | 3300032005 | Bacteria | 10725 |
| 617 | Ga0307411_10017387 | 3300032005 | Bacteria | 4096 |
| 618 | Ga0307411_10042910 | 3300032005 | Bacteria | 2890 |
| 619 | Ga0307411_10792667 | 3300032005 | Bacteria | 834 |
| 620 | Ga0307411_11291796 | 3300032005 | Bacteria | 664 |
| 621 | Ga0307415_100041219 | 3300032126 | Bacteria | 3064 |
| 622 | Ga0307415_100240380 | 3300032126 | Bacteria | 1464 |
| 623 | Ga0307510_10000010 | 3300033180 | Bacteria | 377457 |
| 624 | Ga0307510_10019615 | 3300033180 | Bacteria | 7924 |
| 625 | Ga0316212_1027775 | 3300033547 | Bacteria | 794 |
| 626 | Ga0373923_0332737 | 3300035111 | Bacteria | 723 |
| 627 | Ga0373936_0014123 | 3300035113 | Bacteria | 3051 |
| 628 | Ga0373936_0019053 | 3300035113 | Bacteria | 2657 |
| 629 | Ga0373936_0096979 | 3300035113 | Bacteria | 1241 |
| 630 | Ga0373936_0220327 | 3300035113 | Bacteria | 841 |
| 631 | Ga0373953_0026671 | 3300035117 | Bacteria | 2215 |
| 632 | Ga0373953_0134946 | 3300035117 | Bacteria | 1054 |
| 633 | Ga0373953_0156694 | 3300035117 | Bacteria | 978 |
| 634 | Ga0373954_0079775 | 3300035118 | Bacteria | 1563 |
| 635 | Ga0373956_0142596 | 3300035119 | Bacteria | 1125 |
| 636 | Ga0373956_0244541 | 3300035119 | Bacteria | 853 |
| 637 | Ga0373943_0074814 | 3300035170 | Bacteria | 1723 |
| 638 | Ga0373955_0143437 | 3300035172 | Bacteria | 1402 |
| 639 | Ga0373955_0308838 | 3300035172 | Bacteria | 954 |
| 640 | Ga0316574_0072750 | 3300035398 | Bacteria | 2173 |
| 641 | Ga0373924_0159693 | 3300035410 | Bacteria | 988 |
| 642 | Ga0373924_0206938 | 3300035410 | Bacteria | 866 |
| 643 | Ga0373935_0696693 | 3300035692 | Bacteria | 747 |
| 644 | Ga0373927_0026014 | 3300035695 | Bacteria | 3825 |
| 645 | Ga0373927_0168559 | 3300035695 | Bacteria | 1435 |
| 646 | Ga0373933_0012633 | 3300035724 | Bacteria | 4667 |
| 647 | Ga0373933_0534519 | 3300035724 | Bacteria | 769 |
| 648 | Ga0373947_0116053 | 3300035725 | Bacteria | 1697 |
| 649 | Ga0373937_0203792 | 3300036401 | Bacteria | 1860 |
| 650 | Ga0373937_0369215 | 3300036401 | Bacteria | 1360 |
| 651 | Ga0373937_0445582 | 3300036401 | Bacteria | 1229 |
| 652 | Ga0316584_0087069 | 3300036712 | Bacteria | 2338 |
| 653 | Ga0373925_0072983 | 3300037068 | Bacteria | 2597 |
| 654 | Ga0373925_0459402 | 3300037068 | Bacteria | 1043 |
| 655 | Ga0373925_0477407 | 3300037068 | Bacteria | 1022 |
| 656 | Ga0395900_0035103 | 3300037418 | Bacteria | 5166 |
| 657 | Ga0395898_0028526 | 3300037466 | Bacteria | 5592 |
| 658 | Ga0395898_0042737 | 3300037466 | Bacteria | 4470 |
| 659 | Ga0395898_0046444 | 3300037466 | Bacteria | 4266 |
| 660 | Ga0395898_0171233 | 3300037466 | Bacteria | 2076 |
| 661 | Ga0395905_0731640 | 3300037471 | Bacteria | 892 |
| 662 | Ga0395905_1575270 | 3300037471 | Bacteria | 562 |
| 663 | Ga0436365_0303382 | 3300039437 | Bacteria | 5459 |
| 664 | Ga0436365_0338742 | 3300039437 | Bacteria | 819 |
| 665 | Ga0436365_0869677 | 3300039437 | Bacteria | 1160 |
| 666 | Ga0436365_0908999 | 3300039437 | Bacteria | 4724 |
| 667 | Ga0436360_0033999 | 3300039438 | Bacteria | 750 |
| 668 | Ga0436360_0335434 | 3300039438 | Bacteria | 8420 |
| 669 | Ga0436360_0928068 | 3300039438 | Bacteria | 705 |
| 670 | Ga0436361_1016867 | 3300039447 | Bacteria | 1226 |
| 671 | Ga0436361_1172308 | 3300039447 | Bacteria | 8529 |
| 672 | Ga0436361_1176747 | 3300039447 | Bacteria | 1204 |
| 673 | Ga0436363_0122084 | 3300039450 | Bacteria | 2553 |
| 674 | Ga0436363_0268552 | 3300039450 | Bacteria | 6033 |
| 675 | Ga0436363_0378144 | 3300039450 | Bacteria | 1793 |
| 676 | Ga0436363_0861289 | 3300039450 | Bacteria | 1137 |
| 677 | Ga0436363_1158081 | 3300039450 | Bacteria | 761 |
| 678 | Ga0436363_1328184 | 3300039450 | Bacteria | 10036 |
| 679 | Ga0436363_1591892 | 3300039450 | Bacteria | 1218 |
| 680 | Ga0436362_0937886 | 3300039453 | Unclassified | 816 |
| 681 | Ga0439439_0045723 | 3300041406 | Bacteria | 1142 |
| 682 | Ga0439453_0011553 | 3300041408 | Bacteria | 1475 |
| 683 | Ga0451787_417005 | 3300041441 | Bacteria | 636 |
| 684 | Ga0451789_0579430 | 3300041443 | Bacteria | 1101 |
| 685 | Ga0451791_1119097 | 3300041451 | Bacteria | 1358 |
| 686 | Ga0451791_1750484 | 3300041451 | Bacteria | 621 |
| 687 | Ga0451793_0229681 | 3300041452 | Bacteria | 587 |
| 688 | Ga0451797_0553840 | 3300041453 | Bacteria | 624 |
| 689 | Ga0451795_1018544 | 3300041456 | Bacteria | 1373 |
| 690 | Ga0451800_0299913 | 3300041459 | Bacteria | 1229 |
| 691 | Ga0451800_0510418 | 3300041459 | Bacteria | 596 |
| 692 | Ga0451800_1642085 | 3300041459 | Bacteria | 1013 |
| 693 | Ga0451802_0265411 | 3300041460 | Bacteria | 3311 |
| 694 | Ga0451802_1746363 | 3300041460 | Bacteria | 2157 |
| 695 | Ga0451804_0808277 | 3300041463 | Bacteria | 617 |
| 696 | Ga0451804_0832309 | 3300041463 | Bacteria | 858 |
| 697 | Ga0451807_0666976 | 3300041486 | Bacteria | 574 |
| 698 | Ga0451807_1774474 | 3300041486 | Bacteria | 945 |
| 699 | Ga0451833_0262536 | 3300041491 | Bacteria | 674 |
| 700 | Ga0451837_0300169 | 3300041494 | Bacteria | 765 |
| 701 | Ga0451839_0947681 | 3300041496 | Bacteria | 724 |
| 702 | Ga0451851_0365422 | 3300041507 | Bacteria | 662 |
| 703 | Ga0451853_0413289 | 3300041512 | Bacteria | 1548 |
| 704 | Ga0451853_1200973 | 3300041512 | Bacteria | 584 |
| 705 | Ga0439431_0027472 | 3300041997 | Bacteria | 1398 |
| 706 | Ga0439433_0009397 | 3300041999 | Bacteria | 2128 |
| 707 | Ga0439442_018200 | 3300042002 | Bacteria | 1453 |
| 708 | Ga0439443_008288 | 3300042003 | Bacteria | 1464 |
| 709 | Ga0439456_017772 | 3300042013 | Bacteria | 1491 |
| 710 | Ga0450920_004346 | 3300042122 | Bacteria | 2486 |
| 711 | Ga0450923_001623 | 3300042125 | Bacteria | 3034 |
| 712 | Ga0450923_001799 | 3300042125 | Bacteria | 2938 |
| 713 | Ga0450923_093410 | 3300042125 | Bacteria | 688 |
| 714 | Ga0450923_097886 | 3300042125 | Bacteria | 674 |
| 715 | Ga0450894_004282 | 3300042131 | Bacteria | 1858 |
| 716 | Ga0450895_000816 | 3300042132 | Bacteria | 1972 |
| 717 | Ga0450896_002134 | 3300042133 | Bacteria | 2526 |
| 718 | Ga0450898_014493 | 3300042134 | Bacteria | 1326 |
| 719 | Ga0450910_012031 | 3300042147 | Bacteria | 1247 |
| 720 | Ga0450910_012345 | 3300042147 | Bacteria | 1234 |
| 721 | Ga0439446_0000369 | 3300042156 | Bacteria | 8641 |
| 722 | Ga0439446_0005318 | 3300042156 | Bacteria | 3309 |
| 723 | Ga0439446_0032069 | 3300042156 | Bacteria | 1522 |
| 724 | Ga0450908_004140 | 3300042184 | Bacteria | 2803 |
| 725 | Ga0439434_0000893 | 3300042435 | Bacteria | 8601 |
| 726 | Ga0439435_0000462 | 3300042436 | Bacteria | 6424 |
| 727 | Ga0439444_0000456 | 3300042437 | Bacteria | 4556 |
| 728 | Ga0439459_0040765 | 3300042438 | Bacteria | 986 |
| 729 | Ga0439464_0162601 | 3300042439 | Bacteria | 702 |
| 730 | Ga0450918_007153 | 3300042531 | Bacteria | 1983 |
| 731 | Ga0451577_0097002 | 3300042876 | Bacteria | 2632 |
| 732 | Ga0451577_0653005 | 3300042876 | Bacteria | 954 |
| 733 | Ga0466969_0000982 | 3300044656 | Bacteria | 15393 |
| 734 | Ga0466969_0001200 | 3300044656 | Bacteria | 14008 |
| 735 | Ga0466969_0082749 | 3300044656 | Bacteria | 1529 |
| 736 | Ga0466969_0101989 | 3300044656 | Bacteria | 1350 |
| 737 | Ga0466965_0066072 | 3300044683 | Bacteria | 1813 |
| 738 | Ga0466966_0030307 | 3300044684 | Bacteria | 3512 |
| 739 | Ga0466966_0044847 | 3300044684 | Bacteria | 2829 |
| 740 | Ga0466966_0094645 | 3300044684 | Bacteria | 1851 |
| 741 | Ga0466961_0000578 | 3300044693 | Bacteria | 23292 |
| 742 | Ga0466964_0000252 | 3300044706 | Bacteria | 15468 |
| 743 | Ga0453684_0440648 | 3300044712 | Bacteria | 1452 |
| 744 | Ga0466971_0000941 | 3300044719 | Bacteria | 11963 |
| 745 | Ga0466970_0035215 | 3300044765 | Bacteria | 2652 |
| 746 | Ga0466957_0064636 | 3300044842 | Bacteria | 2251 |
| 747 | Ga0466960_0094798 | 3300044901 | Bacteria | 1527 |
| 748 | Ga0466959_0014261 | 3300045049 | Bacteria | 5768 |
| 749 | Ga0466959_0064687 | 3300045049 | Bacteria | 2655 |
| 750 | Ga0466959_0205595 | 3300045049 | Bacteria | 1369 |
| 751 | Ga0466959_0216794 | 3300045049 | Bacteria | 1328 |
| 752 | Ga0466959_0518270 | 3300045049 | Bacteria | 805 |
| 753 | Ga0451576_0068277 | 3300045051 | Unclassified | 3699 |
| 754 | Ga0451576_1265543 | 3300045051 | Bacteria | 769 |
| 755 | Ga0466958_0031544 | 3300045836 | Bacteria | 3150 |
| 756 | Ga0466967_0437847 | 3300045976 | Bacteria | 1276 |
| 757 | Ga0495617_096422 | 3300046452 | Bacteria | 963 |
| 758 | Ga0495590_0057281 | 3300046457 | Bacteria | 1362 |
| 759 | Ga0495590_0071514 | 3300046457 | Bacteria | 1217 |
| 760 | Ga0495591_072580 | 3300046458 | Bacteria | 891 |
| 761 | Ga0495629_0310940 | 3300046459 | Bacteria | 1078 |
| 762 | Ga0495638_0001478 | 3300046460 | Bacteria | 21227 |
| 763 | Ga0495638_0050101 | 3300046460 | Bacteria | 2609 |
| 764 | Ga0495638_0142698 | 3300046460 | Bacteria | 1396 |
| 765 | Ga0495638_0197188 | 3300046460 | Bacteria | 1139 |
| 766 | Ga0495580_0006591 | 3300046472 | Bacteria | 9435 |
| 767 | Ga0495580_0020718 | 3300046472 | Bacteria | 4861 |
| 768 | Ga0495580_0041092 | 3300046472 | Bacteria | 3299 |
| 769 | Ga0495580_0225236 | 3300046472 | Bacteria | 1288 |
| 770 | Ga0495580_0395823 | 3300046472 | Bacteria | 932 |
| 771 | Ga0495605_0208624 | 3300046474 | Bacteria | 849 |
| 772 | Ga0495639_0353189 | 3300046475 | Bacteria | 738 |
| 773 | Ga0495664_0381127 | 3300046477 | Bacteria | 848 |
| 774 | Ga0495585_0115260 | 3300046492 | Bacteria | 1426 |
| 775 | Ga0495606_0108932 | 3300046507 | Bacteria | 1674 |
| 776 | Ga0495608_0260742 | 3300046511 | Bacteria | 1079 |
| 777 | Ga0495616_0000953 | 3300046513 | Bacteria | 20793 |
| 778 | Ga0495616_0052807 | 3300046513 | Bacteria | 2022 |
| 779 | Ga0495618_0231002 | 3300046514 | Bacteria | 1165 |
| 780 | Ga0495620_0081264 | 3300046515 | Bacteria | 1311 |
| 781 | Ga0495628_0195959 | 3300046516 | Bacteria | 1524 |
| 782 | Ga0495630_0149600 | 3300046517 | Bacteria | 1776 |
| 783 | Ga0495632_0020802 | 3300046519 | Bacteria | 3546 |
| 784 | Ga0495632_0044299 | 3300046519 | Bacteria | 2221 |
| 785 | Ga0495643_0329515 | 3300046522 | Bacteria | 688 |
| 786 | Ga0495644_0053648 | 3300046523 | Bacteria | 1514 |
| 787 | Ga0495652_0620543 | 3300046529 | Bacteria | 735 |
| 788 | Ga0495586_0489156 | 3300046535 | Bacteria | 710 |
| 789 | Ga0495587_0430642 | 3300046536 | Bacteria | 732 |
| 790 | Ga0495598_0113017 | 3300046537 | Bacteria | 912 |
| 791 | Ga0495656_0077574 | 3300046615 | Bacteria | 1491 |
| 792 | Ga0495668_0115392 | 3300046616 | Bacteria | 1469 |
| 793 | Ga0495668_0475624 | 3300046616 | Bacteria | 688 |
| 794 | Ga0495611_0075189 | 3300046648 | Bacteria | 1548 |
| 795 | Ga0495625_0029944 | 3300046660 | Bacteria | 4065 |
| 796 | Ga0495625_0081472 | 3300046660 | Bacteria | 2253 |
| 797 | Ga0495625_0092738 | 3300046660 | Bacteria | 2086 |
| 798 | Ga0495625_0097404 | 3300046660 | Bacteria | 2025 |
| 799 | Ga0495625_0202321 | 3300046660 | Bacteria | 1310 |
| 800 | Ga0495635_0463410 | 3300046663 | Bacteria | 837 |
| 801 | Ga0495659_0134657 | 3300046664 | Bacteria | 982 |
| 802 | Ga0495657_0351105 | 3300046675 | Bacteria | 873 |
| 803 | Ga0495599_0177400 | 3300046678 | Bacteria | 1314 |
| 804 | Ga0495599_0608715 | 3300046678 | Bacteria | 636 |
| 805 | Ga0495647_0177246 | 3300046681 | Bacteria | 926 |
| 806 | Ga0495658_0452817 | 3300046683 | Bacteria | 820 |
| 807 | Ga0495658_0884994 | 3300046683 | Bacteria | 571 |
| 808 | Ga0495613_0288223 | 3300046689 | Bacteria | 1139 |
| 809 | Ga0495613_0521420 | 3300046689 | Bacteria | 798 |
| 810 | Ga0495671_0523726 | 3300046692 | Bacteria | 565 |
| 811 | Ga0495649_0047310 | 3300046694 | Bacteria | 2339 |
| 812 | Ga0495649_0189790 | 3300046694 | Bacteria | 1070 |
| 813 | Ga0495604_0545513 | 3300047317 | Bacteria | 748 |
| 814 | Ga0495680_0173575 | 3300047322 | Bacteria | 1560 |
| 815 | Ga0495687_040056 | 3300047443 | Bacteria | 2068 |
| 816 | Ga0495687_074242 | 3300047443 | Bacteria | 1353 |
| 817 | Ga0495681_0036130 | 3300047470 | Bacteria | 2446 |
| 818 | Ga0495686_0064610 | 3300047472 | Bacteria | 2265 |
| 819 | Ga0495686_0364049 | 3300047472 | Bacteria | 783 |
| 820 | Ga0495602_0351646 | 3300048088 | Bacteria | 1063 |
| 821 | Ga0496100_0133500 | 3300048903 | Bacteria | 1751 |
| 822 | Ga0496100_0929492 | 3300048903 | Bacteria | 683 |
| 823 | Ga0496101_0111028 | 3300048904 | Bacteria | 2064 |
| 824 | Ga0496101_0290623 | 3300048904 | Bacteria | 1279 |
| 825 | Ga0496101_0472422 | 3300048904 | Bacteria | 990 |
| 826 | Ga0496102_0012586 | 3300048905 | Bacteria | 7328 |
| 827 | Ga0496102_0025352 | 3300048905 | Bacteria | 5278 |
| 828 | Ga0496102_0028547 | 3300048905 | Bacteria | 4984 |
| 829 | Ga0496104_0021923 | 3300048907 | Bacteria | 5867 |
| 830 | Ga0496104_0207214 | 3300048907 | Bacteria | 1872 |
| 831 | Ga0496104_0230361 | 3300048907 | Bacteria | 1764 |
| 832 | Ga0496105_0019756 | 3300048908 | Bacteria | 5435 |
| 833 | Ga0496105_0183316 | 3300048908 | Bacteria | 1713 |
| 834 | Ga0496105_0206325 | 3300048908 | Bacteria | 1603 |
| 835 | Ga0496106_0095620 | 3300048909 | Bacteria | 2298 |
| 836 | Ga0496106_0109593 | 3300048909 | Bacteria | 2148 |
| 837 | Ga0496107_0136732 | 3300048910 | Bacteria | 1810 |
| 838 | Ga0496107_0686813 | 3300048910 | Bacteria | 753 |
| 839 | Ga0496108_0055001 | 3300048911 | Bacteria | 3341 |
| 840 | Ga0496109_0672668 | 3300048912 | Bacteria | 972 |
| 841 | Ga0496109_1300234 | 3300048912 | Bacteria | 663 |
| 842 | Ga0496110_0033998 | 3300048913 | Bacteria | 4412 |
| 843 | Ga0496111_0419988 | 3300048914 | Bacteria | 988 |
| 844 | Ga0496112_0236706 | 3300048915 | Bacteria | 1779 |
| 845 | Ga0496113_0285438 | 3300048916 | Bacteria | 1320 |
| 846 | Ga0496114_0024321 | 3300048917 | Bacteria | 4943 |
| 847 | Ga0496114_0112791 | 3300048917 | Bacteria | 2330 |
| 848 | Ga0496114_0298917 | 3300048917 | Bacteria | 1421 |
| 849 | Ga0496115_0014977 | 3300048918 | Bacteria | 5878 |
| 850 | Ga0496116_0009539 | 3300048919 | Bacteria | 8267 |
| 851 | Ga0496117_0000581 | 3300048920 | Bacteria | 60186 |
| 852 | Ga0496118_0001068 | 3300048921 | Bacteria | 42766 |
| 853 | Ga0496118_0042982 | 3300048921 | Bacteria | 3558 |
| 854 | Ga0496119_0006293 | 3300048922 | Bacteria | 11072 |
| 855 | Ga0496119_0022325 | 3300048922 | Bacteria | 4535 |
| 856 | Ga0496120_0007212 | 3300048923 | Bacteria | 8320 |
| 857 | Ga0496120_0018016 | 3300048923 | Bacteria | 4562 |
| 858 | Ga0496121_0003828 | 3300048924 | Bacteria | 20935 |
| 859 | Ga0496121_0039297 | 3300048924 | Bacteria | 4172 |
| 860 | Ga0496121_0143634 | 3300048924 | Bacteria | 1767 |
| 861 | Ga0496124_0159819 | 3300048927 | Bacteria | 1757 |
| 862 | Ga0496125_0000553 | 3300048928 | Bacteria | 64496 |
| 863 | Ga0496125_0008847 | 3300048928 | Bacteria | 10466 |
| 864 | Ga0496125_0024657 | 3300048928 | Bacteria | 5525 |
| 865 | Ga0496125_0402185 | 3300048928 | Bacteria | 800 |
| 866 | Ga0496125_0417972 | 3300048928 | Bacteria | 778 |
| 867 | Ga0496126_0010409 | 3300048929 | Bacteria | 9754 |
| 868 | Ga0496126_0041287 | 3300048929 | Bacteria | 4271 |
| 869 | Ga0496126_0055830 | 3300048929 | Bacteria | 3571 |
| 870 | Ga0496126_0223740 | 3300048929 | Bacteria | 1579 |
| 871 | Ga0496126_0597240 | 3300048929 | Bacteria | 870 |
| 872 | Ga0496126_0630455 | 3300048929 | Bacteria | 841 |
| 873 | Ga0501031_0015117 | 3300049568 | Bacteria | 5014 |
| 874 | Ga0501032_0198905 | 3300049569 | Bacteria | 1308 |
| 875 | Ga0501036_0146115 | 3300049572 | Bacteria | 1994 |
| 876 | Ga0501036_0161723 | 3300049572 | Bacteria | 1887 |
| 877 | Ga0501036_0377202 | 3300049572 | Bacteria | 1184 |
| 878 | Ga0501036_1126164 | 3300049572 | Bacteria | 641 |
| 879 | Ga0501037_0417099 | 3300049573 | Bacteria | 919 |
| 880 | Ga0501038_0058049 | 3300049574 | Bacteria | 3319 |
| 881 | Ga0501038_0758606 | 3300049574 | Bacteria | 723 |
| 882 | Ga0501039_0000970 | 3300049575 | Bacteria | 20831 |
| 883 | Ga0501039_0320378 | 3300049575 | Bacteria | 1219 |
| 884 | Ga0501040_0044629 | 3300049576 | Bacteria | 3022 |
| 885 | Ga0501040_0144164 | 3300049576 | Bacteria | 1678 |
| 886 | Ga0501040_0357800 | 3300049576 | Bacteria | 1046 |
| 887 | Ga0501041_0015807 | 3300049577 | Bacteria | 4484 |
| 888 | Ga0501041_0043472 | 3300049577 | Bacteria | 2731 |
| 889 | Ga0501042_0068228 | 3300049578 | Bacteria | 2542 |
| 890 | Ga0501042_0206461 | 3300049578 | Bacteria | 1416 |
| 891 | Ga0501042_0224338 | 3300049578 | Bacteria | 1355 |
| 892 | Ga0501042_0854873 | 3300049578 | Bacteria | 662 |
| 893 | Ga0501043_0026690 | 3300049579 | Bacteria | 4531 |
| 894 | Ga0501046_0020094 | 3300049580 | Bacteria | 5530 |
| 895 | Ga0501046_0559762 | 3300049580 | Bacteria | 814 |
| 896 | Ga0501047_0172845 | 3300049581 | Bacteria | 2029 |
| 897 | Ga0501047_0884226 | 3300049581 | Bacteria | 707 |
| 898 | Ga0501047_1064472 | 3300049581 | Bacteria | 622 |
| 899 | Ga0501048_0006642 | 3300049582 | Bacteria | 8793 |
| 900 | Ga0501048_0028166 | 3300049582 | Bacteria | 4079 |
| 901 | Ga0501048_0208287 | 3300049582 | Bacteria | 1387 |
| 902 | Ga0501048_0271543 | 3300049582 | Bacteria | 1205 |
| 903 | Ga0501067_0009497 | 3300049583 | Bacteria | 5388 |
| 904 | Ga0501067_0016021 | 3300049583 | Bacteria | 4146 |
| 905 | Ga0501068_0000877 | 3300049584 | Bacteria | 15682 |
| 906 | Ga0501068_0015711 | 3300049584 | Bacteria | 4353 |
| 907 | Ga0501069_0292162 | 3300049585 | Bacteria | 955 |
| 908 | Ga0501070_0964995 | 3300049586 | Bacteria | 662 |
| 909 | Ga0501071_0000217 | 3300049587 | Bacteria | 26317 |
| 910 | Ga0501071_0003860 | 3300049587 | Bacteria | 9435 |
| 911 | Ga0501071_0015529 | 3300049587 | Bacteria | 5229 |
| 912 | Ga0501071_0149101 | 3300049587 | Bacteria | 1744 |
| 913 | Ga0501072_0030680 | 3300049588 | Bacteria | 4206 |
| 914 | Ga0501072_0091121 | 3300049588 | Bacteria | 2420 |
| 915 | Ga0501073_0002934 | 3300049589 | Bacteria | 12799 |
| 916 | Ga0501073_0036663 | 3300049589 | Bacteria | 3483 |
| 917 | Ga0501073_0253118 | 3300049589 | Bacteria | 1216 |
| 918 | Ga0501073_0323756 | 3300049589 | Bacteria | 1064 |
| 919 | Ga0501073_0524211 | 3300049589 | Bacteria | 819 |
| 920 | Ga0501074_0005690 | 3300049590 | Bacteria | 8981 |
| 921 | Ga0501074_0040383 | 3300049590 | Bacteria | 3380 |
| 922 | Ga0501074_0055774 | 3300049590 | Bacteria | 2847 |
| 923 | Ga0501074_0106747 | 3300049590 | Bacteria | 2005 |
| 924 | Ga0501075_0006246 | 3300049591 | Bacteria | 8190 |
| 925 | Ga0501076_0000571 | 3300049592 | Bacteria | 23489 |
| 926 | Ga0501076_0237794 | 3300049592 | Bacteria | 1489 |
| 927 | Ga0501076_0308509 | 3300049592 | Bacteria | 1298 |
| 928 | Ga0501076_0470952 | 3300049592 | Bacteria | 1035 |
| 929 | Ga0501076_0798339 | 3300049592 | Bacteria | 779 |
| 930 | Ga0501076_1155329 | 3300049592 | Bacteria | 637 |
| 931 | Ga0501077_0061780 | 3300049593 | Bacteria | 2377 |
| 932 | Ga0501077_0090215 | 3300049593 | Bacteria | 1942 |
| 933 | Ga0501077_0181557 | 3300049593 | Bacteria | 1337 |
| 934 | Ga0501077_0359010 | 3300049593 | Bacteria | 930 |
| 935 | Ga0501079_0006287 | 3300049741 | Bacteria | 8906 |
| 936 | Ga0501079_0047992 | 3300049741 | Bacteria | 3294 |
| 937 | Ga0501079_0176423 | 3300049741 | Bacteria | 1666 |
| 938 | Ga0501079_0355162 | 3300049741 | Bacteria | 1148 |
| 939 | Ga0501079_1141123 | 3300049741 | Bacteria | 614 |
| 940 | Ga0501080_0051988 | 3300049742 | Bacteria | 3813 |
| 941 | Ga0501080_0064731 | 3300049742 | Bacteria | 3400 |
| 942 | Ga0501080_0130907 | 3300049742 | Bacteria | 2323 |
| 943 | Ga0501080_0186836 | 3300049742 | Bacteria | 1905 |
| 944 | Ga0501080_0550258 | 3300049742 | Bacteria | 1028 |
| 945 | Ga0501081_0001576 | 3300049743 | Bacteria | 14052 |
| 946 | Ga0501081_0053945 | 3300049743 | Bacteria | 2776 |
| 947 | Ga0501081_0291103 | 3300049743 | Bacteria | 1197 |
| 948 | Ga0501083_0072663 | 3300049744 | Bacteria | 2286 |
| 949 | Ga0501083_0215490 | 3300049744 | Bacteria | 1251 |
| 950 | Ga0501035_0075026 | 3300049822 | Bacteria | 2991 |
| 951 | Ga0501035_0249314 | 3300049822 | Bacteria | 1508 |
| 952 | Ga0501035_0345593 | 3300049822 | Bacteria | 1246 |
| 953 | Ga0501044_0660648 | 3300049823 | Bacteria | 934 |
| 954 | Ga0501045_0000563 | 3300049824 | Bacteria | 23313 |
| 955 | Ga0501045_0103998 | 3300049824 | Bacteria | 2103 |
| 956 | Ga0501045_0308044 | 3300049824 | Bacteria | 1179 |
| 957 | nmdc:mga05p37_143344_c1 | 3300050507 | Bacteria | 2926 |
| 958 | nmdc:mga08y16_35804_c1 | 3300050511 | Bacteria | 5213 |
| 959 | nmdc:mga08y16_493239_c1 | 3300050511 | Bacteria | 1245 |
| 960 | nmdc:mga08y16_7354_c1 | 3300050511 | Bacteria | 11553 |
| 961 | nmdc:mga0n895_199652_c1 | 3300050512 | Bacteria | 2031 |
| 962 | nmdc:mga0rr50_11973_c1 | 3300050513 | Bacteria | 5581 |
| 963 | nmdc:mga08x19_217680_c1 | 3300050514 | Bacteria | 1312 |
| 964 | Ga0495612_0078887 | 3300053078 | Bacteria | 1382 |
| 965 | Ga0495595_0399236 | 3300053084 | Bacteria | 697 |
| 966 | Ga0500644_0075279 | 3300053088 | Bacteria | 1227 |
| 967 | Ga0500644_0263268 | 3300053088 | Bacteria | 730 |
| 968 | Ga0500646_0009703 | 3300053090 | Bacteria | 2464 |
| 969 | Ga0500583_0008807 | 3300053092 | Bacteria | 3651 |
| 970 | Ga0500583_0035077 | 3300053092 | Bacteria | 2235 |
| 971 | Ga0500583_0061322 | 3300053092 | Bacteria | 1775 |
| 972 | Ga0500651_0054681 | 3300053093 | Bacteria | 2501 |
| 973 | Ga0500641_0017271 | 3300053096 | Bacteria | 2697 |
| 974 | Ga0500641_0054606 | 3300053096 | Bacteria | 1652 |
| 975 | Ga0500641_0197909 | 3300053096 | Bacteria | 858 |
| 976 | Ga0500650_0499997 | 3300053098 | Bacteria | 517 |
| 977 | Ga0500556_0000801 | 3300053104 | Bacteria | 18392 |
| 978 | Ga0500556_0248461 | 3300053104 | Bacteria | 700 |
| 979 | Ga0500562_020126 | 3300053108 | Bacteria | 1732 |
| 980 | Ga0500591_063973 | 3300053115 | Bacteria | 1687 |
| 981 | Ga0500595_018281 | 3300053119 | Bacteria | 2567 |
| 982 | Ga0500614_164402 | 3300053123 | Bacteria | 674 |
| 983 | Ga0500628_061724 | 3300053129 | Bacteria | 917 |
| 984 | Ga0500652_197747 | 3300053131 | Bacteria | 817 |
| 985 | Ga0500658_0136358 | 3300053134 | Bacteria | 1098 |
| 986 | Ga0500568_0001263 | 3300053139 | Bacteria | 16721 |
| 987 | Ga0500568_0049181 | 3300053139 | Bacteria | 1665 |
| 988 | Ga0500577_0258285 | 3300053142 | Bacteria | 758 |
| 989 | Ga0500590_149032 | 3300053148 | Bacteria | 1058 |
| 990 | Ga0500616_0000092 | 3300053153 | Bacteria | 183860 |
| 991 | Ga0500616_0021879 | 3300053153 | Bacteria | 3576 |
| 992 | Ga0500616_0022231 | 3300053153 | Bacteria | 3544 |
| 993 | Ga0500627_0323827 | 3300053158 | Bacteria | 669 |
| 994 | Ga0500630_127871 | 3300053159 | Bacteria | 1115 |
| 995 | Ga0500636_0232782 | 3300053177 | Bacteria | 952 |
| 996 | Ga0500596_044456 | 3300053735 | Bacteria | 715 |
| 997 | Ga0501084_0050268 | 3300054114 | Bacteria | 3489 |
| 998 | Ga0501084_0064716 | 3300054114 | Bacteria | 3059 |
| 999 | Ga0501084_0107580 | 3300054114 | Bacteria | 2343 |
| 1000 | Ga0501084_0251930 | 3300054114 | Bacteria | 1490 |
| 1001 | Ga0501084_0641237 | 3300054114 | Bacteria | 897 |
| 1002 | Ga0501082_0000958 | 3300060353 | Bacteria | 25525 |
| 1003 | Ga0501082_0197914 | 3300060353 | Bacteria | 1748 |
| 1004 | Ga0501082_0686899 | 3300060353 | Bacteria | 896 |
| 1005 | Ga0466962_0000530 | 3300061719 | Bacteria | 16710 |
| 1006 | Ga0466962_0169473 | 3300061719 | Bacteria | 1063 |
| 1007 | Ga0530510_0008083 | 3300061734 | Bacteria | 7336 |
| 1008 | Ga0436365_1311778 | |||
| 1009 | Ga0070676_10059641 | |||
| 1010 | Ga0070683_100018504 | |||
| 1011 | Ga0070690_100032408 | |||
| 1012 | Ga0070690_100272676 | |||
| 1013 | Ga0070690_100538125 | |||
| 1014 | Ga0070670_100034693 | |||
| 1015 | Ga0070670_100330055 | |||
| 1016 | Ga0070677_10049724 | |||
| 1017 | Ga0070677_10189239 | |||
| 1018 | Ga0068869_100109697 | |||
| 1019 | Ga0068869_100133696 | |||
| 1020 | Ga0068869_100401934 | |||
| 1021 | Ga0068869_101207920 | |||
| 1022 | Ga0070666_10020519 | |||
| 1023 | Ga0070666_10640677 | |||
| 1024 | Ga0070666_11233348 | |||
| 1025 | Ga0070680_100000968 | |||
| 1026 | Ga0070680_100023132 | |||
| 1027 | Ga0070680_100773082 | |||
| 1028 | Ga0070682_100061248 | |||
| 1029 | Ga0070682_100066875 | |||
| 1030 | Ga0070682_100431172 | |||
| 1031 | Ga0068868_100485231 | |||
| 1032 | Ga0070689_100003519 | |||
| 1033 | Ga0070689_100104945 | |||
| 1034 | Ga0070691_10232450 | |||
| 1035 | Ga0070661_101230832 | |||
| 1036 | Ga0070661_101439008 | |||
| 1037 | Ga0070668_100380040 | |||
| 1038 | Ga0070668_100602234 | |||
| 1039 | Ga0070669_100183600 | |||
| 1040 | Ga0070669_100334463 | |||
| 1041 | Ga0070675_100004710 | |||
| 1042 | Ga0070675_100438038 | |||
| 1043 | Ga0070675_100709863 | |||
| 1044 | Ga0070675_100753352 | |||
| 1045 | Ga0070671_100088963 | |||
| 1046 | Ga0070671_100201924 | |||
| 1047 | Ga0070671_100567660 | |||
| 1048 | Ga0070674_100031373 | |||
| 1049 | Ga0070674_100041631 | |||
| 1050 | Ga0070674_100196063 | |||
| 1051 | Ga0070673_100059868 | |||
| 1052 | Ga0070673_100104718 | |||
| 1053 | Ga0070673_100566882 | |||
| 1054 | Ga0070673_101206812 | |||
| 1055 | Ga0070659_100181683 | |||
| 1056 | Ga0070667_100005254 | |||
| 1057 | Ga0070667_100041203 | |||
| 1058 | Ga0070667_100483489 | |||
| 1059 | Ga0070709_10397554 | |||
| 1060 | Ga0070709_10795717 | |||
| 1061 | Ga0070713_100008265 | |||
| 1062 | Ga0070713_100063685 | |||
| 1063 | Ga0070713_100074838 | |||
| 1064 | Ga0070713_100206967 | |||
| 1065 | Ga0070713_100952283 | |||
| 1066 | Ga0070710_10048728 | |||
| 1067 | Ga0070701_10039868 | |||
| 1068 | Ga0070711_100015720 | |||
| 1069 | Ga0070711_100031371 | |||
| 1070 | Ga0070711_100310571 | |||
| 1071 | Ga0070705_100385418 | |||
| 1072 | Ga0070705_100852803 | |||
| 1073 | Ga0070700_100039274 | |||
| 1074 | Ga0070700_100042098 | |||
| 1075 | Ga0070700_100376932 | |||
| 1076 | Ga0070700_101495909 | |||
| 1077 | Ga0070694_100199770 | |||
| 1078 | Ga0070663_100472475 | |||
| 1079 | Ga0070663_100889462 | |||
| 1080 | Ga0070663_101106769 | |||
| 1081 | Ga0070678_100097616 | |||
| 1082 | Ga0070678_100131843 | |||
| 1083 | Ga0070662_100164274 | |||
| 1084 | Ga0070662_100869756 | |||
| 1085 | Ga0070681_10003465 | |||
| 1086 | Ga0070681_10005119 | |||
| 1087 | Ga0070681_10026451 | |||
| 1088 | Ga0070681_10057408 | |||
| 1089 | Ga0070681_10081733 | |||
| 1090 | Ga0070681_10212956 | |||
| 1091 | Ga0070681_10319999 | |||
| 1092 | Ga0070681_10496755 | |||
| 1093 | Ga0070681_11080631 | |||
| 1094 | Ga0068867_100066038 | |||
| 1095 | Ga0068867_100147690 | |||
| 1096 | Ga0070685_10166632 | |||
| 1097 | Ga0070699_100133771 | |||
| 1098 | Ga0070679_100026143 | |||
| 1099 | Ga0070679_100071807 | |||
| 1100 | Ga0070679_100079665 | |||
| 1101 | Ga0070679_100133960 | |||
| 1102 | Ga0070679_100214429 | |||
| 1103 | Ga0070679_100263589 | |||
| 1104 | Ga0070679_100267623 | |||
| 1105 | Ga0070684_100063122 | |||
| 1106 | Ga0068853_100318914 | |||
| 1107 | Ga0068853_100636393 | |||
| 1108 | Ga0070672_100018864 | |||
| 1109 | Ga0070672_100138828 | |||
| 1110 | Ga0070686_100040720 | |||
| 1111 | Ga0070686_100075511 | |||
| 1112 | Ga0070686_100240435 | |||
| 1113 | Ga0070686_100458541 | |||
| 1114 | Ga0070686_100519385 | |||
| 1115 | Ga0070695_100095346 | |||
| 1116 | Ga0070695_100156284 | |||
| 1117 | Ga0070696_100011512 | |||
| 1118 | Ga0070696_100096560 | |||
| 1119 | Ga0070696_100215163 | |||
| 1120 | Ga0070696_100300554 | |||
| 1121 | Ga0070693_100197309 | |||
| 1122 | Ga0070693_100454102 | |||
| 1123 | Ga0070665_100001792 | |||
| 1124 | Ga0070665_100006525 | |||
| 1125 | Ga0070665_100014256 | |||
| 1126 | Ga0070665_100017976 | |||
| 1127 | Ga0070665_100030686 | |||
| 1128 | Ga0070665_100049788 | |||
| 1129 | Ga0070665_100107726 | |||
| 1130 | Ga0070665_100647534 | |||
| 1131 | Ga0070665_100666866 | |||
| 1132 | Ga0070704_100207122 | |||
| 1133 | Ga0068855_100004111 | |||
| 1134 | Ga0068855_100007561 | |||
| 1135 | Ga0068855_100010659 | |||
| 1136 | Ga0068855_100052155 | |||
| 1137 | Ga0068855_100311930 | |||
| 1138 | Ga0070664_100021561 | |||
| 1139 | Ga0068857_100151222 | |||
| 1140 | Ga0068857_100456434 | |||
| 1141 | Ga0068854_100139110 | |||
| 1142 | Ga0068854_100521584 | |||
| 1143 | Ga0068856_100214570 | |||
| 1144 | Ga0068856_100266115 | |||
| 1145 | Ga0068856_100448067 | |||
| 1146 | Ga0068856_100464880 | |||
| 1147 | Ga0070702_100054766 | |||
| 1148 | Ga0068852_100617935 | |||
| 1149 | Ga0068859_100004119 | |||
| 1150 | Ga0068859_100198070 | |||
| 1151 | Ga0068859_100327927 | |||
| 1152 | Ga0068859_100430338 | |||
| 1153 | Ga0068859_100749426 | |||
| 1154 | Ga0068864_100012721 | |||
| 1155 | Ga0068866_10316910 | |||
| 1156 | Ga0068861_100003440 | |||
| 1157 | Ga0068861_100004932 | |||
| 1158 | Ga0068861_100107896 | |||
| 1159 | Ga0068861_100178295 | |||
| 1160 | Ga0068861_100219749 | |||
| 1161 | Ga0068861_100229941 | |||
| 1162 | Ga0068861_100406858 | |||
| 1163 | Ga0068861_100893147 | |||
| 1164 | Ga0068861_100912073 | |||
| 1165 | Ga0068851_10190025 | |||
| 1166 | Ga0068870_10002932 | |||
| 1167 | Ga0068870_10424075 | |||
| 1168 | Ga0068863_100001602 | |||
| 1169 | Ga0068863_100042144 | |||
| 1170 | Ga0068863_100196967 | |||
| 1171 | Ga0068863_100444362 | |||
| 1172 | Ga0068863_100623449 | |||
| 1173 | Ga0068863_101417686 | |||
| 1174 | Ga0068858_100001047 | |||
| 1175 | Ga0068858_100003727 | |||
| 1176 | Ga0068858_100111814 | |||
| 1177 | Ga0068858_100246291 | |||
| 1178 | Ga0068858_100247977 | |||
| 1179 | Ga0068858_100267048 | |||
| 1180 | Ga0068860_100011257 | |||
| 1181 | Ga0068860_100080596 | |||
| 1182 | Ga0068860_100111333 | |||
| 1183 | Ga0068860_100264615 | |||
| 1184 | Ga0068860_101121708 | |||
| 1185 | Ga0068862_100035494 | |||
| 1186 | Ga0068862_100073411 | |||
| 1187 | Ga0068862_100165484 | |||
| 1188 | Ga0068862_100578320 | |||
| 1189 | Ga0068862_101222130 | |||
| 1190 | Ga0068862_101369490 | |||
| 1191 | Ga0081455_10000812 | |||
| 1192 | Ga0081455_10004966 | |||
| 1193 | Ga0081539_10000007 | |||
| 1194 | Ga0070717_10067689 | |||
| 1195 | Ga0070715_10212742 | |||
| 1196 | Ga0070715_10458577 | |||
| 1197 | Ga0070716_100022541 | |||
| 1198 | Ga0070712_100085564 | |||
| 1199 | Ga0070712_100138588 | |||
| 1200 | Ga0097621_100024793 | |||
| 1201 | Ga0097621_100040528 | |||
| 1202 | Ga0097621_100103993 | |||
| 1203 | Ga0097621_100333498 | |||
| 1204 | Ga0097621_100375570 | |||
| 1205 | Ga0097621_100495507 | |||
| 1206 | Ga0097621_101058680 | |||
| 1207 | Ga0097621_101187880 | |||
| 1208 | Ga0068871_100013848 | |||
| 1209 | Ga0068871_100043523 | |||
| 1210 | Ga0068871_100141596 | |||
| 1211 | Ga0068871_100182633 | |||
| 1212 | Ga0068871_100428187 | |||
| 1213 | Ga0075428_100002675 | |||
| 1214 | Ga0075428_101101009 | |||
| 1215 | Ga0075434_100206819 | |||
| 1216 | Ga0075429_100242266 | |||
| 1217 | Ga0075429_100687881 | |||
| 1218 | Ga0068865_100110615 | |||
| 1219 | Ga0075436_100208625 | |||
| 1220 | Ga0097620_100004119 | |||
| 1221 | Ga0097620_100198067 | |||
| 1222 | Ga0097620_100327935 | |||
| 1223 | Ga0097620_100430277 | |||
| 1224 | Ga0097620_100749424 | |||
| 1225 | Ga0097620_100792301 | |||
| 1226 | Ga0099794_10085604 | |||
| 1227 | Ga0099795_10004148 | |||
| 1228 | Ga0099795_10068942 | |||
| 1229 | Ga0105240_10001173 | |||
| 1230 | Ga0105240_10008995 | |||
| 1231 | Ga0105240_10019130 | |||
| 1232 | Ga0105240_10064942 | |||
| 1233 | Ga0105240_10069156 | |||
| 1234 | Ga0105240_10108677 | |||
| 1235 | Ga0105240_10127100 | |||
| 1236 | Ga0105240_10200507 | |||
| 1237 | Ga0105240_10283278 | |||
| 1238 | Ga0105240_10303733 | |||
| 1239 | Ga0105240_10500134 | |||
| 1240 | Ga0105240_11746776 | |||
| 1241 | Ga0111539_10005694 | |||
| 1242 | Ga0111539_10060190 | |||
| 1243 | Ga0111539_10615883 | |||
| 1244 | Ga0105245_10075271 | |||
| 1245 | Ga0105245_11337731 | |||
| 1246 | Ga0105247_10000233 | |||
| 1247 | Ga0105247_10012403 | |||
| 1248 | Ga0105247_10202682 | |||
| 1249 | Ga0105247_11056090 | |||
| 1250 | Ga0114129_10104189 | |||
| 1251 | Ga0105243_11809056 | |||
| 1252 | Ga0105241_10429656 | |||
| 1253 | Ga0105241_10513062 | |||
| 1254 | Ga0105241_10757611 | |||
| 1255 | Ga0105242_10010801 | |||
| 1256 | Ga0105242_10213676 | |||
| 1257 | Ga0105242_10365787 | |||
| 1258 | Ga0105242_10520623 | |||
| 1259 | Ga0105242_11079691 | |||
| 1260 | Ga0105248_10005023 | |||
| 1261 | Ga0105248_10440185 | |||
| 1262 | Ga0105248_11538174 | |||
| 1263 | Ga0105237_10064865 | |||
| 1264 | Ga0105237_10074879 | |||
| 1265 | Ga0105237_10135041 | |||
| 1266 | Ga0105237_10301187 | |||
| 1267 | Ga0105237_10346105 | |||
| 1268 | Ga0105238_10002316 | |||
| 1269 | Ga0105238_10019715 | |||
| 1270 | Ga0105238_10055950 | |||
| 1271 | Ga0105238_10113117 | |||
| 1272 | Ga0105238_10141644 | |||
| 1273 | Ga0105238_10227427 | |||
| 1274 | Ga0105238_10255452 | |||
| 1275 | Ga0105238_10580757 | |||
| 1276 | Ga0105249_10086181 | |||
| 1277 | Ga0105249_10095526 | |||
| 1278 | Ga0105249_10421450 | |||
| 1279 | Ga0105249_10475595 | |||
| 1280 | Ga0105249_10660702 | |||
| 1281 | Ga0105030_107969 | |||
| 1282 | Ga0099796_10006870 | |||
| 1283 | Ga0105239_10373422 | |||
| 1284 | Ga0105239_10611511 | |||
| 1285 | Ga0105239_10692038 | |||
| 1286 | Ga0105239_11128953 | |||
| 1287 | Ga0105246_11138257 | |||
| 1288 | Ga0157370_10001000 | |||
| 1289 | Ga0157370_10769347 | |||
| 1290 | Ga0157370_11166648 | |||
| 1291 | Ga0157369_10012063 | |||
| 1292 | Ga0157369_10267051 | |||
| 1293 | Ga0157369_10364086 | |||
| 1294 | Ga0157369_10810287 | |||
| 1295 | Ga0157369_10972713 | |||
| 1296 | Ga0157369_11277983 | |||
| 1297 | Ga0157374_10238699 | |||
| 1298 | Ga0157374_10416706 | |||
| 1299 | Ga0157374_10517772 | |||
| 1300 | Ga0157378_10040872 | |||
| 1301 | Ga0157378_10054988 | |||
| 1302 | Ga0163162_10107404 | |||
| 1303 | Ga0163162_10163682 | |||
| 1304 | Ga0163162_11059411 | |||
| 1305 | Ga0157372_10061340 | |||
| 1306 | Ga0157372_10172800 | |||
| 1307 | Ga0157372_10641194 | |||
| 1308 | Ga0157372_10715392 | |||
| 1309 | Ga0157372_11193860 | |||
| 1310 | Ga0157375_10006160 | |||
| 1311 | Ga0157375_10144830 | |||
| 1312 | Ga0163163_10062321 | |||
| 1313 | Ga0163163_10094096 | |||
| 1314 | Ga0163163_10098153 | |||
| 1315 | Ga0163163_10110396 | |||
| 1316 | Ga0163163_10271030 | |||
| 1317 | Ga0163163_10362033 | |||
| 1318 | Ga0163163_10447644 | |||
| 1319 | Ga0163163_10747810 | |||
| 1320 | Ga0157380_10006488 | |||
| 1321 | Ga0157380_10018385 | |||
| 1322 | Ga0157380_10019445 | |||
| 1323 | Ga0157380_10029531 | |||
| 1324 | Ga0157380_10034435 | |||
| 1325 | Ga0157380_10048541 | |||
| 1326 | Ga0157380_10113939 | |||
| 1327 | Ga0157380_10270079 | |||
| 1328 | Ga0157377_10184017 | |||
| 1329 | Ga0157379_10023361 | |||
| 1330 | Ga0157379_10054291 | |||
| 1331 | Ga0157379_10054721 | |||
| 1332 | Ga0157379_10129068 | |||
| 1333 | Ga0157379_10191037 | |||
| 1334 | Ga0157379_10752390 | |||
| 1335 | Ga0157379_10898289 | |||
| 1336 | Ga0157379_11064911 | |||
| 1337 | Ga0157376_10042389 | |||
| 1338 | Ga0157376_10285966 | |||
| 1339 | Ga0157376_10367887 | |||
| 1340 | Ga0157376_11239439 | |||
| 1341 | Ga0157376_12215256 | |||
| 1342 | Ga0197907_10910721 | |||
| 1343 | Ga0213872_10170418 | |||
| 1344 | Ga0213874_10028837 | |||
| 1345 | Ga0213874_10079968 | |||
| 1346 | Ga0213874_10217635 | |||
| 1347 | Ga0213876_10085012 | |||
| 1348 | Ga0213876_10209494 | |||
| 1349 | Ga0224712_10631440 | |||
| 1350 | Ga0228598_1028368 | |||
| 1351 | Ga0207656_10241780 | |||
| 1352 | Ga0207682_10003313 | |||
| 1353 | Ga0207682_10005611 | |||
| 1354 | Ga0207682_10379223 | |||
| 1355 | Ga0207692_10379710 | |||
| 1356 | Ga0207642_10055749 | |||
| 1357 | Ga0207642_10380908 | |||
| 1358 | Ga0207642_10502936 | |||
| 1359 | Ga0207710_10000201 | |||
| 1360 | Ga0207680_10247279 | |||
| 1361 | Ga0207680_10760287 | |||
| 1362 | Ga0207685_10121858 | |||
| 1363 | Ga0207685_10142182 | |||
| 1364 | Ga0207685_10352875 | |||
| 1365 | Ga0207699_10029870 | |||
| 1366 | Ga0207699_10034043 | |||
| 1367 | Ga0207699_10769382 | |||
| 1368 | Ga0207699_10825005 | |||
| 1369 | Ga0207699_10870939 | |||
| 1370 | Ga0207645_10181840 | |||
| 1371 | Ga0207643_10011260 | |||
| 1372 | Ga0207643_10133989 | |||
| 1373 | Ga0207707_10002563 | |||
| 1374 | Ga0207707_10005125 | |||
| 1375 | Ga0207707_10034584 | |||
| 1376 | Ga0207707_10094049 | |||
| 1377 | Ga0207707_10188602 | |||
| 1378 | Ga0207707_10397706 | |||
| 1379 | Ga0207695_10008576 | |||
| 1380 | Ga0207695_10083482 | |||
| 1381 | Ga0207695_10119723 | |||
| 1382 | Ga0207695_10167856 | |||
| 1383 | Ga0207695_10297350 | |||
| 1384 | Ga0207695_10363688 | |||
| 1385 | Ga0207695_10589630 | |||
| 1386 | Ga0207695_10985401 | |||
| 1387 | Ga0207671_10125028 | |||
| 1388 | Ga0207671_10162008 | |||
| 1389 | Ga0207671_10268227 | |||
| 1390 | Ga0207693_10000504 | |||
| 1391 | Ga0207693_10085140 | |||
| 1392 | Ga0207663_10095173 | |||
| 1393 | Ga0207663_10262273 | |||
| 1394 | Ga0207663_10266286 | |||
| 1395 | Ga0207663_10520252 | |||
| 1396 | Ga0207660_10034299 | |||
| 1397 | Ga0207660_10043141 | |||
| 1398 | Ga0207660_10066645 | |||
| 1399 | Ga0207660_11291684 | |||
| 1400 | Ga0207657_10157492 | |||
| 1401 | Ga0207649_11083828 | |||
| 1402 | Ga0207652_10005625 | |||
| 1403 | Ga0207652_10041710 | |||
| 1404 | Ga0207652_10059561 | |||
| 1405 | Ga0207652_10161919 | |||
| 1406 | Ga0207652_10295307 | |||
| 1407 | Ga0207652_10296029 | |||
| 1408 | Ga0207652_10301899 | |||
| 1409 | Ga0207652_10351894 | |||
| 1410 | Ga0207694_10310382 | |||
| 1411 | Ga0207694_10574763 | |||
| 1412 | Ga0207694_10949198 | |||
| 1413 | Ga0207650_10293741 | |||
| 1414 | Ga0207659_10038986 | |||
| 1415 | Ga0207659_10173280 | |||
| 1416 | Ga0207687_10113306 | |||
| 1417 | Ga0207687_10360615 | |||
| 1418 | Ga0207700_10035973 | |||
| 1419 | Ga0207700_10048329 | |||
| 1420 | Ga0207700_10223259 | |||
| 1421 | Ga0207700_10629090 | |||
| 1422 | Ga0207664_10023491 | |||
| 1423 | Ga0207664_11309316 | |||
| 1424 | Ga0207644_10019585 | |||
| 1425 | Ga0207644_10074500 | |||
| 1426 | Ga0207644_10505370 | |||
| 1427 | Ga0207690_10697987 | |||
| 1428 | Ga0207706_10186322 | |||
| 1429 | Ga0207686_10133587 | |||
| 1430 | Ga0207686_10237894 | |||
| 1431 | Ga0207709_10055774 | |||
| 1432 | Ga0207670_10219925 | |||
| 1433 | Ga0207670_10462434 | |||
| 1434 | Ga0207670_10710493 | |||
| 1435 | Ga0207670_10991982 | |||
| 1436 | Ga0207669_10011913 | |||
| 1437 | Ga0207669_10140071 | |||
| 1438 | Ga0207669_10401784 | |||
| 1439 | Ga0207704_10692614 | |||
| 1440 | Ga0207665_10001101 | |||
| 1441 | Ga0207665_10024483 | |||
| 1442 | Ga0207665_10105960 | |||
| 1443 | Ga0207691_10003800 | |||
| 1444 | Ga0207691_10011067 | |||
| 1445 | Ga0207691_10450321 | |||
| 1446 | Ga0207711_10062553 | |||
| 1447 | Ga0207711_10365682 | |||
| 1448 | Ga0207711_10569001 | |||
| 1449 | Ga0207711_10684875 | |||
| 1450 | Ga0207689_10125712 | |||
| 1451 | Ga0207689_10285138 | |||
| 1452 | Ga0207689_10394036 | |||
| 1453 | Ga0207689_11282875 | |||
| 1454 | Ga0207661_10305127 | |||
| 1455 | Ga0207679_10308371 | |||
| 1456 | Ga0207679_10363017 | |||
| 1457 | Ga0207679_10581953 | |||
| 1458 | Ga0207679_11372584 | |||
| 1459 | Ga0207667_10008439 | |||
| 1460 | Ga0207667_10022646 | |||
| 1461 | Ga0207667_10076501 | |||
| 1462 | Ga0207667_10222530 | |||
| 1463 | Ga0207667_11800497 | |||
| 1464 | Ga0207651_10074944 | |||
| 1465 | Ga0207651_10301027 | |||
| 1466 | Ga0207651_10442318 | |||
| 1467 | Ga0207651_10990310 | |||
| 1468 | Ga0207651_11093608 | |||
| 1469 | Ga0207712_10078343 | |||
| 1470 | Ga0207712_10541867 | |||
| 1471 | Ga0207712_10695769 | |||
| 1472 | Ga0207668_10218273 | |||
| 1473 | Ga0207668_10671333 | |||
| 1474 | Ga0207668_11023663 | |||
| 1475 | Ga0207658_10000303 | |||
| 1476 | Ga0207658_10024530 | |||
| 1477 | Ga0207658_10034700 | |||
| 1478 | Ga0207658_10205862 | |||
| 1479 | Ga0207658_11340156 | |||
| 1480 | Ga0207677_10057464 | |||
| 1481 | Ga0207703_10003121 | |||
| 1482 | Ga0207703_10006615 | |||
| 1483 | Ga0207703_10092458 | |||
| 1484 | Ga0207703_10789439 | |||
| 1485 | Ga0207703_11829831 | |||
| 1486 | Ga0207639_10204555 | |||
| 1487 | Ga0207639_11083032 | |||
| 1488 | Ga0207639_12019751 | |||
| 1489 | Ga0207678_10144536 | |||
| 1490 | Ga0207678_10296965 | |||
| 1491 | Ga0207708_10016081 | |||
| 1492 | Ga0207708_10324412 | |||
| 1493 | Ga0207708_10355177 | |||
| 1494 | Ga0207708_10775517 | |||
| 1495 | Ga0207708_10880885 | |||
| 1496 | Ga0207702_10148678 | |||
| 1497 | Ga0207702_10629612 | |||
| 1498 | Ga0207641_10003475 | |||
| 1499 | Ga0207641_10004348 | |||
| 1500 | Ga0207641_10145565 | |||
| 1501 | Ga0207641_10344643 | |||
| 1502 | Ga0207641_10433822 | |||
| 1503 | Ga0207641_10630206 | |||
| 1504 | Ga0207641_10742867 | |||
| 1505 | Ga0207641_12262864 | |||
| 1506 | Ga0207648_10024833 | |||
| 1507 | Ga0207648_10048166 | |||
| 1508 | Ga0207648_10059568 | |||
| 1509 | Ga0207676_10007753 | |||
| 1510 | Ga0207676_10439291 | |||
| 1511 | Ga0207674_10273415 | |||
| 1512 | Ga0207675_100002742 | |||
| 1513 | Ga0207675_100018690 | |||
| 1514 | Ga0207675_100027461 | |||
| 1515 | Ga0207675_100096122 | |||
| 1516 | Ga0207675_100128928 | |||
| 1517 | Ga0207675_100434221 | |||
| 1518 | Ga0207675_100937085 | |||
| 1519 | Ga0207683_10061481 | |||
| 1520 | Ga0207683_10123215 | |||
| 1521 | Ga0207683_10298547 | |||
| 1522 | Ga0207683_10766420 | |||
| 1523 | Ga0207698_10516891 | |||
| 1524 | Ga0209996_1032536 | |||
| 1525 | Ga0210002_1045303 | |||
| 1526 | Ga0209588_1051957 | |||
| 1527 | Ga0209966_1104527 | |||
| 1528 | Ga0209974_10087375 | |||
| 1529 | Ga0207428_10000990 | |||
| 1530 | Ga0265354_1000834 | |||
| 1531 | Ga0265356_1001137 | |||
| 1532 | Ga0265355_1007989 | |||
| 1533 | Ga0268266_10002557 | |||
| 1534 | Ga0268266_10006072 | |||
| 1535 | Ga0268266_10006493 | |||
| 1536 | Ga0268266_10075426 | |||
| 1537 | Ga0268266_10080204 | |||
| 1538 | Ga0268266_10125135 | |||
| 1539 | Ga0268266_10140339 | |||
| 1540 | Ga0268266_10167606 | |||
| 1541 | Ga0268266_10900407 | |||
| 1542 | Ga0268265_10038525 | |||
| 1543 | Ga0268265_10182138 | |||
| 1544 | Ga0268265_10198098 | |||
| 1545 | Ga0268265_10200532 | |||
| 1546 | Ga0268265_10421447 | |||
| 1547 | Ga0268265_11139119 | |||
| 1548 | Ga0268264_10001238 | |||
| 1549 | Ga0268264_10030059 | |||
| 1550 | Ga0268264_10034163 | |||
| 1551 | Ga0268264_10252960 | |||
| 1552 | Ga0268264_11210140 | |||
| 1553 | Ga0265318_10153719 | |||
| 1554 | Ga0307515_10006279 | |||
| 1555 | Ga0265338_10565779 | |||
| 1556 | Ga0307511_10000172 | |||
| 1557 | Ga0307511_10013004 | |||
| 1558 | Ga0307511_10114098 | |||
| 1559 | Ga0265770_1002356 | |||
| 1560 | Ga0265771_1000328 | |||
| 1561 | Ga0265773_1010374 | |||
| 1562 | Ga0265760_10000462 | |||
| 1563 | Ga0265760_10246424 | |||
| 1564 | Ga0265340_10007525 | |||
| 1565 | Ga0265339_10281921 | |||
| 1566 | Ga0265339_10344780 | |||
| 1567 | Ga0265331_10110405 | |||
| 1568 | Ga0307513_10009329 | |||
| 1569 | Ga0307513_10029412 | |||
| 1570 | Ga0307513_10034337 | |||
| 1571 | Ga0307513_10065152 | |||
| 1572 | Ga0307513_10324651 | |||
| 1573 | Ga0307509_10001027 | |||
| 1574 | Ga0307509_10156836 | |||
| 1575 | Ga0307509_10232468 | |||
| 1576 | Ga0307408_100067860 | |||
| 1577 | Ga0307408_100074277 | |||
| 1578 | Ga0307408_100122985 | |||
| 1579 | Ga0307408_100167946 | |||
| 1580 | Ga0307408_101430908 | |||
| 1581 | Ga0307408_101742039 | |||
| 1582 | Ga0265313_10041615 | |||
| 1583 | Ga0307514_10200908 | |||
| 1584 | Ga0316575_10009676 | |||
| 1585 | Ga0265314_10200051 | |||
| 1586 | Ga0265314_10292498 | |||
| 1587 | Ga0316576_10030261 | |||
| 1588 | Ga0316578_10609274 | |||
| 1589 | Ga0307516_10048270 | |||
| 1590 | Ga0307516_10434446 | |||
| 1591 | Ga0307405_10007840 | |||
| 1592 | Ga0307405_10016044 | |||
| 1593 | Ga0307405_10799654 | |||
| 1594 | Ga0316577_10048607 | |||
| 1595 | Ga0307413_10004099 | |||
| 1596 | Ga0307413_10022662 | |||
| 1597 | Ga0307410_10003481 | |||
| 1598 | Ga0307410_10014862 | |||
| 1599 | Ga0307410_10240121 | |||
| 1600 | Ga0307410_10661886 | |||
| 1601 | Ga0307406_10752500 | |||
| 1602 | Ga0307406_11044795 | |||
| 1603 | Ga0307407_10009190 | |||
| 1604 | Ga0307407_10126846 | |||
| 1605 | Ga0307407_10540485 | |||
| 1606 | Ga0307412_10015163 | |||
| 1607 | Ga0307412_10056917 | |||
| 1608 | Ga0307412_10307943 | |||
| 1609 | Ga0307409_100005159 | |||
| 1610 | Ga0307409_100062053 | |||
| 1611 | Ga0307409_100138477 | |||
| 1612 | Ga0307409_100148629 | |||
| 1613 | Ga0307409_100326915 | |||
| 1614 | Ga0307416_100018394 | |||
| 1615 | Ga0307416_100332688 | |||
| 1616 | Ga0307416_100521976 | |||
| 1617 | Ga0307416_100921045 | |||
| 1618 | Ga0307416_101094738 | |||
| 1619 | Ga0307416_101355486 | |||
| 1620 | Ga0307414_10012857 | |||
| 1621 | Ga0307414_10111053 | |||
| 1622 | Ga0307414_11058530 | |||
| 1623 | Ga0307411_10001043 | |||
| 1624 | Ga0307411_10017387 | |||
| 1625 | Ga0307411_10042910 | |||
| 1626 | Ga0307411_10792667 | |||
| 1627 | Ga0307411_11291796 | |||
| 1628 | Ga0307415_100041219 | |||
| 1629 | Ga0307415_100240380 | |||
| 1630 | Ga0307510_10000010 | |||
| 1631 | Ga0307510_10019615 | |||
| 1632 | Ga0316212_1027775 | |||
| 1633 | Ga0373923_0332737 | |||
| 1634 | Ga0373936_0014123 | |||
| 1635 | Ga0373936_0019053 | |||
| 1636 | Ga0373936_0096979 | |||
| 1637 | Ga0373936_0220327 | |||
| 1638 | Ga0373953_0026671 | |||
| 1639 | Ga0373953_0134946 | |||
| 1640 | Ga0373953_0156694 | |||
| 1641 | Ga0373954_0079775 | |||
| 1642 | Ga0373956_0142596 | |||
| 1643 | Ga0373956_0244541 | |||
| 1644 | Ga0373943_0074814 | |||
| 1645 | Ga0373955_0143437 | |||
| 1646 | Ga0373955_0308838 | |||
| 1647 | Ga0316574_0072750 | |||
| 1648 | Ga0373924_0159693 | |||
| 1649 | Ga0373924_0206938 | |||
| 1650 | Ga0373935_0696693 | |||
| 1651 | Ga0373927_0026014 | |||
| 1652 | Ga0373927_0168559 | |||
| 1653 | Ga0373933_0012633 | |||
| 1654 | Ga0373933_0534519 | |||
| 1655 | Ga0373947_0116053 | |||
| 1656 | Ga0373937_0203792 | |||
| 1657 | Ga0373937_0369215 | |||
| 1658 | Ga0373937_0445582 | |||
| 1659 | Ga0316584_0087069 | |||
| 1660 | Ga0373925_0072983 | |||
| 1661 | Ga0373925_0459402 | |||
| 1662 | Ga0373925_0477407 | |||
| 1663 | Ga0395900_0035103 | |||
| 1664 | Ga0395898_0028526 | |||
| 1665 | Ga0395898_0042737 | |||
| 1666 | Ga0395898_0046444 | |||
| 1667 | Ga0395898_0171233 | |||
| 1668 | Ga0395905_0731640 | |||
| 1669 | Ga0395905_1575270 | |||
| 1670 | Ga0436365_0303382 | |||
| 1671 | Ga0436365_0338742 | |||
| 1672 | Ga0436365_0869677 | |||
| 1673 | Ga0436365_0908999 | |||
| 1674 | Ga0436360_0033999 | |||
| 1675 | Ga0436360_0335434 | |||
| 1676 | Ga0436360_0928068 | |||
| 1677 | Ga0436361_1016867 | |||
| 1678 | Ga0436361_1172308 | |||
| 1679 | Ga0436361_1176747 | |||
| 1680 | Ga0436363_0122084 | |||
| 1681 | Ga0436363_0268552 | |||
| 1682 | Ga0436363_0378144 | |||
| 1683 | Ga0436363_0861289 | |||
| 1684 | Ga0436363_1158081 | |||
| 1685 | Ga0436363_1328184 | |||
| 1686 | Ga0436363_1591892 | |||
| 1687 | Ga0436362_0937886 | |||
| 1688 | Ga0439439_0045723 | |||
| 1689 | Ga0439453_0011553 | |||
| 1690 | Ga0451787_417005 | |||
| 1691 | Ga0451789_0579430 | |||
| 1692 | Ga0451791_1119097 | |||
| 1693 | Ga0451791_1750484 | |||
| 1694 | Ga0451793_0229681 | |||
| 1695 | Ga0451797_0553840 | |||
| 1696 | Ga0451795_1018544 | |||
| 1697 | Ga0451800_0299913 | |||
| 1698 | Ga0451800_0510418 | |||
| 1699 | Ga0451800_1642085 | |||
| 1700 | Ga0451802_0265411 | |||
| 1701 | Ga0451802_1746363 | |||
| 1702 | Ga0451804_0808277 | |||
| 1703 | Ga0451804_0832309 | |||
| 1704 | Ga0451807_0666976 | |||
| 1705 | Ga0451807_1774474 | |||
| 1706 | Ga0451833_0262536 | |||
| 1707 | Ga0451837_0300169 | |||
| 1708 | Ga0451839_0947681 | |||
| 1709 | Ga0451851_0365422 | |||
| 1710 | Ga0451853_0413289 | |||
| 1711 | Ga0451853_1200973 | |||
| 1712 | Ga0439431_0027472 | |||
| 1713 | Ga0439433_0009397 | |||
| 1714 | Ga0439442_018200 | |||
| 1715 | Ga0439443_008288 | |||
| 1716 | Ga0439456_017772 | |||
| 1717 | Ga0450920_004346 | |||
| 1718 | Ga0450923_001623 | |||
| 1719 | Ga0450923_001799 | |||
| 1720 | Ga0450923_093410 | |||
| 1721 | Ga0450923_097886 | |||
| 1722 | Ga0450894_004282 | |||
| 1723 | Ga0450895_000816 | |||
| 1724 | Ga0450896_002134 | |||
| 1725 | Ga0450898_014493 | |||
| 1726 | Ga0450910_012031 | |||
| 1727 | Ga0450910_012345 | |||
| 1728 | Ga0439446_0000369 | |||
| 1729 | Ga0439446_0005318 | |||
| 1730 | Ga0439446_0032069 | |||
| 1731 | Ga0450908_004140 | |||
| 1732 | Ga0439434_0000893 | |||
| 1733 | Ga0439435_0000462 | |||
| 1734 | Ga0439444_0000456 | |||
| 1735 | Ga0439459_0040765 | |||
| 1736 | Ga0439464_0162601 | |||
| 1737 | Ga0450918_007153 | |||
| 1738 | Ga0451577_0097002 | |||
| 1739 | Ga0451577_0653005 | |||
| 1740 | Ga0466969_0000982 | |||
| 1741 | Ga0466969_0001200 | |||
| 1742 | Ga0466969_0082749 | |||
| 1743 | Ga0466969_0101989 | |||
| 1744 | Ga0466965_0066072 | |||
| 1745 | Ga0466966_0030307 | |||
| 1746 | Ga0466966_0044847 | |||
| 1747 | Ga0466966_0094645 | |||
| 1748 | Ga0466961_0000578 | |||
| 1749 | Ga0466964_0000252 | |||
| 1750 | Ga0453684_0440648 | |||
| 1751 | Ga0466971_0000941 | |||
| 1752 | Ga0466970_0035215 | |||
| 1753 | Ga0466957_0064636 | |||
| 1754 | Ga0466960_0094798 | |||
| 1755 | Ga0466959_0014261 | |||
| 1756 | Ga0466959_0064687 | |||
| 1757 | Ga0466959_0205595 | |||
| 1758 | Ga0466959_0216794 | |||
| 1759 | Ga0466959_0518270 | |||
| 1760 | Ga0451576_0068277 | |||
| 1761 | Ga0451576_1265543 | |||
| 1762 | Ga0466958_0031544 | |||
| 1763 | Ga0466967_0437847 | |||
| 1764 | Ga0495617_096422 | |||
| 1765 | Ga0495590_0057281 | |||
| 1766 | Ga0495590_0071514 | |||
| 1767 | Ga0495591_072580 | |||
| 1768 | Ga0495629_0310940 | |||
| 1769 | Ga0495638_0001478 | |||
| 1770 | Ga0495638_0050101 | |||
| 1771 | Ga0495638_0142698 | |||
| 1772 | Ga0495638_0197188 | |||
| 1773 | Ga0495580_0006591 | |||
| 1774 | Ga0495580_0020718 | |||
| 1775 | Ga0495580_0041092 | |||
| 1776 | Ga0495580_0225236 | |||
| 1777 | Ga0495580_0395823 | |||
| 1778 | Ga0495605_0208624 | |||
| 1779 | Ga0495639_0353189 | |||
| 1780 | Ga0495664_0381127 | |||
| 1781 | Ga0495585_0115260 | |||
| 1782 | Ga0495606_0108932 | |||
| 1783 | Ga0495608_0260742 | |||
| 1784 | Ga0495616_0000953 | |||
| 1785 | Ga0495616_0052807 | |||
| 1786 | Ga0495618_0231002 | |||
| 1787 | Ga0495620_0081264 | |||
| 1788 | Ga0495628_0195959 | |||
| 1789 | Ga0495630_0149600 | |||
| 1790 | Ga0495632_0020802 | |||
| 1791 | Ga0495632_0044299 | |||
| 1792 | Ga0495643_0329515 | |||
| 1793 | Ga0495644_0053648 | |||
| 1794 | Ga0495652_0620543 | |||
| 1795 | Ga0495586_0489156 | |||
| 1796 | Ga0495587_0430642 | |||
| 1797 | Ga0495598_0113017 | |||
| 1798 | Ga0495656_0077574 | |||
| 1799 | Ga0495668_0115392 | |||
| 1800 | Ga0495668_0475624 | |||
| 1801 | Ga0495611_0075189 | |||
| 1802 | Ga0495625_0029944 | |||
| 1803 | Ga0495625_0081472 | |||
| 1804 | Ga0495625_0092738 | |||
| 1805 | Ga0495625_0097404 | |||
| 1806 | Ga0495625_0202321 | |||
| 1807 | Ga0495635_0463410 | |||
| 1808 | Ga0495659_0134657 | |||
| 1809 | Ga0495657_0351105 | |||
| 1810 | Ga0495599_0177400 | |||
| 1811 | Ga0495599_0608715 | |||
| 1812 | Ga0495647_0177246 | |||
| 1813 | Ga0495658_0452817 | |||
| 1814 | Ga0495658_0884994 | |||
| 1815 | Ga0495613_0288223 | |||
| 1816 | Ga0495613_0521420 | |||
| 1817 | Ga0495671_0523726 | |||
| 1818 | Ga0495649_0047310 | |||
| 1819 | Ga0495649_0189790 | |||
| 1820 | Ga0495604_0545513 | |||
| 1821 | Ga0495680_0173575 | |||
| 1822 | Ga0495687_040056 | |||
| 1823 | Ga0495687_074242 | |||
| 1824 | Ga0495681_0036130 | |||
| 1825 | Ga0495686_0064610 | |||
| 1826 | Ga0495686_0364049 | |||
| 1827 | Ga0495602_0351646 | |||
| 1828 | Ga0496100_0133500 | |||
| 1829 | Ga0496100_0929492 | |||
| 1830 | Ga0496101_0111028 | |||
| 1831 | Ga0496101_0290623 | |||
| 1832 | Ga0496101_0472422 | |||
| 1833 | Ga0496102_0012586 | |||
| 1834 | Ga0496102_0025352 | |||
| 1835 | Ga0496102_0028547 | |||
| 1836 | Ga0496104_0021923 | |||
| 1837 | Ga0496104_0207214 | |||
| 1838 | Ga0496104_0230361 | |||
| 1839 | Ga0496105_0019756 | |||
| 1840 | Ga0496105_0183316 | |||
| 1841 | Ga0496105_0206325 | |||
| 1842 | Ga0496106_0095620 | |||
| 1843 | Ga0496106_0109593 | |||
| 1844 | Ga0496107_0136732 | |||
| 1845 | Ga0496107_0686813 | |||
| 1846 | Ga0496108_0055001 | |||
| 1847 | Ga0496109_0672668 | |||
| 1848 | Ga0496109_1300234 | |||
| 1849 | Ga0496110_0033998 | |||
| 1850 | Ga0496111_0419988 | |||
| 1851 | Ga0496112_0236706 | |||
| 1852 | Ga0496113_0285438 | |||
| 1853 | Ga0496114_0024321 | |||
| 1854 | Ga0496114_0112791 | |||
| 1855 | Ga0496114_0298917 | |||
| 1856 | Ga0496115_0014977 | |||
| 1857 | Ga0496116_0009539 | |||
| 1858 | Ga0496117_0000581 | |||
| 1859 | Ga0496118_0001068 | |||
| 1860 | Ga0496118_0042982 | |||
| 1861 | Ga0496119_0006293 | |||
| 1862 | Ga0496119_0022325 | |||
| 1863 | Ga0496120_0007212 | |||
| 1864 | Ga0496120_0018016 | |||
| 1865 | Ga0496121_0003828 | |||
| 1866 | Ga0496121_0039297 | |||
| 1867 | Ga0496121_0143634 | |||
| 1868 | Ga0496124_0159819 | |||
| 1869 | Ga0496125_0000553 | |||
| 1870 | Ga0496125_0008847 | |||
| 1871 | Ga0496125_0024657 | |||
| 1872 | Ga0496125_0402185 | |||
| 1873 | Ga0496125_0417972 | |||
| 1874 | Ga0496126_0010409 | |||
| 1875 | Ga0496126_0041287 | |||
| 1876 | Ga0496126_0055830 | |||
| 1877 | Ga0496126_0223740 | |||
| 1878 | Ga0496126_0597240 | |||
| 1879 | Ga0496126_0630455 | |||
| 1880 | Ga0501031_0015117 | |||
| 1881 | Ga0501032_0198905 | |||
| 1882 | Ga0501036_0146115 | |||
| 1883 | Ga0501036_0161723 | |||
| 1884 | Ga0501036_0377202 | |||
| 1885 | Ga0501036_1126164 | |||
| 1886 | Ga0501037_0417099 | |||
| 1887 | Ga0501038_0058049 | |||
| 1888 | Ga0501038_0758606 | |||
| 1889 | Ga0501039_0000970 | |||
| 1890 | Ga0501039_0320378 | |||
| 1891 | Ga0501040_0044629 | |||
| 1892 | Ga0501040_0144164 | |||
| 1893 | Ga0501040_0357800 | |||
| 1894 | Ga0501041_0015807 | |||
| 1895 | Ga0501041_0043472 | |||
| 1896 | Ga0501042_0068228 | |||
| 1897 | Ga0501042_0206461 | |||
| 1898 | Ga0501042_0224338 | |||
| 1899 | Ga0501042_0854873 | |||
| 1900 | Ga0501043_0026690 | |||
| 1901 | Ga0501046_0020094 | |||
| 1902 | Ga0501046_0559762 | |||
| 1903 | Ga0501047_0172845 | |||
| 1904 | Ga0501047_0884226 | |||
| 1905 | Ga0501047_1064472 | |||
| 1906 | Ga0501048_0006642 | |||
| 1907 | Ga0501048_0028166 | |||
| 1908 | Ga0501048_0208287 | |||
| 1909 | Ga0501048_0271543 | |||
| 1910 | Ga0501067_0009497 | |||
| 1911 | Ga0501067_0016021 | |||
| 1912 | Ga0501068_0000877 | |||
| 1913 | Ga0501068_0015711 | |||
| 1914 | Ga0501069_0292162 | |||
| 1915 | Ga0501070_0964995 | |||
| 1916 | Ga0501071_0000217 | |||
| 1917 | Ga0501071_0003860 | |||
| 1918 | Ga0501071_0015529 | |||
| 1919 | Ga0501071_0149101 | |||
| 1920 | Ga0501072_0030680 | |||
| 1921 | Ga0501072_0091121 | |||
| 1922 | Ga0501073_0002934 | |||
| 1923 | Ga0501073_0036663 | |||
| 1924 | Ga0501073_0253118 | |||
| 1925 | Ga0501073_0323756 | |||
| 1926 | Ga0501073_0524211 | |||
| 1927 | Ga0501074_0005690 | |||
| 1928 | Ga0501074_0040383 | |||
| 1929 | Ga0501074_0055774 | |||
| 1930 | Ga0501074_0106747 | |||
| 1931 | Ga0501075_0006246 | |||
| 1932 | Ga0501076_0000571 | |||
| 1933 | Ga0501076_0237794 | |||
| 1934 | Ga0501076_0308509 | |||
| 1935 | Ga0501076_0470952 | |||
| 1936 | Ga0501076_0798339 | |||
| 1937 | Ga0501076_1155329 | |||
| 1938 | Ga0501077_0061780 | |||
| 1939 | Ga0501077_0090215 | |||
| 1940 | Ga0501077_0181557 | |||
| 1941 | Ga0501077_0359010 | |||
| 1942 | Ga0501079_0006287 | |||
| 1943 | Ga0501079_0047992 | |||
| 1944 | Ga0501079_0176423 | |||
| 1945 | Ga0501079_0355162 | |||
| 1946 | Ga0501079_1141123 | |||
| 1947 | Ga0501080_0051988 | |||
| 1948 | Ga0501080_0064731 | |||
| 1949 | Ga0501080_0130907 | |||
| 1950 | Ga0501080_0186836 | |||
| 1951 | Ga0501080_0550258 | |||
| 1952 | Ga0501081_0001576 | |||
| 1953 | Ga0501081_0053945 | |||
| 1954 | Ga0501081_0291103 | |||
| 1955 | Ga0501083_0072663 | |||
| 1956 | Ga0501083_0215490 | |||
| 1957 | Ga0501035_0075026 | |||
| 1958 | Ga0501035_0249314 | |||
| 1959 | Ga0501035_0345593 | |||
| 1960 | Ga0501044_0660648 | |||
| 1961 | Ga0501045_0000563 | |||
| 1962 | Ga0501045_0103998 | |||
| 1963 | Ga0501045_0308044 | |||
| 1964 | nmdc:mga05p37_143344_c1 | |||
| 1965 | nmdc:mga08y16_35804_c1 | |||
| 1966 | nmdc:mga08y16_493239_c1 | |||
| 1967 | nmdc:mga08y16_7354_c1 | |||
| 1968 | nmdc:mga0n895_199652_c1 | |||
| 1969 | nmdc:mga0rr50_11973_c1 | |||
| 1970 | nmdc:mga08x19_217680_c1 | |||
| 1971 | Ga0495612_0078887 | |||
| 1972 | Ga0495595_0399236 | |||
| 1973 | Ga0500644_0075279 | |||
| 1974 | Ga0500644_0263268 | |||
| 1975 | Ga0500646_0009703 | |||
| 1976 | Ga0500583_0008807 | |||
| 1977 | Ga0500583_0035077 | |||
| 1978 | Ga0500583_0061322 | |||
| 1979 | Ga0500651_0054681 | |||
| 1980 | Ga0500641_0017271 | |||
| 1981 | Ga0500641_0054606 | |||
| 1982 | Ga0500641_0197909 | |||
| 1983 | Ga0500650_0499997 | |||
| 1984 | Ga0500556_0000801 | |||
| 1985 | Ga0500556_0248461 | |||
| 1986 | Ga0500562_020126 | |||
| 1987 | Ga0500591_063973 | |||
| 1988 | Ga0500595_018281 | |||
| 1989 | Ga0500614_164402 | |||
| 1990 | Ga0500628_061724 | |||
| 1991 | Ga0500652_197747 | |||
| 1992 | Ga0500658_0136358 | |||
| 1993 | Ga0500568_0001263 | |||
| 1994 | Ga0500568_0049181 | |||
| 1995 | Ga0500577_0258285 | |||
| 1996 | Ga0500590_149032 | |||
| 1997 | Ga0500616_0000092 | |||
| 1998 | Ga0500616_0021879 | |||
| 1999 | Ga0500616_0022231 | |||
| 2000 | Ga0500627_0323827 | |||
| 2001 | Ga0500630_127871 | |||
| 2002 | Ga0500636_0232782 | |||
| 2003 | Ga0500596_044456 | |||
| 2004 | Ga0501084_0050268 | |||
| 2005 | Ga0501084_0064716 | |||
| 2006 | Ga0501084_0107580 | |||
| 2007 | Ga0501084_0251930 | |||
| 2008 | Ga0501084_0641237 | |||
| 2009 | Ga0501082_0000958 | |||
| 2010 | Ga0501082_0197914 | |||
| 2011 | Ga0501082_0686899 | |||
| 2012 | Ga0466962_0000530 | |||
| 2013 | Ga0466962_0169473 | |||
| 2014 | Ga0530510_0008083 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pxu-assembly1.cif.gz_A | crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei bound to dephospho-coenzyme a | 0.874 | 1 | 157 |
| 3l93-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from yersinia pestis. | 0.8674 | 1 | 159 |
| 8i8j-assembly1.cif.gz_B | error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8i8j | 0.865 | 1 | 157 |
| 8i8i-assembly2.cif.gz_C-2 | crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution | 0.8634 | 1 | 158 |
| 3k9w-assembly1.cif.gz_A | crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei with hydrolyzed 3'-dephospho coenzyme a | 0.8625 | 1 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8607 | 1 | 159 | 3.40.50.620 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8533 | 3 | 159 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8508 | 1 | 159 | 3.40.50.620 |
| 4natB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8507 | 1 | 159 | 3.40.50.620 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8428 | 3 | 159 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R4AKA4-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.8786 | 3 | 157 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A7C5HWS1-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.8775 | 3 | 157 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A6L7MAV5-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.8771 | 4 | 157 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A5C7VCV9-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.8768 | 3 | 157 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A836WT33-F1-model_v4 | deleted | 0.8756 | 3 | 157 |
|