F487976
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1004 | 396 | 1004 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300059492|Ga0587073_0158992|Ga0587073_0158992_226_525 |
| Length | 99 |
| Sequence | MIRVVLPTPLRTLARTQGAEVQLEVAEPPTLAAVLTALETSYPMLRGTLRDHTTEQRRPFIRFFACGQDLSHDPASNRLPPEVASGKEPLLVVGAMAGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 195 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 233 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 244 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 247 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 248 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 249 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 250 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 251 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 330 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 331 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 359 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 360 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 361 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 365 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 366 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 367 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 368 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 374 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 375 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 376 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 377 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.59 |
| Rhizosphere | 95.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_4394635 | 2162886012 | Bacteria | 1087 |
| 2 | JGI24737J22298_10035235 | 3300001990 | Bacteria | 1549 |
| 3 | JGI25406J46586_10082425 | 3300003203 | Bacteria | 984 |
| 4 | Ga0065714_10224779 | 3300005288 | Unclassified | 831 |
| 5 | Ga0065714_10345260 | 3300005288 | Unclassified | 641 |
| 6 | Ga0065704_10033584 | 3300005289 | Unclassified | 1147 |
| 7 | Ga0065704_10098033 | 3300005289 | Bacteria | 2368 |
| 8 | Ga0065704_10209423 | 3300005289 | Bacteria | 1078 |
| 9 | Ga0065704_10380402 | 3300005289 | Unclassified | 766 |
| 10 | Ga0065704_10457160 | 3300005289 | Unclassified | 700 |
| 11 | Ga0065712_10000625 | 3300005290 | Bacteria | 9379 |
| 12 | Ga0065712_10009242 | 3300005290 | Bacteria | 3598 |
| 13 | Ga0065712_10012607 | 3300005290 | Bacteria | 3589 |
| 14 | Ga0065712_10090964 | 3300005290 | Bacteria | 2395 |
| 15 | Ga0065712_10244232 | 3300005290 | Unclassified | 976 |
| 16 | Ga0065715_10004174 | 3300005293 | Bacteria | 3632 |
| 17 | Ga0065715_10011829 | 3300005293 | Bacteria | 2530 |
| 18 | Ga0065715_10015359 | 3300005293 | Bacteria | 5108 |
| 19 | Ga0065715_10052692 | 3300005293 | Bacteria | 809 |
| 20 | Ga0065715_10095555 | 3300005293 | Bacteria | 4059 |
| 21 | Ga0065715_10102208 | 3300005293 | Bacteria | 3112 |
| 22 | Ga0065715_10281165 | 3300005293 | Unclassified | 1085 |
| 23 | Ga0065715_10396383 | 3300005293 | Unclassified | 887 |
| 24 | Ga0065715_10681365 | 3300005293 | Bacteria | 663 |
| 25 | Ga0065707_10029602 | 3300005295 | Unclassified | 1503 |
| 26 | Ga0065707_10044765 | 3300005295 | Bacteria | 1239 |
| 27 | Ga0065707_10317336 | 3300005295 | Bacteria | 973 |
| 28 | Ga0070658_10106685 | 3300005327 | Bacteria | 2318 |
| 29 | Ga0070658_10573231 | 3300005327 | Unclassified | 977 |
| 30 | Ga0070658_10621415 | 3300005327 | Bacteria | 937 |
| 31 | Ga0070676_10004800 | 3300005328 | Bacteria | 7152 |
| 32 | Ga0070676_10240783 | 3300005328 | Unclassified | 1203 |
| 33 | Ga0070676_10871794 | 3300005328 | Unclassified | 669 |
| 34 | Ga0070683_100035782 | 3300005329 | Bacteria | 4539 |
| 35 | Ga0070683_100052420 | 3300005329 | Bacteria | 3779 |
| 36 | Ga0070683_100211865 | 3300005329 | Bacteria | 1841 |
| 37 | Ga0070683_100306238 | 3300005329 | Bacteria | 1511 |
| 38 | Ga0070683_101377772 | 3300005329 | Unclassified | 678 |
| 39 | Ga0070690_100621405 | 3300005330 | Bacteria | 822 |
| 40 | Ga0070690_101100024 | 3300005330 | Bacteria | 630 |
| 41 | Ga0068869_100151332 | 3300005334 | Bacteria | 1800 |
| 42 | Ga0068869_100155653 | 3300005334 | Bacteria | 1776 |
| 43 | Ga0068869_101946030 | 3300005334 | Bacteria | 527 |
| 44 | Ga0070666_10041534 | 3300005335 | Bacteria | 3074 |
| 45 | Ga0070680_100362105 | 3300005336 | Bacteria | 1234 |
| 46 | Ga0070680_100896467 | 3300005336 | Bacteria | 765 |
| 47 | Ga0070682_100532356 | 3300005337 | Bacteria | 916 |
| 48 | Ga0068868_100027582 | 3300005338 | Bacteria | 4333 |
| 49 | Ga0068868_102312435 | 3300005338 | Unclassified | 513 |
| 50 | Ga0070660_100057363 | 3300005339 | Bacteria | 3016 |
| 51 | Ga0070660_100463823 | 3300005339 | Bacteria | 1052 |
| 52 | Ga0070689_100024392 | 3300005340 | Bacteria | 4536 |
| 53 | Ga0070689_100057914 | 3300005340 | Bacteria | 3009 |
| 54 | Ga0070689_100069596 | 3300005340 | Bacteria | 2746 |
| 55 | Ga0070689_100110073 | 3300005340 | Bacteria | 2190 |
| 56 | Ga0070689_100616962 | 3300005340 | Bacteria | 941 |
| 57 | Ga0070689_100876160 | 3300005340 | Bacteria | 793 |
| 58 | Ga0070689_101032025 | 3300005340 | Unclassified | 733 |
| 59 | Ga0070687_100003020 | 3300005343 | Bacteria | 6470 |
| 60 | Ga0070687_100215246 | 3300005343 | Bacteria | 1173 |
| 61 | Ga0070661_100916387 | 3300005344 | Bacteria | 724 |
| 62 | Ga0070692_10509056 | 3300005345 | Bacteria | 782 |
| 63 | Ga0070692_10910394 | 3300005345 | Unclassified | 609 |
| 64 | Ga0070668_100025873 | 3300005347 | Bacteria | 4450 |
| 65 | Ga0070668_100174407 | 3300005347 | Bacteria | 1752 |
| 66 | Ga0070668_102066745 | 3300005347 | Unclassified | 526 |
| 67 | Ga0070669_100019108 | 3300005353 | Bacteria | 4898 |
| 68 | Ga0070669_100536476 | 3300005353 | Bacteria | 974 |
| 69 | Ga0070675_100010980 | 3300005354 | Bacteria | 7090 |
| 70 | Ga0070675_100016132 | 3300005354 | Bacteria | 5922 |
| 71 | Ga0070675_100020946 | 3300005354 | Bacteria | 5221 |
| 72 | Ga0070675_100245171 | 3300005354 | Bacteria | 1566 |
| 73 | Ga0070675_100257366 | 3300005354 | Bacteria | 1529 |
| 74 | Ga0070671_100427599 | 3300005355 | Bacteria | 1135 |
| 75 | Ga0070671_100481161 | 3300005355 | Unclassified | 1067 |
| 76 | Ga0070671_100991826 | 3300005355 | Bacteria | 736 |
| 77 | Ga0070674_100767093 | 3300005356 | Bacteria | 830 |
| 78 | Ga0070674_100858158 | 3300005356 | Bacteria | 788 |
| 79 | Ga0070673_100032511 | 3300005364 | Bacteria | 3929 |
| 80 | Ga0070673_100084292 | 3300005364 | Bacteria | 2584 |
| 81 | Ga0070673_100741470 | 3300005364 | Unclassified | 904 |
| 82 | Ga0070673_100823784 | 3300005364 | Bacteria | 858 |
| 83 | Ga0070673_102361174 | 3300005364 | Bacteria | 506 |
| 84 | Ga0070688_100006375 | 3300005365 | Bacteria | 6305 |
| 85 | Ga0070688_100029398 | 3300005365 | Bacteria | 3290 |
| 86 | Ga0070688_100029494 | 3300005365 | Bacteria | 3285 |
| 87 | Ga0070688_100054513 | 3300005365 | Bacteria | 2505 |
| 88 | Ga0070659_100019729 | 3300005366 | Bacteria | 5115 |
| 89 | Ga0070659_100056308 | 3300005366 | Bacteria | 3101 |
| 90 | Ga0070659_101240376 | 3300005366 | Bacteria | 660 |
| 91 | Ga0070667_100013915 | 3300005367 | Bacteria | 6652 |
| 92 | Ga0070667_100042500 | 3300005367 | Bacteria | 3814 |
| 93 | Ga0070667_100056475 | 3300005367 | Bacteria | 3316 |
| 94 | Ga0070667_100177455 | 3300005367 | Bacteria | 1883 |
| 95 | Ga0070667_100894814 | 3300005367 | Bacteria | 826 |
| 96 | Ga0070667_102056487 | 3300005367 | Bacteria | 538 |
| 97 | Ga0070703_10386672 | 3300005406 | Unclassified | 606 |
| 98 | Ga0070709_10068002 | 3300005434 | Bacteria | 2289 |
| 99 | Ga0070709_10384167 | 3300005434 | Bacteria | 1045 |
| 100 | Ga0070714_100090123 | 3300005435 | Bacteria | 2685 |
| 101 | Ga0070713_100601197 | 3300005436 | Bacteria | 1045 |
| 102 | Ga0070710_10041420 | 3300005437 | Bacteria | 2543 |
| 103 | Ga0070701_10838916 | 3300005438 | Unclassified | 630 |
| 104 | Ga0070711_100052061 | 3300005439 | Viruses | 2816 |
| 105 | Ga0070711_101297645 | 3300005439 | Unclassified | 632 |
| 106 | Ga0070705_100508117 | 3300005440 | Unclassified | 916 |
| 107 | Ga0070700_100093396 | 3300005441 | Bacteria | 1968 |
| 108 | Ga0070694_100002927 | 3300005444 | Bacteria | 10148 |
| 109 | Ga0070694_100141540 | 3300005444 | Bacteria | 1748 |
| 110 | Ga0070694_100376525 | 3300005444 | Bacteria | 1106 |
| 111 | Ga0070663_100105476 | 3300005455 | Bacteria | 2109 |
| 112 | Ga0070663_100125892 | 3300005455 | Bacteria | 1941 |
| 113 | Ga0070678_100030782 | 3300005456 | Bacteria | 3693 |
| 114 | Ga0070678_100057554 | 3300005456 | Bacteria | 2848 |
| 115 | Ga0070662_100019870 | 3300005457 | Bacteria | 4568 |
| 116 | Ga0070662_100219811 | 3300005457 | Bacteria | 1515 |
| 117 | Ga0070681_10158486 | 3300005458 | Bacteria | 2187 |
| 118 | Ga0070681_10523537 | 3300005458 | Bacteria | 1099 |
| 119 | Ga0068867_101504882 | 3300005459 | Bacteria | 627 |
| 120 | Ga0070685_10004471 | 3300005466 | Bacteria | 7072 |
| 121 | Ga0070685_10832587 | 3300005466 | Unclassified | 682 |
| 122 | Ga0070685_11330265 | 3300005466 | Bacteria | 550 |
| 123 | Ga0070706_100327051 | 3300005467 | Bacteria | 1430 |
| 124 | Ga0070706_100329059 | 3300005467 | Bacteria | 1425 |
| 125 | Ga0070706_100598426 | 3300005467 | Bacteria | 1025 |
| 126 | Ga0070706_100936543 | 3300005467 | Bacteria | 800 |
| 127 | Ga0070706_101002882 | 3300005467 | Unclassified | 770 |
| 128 | Ga0070706_101666960 | 3300005467 | Bacteria | 581 |
| 129 | Ga0070707_100051720 | 3300005468 | Bacteria | 3938 |
| 130 | Ga0070707_100091622 | 3300005468 | Unclassified | 2943 |
| 131 | Ga0070707_100370917 | 3300005468 | Bacteria | 1390 |
| 132 | Ga0070707_100524120 | 3300005468 | Unclassified | 1147 |
| 133 | Ga0070698_100301528 | 3300005471 | Bacteria | 1533 |
| 134 | Ga0070698_100482119 | 3300005471 | Unclassified | 1177 |
| 135 | Ga0070679_100974110 | 3300005530 | Bacteria | 792 |
| 136 | Ga0070679_102208443 | 3300005530 | Unclassified | 500 |
| 137 | Ga0070684_100020105 | 3300005535 | Bacteria | 5538 |
| 138 | Ga0070684_100031426 | 3300005535 | Bacteria | 4520 |
| 139 | Ga0070684_100463644 | 3300005535 | Bacteria | 1171 |
| 140 | Ga0070684_100566668 | 3300005535 | Bacteria | 1055 |
| 141 | Ga0070684_101096965 | 3300005535 | Bacteria | 748 |
| 142 | Ga0070697_100517226 | 3300005536 | Unclassified | 1045 |
| 143 | Ga0070697_100743642 | 3300005536 | Unclassified | 866 |
| 144 | Ga0070697_100821865 | 3300005536 | Bacteria | 823 |
| 145 | Ga0070697_101229090 | 3300005536 | Bacteria | 668 |
| 146 | Ga0068853_100932860 | 3300005539 | Unclassified | 834 |
| 147 | Ga0070672_100481621 | 3300005543 | Bacteria | 1071 |
| 148 | Ga0070686_100131952 | 3300005544 | Bacteria | 1728 |
| 149 | Ga0070686_101310968 | 3300005544 | Bacteria | 605 |
| 150 | Ga0070686_101384347 | 3300005544 | Unclassified | 590 |
| 151 | Ga0070695_100005952 | 3300005545 | Bacteria | 7200 |
| 152 | Ga0070695_100070184 | 3300005545 | Bacteria | 2291 |
| 153 | Ga0070695_100786667 | 3300005545 | Unclassified | 761 |
| 154 | Ga0070696_100017047 | 3300005546 | Bacteria | 4900 |
| 155 | Ga0070696_100190017 | 3300005546 | Unclassified | 1528 |
| 156 | Ga0070696_101245237 | 3300005546 | Bacteria | 630 |
| 157 | Ga0070693_100069579 | 3300005547 | Bacteria | 2069 |
| 158 | Ga0070665_100094688 | 3300005548 | Bacteria | 2991 |
| 159 | Ga0070665_100356471 | 3300005548 | Bacteria | 1468 |
| 160 | Ga0070665_100689338 | 3300005548 | Bacteria | 1035 |
| 161 | Ga0070665_100826454 | 3300005548 | Unclassified | 939 |
| 162 | Ga0070704_100024165 | 3300005549 | Bacteria | 3984 |
| 163 | Ga0070704_100063567 | 3300005549 | Unclassified | 2649 |
| 164 | Ga0070664_100802744 | 3300005564 | Unclassified | 880 |
| 165 | Ga0070664_101107043 | 3300005564 | Bacteria | 746 |
| 166 | Ga0068856_100124531 | 3300005614 | Bacteria | 2580 |
| 167 | Ga0068856_100586633 | 3300005614 | Bacteria | 1136 |
| 168 | Ga0070702_101150838 | 3300005615 | Bacteria | 623 |
| 169 | Ga0068859_100073768 | 3300005617 | Bacteria | 3450 |
| 170 | Ga0068859_100075988 | 3300005617 | Bacteria | 3400 |
| 171 | Ga0068859_101078947 | 3300005617 | Bacteria | 883 |
| 172 | Ga0068859_101847872 | 3300005617 | Unclassified | 667 |
| 173 | Ga0068864_100282517 | 3300005618 | Bacteria | 1550 |
| 174 | Ga0068864_100630238 | 3300005618 | Bacteria | 1043 |
| 175 | Ga0068861_100112660 | 3300005719 | Unclassified | 2182 |
| 176 | Ga0068861_100331167 | 3300005719 | Bacteria | 1329 |
| 177 | Ga0068861_101450908 | 3300005719 | Bacteria | 672 |
| 178 | Ga0068851_10691505 | 3300005834 | Unclassified | 627 |
| 179 | Ga0068870_10195438 | 3300005840 | Bacteria | 1223 |
| 180 | Ga0068870_10660298 | 3300005840 | Bacteria | 717 |
| 181 | Ga0068863_100029528 | 3300005841 | Bacteria | 5233 |
| 182 | Ga0068863_100228567 | 3300005841 | Bacteria | 1794 |
| 183 | Ga0068863_101395932 | 3300005841 | Bacteria | 708 |
| 184 | Ga0068858_100034200 | 3300005842 | Bacteria | 4713 |
| 185 | Ga0068858_100078546 | 3300005842 | Bacteria | 3067 |
| 186 | Ga0068858_100118665 | 3300005842 | Bacteria | 2473 |
| 187 | Ga0068858_101048204 | 3300005842 | Bacteria | 800 |
| 188 | Ga0068860_100021636 | 3300005843 | Bacteria | 6226 |
| 189 | Ga0068860_100280619 | 3300005843 | Bacteria | 1628 |
| 190 | Ga0068862_100041613 | 3300005844 | Bacteria | 3910 |
| 191 | Ga0068862_100821444 | 3300005844 | Unclassified | 909 |
| 192 | Ga0081455_10001083 | 3300005937 | Bacteria | 34289 |
| 193 | Ga0081455_10003380 | 3300005937 | Bacteria | 18388 |
| 194 | Ga0081455_10013473 | 3300005937 | Bacteria | 8077 |
| 195 | Ga0081455_10098327 | 3300005937 | Bacteria | 2356 |
| 196 | Ga0081455_10311029 | 3300005937 | Bacteria | 1126 |
| 197 | Ga0081455_10457364 | 3300005937 | Unclassified | 870 |
| 198 | Ga0081538_10028746 | 3300005981 | Bacteria | 3815 |
| 199 | Ga0081540_1024266 | 3300005983 | Bacteria | 3522 |
| 200 | Ga0081540_1032511 | 3300005983 | Bacteria | 2848 |
| 201 | Ga0081540_1093820 | 3300005983 | Bacteria | 1313 |
| 202 | Ga0081539_10014701 | 3300005985 | Bacteria | 5757 |
| 203 | Ga0070717_10036763 | 3300006028 | Bacteria | 3973 |
| 204 | Ga0070717_10147250 | 3300006028 | Bacteria | 2035 |
| 205 | Ga0070717_10631358 | 3300006028 | Bacteria | 972 |
| 206 | Ga0070717_10638084 | 3300006028 | Bacteria | 967 |
| 207 | Ga0070717_11042484 | 3300006028 | Bacteria | 745 |
| 208 | Ga0070717_11473692 | 3300006028 | Unclassified | 618 |
| 209 | Ga0070715_10048082 | 3300006163 | Bacteria | 1821 |
| 210 | Ga0070715_10237817 | 3300006163 | Bacteria | 945 |
| 211 | Ga0070715_10571178 | 3300006163 | Unclassified | 659 |
| 212 | Ga0070716_100099847 | 3300006173 | Bacteria | 1777 |
| 213 | Ga0070716_100476223 | 3300006173 | Bacteria | 916 |
| 214 | Ga0070716_101089943 | 3300006173 | Unclassified | 636 |
| 215 | Ga0070712_100044614 | 3300006175 | Bacteria | 3057 |
| 216 | Ga0070712_100232801 | 3300006175 | Bacteria | 1464 |
| 217 | Ga0070712_100245420 | 3300006175 | Bacteria | 1428 |
| 218 | Ga0070712_100253441 | 3300006175 | Unclassified | 1407 |
| 219 | Ga0070712_100446963 | 3300006175 | Unclassified | 1076 |
| 220 | Ga0070712_100710701 | 3300006175 | Unclassified | 857 |
| 221 | Ga0070712_101262894 | 3300006175 | Unclassified | 643 |
| 222 | Ga0097621_100095130 | 3300006237 | Bacteria | 2498 |
| 223 | Ga0097621_100271998 | 3300006237 | Unclassified | 1489 |
| 224 | Ga0068871_100060040 | 3300006358 | Bacteria | 3100 |
| 225 | Ga0075428_100011203 | 3300006844 | Bacteria | 9978 |
| 226 | Ga0075428_100059664 | 3300006844 | Bacteria | 4177 |
| 227 | Ga0075428_100180070 | 3300006844 | Bacteria | 2288 |
| 228 | Ga0075428_100578201 | 3300006844 | Bacteria | 1200 |
| 229 | Ga0075428_100918227 | 3300006844 | Unclassified | 928 |
| 230 | Ga0075428_101725415 | 3300006844 | Bacteria | 653 |
| 231 | Ga0075428_102374384 | 3300006844 | Bacteria | 545 |
| 232 | Ga0075430_100001915 | 3300006846 | Bacteria | 17076 |
| 233 | Ga0075430_100026366 | 3300006846 | Bacteria | 4946 |
| 234 | Ga0075430_100036343 | 3300006846 | Bacteria | 4177 |
| 235 | Ga0075430_100085507 | 3300006846 | Bacteria | 2640 |
| 236 | Ga0075430_100625851 | 3300006846 | Bacteria | 888 |
| 237 | Ga0075430_101681801 | 3300006846 | Bacteria | 521 |
| 238 | Ga0075431_100007491 | 3300006847 | Bacteria | 10869 |
| 239 | Ga0075431_100025414 | 3300006847 | Bacteria | 6070 |
| 240 | Ga0075431_100035701 | 3300006847 | Bacteria | 5118 |
| 241 | Ga0075431_100053137 | 3300006847 | Bacteria | 4177 |
| 242 | Ga0075431_100306843 | 3300006847 | Bacteria | 1603 |
| 243 | Ga0075431_100337683 | 3300006847 | Bacteria | 1516 |
| 244 | Ga0075431_100597248 | 3300006847 | Bacteria | 1088 |
| 245 | Ga0075431_100760500 | 3300006847 | Bacteria | 944 |
| 246 | Ga0075431_100798373 | 3300006847 | Bacteria | 917 |
| 247 | Ga0075431_101544295 | 3300006847 | Bacteria | 622 |
| 248 | Ga0075433_10078095 | 3300006852 | Bacteria | 2917 |
| 249 | Ga0075433_10299893 | 3300006852 | Bacteria | 1423 |
| 250 | Ga0075433_11003209 | 3300006852 | Bacteria | 727 |
| 251 | Ga0075434_100096643 | 3300006871 | Bacteria | 2959 |
| 252 | Ga0075434_100111314 | 3300006871 | Bacteria | 2749 |
| 253 | Ga0075434_100217380 | 3300006871 | Bacteria | 1931 |
| 254 | Ga0075434_100480867 | 3300006871 | Bacteria | 1263 |
| 255 | Ga0075434_101333612 | 3300006871 | Unclassified | 728 |
| 256 | Ga0075434_101920156 | 3300006871 | Unclassified | 598 |
| 257 | Ga0075434_102057202 | 3300006871 | Bacteria | 576 |
| 258 | Ga0075429_100003072 | 3300006880 | Bacteria | 14154 |
| 259 | Ga0075429_100051493 | 3300006880 | Bacteria | 3583 |
| 260 | Ga0075429_100159364 | 3300006880 | Bacteria | 1976 |
| 261 | Ga0075429_100240007 | 3300006880 | Bacteria | 1587 |
| 262 | Ga0068865_100228975 | 3300006881 | Unclassified | 1457 |
| 263 | Ga0068865_100299299 | 3300006881 | Bacteria | 1287 |
| 264 | Ga0075436_101504928 | 3300006914 | Bacteria | 511 |
| 265 | Ga0097620_100073767 | 3300006931 | Bacteria | 3450 |
| 266 | Ga0097620_100075987 | 3300006931 | Bacteria | 3400 |
| 267 | Ga0097620_101078751 | 3300006931 | Bacteria | 883 |
| 268 | Ga0097620_101847439 | 3300006931 | Unclassified | 667 |
| 269 | Ga0075435_100284041 | 3300007076 | Bacteria | 1413 |
| 270 | Ga0075435_101613181 | 3300007076 | Bacteria | 569 |
| 271 | Ga0099795_10022013 | 3300007788 | Bacteria | 2099 |
| 272 | Ga0105244_10381617 | 3300009036 | Bacteria | 649 |
| 273 | Ga0111539_10005737 | 3300009094 | Bacteria | 16055 |
| 274 | Ga0111539_10127619 | 3300009094 | Bacteria | 2979 |
| 275 | Ga0111539_10392634 | 3300009094 | Bacteria | 1616 |
| 276 | Ga0111539_13551768 | 3300009094 | Bacteria | 500 |
| 277 | Ga0105245_10648793 | 3300009098 | Bacteria | 1086 |
| 278 | Ga0105245_11022583 | 3300009098 | Bacteria | 871 |
| 279 | Ga0105245_11231782 | 3300009098 | Bacteria | 796 |
| 280 | Ga0105245_11729444 | 3300009098 | Bacteria | 678 |
| 281 | Ga0105245_11763135 | 3300009098 | Bacteria | 672 |
| 282 | Ga0105245_11816290 | 3300009098 | Unclassified | 662 |
| 283 | Ga0105247_10127501 | 3300009101 | Bacteria | 1655 |
| 284 | Ga0105247_10981384 | 3300009101 | Unclassified | 658 |
| 285 | Ga0114129_10002600 | 3300009147 | Bacteria | 25101 |
| 286 | Ga0114129_10070807 | 3300009147 | Bacteria | 4863 |
| 287 | Ga0114129_10071259 | 3300009147 | Bacteria | 4846 |
| 288 | Ga0114129_10094450 | 3300009147 | Bacteria | 4142 |
| 289 | Ga0114129_10275796 | 3300009147 | Bacteria | 2248 |
| 290 | Ga0114129_10314759 | 3300009147 | Bacteria | 2083 |
| 291 | Ga0114129_10443839 | 3300009147 | Bacteria | 1703 |
| 292 | Ga0114129_10454551 | 3300009147 | Bacteria | 1679 |
| 293 | Ga0114129_10874492 | 3300009147 | Bacteria | 1141 |
| 294 | Ga0114129_10972651 | 3300009147 | Bacteria | 1071 |
| 295 | Ga0114129_11736140 | 3300009147 | Unclassified | 761 |
| 296 | Ga0105243_10327504 | 3300009148 | Bacteria | 1398 |
| 297 | Ga0105243_11034396 | 3300009148 | Bacteria | 826 |
| 298 | Ga0105241_10111999 | 3300009174 | Bacteria | 2186 |
| 299 | Ga0105241_11287371 | 3300009174 | Unclassified | 696 |
| 300 | Ga0105242_10639311 | 3300009176 | Bacteria | 1033 |
| 301 | Ga0105242_11739199 | 3300009176 | Bacteria | 661 |
| 302 | Ga0105248_10173972 | 3300009177 | Bacteria | 2427 |
| 303 | Ga0105248_10295561 | 3300009177 | Bacteria | 1824 |
| 304 | Ga0105248_10376810 | 3300009177 | Bacteria | 1597 |
| 305 | Ga0105237_10575801 | 3300009545 | Bacteria | 1133 |
| 306 | Ga0105237_10672651 | 3300009545 | Unclassified | 1042 |
| 307 | Ga0105249_10031035 | 3300009553 | Bacteria | 4831 |
| 308 | Ga0105249_10121601 | 3300009553 | Bacteria | 2481 |
| 309 | Ga0105249_10206168 | 3300009553 | Bacteria | 1926 |
| 310 | Ga0105249_11830032 | 3300009553 | Unclassified | 680 |
| 311 | Ga0099796_10033170 | 3300010159 | Bacteria | 1697 |
| 312 | Ga0099796_10125912 | 3300010159 | Unclassified | 989 |
| 313 | Ga0105239_10018911 | 3300010375 | Bacteria | 7612 |
| 314 | Ga0105239_10104826 | 3300010375 | Bacteria | 3131 |
| 315 | Ga0105239_10158785 | 3300010375 | Bacteria | 2526 |
| 316 | Ga0105239_10489041 | 3300010375 | Bacteria | 1398 |
| 317 | Ga0105246_10196381 | 3300011119 | Bacteria | 1565 |
| 318 | Ga0157371_10189038 | 3300013102 | Bacteria | 1474 |
| 319 | Ga0157371_10237610 | 3300013102 | Bacteria | 1310 |
| 320 | Ga0157370_10252645 | 3300013104 | Bacteria | 1631 |
| 321 | Ga0157370_10386562 | 3300013104 | Bacteria | 1289 |
| 322 | Ga0157369_10091104 | 3300013105 | Bacteria | 3255 |
| 323 | Ga0157369_10099659 | 3300013105 | Bacteria | 3097 |
| 324 | Ga0157374_10052870 | 3300013296 | Bacteria | 3785 |
| 325 | Ga0157374_10110448 | 3300013296 | Bacteria | 2644 |
| 326 | Ga0157374_10127668 | 3300013296 | Bacteria | 2459 |
| 327 | Ga0157374_10140991 | 3300013296 | Bacteria | 2340 |
| 328 | Ga0157374_10144922 | 3300013296 | Bacteria | 2307 |
| 329 | Ga0157374_10265918 | 3300013296 | Bacteria | 1690 |
| 330 | Ga0157374_11443083 | 3300013296 | Bacteria | 711 |
| 331 | Ga0157378_10014270 | 3300013297 | Bacteria | 6955 |
| 332 | Ga0157378_10203079 | 3300013297 | Bacteria | 1875 |
| 333 | Ga0157378_10487171 | 3300013297 | Bacteria | 1230 |
| 334 | Ga0157378_10698935 | 3300013297 | Bacteria | 1033 |
| 335 | Ga0157378_10711758 | 3300013297 | Bacteria | 1024 |
| 336 | Ga0157378_10900510 | 3300013297 | Bacteria | 915 |
| 337 | Ga0157378_11103868 | 3300013297 | Bacteria | 830 |
| 338 | Ga0157378_12204185 | 3300013297 | Unclassified | 602 |
| 339 | Ga0163162_10015388 | 3300013306 | Bacteria | 7473 |
| 340 | Ga0163162_10094062 | 3300013306 | Bacteria | 3083 |
| 341 | Ga0163162_10380908 | 3300013306 | Bacteria | 1544 |
| 342 | Ga0163162_10868601 | 3300013306 | Bacteria | 1016 |
| 343 | Ga0163162_13329667 | 3300013306 | Unclassified | 514 |
| 344 | Ga0157372_10035572 | 3300013307 | Bacteria | 5484 |
| 345 | Ga0157372_10055060 | 3300013307 | Bacteria | 4440 |
| 346 | Ga0157372_10095387 | 3300013307 | Bacteria | 3389 |
| 347 | Ga0157372_10970471 | 3300013307 | Bacteria | 985 |
| 348 | Ga0157375_10018336 | 3300013308 | Bacteria | 6346 |
| 349 | Ga0157375_10846195 | 3300013308 | Unclassified | 1061 |
| 350 | Ga0157375_11001309 | 3300013308 | Bacteria | 975 |
| 351 | Ga0157375_11038360 | 3300013308 | Bacteria | 958 |
| 352 | Ga0157375_11108362 | 3300013308 | Bacteria | 927 |
| 353 | Ga0157375_11114413 | 3300013308 | Bacteria | 924 |
| 354 | Ga0157375_11598055 | 3300013308 | Unclassified | 771 |
| 355 | Ga0163163_10555492 | 3300014325 | Bacteria | 1211 |
| 356 | Ga0163163_10671017 | 3300014325 | Bacteria | 1100 |
| 357 | Ga0163163_10943805 | 3300014325 | Bacteria | 926 |
| 358 | Ga0163163_10976876 | 3300014325 | Bacteria | 910 |
| 359 | Ga0182008_10032361 | 3300014497 | Bacteria | 2628 |
| 360 | Ga0182008_10145039 | 3300014497 | Unclassified | 1189 |
| 361 | Ga0157377_10096046 | 3300014745 | Bacteria | 1758 |
| 362 | Ga0157377_10476494 | 3300014745 | Unclassified | 867 |
| 363 | Ga0157377_10623923 | 3300014745 | Unclassified | 772 |
| 364 | Ga0157379_10051616 | 3300014968 | Bacteria | 3673 |
| 365 | Ga0157379_10352184 | 3300014968 | Bacteria | 1348 |
| 366 | Ga0157379_10762448 | 3300014968 | Bacteria | 911 |
| 367 | Ga0157379_11168237 | 3300014968 | Bacteria | 739 |
| 368 | Ga0157376_10138274 | 3300014969 | Bacteria | 2182 |
| 369 | Ga0157376_10459161 | 3300014969 | Unclassified | 1244 |
| 370 | Ga0157376_10565818 | 3300014969 | Bacteria | 1127 |
| 371 | Ga0157376_11143054 | 3300014969 | Bacteria | 805 |
| 372 | Ga0157376_12215554 | 3300014969 | Bacteria | 588 |
| 373 | Ga0157376_12690401 | 3300014969 | Bacteria | 537 |
| 374 | Ga0182005_1063808 | 3300015265 | Unclassified | 1007 |
| 375 | Ga0163161_10903774 | 3300017792 | Bacteria | 748 |
| 376 | Ga0206354_10138387 | 3300020081 | Bacteria | 688 |
| 377 | Ga0213873_10095422 | 3300021358 | Bacteria | 849 |
| 378 | Ga0213872_10000378 | 3300021361 | Bacteria | 37429 |
| 379 | Ga0213876_10004175 | 3300021384 | Bacteria | 8108 |
| 380 | Ga0213875_10553157 | 3300021388 | Bacteria | 555 |
| 381 | Ga0207666_1011002 | 3300025271 | Unclassified | 1246 |
| 382 | Ga0207666_1018614 | 3300025271 | Bacteria | 1009 |
| 383 | Ga0207673_1009654 | 3300025290 | Bacteria | 1235 |
| 384 | Ga0207673_1011046 | 3300025290 | Bacteria | 1167 |
| 385 | Ga0207673_1027021 | 3300025290 | Unclassified | 788 |
| 386 | Ga0207697_10003372 | 3300025315 | Bacteria | 7931 |
| 387 | Ga0207697_10003736 | 3300025315 | Bacteria | 7446 |
| 388 | Ga0207697_10006400 | 3300025315 | Bacteria | 5332 |
| 389 | Ga0207697_10037374 | 3300025315 | Bacteria | 1989 |
| 390 | Ga0207697_10039285 | 3300025315 | Bacteria | 1941 |
| 391 | Ga0207697_10088169 | 3300025315 | Bacteria | 1313 |
| 392 | Ga0207697_10199035 | 3300025315 | Bacteria | 881 |
| 393 | Ga0207653_10040172 | 3300025885 | Bacteria | 1533 |
| 394 | Ga0207653_10304369 | 3300025885 | Bacteria | 618 |
| 395 | Ga0207692_10427451 | 3300025898 | Bacteria | 830 |
| 396 | Ga0207680_10072808 | 3300025903 | Bacteria | 2134 |
| 397 | Ga0207647_10019407 | 3300025904 | Bacteria | 4573 |
| 398 | Ga0207699_10081423 | 3300025906 | Bacteria | 2008 |
| 399 | Ga0207699_10401900 | 3300025906 | Bacteria | 976 |
| 400 | Ga0207645_10002865 | 3300025907 | Bacteria | 13362 |
| 401 | Ga0207645_10044381 | 3300025907 | Bacteria | 2845 |
| 402 | Ga0207645_10747642 | 3300025907 | Bacteria | 665 |
| 403 | Ga0207705_10491855 | 3300025909 | Bacteria | 952 |
| 404 | Ga0207684_10127241 | 3300025910 | Unclassified | 2186 |
| 405 | Ga0207684_10280468 | 3300025910 | Bacteria | 1437 |
| 406 | Ga0207684_10561714 | 3300025910 | Bacteria | 976 |
| 407 | Ga0207684_10764564 | 3300025910 | Bacteria | 818 |
| 408 | Ga0207707_10638898 | 3300025912 | Bacteria | 898 |
| 409 | Ga0207671_10449412 | 3300025914 | Unclassified | 1026 |
| 410 | Ga0207671_10516282 | 3300025914 | Unclassified | 952 |
| 411 | Ga0207693_10023334 | 3300025915 | Bacteria | 4912 |
| 412 | Ga0207693_10054152 | 3300025915 | Bacteria | 3148 |
| 413 | Ga0207693_10057952 | 3300025915 | Bacteria | 3035 |
| 414 | Ga0207693_10270654 | 3300025915 | Bacteria | 1331 |
| 415 | Ga0207693_10377099 | 3300025915 | Unclassified | 1109 |
| 416 | Ga0207693_10543651 | 3300025915 | Unclassified | 906 |
| 417 | Ga0207693_10671726 | 3300025915 | Unclassified | 804 |
| 418 | Ga0207693_10814619 | 3300025915 | Bacteria | 719 |
| 419 | Ga0207693_11095387 | 3300025915 | Unclassified | 605 |
| 420 | Ga0207663_10231756 | 3300025916 | Bacteria | 1350 |
| 421 | Ga0207663_10396562 | 3300025916 | Bacteria | 1054 |
| 422 | Ga0207663_10899913 | 3300025916 | Bacteria | 708 |
| 423 | Ga0207663_11532077 | 3300025916 | Unclassified | 537 |
| 424 | Ga0207662_10006880 | 3300025918 | Bacteria | 6161 |
| 425 | Ga0207662_10245863 | 3300025918 | Bacteria | 1173 |
| 426 | Ga0207657_10045562 | 3300025919 | Bacteria | 3848 |
| 427 | Ga0207657_10071180 | 3300025919 | Bacteria | 2945 |
| 428 | Ga0207652_10332966 | 3300025921 | Bacteria | 1371 |
| 429 | Ga0207652_11389634 | 3300025921 | Bacteria | 605 |
| 430 | Ga0207646_10077427 | 3300025922 | Bacteria | 2972 |
| 431 | Ga0207646_10215294 | 3300025922 | Bacteria | 1735 |
| 432 | Ga0207646_10233100 | 3300025922 | Unclassified | 1663 |
| 433 | Ga0207646_11073981 | 3300025922 | Bacteria | 709 |
| 434 | Ga0207646_11652580 | 3300025922 | Bacteria | 551 |
| 435 | Ga0207681_10008159 | 3300025923 | Bacteria | 6401 |
| 436 | Ga0207681_10832090 | 3300025923 | Bacteria | 772 |
| 437 | Ga0207659_10021721 | 3300025926 | Bacteria | 4266 |
| 438 | Ga0207659_10023201 | 3300025926 | Bacteria | 4138 |
| 439 | Ga0207659_10066527 | 3300025926 | Bacteria | 2616 |
| 440 | Ga0207659_10281783 | 3300025926 | Bacteria | 1359 |
| 441 | Ga0207659_10654320 | 3300025926 | Unclassified | 898 |
| 442 | Ga0207659_11047651 | 3300025926 | Bacteria | 702 |
| 443 | Ga0207687_10394818 | 3300025927 | Bacteria | 1136 |
| 444 | Ga0207700_10024764 | 3300025928 | Bacteria | 4158 |
| 445 | Ga0207664_10086772 | 3300025929 | Bacteria | 2557 |
| 446 | Ga0207644_10114526 | 3300025931 | Bacteria | 2043 |
| 447 | Ga0207644_10561735 | 3300025931 | Bacteria | 945 |
| 448 | Ga0207644_10574125 | 3300025931 | Bacteria | 935 |
| 449 | Ga0207690_10122155 | 3300025932 | Bacteria | 1893 |
| 450 | Ga0207690_10457390 | 3300025932 | Unclassified | 1027 |
| 451 | Ga0207690_10632951 | 3300025932 | Bacteria | 875 |
| 452 | Ga0207706_10026220 | 3300025933 | Bacteria | 5216 |
| 453 | Ga0207706_10228671 | 3300025933 | Bacteria | 1628 |
| 454 | Ga0207706_10633998 | 3300025933 | Unclassified | 916 |
| 455 | Ga0207706_10916160 | 3300025933 | Unclassified | 740 |
| 456 | Ga0207709_10825196 | 3300025935 | Bacteria | 750 |
| 457 | Ga0207670_10000021 | 3300025936 | Bacteria | 155646 |
| 458 | Ga0207670_10011904 | 3300025936 | Bacteria | 5066 |
| 459 | Ga0207670_10024611 | 3300025936 | Bacteria | 3765 |
| 460 | Ga0207670_10088725 | 3300025936 | Bacteria | 2181 |
| 461 | Ga0207670_10152646 | 3300025936 | Bacteria | 1715 |
| 462 | Ga0207670_10178356 | 3300025936 | Bacteria | 1598 |
| 463 | Ga0207670_10560922 | 3300025936 | Bacteria | 934 |
| 464 | Ga0207704_10359153 | 3300025938 | Unclassified | 1137 |
| 465 | Ga0207665_10013313 | 3300025939 | Bacteria | 5406 |
| 466 | Ga0207665_11655587 | 3300025939 | Bacteria | 507 |
| 467 | Ga0207691_10034931 | 3300025940 | Bacteria | 4671 |
| 468 | Ga0207711_10098700 | 3300025941 | Bacteria | 2581 |
| 469 | Ga0207711_10127639 | 3300025941 | Bacteria | 2277 |
| 470 | Ga0207689_10056964 | 3300025942 | Bacteria | 3215 |
| 471 | Ga0207689_10496306 | 3300025942 | Bacteria | 1023 |
| 472 | Ga0207661_10034334 | 3300025944 | Bacteria | 3943 |
| 473 | Ga0207661_10115633 | 3300025944 | Bacteria | 2276 |
| 474 | Ga0207661_10270540 | 3300025944 | Bacteria | 1516 |
| 475 | Ga0207661_10316294 | 3300025944 | Bacteria | 1402 |
| 476 | Ga0207661_10804851 | 3300025944 | Bacteria | 865 |
| 477 | Ga0207661_10956352 | 3300025944 | Unclassified | 789 |
| 478 | Ga0207679_10018603 | 3300025945 | Bacteria | 4657 |
| 479 | Ga0207679_10146618 | 3300025945 | Bacteria | 1915 |
| 480 | Ga0207679_10762433 | 3300025945 | Unclassified | 880 |
| 481 | Ga0207651_12059937 | 3300025960 | Unclassified | 513 |
| 482 | Ga0207712_10031248 | 3300025961 | Bacteria | 3585 |
| 483 | Ga0207712_10065405 | 3300025961 | Bacteria | 2595 |
| 484 | Ga0207712_10486107 | 3300025961 | Unclassified | 1053 |
| 485 | Ga0207668_10007215 | 3300025972 | Bacteria | 6600 |
| 486 | Ga0207668_10124714 | 3300025972 | Bacteria | 1956 |
| 487 | Ga0207668_10155590 | 3300025972 | Bacteria | 1776 |
| 488 | Ga0207640_10926036 | 3300025981 | Unclassified | 763 |
| 489 | Ga0207658_10020950 | 3300025986 | Bacteria | 4531 |
| 490 | Ga0207658_11444016 | 3300025986 | Bacteria | 629 |
| 491 | Ga0207658_11971881 | 3300025986 | Bacteria | 531 |
| 492 | Ga0207677_10020052 | 3300026023 | Bacteria | 4051 |
| 493 | Ga0207703_10020759 | 3300026035 | Bacteria | 5140 |
| 494 | Ga0207703_10161344 | 3300026035 | Bacteria | 1964 |
| 495 | Ga0207703_11762263 | 3300026035 | Bacteria | 595 |
| 496 | Ga0207703_11932930 | 3300026035 | Bacteria | 566 |
| 497 | Ga0207639_10111178 | 3300026041 | Bacteria | 2233 |
| 498 | Ga0207678_10033052 | 3300026067 | Bacteria | 4508 |
| 499 | Ga0207678_10116710 | 3300026067 | Bacteria | 2277 |
| 500 | Ga0207708_10262170 | 3300026075 | Bacteria | 1395 |
| 501 | Ga0207708_11557173 | 3300026075 | Bacteria | 581 |
| 502 | Ga0207702_10309229 | 3300026078 | Bacteria | 1502 |
| 503 | Ga0207702_10627982 | 3300026078 | Bacteria | 1055 |
| 504 | Ga0207641_10164231 | 3300026088 | Bacteria | 2021 |
| 505 | Ga0207676_10411439 | 3300026095 | Bacteria | 1266 |
| 506 | Ga0207676_10556710 | 3300026095 | Bacteria | 1096 |
| 507 | Ga0207675_100237546 | 3300026118 | Bacteria | 1760 |
| 508 | Ga0207675_101167344 | 3300026118 | Unclassified | 790 |
| 509 | Ga0207675_101848717 | 3300026118 | Bacteria | 623 |
| 510 | Ga0207683_10088748 | 3300026121 | Bacteria | 2752 |
| 511 | Ga0210002_1108051 | 3300027617 | Bacteria | 505 |
| 512 | Ga0209998_10059150 | 3300027717 | Unclassified | 900 |
| 513 | Ga0209974_10219800 | 3300027876 | Bacteria | 707 |
| 514 | Ga0207428_10040322 | 3300027907 | Bacteria | 3789 |
| 515 | Ga0207428_10184683 | 3300027907 | Bacteria | 1574 |
| 516 | Ga0268266_10204709 | 3300028379 | Bacteria | 1807 |
| 517 | Ga0268266_11204648 | 3300028379 | Unclassified | 732 |
| 518 | Ga0268266_11283747 | 3300028379 | Bacteria | 707 |
| 519 | Ga0268266_11556726 | 3300028379 | Bacteria | 637 |
| 520 | Ga0268265_10019225 | 3300028380 | Bacteria | 4744 |
| 521 | Ga0268264_10042385 | 3300028381 | Bacteria | 3768 |
| 522 | Ga0268264_10049735 | 3300028381 | Bacteria | 3489 |
| 523 | Ga0268264_12660968 | 3300028381 | Unclassified | 504 |
| 524 | Ga0265326_10082652 | 3300028558 | Bacteria | 908 |
| 525 | Ga0265323_10040665 | 3300028653 | Bacteria | 1690 |
| 526 | Ga0265327_10063801 | 3300031251 | Bacteria | 1869 |
| 527 | Ga0307408_100040831 | 3300031548 | Bacteria | 3287 |
| 528 | Ga0307408_100139665 | 3300031548 | Bacteria | 1900 |
| 529 | Ga0307408_101391132 | 3300031548 | Unclassified | 660 |
| 530 | Ga0316579_10502126 | 3300031691 | Bacteria | 587 |
| 531 | Ga0265314_10128452 | 3300031711 | Bacteria | 1584 |
| 532 | Ga0265342_10027518 | 3300031712 | Bacteria | 3552 |
| 533 | Ga0316576_10825821 | 3300031727 | Bacteria | 666 |
| 534 | Ga0316578_10255383 | 3300031728 | Bacteria | 1051 |
| 535 | Ga0307405_10293073 | 3300031731 | Bacteria | 1231 |
| 536 | Ga0307405_10444504 | 3300031731 | Bacteria | 1026 |
| 537 | Ga0307405_10496314 | 3300031731 | Bacteria | 977 |
| 538 | Ga0307405_10930105 | 3300031731 | Bacteria | 737 |
| 539 | Ga0316577_10835322 | 3300031733 | Unclassified | 522 |
| 540 | Ga0307413_10035530 | 3300031824 | Bacteria | 2860 |
| 541 | Ga0307410_10068439 | 3300031852 | Bacteria | 2452 |
| 542 | Ga0307410_10237853 | 3300031852 | Bacteria | 1410 |
| 543 | Ga0307410_10516420 | 3300031852 | Bacteria | 985 |
| 544 | Ga0307410_10852106 | 3300031852 | Unclassified | 778 |
| 545 | Ga0307406_10345085 | 3300031901 | Bacteria | 1161 |
| 546 | Ga0307406_10401696 | 3300031901 | Bacteria | 1086 |
| 547 | Ga0307407_10305365 | 3300031903 | Bacteria | 1111 |
| 548 | Ga0307412_10293265 | 3300031911 | Bacteria | 1282 |
| 549 | Ga0307409_100034733 | 3300031995 | Bacteria | 3687 |
| 550 | Ga0307409_100198618 | 3300031995 | Bacteria | 1792 |
| 551 | Ga0307409_100385465 | 3300031995 | Bacteria | 1334 |
| 552 | Ga0307409_102540235 | 3300031995 | Bacteria | 541 |
| 553 | Ga0307416_100037330 | 3300032002 | Bacteria | 3737 |
| 554 | Ga0307416_100234993 | 3300032002 | Bacteria | 1770 |
| 555 | Ga0307416_101418723 | 3300032002 | Bacteria | 800 |
| 556 | Ga0307414_10088334 | 3300032004 | Bacteria | 2294 |
| 557 | Ga0307414_10101533 | 3300032004 | Bacteria | 2166 |
| 558 | Ga0307411_10010437 | 3300032005 | Bacteria | 4952 |
| 559 | Ga0307411_10110875 | 3300032005 | Bacteria | 1963 |
| 560 | Ga0307411_10133724 | 3300032005 | Bacteria | 1817 |
| 561 | Ga0307415_100282685 | 3300032126 | Bacteria | 1365 |
| 562 | Ga0307415_100379256 | 3300032126 | Bacteria | 1200 |
| 563 | Ga0307415_101122121 | 3300032126 | Bacteria | 737 |
| 564 | Ga0316593_10170347 | 3300032168 | Bacteria | 798 |
| 565 | Ga0373938_0042998 | 3300034957 | Bacteria | 1009 |
| 566 | Ga0373934_0243286 | 3300035086 | Bacteria | 743 |
| 567 | Ga0373934_0286019 | 3300035086 | Bacteria | 683 |
| 568 | Ga0373934_0489000 | 3300035086 | Unclassified | 517 |
| 569 | Ga0373940_0059650 | 3300035088 | Bacteria | 1089 |
| 570 | Ga0373923_0126601 | 3300035111 | Bacteria | 1145 |
| 571 | Ga0373923_0201467 | 3300035111 | Bacteria | 920 |
| 572 | Ga0373932_0084953 | 3300035112 | Bacteria | 1006 |
| 573 | Ga0373932_0121943 | 3300035112 | Bacteria | 870 |
| 574 | Ga0373932_0227489 | 3300035112 | Bacteria | 673 |
| 575 | Ga0373936_0498815 | 3300035113 | Unclassified | 566 |
| 576 | Ga0373939_0215436 | 3300035114 | Bacteria | 733 |
| 577 | Ga0373939_0292483 | 3300035114 | Bacteria | 647 |
| 578 | Ga0373941_0115567 | 3300035115 | Bacteria | 951 |
| 579 | Ga0373953_0148355 | 3300035117 | Bacteria | 1004 |
| 580 | Ga0373953_0196340 | 3300035117 | Bacteria | 872 |
| 581 | Ga0373954_0208374 | 3300035118 | Unclassified | 961 |
| 582 | Ga0373956_0124709 | 3300035119 | Bacteria | 1204 |
| 583 | Ga0373956_0259708 | 3300035119 | Bacteria | 826 |
| 584 | Ga0373956_0641237 | 3300035119 | Bacteria | 507 |
| 585 | Ga0373957_0029426 | 3300035120 | Bacteria | 2007 |
| 586 | Ga0373957_0204186 | 3300035120 | Bacteria | 824 |
| 587 | Ga0373943_0122325 | 3300035170 | Bacteria | 1384 |
| 588 | Ga0373955_0169424 | 3300035172 | Bacteria | 1292 |
| 589 | Ga0373955_0349175 | 3300035172 | Bacteria | 896 |
| 590 | Ga0373955_0648238 | 3300035172 | Unclassified | 647 |
| 591 | Ga0373942_0025484 | 3300035207 | Bacteria | 1525 |
| 592 | Ga0373961_0301746 | 3300035241 | Bacteria | 593 |
| 593 | Ga0373962_0073255 | 3300035242 | Bacteria | 1027 |
| 594 | Ga0316574_0766334 | 3300035398 | Unclassified | 589 |
| 595 | Ga0373935_0229708 | 3300035692 | Bacteria | 1292 |
| 596 | Ga0373927_0002811 | 3300035695 | Bacteria | 12708 |
| 597 | Ga0373927_0184193 | 3300035695 | Bacteria | 1370 |
| 598 | Ga0373927_0301055 | 3300035695 | Unclassified | 1055 |
| 599 | Ga0373927_0887304 | 3300035695 | Bacteria | 589 |
| 600 | Ga0373933_0106704 | 3300035724 | Bacteria | 1743 |
| 601 | Ga0373933_0938569 | 3300035724 | Unclassified | 570 |
| 602 | Ga0373947_0258016 | 3300035725 | Bacteria | 1154 |
| 603 | Ga0373947_0993968 | 3300035725 | Unclassified | 572 |
| 604 | Ga0373947_1157194 | 3300035725 | Unclassified | 527 |
| 605 | Ga0373937_0103062 | 3300036401 | Bacteria | 2650 |
| 606 | Ga0373937_0126691 | 3300036401 | Bacteria | 2383 |
| 607 | Ga0373937_0179190 | 3300036401 | Bacteria | 1990 |
| 608 | Ga0373937_0339702 | 3300036401 | Bacteria | 1422 |
| 609 | Ga0373937_0384119 | 3300036401 | Unclassified | 1332 |
| 610 | Ga0373937_0877594 | 3300036401 | Bacteria | 846 |
| 611 | Ga0373937_1565220 | 3300036401 | Bacteria | 606 |
| 612 | Ga0316582_0012184 | 3300036647 | Bacteria | 4788 |
| 613 | Ga0316584_0017857 | 3300036712 | Bacteria | 5109 |
| 614 | Ga0316584_0267267 | 3300036712 | Unclassified | 1245 |
| 615 | Ga0373925_0100046 | 3300037068 | Bacteria | 2228 |
| 616 | Ga0395900_0101330 | 3300037418 | Unclassified | 2958 |
| 617 | Ga0395900_0814081 | 3300037418 | Unclassified | 861 |
| 618 | Ga0395900_1073238 | 3300037418 | Unclassified | 723 |
| 619 | Ga0395898_0462286 | 3300037466 | Unclassified | 1208 |
| 620 | Ga0395905_0560245 | 3300037471 | Unclassified | 1044 |
| 621 | Ga0436364_1092155 | 3300037853 | Bacteria | 743 |
| 622 | Ga0436364_1460655 | 3300037853 | Bacteria | 626 |
| 623 | Ga0395901_0532730 | 3300038443 | Bacteria | 1192 |
| 624 | Ga0436365_0224016 | 3300039437 | Unclassified | 613 |
| 625 | Ga0436365_1476328 | 3300039437 | Bacteria | 212791 |
| 626 | Ga0436361_0786779 | 3300039447 | Bacteria | 144856 |
| 627 | Ga0436362_0793938 | 3300039453 | Bacteria | 1389 |
| 628 | Ga0451849_1440942 | 3300041505 | Bacteria | 1102 |
| 629 | Ga0451851_0871010 | 3300041507 | Bacteria | 1089 |
| 630 | Ga0451853_2446995 | 3300041512 | Unclassified | 799 |
| 631 | Ga0439448_0055755 | 3300042005 | Bacteria | 1300 |
| 632 | Ga0439451_049454 | 3300042009 | Bacteria | 842 |
| 633 | Ga0439458_0007203 | 3300042157 | Bacteria | 2475 |
| 634 | Ga0439435_0156769 | 3300042436 | Bacteria | 733 |
| 635 | Ga0439464_0017396 | 3300042439 | Bacteria | 1949 |
| 636 | Ga0439460_0015422 | 3300042461 | Bacteria | 2023 |
| 637 | Ga0439460_0240051 | 3300042461 | Bacteria | 625 |
| 638 | Ga0451577_0042049 | 3300042876 | Bacteria | 4099 |
| 639 | Ga0451577_0692071 | 3300042876 | Bacteria | 924 |
| 640 | Ga0451577_0841633 | 3300042876 | Bacteria | 828 |
| 641 | Ga0451577_0876750 | 3300042876 | Bacteria | 809 |
| 642 | Ga0451577_1817317 | 3300042876 | Unclassified | 535 |
| 643 | Ga0453683_0002195 | 3300044673 | Bacteria | 15518 |
| 644 | Ga0453683_0135726 | 3300044673 | Bacteria | 1551 |
| 645 | Ga0466966_0008342 | 3300044684 | Bacteria | 6861 |
| 646 | Ga0466963_0868561 | 3300044694 | Unclassified | 636 |
| 647 | Ga0466964_0334482 | 3300044706 | Unclassified | 773 |
| 648 | Ga0453684_0056727 | 3300044712 | Bacteria | 5077 |
| 649 | Ga0453684_0170452 | 3300044712 | Unclassified | 2565 |
| 650 | Ga0453684_0277627 | 3300044712 | Bacteria | 1912 |
| 651 | Ga0453684_0485039 | 3300044712 | Bacteria | 1371 |
| 652 | Ga0453684_0574587 | 3300044712 | Bacteria | 1239 |
| 653 | Ga0453684_1147918 | 3300044712 | Bacteria | 818 |
| 654 | Ga0466959_0293038 | 3300045049 | Bacteria | 1115 |
| 655 | Ga0451576_0413151 | 3300045051 | Bacteria | 1415 |
| 656 | Ga0451576_2183154 | 3300045051 | Bacteria | 569 |
| 657 | Ga0451576_2523353 | 3300045051 | Bacteria | 525 |
| 658 | Ga0466967_0105899 | 3300045976 | Bacteria | 2577 |
| 659 | Ga0466967_0845278 | 3300045976 | Bacteria | 909 |
| 660 | Ga0495592_0020273 | 3300046454 | Bacteria | 5057 |
| 661 | Ga0495603_0049371 | 3300046455 | Bacteria | 2505 |
| 662 | Ga0495603_0156048 | 3300046455 | Unclassified | 1325 |
| 663 | Ga0495629_0001099 | 3300046459 | Bacteria | 21423 |
| 664 | Ga0495629_0084139 | 3300046459 | Unclassified | 2220 |
| 665 | Ga0495629_0254391 | 3300046459 | Unclassified | 1208 |
| 666 | Ga0495641_0035385 | 3300046461 | Bacteria | 2355 |
| 667 | Ga0495641_0060507 | 3300046461 | Bacteria | 1711 |
| 668 | Ga0495651_0290267 | 3300046462 | Bacteria | 1101 |
| 669 | Ga0495651_0498431 | 3300046462 | Unclassified | 780 |
| 670 | Ga0495653_0086911 | 3300046463 | Bacteria | 2297 |
| 671 | Ga0495653_0654885 | 3300046463 | Unclassified | 641 |
| 672 | Ga0495653_0759320 | 3300046463 | Unclassified | 585 |
| 673 | Ga0495653_0828994 | 3300046463 | Unclassified | 554 |
| 674 | Ga0495580_0178155 | 3300046472 | Bacteria | 1468 |
| 675 | Ga0495580_1015991 | 3300046472 | Bacteria | 528 |
| 676 | Ga0495582_0011615 | 3300046473 | Bacteria | 4854 |
| 677 | Ga0495582_0053264 | 3300046473 | Bacteria | 2232 |
| 678 | Ga0495582_0538493 | 3300046473 | Bacteria | 675 |
| 679 | Ga0495639_0047642 | 3300046475 | Bacteria | 1942 |
| 680 | Ga0495639_0517273 | 3300046475 | Bacteria | 610 |
| 681 | Ga0495639_0533918 | 3300046475 | Bacteria | 600 |
| 682 | Ga0495639_0630901 | 3300046475 | Unclassified | 552 |
| 683 | Ga0495662_0171116 | 3300046476 | Bacteria | 1070 |
| 684 | Ga0495662_0331137 | 3300046476 | Unclassified | 749 |
| 685 | Ga0495662_0678010 | 3300046476 | Unclassified | 503 |
| 686 | Ga0495664_0024014 | 3300046477 | Bacteria | 3541 |
| 687 | Ga0495664_0534803 | 3300046477 | Bacteria | 699 |
| 688 | Ga0495585_0572150 | 3300046492 | Unclassified | 533 |
| 689 | Ga0495594_0006555 | 3300046499 | Bacteria | 5988 |
| 690 | Ga0495594_0008374 | 3300046499 | Bacteria | 5327 |
| 691 | Ga0495607_0451831 | 3300046501 | Unclassified | 577 |
| 692 | Ga0495608_0162766 | 3300046511 | Unclassified | 1418 |
| 693 | Ga0495608_0342425 | 3300046511 | Bacteria | 921 |
| 694 | Ga0495618_0015458 | 3300046514 | Bacteria | 4660 |
| 695 | Ga0495618_0214412 | 3300046514 | Unclassified | 1216 |
| 696 | Ga0495628_0044764 | 3300046516 | Bacteria | 3519 |
| 697 | Ga0495628_0196802 | 3300046516 | Bacteria | 1520 |
| 698 | Ga0495628_0490409 | 3300046516 | Bacteria | 888 |
| 699 | Ga0495630_0024804 | 3300046517 | Bacteria | 4433 |
| 700 | Ga0495630_0040314 | 3300046517 | Bacteria | 3490 |
| 701 | Ga0495630_0316882 | 3300046517 | Unclassified | 1192 |
| 702 | Ga0495630_0390217 | 3300046517 | Unclassified | 1066 |
| 703 | Ga0495637_0184711 | 3300046520 | Unclassified | 772 |
| 704 | Ga0495644_0342905 | 3300046523 | Unclassified | 588 |
| 705 | Ga0495666_0035153 | 3300046526 | Bacteria | 2443 |
| 706 | Ga0495666_0241262 | 3300046526 | Unclassified | 825 |
| 707 | Ga0495652_0060309 | 3300046529 | Bacteria | 3206 |
| 708 | Ga0495652_0255004 | 3300046529 | Bacteria | 1298 |
| 709 | Ga0495665_0634456 | 3300046531 | Bacteria | 532 |
| 710 | Ga0495640_0057781 | 3300046533 | Bacteria | 2647 |
| 711 | Ga0495640_0062753 | 3300046533 | Bacteria | 2519 |
| 712 | Ga0495640_0941790 | 3300046533 | Bacteria | 510 |
| 713 | Ga0495586_0044188 | 3300046535 | Bacteria | 2399 |
| 714 | Ga0495586_0059714 | 3300046535 | Bacteria | 2072 |
| 715 | Ga0495586_0087441 | 3300046535 | Bacteria | 1718 |
| 716 | Ga0495586_0383120 | 3300046535 | Unclassified | 809 |
| 717 | Ga0495586_0931272 | 3300046535 | Unclassified | 501 |
| 718 | Ga0495587_0048084 | 3300046536 | Bacteria | 2527 |
| 719 | Ga0495587_0052430 | 3300046536 | Bacteria | 2407 |
| 720 | Ga0495587_0469760 | 3300046536 | Unclassified | 696 |
| 721 | Ga0495587_0526367 | 3300046536 | Unclassified | 653 |
| 722 | Ga0495645_0003220 | 3300046543 | Bacteria | 11078 |
| 723 | Ga0495645_0077919 | 3300046543 | Bacteria | 2383 |
| 724 | Ga0495645_0229600 | 3300046543 | Bacteria | 1244 |
| 725 | Ga0495645_0440512 | 3300046543 | Bacteria | 823 |
| 726 | Ga0495667_0482072 | 3300046559 | Unclassified | 778 |
| 727 | Ga0495667_0516005 | 3300046559 | Bacteria | 748 |
| 728 | Ga0495634_0080075 | 3300046642 | Bacteria | 2138 |
| 729 | Ga0495634_0149284 | 3300046642 | Bacteria | 1479 |
| 730 | Ga0495611_0198955 | 3300046648 | Bacteria | 935 |
| 731 | Ga0495635_0005233 | 3300046663 | Bacteria | 9027 |
| 732 | Ga0495635_0403481 | 3300046663 | Bacteria | 908 |
| 733 | Ga0495635_0947418 | 3300046663 | Unclassified | 550 |
| 734 | Ga0495657_0188742 | 3300046675 | Bacteria | 1261 |
| 735 | Ga0495657_0834615 | 3300046675 | Bacteria | 526 |
| 736 | Ga0495599_0006509 | 3300046678 | Bacteria | 7046 |
| 737 | Ga0495623_0009108 | 3300046679 | Bacteria | 6440 |
| 738 | Ga0495623_0305510 | 3300046679 | Bacteria | 878 |
| 739 | Ga0495623_0719139 | 3300046679 | Bacteria | 510 |
| 740 | Ga0495646_0108517 | 3300046680 | Bacteria | 1582 |
| 741 | Ga0495647_0016331 | 3300046681 | Bacteria | 2612 |
| 742 | Ga0495647_0060970 | 3300046681 | Bacteria | 1488 |
| 743 | Ga0495658_0002224 | 3300046683 | Bacteria | 9809 |
| 744 | Ga0495658_0047774 | 3300046683 | Bacteria | 2411 |
| 745 | Ga0495658_0123254 | 3300046683 | Bacteria | 1570 |
| 746 | Ga0495658_0273510 | 3300046683 | Bacteria | 1065 |
| 747 | Ga0495658_0480102 | 3300046683 | Bacteria | 795 |
| 748 | Ga0495669_0413907 | 3300046684 | Unclassified | 654 |
| 749 | Ga0495613_0002740 | 3300046689 | Bacteria | 13235 |
| 750 | Ga0495613_0028292 | 3300046689 | Bacteria | 4168 |
| 751 | Ga0495613_0072994 | 3300046689 | Bacteria | 2501 |
| 752 | Ga0495613_0752221 | 3300046689 | Bacteria | 639 |
| 753 | Ga0495624_0313102 | 3300046690 | Bacteria | 946 |
| 754 | Ga0495600_0193625 | 3300046809 | Bacteria | 1307 |
| 755 | Ga0495581_0004247 | 3300047315 | Bacteria | 8263 |
| 756 | Ga0495581_0222804 | 3300047315 | Unclassified | 1103 |
| 757 | Ga0495581_0312131 | 3300047315 | Unclassified | 919 |
| 758 | Ga0495581_0618525 | 3300047315 | Bacteria | 627 |
| 759 | Ga0495604_0324751 | 3300047317 | Bacteria | 1028 |
| 760 | Ga0495674_0062901 | 3300047319 | Bacteria | 3230 |
| 761 | Ga0495674_0802101 | 3300047319 | Bacteria | 732 |
| 762 | Ga0495674_0927350 | 3300047319 | Unclassified | 671 |
| 763 | Ga0495676_0259471 | 3300047321 | Bacteria | 1183 |
| 764 | Ga0495676_0290060 | 3300047321 | Bacteria | 1106 |
| 765 | Ga0495680_0001823 | 3300047322 | Bacteria | 22500 |
| 766 | Ga0495680_0602878 | 3300047322 | Unclassified | 735 |
| 767 | Ga0495675_0046827 | 3300047444 | Bacteria | 2752 |
| 768 | Ga0495684_0091335 | 3300047471 | Bacteria | 2306 |
| 769 | Ga0495684_0132989 | 3300047471 | Bacteria | 1867 |
| 770 | Ga0495684_0832316 | 3300047471 | Unclassified | 600 |
| 771 | Ga0495593_0107907 | 3300047673 | Bacteria | 1423 |
| 772 | Ga0495602_0049168 | 3300048088 | Bacteria | 3780 |
| 773 | Ga0495602_0714855 | 3300048088 | Bacteria | 679 |
| 774 | Ga0495614_0004515 | 3300048089 | Bacteria | 6279 |
| 775 | Ga0496100_0036655 | 3300048903 | Unclassified | 3096 |
| 776 | Ga0496100_0210224 | 3300048903 | Unclassified | 1423 |
| 777 | Ga0496101_0407012 | 3300048904 | Bacteria | 1072 |
| 778 | Ga0496101_0743474 | 3300048904 | Bacteria | 774 |
| 779 | Ga0496102_0152597 | 3300048905 | Bacteria | 2171 |
| 780 | Ga0496102_0162326 | 3300048905 | Bacteria | 2102 |
| 781 | Ga0496102_0702019 | 3300048905 | Unclassified | 935 |
| 782 | Ga0496103_0070109 | 3300048906 | Bacteria | 2193 |
| 783 | Ga0496103_0209653 | 3300048906 | Bacteria | 1253 |
| 784 | Ga0496104_0084018 | 3300048907 | Bacteria | 3037 |
| 785 | Ga0496104_0141876 | 3300048907 | Bacteria | 2308 |
| 786 | Ga0496104_0340856 | 3300048907 | Bacteria | 1412 |
| 787 | Ga0496105_0071581 | 3300048908 | Bacteria | 2865 |
| 788 | Ga0496105_0489254 | 3300048908 | Bacteria | 967 |
| 789 | Ga0496106_0027205 | 3300048909 | Bacteria | 4259 |
| 790 | Ga0496106_0156683 | 3300048909 | Bacteria | 1799 |
| 791 | Ga0496107_0324934 | 3300048910 | Bacteria | 1145 |
| 792 | Ga0496108_0006877 | 3300048911 | Bacteria | 9205 |
| 793 | Ga0496109_0005698 | 3300048912 | Bacteria | 10427 |
| 794 | Ga0496109_0864380 | 3300048912 | Bacteria | 842 |
| 795 | Ga0496109_1166504 | 3300048912 | Bacteria | 707 |
| 796 | Ga0496110_0054349 | 3300048913 | Bacteria | 3522 |
| 797 | Ga0496111_0064511 | 3300048914 | Unclassified | 2657 |
| 798 | Ga0496111_0320652 | 3300048914 | Unclassified | 1148 |
| 799 | Ga0496112_0047502 | 3300048915 | Bacteria | 4211 |
| 800 | Ga0496112_0095053 | 3300048915 | Bacteria | 2951 |
| 801 | Ga0496112_0101887 | 3300048915 | Bacteria | 2841 |
| 802 | Ga0496112_0129670 | 3300048915 | Bacteria | 2493 |
| 803 | Ga0496112_0613018 | 3300048915 | Bacteria | 1020 |
| 804 | Ga0496112_1434622 | 3300048915 | Bacteria | 605 |
| 805 | Ga0496113_0014627 | 3300048916 | Bacteria | 5362 |
| 806 | Ga0496114_0099938 | 3300048917 | Bacteria | 2475 |
| 807 | Ga0496115_0014127 | 3300048918 | Bacteria | 6042 |
| 808 | Ga0496115_0046704 | 3300048918 | Bacteria | 3462 |
| 809 | Ga0496115_0155585 | 3300048918 | Bacteria | 1889 |
| 810 | Ga0496115_0592420 | 3300048918 | Bacteria | 882 |
| 811 | Ga0496126_0000027 | 3300048929 | Bacteria | 396518 |
| 812 | Ga0501291_024184 | 3300049514 | Bacteria | 986 |
| 813 | Ga0501297_056380 | 3300049520 | Unclassified | 591 |
| 814 | Ga0501298_131132 | 3300049521 | Bacteria | 599 |
| 815 | Ga0501031_0018229 | 3300049568 | Bacteria | 4568 |
| 816 | Ga0501031_0167702 | 3300049568 | Bacteria | 1435 |
| 817 | Ga0501031_0248802 | 3300049568 | Bacteria | 1155 |
| 818 | Ga0501031_0539712 | 3300049568 | Bacteria | 751 |
| 819 | Ga0501032_0003383 | 3300049569 | Bacteria | 12235 |
| 820 | Ga0501032_0167591 | 3300049569 | Bacteria | 1441 |
| 821 | Ga0501032_0239273 | 3300049569 | Bacteria | 1179 |
| 822 | Ga0501033_0006909 | 3300049570 | Bacteria | 8861 |
| 823 | Ga0501033_0007700 | 3300049570 | Bacteria | 8356 |
| 824 | Ga0501033_0085701 | 3300049570 | Bacteria | 2307 |
| 825 | Ga0501034_0027970 | 3300049571 | Bacteria | 5733 |
| 826 | Ga0501034_0594484 | 3300049571 | Bacteria | 1012 |
| 827 | Ga0501036_0011871 | 3300049572 | Bacteria | 7220 |
| 828 | Ga0501036_0030043 | 3300049572 | Bacteria | 4591 |
| 829 | Ga0501036_0037388 | 3300049572 | Bacteria | 4107 |
| 830 | Ga0501036_0376816 | 3300049572 | Bacteria | 1184 |
| 831 | Ga0501036_0566641 | 3300049572 | Bacteria | 943 |
| 832 | Ga0501037_0002059 | 3300049573 | Bacteria | 14585 |
| 833 | Ga0501037_0003998 | 3300049573 | Bacteria | 10688 |
| 834 | Ga0501038_0002739 | 3300049574 | Bacteria | 16418 |
| 835 | Ga0501038_0004476 | 3300049574 | Bacteria | 12994 |
| 836 | Ga0501038_0022090 | 3300049574 | Bacteria | 5704 |
| 837 | Ga0501038_0488687 | 3300049574 | Bacteria | 943 |
| 838 | Ga0501039_0008614 | 3300049575 | Bacteria | 7775 |
| 839 | Ga0501039_0044377 | 3300049575 | Bacteria | 3433 |
| 840 | Ga0501040_0001593 | 3300049576 | Bacteria | 14460 |
| 841 | Ga0501040_0152070 | 3300049576 | Bacteria | 1633 |
| 842 | Ga0501040_0517971 | 3300049576 | Bacteria | 860 |
| 843 | Ga0501040_0654286 | 3300049576 | Bacteria | 759 |
| 844 | Ga0501040_1123033 | 3300049576 | Bacteria | 570 |
| 845 | Ga0501041_0003041 | 3300049577 | Bacteria | 9621 |
| 846 | Ga0501041_0085880 | 3300049577 | Bacteria | 1941 |
| 847 | Ga0501042_0012537 | 3300049578 | Bacteria | 5744 |
| 848 | Ga0501042_0021094 | 3300049578 | Bacteria | 4536 |
| 849 | Ga0501042_0166820 | 3300049578 | Bacteria | 1589 |
| 850 | Ga0501042_0244400 | 3300049578 | Bacteria | 1295 |
| 851 | Ga0501043_0010777 | 3300049579 | Bacteria | 7159 |
| 852 | Ga0501043_0037467 | 3300049579 | Bacteria | 3814 |
| 853 | Ga0501043_0089788 | 3300049579 | Bacteria | 2415 |
| 854 | Ga0501046_0005343 | 3300049580 | Bacteria | 11489 |
| 855 | Ga0501046_0019262 | 3300049580 | Bacteria | 5660 |
| 856 | Ga0501046_0072456 | 3300049580 | Bacteria | 2674 |
| 857 | Ga0501047_0038159 | 3300049581 | Bacteria | 4646 |
| 858 | Ga0501047_0107733 | 3300049581 | Bacteria | 2668 |
| 859 | Ga0501048_0028583 | 3300049582 | Bacteria | 4047 |
| 860 | Ga0501048_0030914 | 3300049582 | Bacteria | 3875 |
| 861 | Ga0501048_0252761 | 3300049582 | Bacteria | 1251 |
| 862 | Ga0501067_0234157 | 3300049583 | Bacteria | 1022 |
| 863 | Ga0501068_0044955 | 3300049584 | Bacteria | 2660 |
| 864 | Ga0501068_0048138 | 3300049584 | Bacteria | 2573 |
| 865 | Ga0501068_0057085 | 3300049584 | Bacteria | 2366 |
| 866 | Ga0501069_0005632 | 3300049585 | Bacteria | 6517 |
| 867 | Ga0501069_0038958 | 3300049585 | Bacteria | 2624 |
| 868 | Ga0501070_0004715 | 3300049586 | Bacteria | 11683 |
| 869 | Ga0501070_0014953 | 3300049586 | Bacteria | 6529 |
| 870 | Ga0501070_0099251 | 3300049586 | Bacteria | 2409 |
| 871 | Ga0501070_0538842 | 3300049586 | Bacteria | 935 |
| 872 | Ga0501071_0007897 | 3300049587 | Bacteria | 7015 |
| 873 | Ga0501071_0009794 | 3300049587 | Bacteria | 6395 |
| 874 | Ga0501071_0132551 | 3300049587 | Bacteria | 1852 |
| 875 | Ga0501072_0003614 | 3300049588 | Bacteria | 11639 |
| 876 | Ga0501072_0021126 | 3300049588 | Bacteria | 5050 |
| 877 | Ga0501072_0066999 | 3300049588 | Bacteria | 2833 |
| 878 | Ga0501072_0132127 | 3300049588 | Bacteria | 1990 |
| 879 | Ga0501072_0641779 | 3300049588 | Bacteria | 836 |
| 880 | Ga0501073_0016233 | 3300049589 | Bacteria | 5397 |
| 881 | Ga0501073_0017742 | 3300049589 | Bacteria | 5151 |
| 882 | Ga0501074_0017399 | 3300049590 | Bacteria | 5215 |
| 883 | Ga0501074_0035170 | 3300049590 | Bacteria | 3629 |
| 884 | Ga0501074_0040296 | 3300049590 | Bacteria | 3384 |
| 885 | Ga0501074_0138096 | 3300049590 | Bacteria | 1744 |
| 886 | Ga0501074_0793606 | 3300049590 | Bacteria | 667 |
| 887 | Ga0501075_0013585 | 3300049591 | Bacteria | 5814 |
| 888 | Ga0501075_0199990 | 3300049591 | Bacteria | 1524 |
| 889 | Ga0501075_0342902 | 3300049591 | Bacteria | 1139 |
| 890 | Ga0501076_0014603 | 3300049592 | Bacteria | 5920 |
| 891 | Ga0501076_0138152 | 3300049592 | Bacteria | 1979 |
| 892 | Ga0501076_0179220 | 3300049592 | Bacteria | 1727 |
| 893 | Ga0501077_0000195 | 3300049593 | Bacteria | 34941 |
| 894 | Ga0501209_281424 | 3300049656 | Unclassified | 522 |
| 895 | Ga0501216_179218 | 3300049660 | Unclassified | 516 |
| 896 | Ga0501217_139282 | 3300049661 | Bacteria | 717 |
| 897 | Ga0501217_158879 | 3300049661 | Unclassified | 681 |
| 898 | Ga0501224_048024 | 3300049664 | Unclassified | 651 |
| 899 | Ga0501235_105739 | 3300049669 | Unclassified | 692 |
| 900 | Ga0501236_121645 | 3300049670 | Bacteria | 531 |
| 901 | Ga0501246_047655 | 3300049676 | Bacteria | 529 |
| 902 | Ga0501249_155783 | 3300049679 | Unclassified | 577 |
| 903 | Ga0501253_068374 | 3300049683 | Bacteria | 780 |
| 904 | Ga0501259_173066 | 3300049688 | Unclassified | 544 |
| 905 | Ga0501225_0047104 | 3300049705 | Unclassified | 1196 |
| 906 | Ga0501079_0000550 | 3300049741 | Bacteria | 24508 |
| 907 | Ga0501079_0004103 | 3300049741 | Bacteria | 10774 |
| 908 | Ga0501079_0024449 | 3300049741 | Bacteria | 4635 |
| 909 | Ga0501079_0273200 | 3300049741 | Bacteria | 1321 |
| 910 | Ga0501080_0039009 | 3300049742 | Bacteria | 4432 |
| 911 | Ga0501080_0057753 | 3300049742 | Bacteria | 3612 |
| 912 | Ga0501080_0128792 | 3300049742 | Bacteria | 2343 |
| 913 | Ga0501080_0617136 | 3300049742 | Unclassified | 961 |
| 914 | Ga0501080_0655368 | 3300049742 | Bacteria | 929 |
| 915 | Ga0501080_0963360 | 3300049742 | Bacteria | 741 |
| 916 | Ga0501080_1069596 | 3300049742 | Unclassified | 697 |
| 917 | Ga0501081_0000417 | 3300049743 | Bacteria | 23491 |
| 918 | Ga0501081_0606153 | 3300049743 | Bacteria | 820 |
| 919 | Ga0501083_0140019 | 3300049744 | Bacteria | 1584 |
| 920 | Ga0501083_0199946 | 3300049744 | Bacteria | 1303 |
| 921 | Ga0501265_043223 | 3300049762 | Bacteria | 687 |
| 922 | Ga0501268_063414 | 3300049765 | Bacteria | 736 |
| 923 | Ga0501268_067290 | 3300049765 | Unclassified | 719 |
| 924 | Ga0501270_143501 | 3300049767 | Unclassified | 538 |
| 925 | Ga0501275_095455 | 3300049772 | Unclassified | 500 |
| 926 | Ga0501035_0000755 | 3300049822 | Bacteria | 34825 |
| 927 | Ga0501035_0004158 | 3300049822 | Bacteria | 13758 |
| 928 | Ga0501035_0119843 | 3300049822 | Bacteria | 2301 |
| 929 | Ga0501035_0178236 | 3300049822 | Bacteria | 1832 |
| 930 | Ga0501044_0000720 | 3300049823 | Bacteria | 39907 |
| 931 | Ga0501044_0006098 | 3300049823 | Bacteria | 13299 |
| 932 | Ga0501044_0119802 | 3300049823 | Bacteria | 2633 |
| 933 | Ga0501045_0004294 | 3300049824 | Bacteria | 9831 |
| 934 | Ga0501045_0161908 | 3300049824 | Bacteria | 1666 |
| 935 | Ga0501045_0550843 | 3300049824 | Bacteria | 855 |
| 936 | Ga0501045_0715067 | 3300049824 | Bacteria | 739 |
| 937 | nmdc:mga05p37_102127_c1 | 3300050507 | Bacteria | 3531 |
| 938 | nmdc:mga05p37_164566_c1 | 3300050507 | Bacteria | 2708 |
| 939 | nmdc:mga05p37_1678919_c1 | 3300050507 | Bacteria | 621 |
| 940 | nmdc:mga05p37_174928_c1 | 3300050507 | Bacteria | 2616 |
| 941 | nmdc:mga05p37_194455_c1 | 3300050507 | Bacteria | 2460 |
| 942 | nmdc:mga05p37_365514_c1 | 3300050507 | Bacteria | 1695 |
| 943 | nmdc:mga05p37_490851_c1 | 3300050507 | Bacteria | 1412 |
| 944 | nmdc:mga05p37_534663_c1 | 3300050507 | Bacteria | 1338 |
| 945 | nmdc:mga05p37_607250_c1 | 3300050507 | Bacteria | 1234 |
| 946 | nmdc:mga05p37_633_c1 | 3300050507 | Bacteria | 38921 |
| 947 | nmdc:mga09592_184992_c1 | 3300050508 | Bacteria | 1802 |
| 948 | nmdc:mga09592_2699_c1 | 3300050508 | Bacteria | 14350 |
| 949 | nmdc:mga09592_349494_c1 | 3300050508 | Bacteria | 1280 |
| 950 | nmdc:mga09592_430577_c1 | 3300050508 | Bacteria | 1139 |
| 951 | nmdc:mga09592_831524_c1 | 3300050508 | Bacteria | 780 |
| 952 | nmdc:mga09592_94227_c1 | 3300050508 | Bacteria | 2560 |
| 953 | nmdc:mga0qj67_120247_c1 | 3300050509 | Bacteria | 2124 |
| 954 | nmdc:mga0qj67_1232144_c1 | 3300050509 | Unclassified | 581 |
| 955 | nmdc:mga0qj67_201930_c1 | 3300050509 | Bacteria | 1615 |
| 956 | nmdc:mga0qj67_45433_c1 | 3300050509 | Bacteria | 3466 |
| 957 | nmdc:mga0qj67_653897_c1 | 3300050509 | Bacteria | 838 |
| 958 | nmdc:mga0qj67_7159_c1 | 3300050509 | Bacteria | 8229 |
| 959 | nmdc:mga06r32_181086_c1 | 3300050510 | Bacteria | 2093 |
| 960 | nmdc:mga06r32_249004_c1 | 3300050510 | Bacteria | 1764 |
| 961 | nmdc:mga06r32_295506_c1 | 3300050510 | Bacteria | 1606 |
| 962 | nmdc:mga06r32_522930_c1 | 3300050510 | Bacteria | 1162 |
| 963 | nmdc:mga06r32_529778_c1 | 3300050510 | Bacteria | 1153 |
| 964 | nmdc:mga06r32_55823_c1 | 3300050510 | Bacteria | 3790 |
| 965 | nmdc:mga06r32_740158_c1 | 3300050510 | Bacteria | 947 |
| 966 | nmdc:mga06r32_9119_c1 | 3300050510 | Bacteria | 8944 |
| 967 | nmdc:mga08y16_126451_c1 | 3300050511 | Bacteria | 2659 |
| 968 | nmdc:mga08y16_43032_c1 | 3300050511 | Bacteria | 4731 |
| 969 | nmdc:mga08y16_661696_c1 | 3300050511 | Bacteria | 1047 |
| 970 | nmdc:mga08y16_690683_c1 | 3300050511 | Bacteria | 1021 |
| 971 | nmdc:mga08y16_733777_c1 | 3300050511 | Bacteria | 985 |
| 972 | nmdc:mga0n895_1038255_c1 | 3300050512 | Unclassified | 799 |
| 973 | nmdc:mga0n895_432797_c1 | 3300050512 | Bacteria | 1329 |
| 974 | nmdc:mga0n895_500980_c1 | 3300050512 | Bacteria | 1223 |
| 975 | nmdc:mga0rr50_143618_c1 | 3300050513 | Bacteria | 1922 |
| 976 | nmdc:mga0rr50_248599_c1 | 3300050513 | Bacteria | 1476 |
| 977 | nmdc:mga0rr50_924910_c1 | 3300050513 | Unclassified | 743 |
| 978 | nmdc:mga08x19_1301049_c1 | 3300050514 | Bacteria | 515 |
| 979 | nmdc:mga0a205_147129_c1 | 3300050515 | Bacteria | 2256 |
| 980 | nmdc:mga0a205_1535753_c1 | 3300050515 | Unclassified | 514 |
| 981 | nmdc:mga0a205_2526_c1 | 3300050515 | Bacteria | 16122 |
| 982 | Ga0495601_0592659 | 3300053077 | Bacteria | 712 |
| 983 | Ga0495601_0951339 | 3300053077 | Unclassified | 541 |
| 984 | Ga0495601_1006588 | 3300053077 | Unclassified | 524 |
| 985 | Ga0495612_0293078 | 3300053078 | Bacteria | 729 |
| 986 | Ga0495595_0151108 | 3300053084 | Bacteria | 1143 |
| 987 | Ga0495619_0002333 | 3300053085 | Bacteria | 12496 |
| 988 | Ga0495619_0140233 | 3300053085 | Unclassified | 1664 |
| 989 | Ga0495619_0167688 | 3300053085 | Unclassified | 1518 |
| 990 | Ga0495619_0372981 | 3300053085 | Bacteria | 986 |
| 991 | Ga0501084_0001686 | 3300054114 | Bacteria | 17565 |
| 992 | Ga0501084_0013262 | 3300054114 | Bacteria | 6820 |
| 993 | Ga0501084_0074012 | 3300054114 | Bacteria | 2852 |
| 994 | Ga0501084_0288161 | 3300054114 | Bacteria | 1387 |
| 995 | Ga0501084_0613396 | 3300054114 | Bacteria | 919 |
| 996 | Ga0587073_0158992 | 3300059492 | Bacteria | 646 |
| 997 | Ga0501082_0003168 | 3300060353 | Bacteria | 14339 |
| 998 | Ga0501082_0006761 | 3300060353 | Bacteria | 9912 |
| 999 | Ga0501082_0027927 | 3300060353 | Bacteria | 4859 |
| 1000 | Ga0501082_0096896 | 3300060353 | Bacteria | 2550 |
| 1001 | Ga0501082_1207546 | 3300060353 | Unclassified | 661 |
| 1002 | Ga0530510_0008140 | 3300061734 | Bacteria | 7314 |
| 1003 | Ga0530510_0407184 | 3300061734 | Bacteria | 1026 |
| 1004 | Ga0530510_0867635 | 3300061734 | Bacteria | 689 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0000027 | Ga0496126_0000027_332651_332941 | 96 |
| 2 | 3300035119 | Ga0373956_0641237 | Ga0373956_0641237_94_387 | 97 |
| 3 | 3300036401 | Ga0373937_0339702 | Ga0373937_0339702_83_376 | 97 |
| 4 | 3300036401 | Ga0373937_1565220 | Ga0373937_1565220_282_575 | 97 |
| 5 | 3300046516 | Ga0495628_0196802 | Ga0495628_0196802_748_1041 | 97 |
| 6 | 3300046536 | Ga0495587_0052430 | Ga0495587_0052430_2097_2390 | 97 |
| 7 | 3300046559 | Ga0495667_0516005 | Ga0495667_0516005_275_568 | 97 |
| 8 | 3300046679 | Ga0495623_0305510 | Ga0495623_0305510_153_446 | 97 |
| 9 | 3300046689 | Ga0495613_0752221 | Ga0495613_0752221_151_444 | 97 |
| 10 | 2162886012 | MBSR1b_contig_4394635 | MBSR1b_0332.00000220 | 98 |
| 11 | 3300001990 | JGI24737J22298_10035235 | JGI24737J22298_100352352 | 98 |
| 12 | 3300003203 | JGI25406J46586_10082425 | JGI25406J46586_100824252 | 98 |
| 13 | 3300005288 | Ga0065714_10224779 | Ga0065714_102247792 | 98 |
| 14 | 3300005288 | Ga0065714_10345260 | Ga0065714_103452602 | 98 |
| 15 | 3300005289 | Ga0065704_10033584 | Ga0065704_100335842 | 98 |
| 16 | 3300005289 | Ga0065704_10098033 | Ga0065704_100980333 | 98 |
| 17 | 3300005289 | Ga0065704_10209423 | Ga0065704_102094231 | 98 |
| 18 | 3300005289 | Ga0065704_10380402 | Ga0065704_103804022 | 98 |
| 19 | 3300005289 | Ga0065704_10457160 | Ga0065704_104571602 | 98 |
| 20 | 3300005290 | Ga0065712_10000625 | Ga0065712_100006259 | 98 |
| 21 | 3300005290 | Ga0065712_10009242 | Ga0065712_100092423 | 98 |
| 22 | 3300005290 | Ga0065712_10012607 | Ga0065712_100126072 | 98 |
| 23 | 3300005290 | Ga0065712_10090964 | Ga0065712_100909643 | 98 |
| 24 | 3300005290 | Ga0065712_10244232 | Ga0065712_102442322 | 98 |
| 25 | 3300005293 | Ga0065715_10004174 | Ga0065715_100041742 | 98 |
| 26 | 3300005293 | Ga0065715_10011829 | Ga0065715_100118292 | 98 |
| 27 | 3300005293 | Ga0065715_10015359 | Ga0065715_100153594 | 98 |
| 28 | 3300005293 | Ga0065715_10052692 | Ga0065715_100526922 | 98 |
| 29 | 3300005293 | Ga0065715_10095555 | Ga0065715_100955552 | 98 |
| 30 | 3300005293 | Ga0065715_10102208 | Ga0065715_101022083 | 98 |
| 31 | 3300005293 | Ga0065715_10281165 | Ga0065715_102811652 | 98 |
| 32 | 3300005293 | Ga0065715_10396383 | Ga0065715_103963831 | 98 |
| 33 | 3300005293 | Ga0065715_10681365 | Ga0065715_106813652 | 98 |
| 34 | 3300005295 | Ga0065707_10029602 | Ga0065707_100296022 | 98 |
| 35 | 3300005295 | Ga0065707_10044765 | Ga0065707_100447652 | 98 |
| 36 | 3300005295 | Ga0065707_10317336 | Ga0065707_103173362 | 98 |
| 37 | 3300005327 | Ga0070658_10106685 | Ga0070658_101066852 | 98 |
| 38 | 3300005327 | Ga0070658_10573231 | Ga0070658_105732312 | 98 |
| 39 | 3300005327 | Ga0070658_10621415 | Ga0070658_106214152 | 98 |
| 40 | 3300005328 | Ga0070676_10004800 | Ga0070676_100048008 | 98 |
| 41 | 3300005328 | Ga0070676_10240783 | Ga0070676_102407832 | 98 |
| 42 | 3300005328 | Ga0070676_10871794 | Ga0070676_108717942 | 98 |
| 43 | 3300005329 | Ga0070683_100035782 | Ga0070683_1000357823 | 98 |
| 44 | 3300005329 | Ga0070683_100052420 | Ga0070683_1000524204 | 98 |
| 45 | 3300005329 | Ga0070683_100211865 | Ga0070683_1002118652 | 98 |
| 46 | 3300005329 | Ga0070683_100306238 | Ga0070683_1003062382 | 98 |
| 47 | 3300005329 | Ga0070683_101377772 | Ga0070683_1013777722 | 98 |
| 48 | 3300005330 | Ga0070690_100621405 | Ga0070690_1006214052 | 98 |
| 49 | 3300005330 | Ga0070690_101100024 | Ga0070690_1011000242 | 98 |
| 50 | 3300005334 | Ga0068869_100151332 | Ga0068869_1001513321 | 98 |
| 51 | 3300005334 | Ga0068869_100155653 | Ga0068869_1001556533 | 98 |
| 52 | 3300005334 | Ga0068869_101946030 | Ga0068869_1019460302 | 98 |
| 53 | 3300005335 | Ga0070666_10041534 | Ga0070666_100415343 | 98 |
| 54 | 3300005336 | Ga0070680_100362105 | Ga0070680_1003621052 | 98 |
| 55 | 3300005336 | Ga0070680_100896467 | Ga0070680_1008964672 | 98 |
| 56 | 3300005337 | Ga0070682_100532356 | Ga0070682_1005323562 | 98 |
| 57 | 3300005338 | Ga0068868_100027582 | Ga0068868_1000275823 | 98 |
| 58 | 3300005338 | Ga0068868_102312435 | Ga0068868_1023124351 | 98 |
| 59 | 3300005339 | Ga0070660_100057363 | Ga0070660_1000573634 | 98 |
| 60 | 3300005339 | Ga0070660_100463823 | Ga0070660_1004638231 | 98 |
| 61 | 3300005340 | Ga0070689_100024392 | Ga0070689_1000243924 | 98 |
| 62 | 3300005340 | Ga0070689_100057914 | Ga0070689_1000579143 | 98 |
| 63 | 3300005340 | Ga0070689_100069596 | Ga0070689_1000695963 | 98 |
| 64 | 3300005340 | Ga0070689_100110073 | Ga0070689_1001100732 | 98 |
| 65 | 3300005340 | Ga0070689_100616962 | Ga0070689_1006169622 | 98 |
| 66 | 3300005340 | Ga0070689_100876160 | Ga0070689_1008761602 | 98 |
| 67 | 3300005340 | Ga0070689_101032025 | Ga0070689_1010320252 | 98 |
| 68 | 3300005343 | Ga0070687_100003020 | Ga0070687_1000030207 | 98 |
| 69 | 3300005343 | Ga0070687_100215246 | Ga0070687_1002152462 | 98 |
| 70 | 3300005344 | Ga0070661_100916387 | Ga0070661_1009163871 | 98 |
| 71 | 3300005345 | Ga0070692_10509056 | Ga0070692_105090562 | 98 |
| 72 | 3300005345 | Ga0070692_10910394 | Ga0070692_109103941 | 98 |
| 73 | 3300005347 | Ga0070668_100025873 | Ga0070668_1000258738 | 98 |
| 74 | 3300005347 | Ga0070668_100174407 | Ga0070668_1001744072 | 98 |
| 75 | 3300005347 | Ga0070668_102066745 | Ga0070668_1020667452 | 98 |
| 76 | 3300005353 | Ga0070669_100019108 | Ga0070669_1000191089 | 98 |
| 77 | 3300005353 | Ga0070669_100536476 | Ga0070669_1005364762 | 98 |
| 78 | 3300005354 | Ga0070675_100010980 | Ga0070675_1000109804 | 98 |
| 79 | 3300005354 | Ga0070675_100016132 | Ga0070675_1000161323 | 98 |
| 80 | 3300005354 | Ga0070675_100020946 | Ga0070675_1000209462 | 98 |
| 81 | 3300005354 | Ga0070675_100245171 | Ga0070675_1002451712 | 98 |
| 82 | 3300005354 | Ga0070675_100257366 | Ga0070675_1002573662 | 98 |
| 83 | 3300005355 | Ga0070671_100427599 | Ga0070671_1004275992 | 98 |
| 84 | 3300005355 | Ga0070671_100481161 | Ga0070671_1004811612 | 98 |
| 85 | 3300005355 | Ga0070671_100991826 | Ga0070671_1009918261 | 98 |
| 86 | 3300005356 | Ga0070674_100767093 | Ga0070674_1007670932 | 98 |
| 87 | 3300005356 | Ga0070674_100858158 | Ga0070674_1008581582 | 98 |
| 88 | 3300005364 | Ga0070673_100032511 | Ga0070673_1000325112 | 98 |
| 89 | 3300005364 | Ga0070673_100084292 | Ga0070673_1000842922 | 98 |
| 90 | 3300005364 | Ga0070673_100741470 | Ga0070673_1007414702 | 98 |
| 91 | 3300005364 | Ga0070673_100823784 | Ga0070673_1008237841 | 98 |
| 92 | 3300005364 | Ga0070673_102361174 | Ga0070673_1023611741 | 98 |
| 93 | 3300005365 | Ga0070688_100006375 | Ga0070688_1000063752 | 98 |
| 94 | 3300005365 | Ga0070688_100029398 | Ga0070688_1000293984 | 98 |
| 95 | 3300005365 | Ga0070688_100029494 | Ga0070688_1000294943 | 98 |
| 96 | 3300005365 | Ga0070688_100054513 | Ga0070688_1000545132 | 98 |
| 97 | 3300005366 | Ga0070659_100019729 | Ga0070659_1000197296 | 98 |
| 98 | 3300005366 | Ga0070659_100056308 | Ga0070659_1000563084 | 98 |
| 99 | 3300005366 | Ga0070659_101240376 | Ga0070659_1012403761 | 98 |
| 100 | 3300005367 | Ga0070667_100013915 | Ga0070667_1000139153 | 98 |
| 101 | 3300005367 | Ga0070667_100042500 | Ga0070667_1000425005 | 98 |
| 102 | 3300005367 | Ga0070667_100056475 | Ga0070667_1000564754 | 98 |
| 103 | 3300005367 | Ga0070667_100177455 | Ga0070667_1001774552 | 98 |
| 104 | 3300005367 | Ga0070667_100894814 | Ga0070667_1008948142 | 98 |
| 105 | 3300005367 | Ga0070667_102056487 | Ga0070667_1020564871 | 98 |
| 106 | 3300005406 | Ga0070703_10386672 | Ga0070703_103866721 | 98 |
| 107 | 3300005434 | Ga0070709_10068002 | Ga0070709_100680022 | 98 |
| 108 | 3300005434 | Ga0070709_10384167 | Ga0070709_103841672 | 98 |
| 109 | 3300005435 | Ga0070714_100090123 | Ga0070714_1000901233 | 98 |
| 110 | 3300005436 | Ga0070713_100601197 | Ga0070713_1006011972 | 98 |
| 111 | 3300005437 | Ga0070710_10041420 | Ga0070710_100414202 | 98 |
| 112 | 3300005438 | Ga0070701_10838916 | Ga0070701_108389162 | 98 |
| 113 | 3300005439 | Ga0070711_100052061 | Ga0070711_1000520612 | 98 |
| 114 | 3300005439 | Ga0070711_101297645 | Ga0070711_1012976451 | 98 |
| 115 | 3300005440 | Ga0070705_100508117 | Ga0070705_1005081172 | 98 |
| 116 | 3300005441 | Ga0070700_100093396 | Ga0070700_1000933961 | 98 |
| 117 | 3300005444 | Ga0070694_100002927 | Ga0070694_1000029276 | 98 |
| 118 | 3300005444 | Ga0070694_100141540 | Ga0070694_1001415402 | 98 |
| 119 | 3300005444 | Ga0070694_100376525 | Ga0070694_1003765252 | 98 |
| 120 | 3300005455 | Ga0070663_100105476 | Ga0070663_1001054762 | 98 |
| 121 | 3300005455 | Ga0070663_100125892 | Ga0070663_1001258922 | 98 |
| 122 | 3300005456 | Ga0070678_100030782 | Ga0070678_1000307822 | 98 |
| 123 | 3300005456 | Ga0070678_100057554 | Ga0070678_1000575542 | 98 |
| 124 | 3300005457 | Ga0070662_100019870 | Ga0070662_1000198702 | 98 |
| 125 | 3300005457 | Ga0070662_100219811 | Ga0070662_1002198111 | 98 |
| 126 | 3300005458 | Ga0070681_10158486 | Ga0070681_101584863 | 98 |
| 127 | 3300005458 | Ga0070681_10523537 | Ga0070681_105235372 | 98 |
| 128 | 3300005459 | Ga0068867_101504882 | Ga0068867_1015048821 | 98 |
| 129 | 3300005466 | Ga0070685_10004471 | Ga0070685_100044714 | 98 |
| 130 | 3300005466 | Ga0070685_10832587 | Ga0070685_108325871 | 98 |
| 131 | 3300005466 | Ga0070685_11330265 | Ga0070685_113302652 | 98 |
| 132 | 3300005467 | Ga0070706_100327051 | Ga0070706_1003270513 | 98 |
| 133 | 3300005467 | Ga0070706_100329059 | Ga0070706_1003290593 | 98 |
| 134 | 3300005467 | Ga0070706_100598426 | Ga0070706_1005984262 | 98 |
| 135 | 3300005467 | Ga0070706_100936543 | Ga0070706_1009365432 | 98 |
| 136 | 3300005467 | Ga0070706_101002882 | Ga0070706_1010028821 | 98 |
| 137 | 3300005467 | Ga0070706_101666960 | Ga0070706_1016669601 | 98 |
| 138 | 3300005468 | Ga0070707_100051720 | Ga0070707_1000517203 | 98 |
| 139 | 3300005468 | Ga0070707_100091622 | Ga0070707_1000916222 | 98 |
| 140 | 3300005468 | Ga0070707_100370917 | Ga0070707_1003709173 | 98 |
| 141 | 3300005468 | Ga0070707_100524120 | Ga0070707_1005241202 | 98 |
| 142 | 3300005471 | Ga0070698_100301528 | Ga0070698_1003015282 | 98 |
| 143 | 3300005471 | Ga0070698_100482119 | Ga0070698_1004821192 | 98 |
| 144 | 3300005530 | Ga0070679_100974110 | Ga0070679_1009741102 | 98 |
| 145 | 3300005530 | Ga0070679_102208443 | Ga0070679_1022084431 | 98 |
| 146 | 3300005535 | Ga0070684_100020105 | Ga0070684_1000201053 | 98 |
| 147 | 3300005535 | Ga0070684_100031426 | Ga0070684_1000314264 | 98 |
| 148 | 3300005535 | Ga0070684_100463644 | Ga0070684_1004636442 | 98 |
| 149 | 3300005535 | Ga0070684_100566668 | Ga0070684_1005666681 | 98 |
| 150 | 3300005535 | Ga0070684_101096965 | Ga0070684_1010969652 | 98 |
| 151 | 3300005536 | Ga0070697_100517226 | Ga0070697_1005172261 | 98 |
| 152 | 3300005536 | Ga0070697_100743642 | Ga0070697_1007436422 | 98 |
| 153 | 3300005536 | Ga0070697_100821865 | Ga0070697_1008218652 | 98 |
| 154 | 3300005536 | Ga0070697_101229090 | Ga0070697_1012290902 | 98 |
| 155 | 3300005539 | Ga0068853_100932860 | Ga0068853_1009328601 | 98 |
| 156 | 3300005543 | Ga0070672_100481621 | Ga0070672_1004816212 | 98 |
| 157 | 3300005544 | Ga0070686_100131952 | Ga0070686_1001319522 | 98 |
| 158 | 3300005544 | Ga0070686_101310968 | Ga0070686_1013109682 | 98 |
| 159 | 3300005544 | Ga0070686_101384347 | Ga0070686_1013843471 | 98 |
| 160 | 3300005545 | Ga0070695_100005952 | Ga0070695_1000059524 | 98 |
| 161 | 3300005545 | Ga0070695_100070184 | Ga0070695_1000701842 | 98 |
| 162 | 3300005545 | Ga0070695_100786667 | Ga0070695_1007866672 | 98 |
| 163 | 3300005546 | Ga0070696_100017047 | Ga0070696_1000170472 | 98 |
| 164 | 3300005546 | Ga0070696_100190017 | Ga0070696_1001900172 | 98 |
| 165 | 3300005546 | Ga0070696_101245237 | Ga0070696_1012452371 | 98 |
| 166 | 3300005547 | Ga0070693_100069579 | Ga0070693_1000695792 | 98 |
| 167 | 3300005548 | Ga0070665_100094688 | Ga0070665_1000946883 | 98 |
| 168 | 3300005548 | Ga0070665_100356471 | Ga0070665_1003564712 | 98 |
| 169 | 3300005548 | Ga0070665_100689338 | Ga0070665_1006893381 | 98 |
| 170 | 3300005548 | Ga0070665_100826454 | Ga0070665_1008264542 | 98 |
| 171 | 3300005549 | Ga0070704_100024165 | Ga0070704_1000241655 | 98 |
| 172 | 3300005549 | Ga0070704_100063567 | Ga0070704_1000635672 | 98 |
| 173 | 3300005564 | Ga0070664_100802744 | Ga0070664_1008027442 | 98 |
| 174 | 3300005564 | Ga0070664_101107043 | Ga0070664_1011070431 | 98 |
| 175 | 3300005614 | Ga0068856_100124531 | Ga0068856_1001245312 | 98 |
| 176 | 3300005614 | Ga0068856_100586633 | Ga0068856_1005866332 | 98 |
| 177 | 3300005615 | Ga0070702_101150838 | Ga0070702_1011508382 | 98 |
| 178 | 3300005617 | Ga0068859_100073768 | Ga0068859_1000737682 | 98 |
| 179 | 3300005617 | Ga0068859_100075988 | Ga0068859_1000759884 | 98 |
| 180 | 3300005617 | Ga0068859_101078947 | Ga0068859_1010789472 | 98 |
| 181 | 3300005617 | Ga0068859_101847872 | Ga0068859_1018478722 | 98 |
| 182 | 3300005618 | Ga0068864_100282517 | Ga0068864_1002825172 | 98 |
| 183 | 3300005618 | Ga0068864_100630238 | Ga0068864_1006302382 | 98 |
| 184 | 3300005719 | Ga0068861_100112660 | Ga0068861_1001126603 | 98 |
| 185 | 3300005719 | Ga0068861_100331167 | Ga0068861_1003311672 | 98 |
| 186 | 3300005719 | Ga0068861_101450908 | Ga0068861_1014509081 | 98 |
| 187 | 3300005834 | Ga0068851_10691505 | Ga0068851_106915051 | 98 |
| 188 | 3300005840 | Ga0068870_10195438 | Ga0068870_101954382 | 98 |
| 189 | 3300005840 | Ga0068870_10660298 | Ga0068870_106602982 | 98 |
| 190 | 3300005841 | Ga0068863_100029528 | Ga0068863_1000295285 | 98 |
| 191 | 3300005841 | Ga0068863_100228567 | Ga0068863_1002285673 | 98 |
| 192 | 3300005841 | Ga0068863_101395932 | Ga0068863_1013959322 | 98 |
| 193 | 3300005842 | Ga0068858_100034200 | Ga0068858_1000342004 | 98 |
| 194 | 3300005842 | Ga0068858_100078546 | Ga0068858_1000785462 | 98 |
| 195 | 3300005842 | Ga0068858_100118665 | Ga0068858_1001186652 | 98 |
| 196 | 3300005842 | Ga0068858_101048204 | Ga0068858_1010482042 | 98 |
| 197 | 3300005843 | Ga0068860_100021636 | Ga0068860_1000216365 | 98 |
| 198 | 3300005843 | Ga0068860_100280619 | Ga0068860_1002806193 | 98 |
| 199 | 3300005844 | Ga0068862_100041613 | Ga0068862_1000416132 | 98 |
| 200 | 3300005844 | Ga0068862_100821444 | Ga0068862_1008214442 | 98 |
| 201 | 3300005937 | Ga0081455_10001083 | Ga0081455_1000108317 | 98 |
| 202 | 3300005937 | Ga0081455_10003380 | Ga0081455_1000338015 | 98 |
| 203 | 3300005937 | Ga0081455_10013473 | Ga0081455_100134734 | 98 |
| 204 | 3300005937 | Ga0081455_10098327 | Ga0081455_100983273 | 98 |
| 205 | 3300005937 | Ga0081455_10311029 | Ga0081455_103110292 | 98 |
| 206 | 3300005937 | Ga0081455_10457364 | Ga0081455_104573642 | 98 |
| 207 | 3300005981 | Ga0081538_10028746 | Ga0081538_100287462 | 98 |
| 208 | 3300005983 | Ga0081540_1024266 | Ga0081540_10242662 | 98 |
| 209 | 3300005983 | Ga0081540_1032511 | Ga0081540_10325113 | 98 |
| 210 | 3300005983 | Ga0081540_1093820 | Ga0081540_10938201 | 98 |
| 211 | 3300005985 | Ga0081539_10014701 | Ga0081539_100147017 | 98 |
| 212 | 3300006028 | Ga0070717_10036763 | Ga0070717_100367635 | 98 |
| 213 | 3300006028 | Ga0070717_10147250 | Ga0070717_101472503 | 98 |
| 214 | 3300006028 | Ga0070717_10631358 | Ga0070717_106313582 | 98 |
| 215 | 3300006028 | Ga0070717_10638084 | Ga0070717_106380842 | 98 |
| 216 | 3300006028 | Ga0070717_11042484 | Ga0070717_110424842 | 98 |
| 217 | 3300006028 | Ga0070717_11473692 | Ga0070717_114736921 | 98 |
| 218 | 3300006163 | Ga0070715_10048082 | Ga0070715_100480822 | 98 |
| 219 | 3300006163 | Ga0070715_10237817 | Ga0070715_102378172 | 98 |
| 220 | 3300006163 | Ga0070715_10571178 | Ga0070715_105711782 | 98 |
| 221 | 3300006173 | Ga0070716_100099847 | Ga0070716_1000998472 | 98 |
| 222 | 3300006173 | Ga0070716_100476223 | Ga0070716_1004762231 | 98 |
| 223 | 3300006173 | Ga0070716_101089943 | Ga0070716_1010899431 | 98 |
| 224 | 3300006175 | Ga0070712_100044614 | Ga0070712_1000446142 | 98 |
| 225 | 3300006175 | Ga0070712_100232801 | Ga0070712_1002328012 | 98 |
| 226 | 3300006175 | Ga0070712_100245420 | Ga0070712_1002454201 | 98 |
| 227 | 3300006175 | Ga0070712_100253441 | Ga0070712_1002534412 | 98 |
| 228 | 3300006175 | Ga0070712_100446963 | Ga0070712_1004469631 | 98 |
| 229 | 3300006175 | Ga0070712_100710701 | Ga0070712_1007107012 | 98 |
| 230 | 3300006175 | Ga0070712_101262894 | Ga0070712_1012628942 | 98 |
| 231 | 3300006237 | Ga0097621_100095130 | Ga0097621_1000951303 | 98 |
| 232 | 3300006237 | Ga0097621_100271998 | Ga0097621_1002719982 | 98 |
| 233 | 3300006358 | Ga0068871_100060040 | Ga0068871_1000600405 | 98 |
| 234 | 3300006844 | Ga0075428_100011203 | Ga0075428_10001120313 | 98 |
| 235 | 3300006844 | Ga0075428_100059664 | Ga0075428_1000596642 | 98 |
| 236 | 3300006844 | Ga0075428_100180070 | Ga0075428_1001800702 | 98 |
| 237 | 3300006844 | Ga0075428_100578201 | Ga0075428_1005782013 | 98 |
| 238 | 3300006844 | Ga0075428_100918227 | Ga0075428_1009182272 | 98 |
| 239 | 3300006844 | Ga0075428_101725415 | Ga0075428_1017254151 | 98 |
| 240 | 3300006844 | Ga0075428_102374384 | Ga0075428_1023743842 | 98 |
| 241 | 3300006846 | Ga0075430_100001915 | Ga0075430_1000019152 | 98 |
| 242 | 3300006846 | Ga0075430_100026366 | Ga0075430_1000263662 | 98 |
| 243 | 3300006846 | Ga0075430_100036343 | Ga0075430_1000363437 | 98 |
| 244 | 3300006846 | Ga0075430_100085507 | Ga0075430_1000855073 | 98 |
| 245 | 3300006846 | Ga0075430_100625851 | Ga0075430_1006258512 | 98 |
| 246 | 3300006846 | Ga0075430_101681801 | Ga0075430_1016818012 | 98 |
| 247 | 3300006847 | Ga0075431_100007491 | Ga0075431_1000074916 | 98 |
| 248 | 3300006847 | Ga0075431_100025414 | Ga0075431_1000254147 | 98 |
| 249 | 3300006847 | Ga0075431_100035701 | Ga0075431_1000357012 | 98 |
| 250 | 3300006847 | Ga0075431_100053137 | Ga0075431_1000531377 | 98 |
| 251 | 3300006847 | Ga0075431_100306843 | Ga0075431_1003068431 | 98 |
| 252 | 3300006847 | Ga0075431_100337683 | Ga0075431_1003376833 | 98 |
| 253 | 3300006847 | Ga0075431_100597248 | Ga0075431_1005972481 | 98 |
| 254 | 3300006847 | Ga0075431_100760500 | Ga0075431_1007605002 | 98 |
| 255 | 3300006847 | Ga0075431_100798373 | Ga0075431_1007983733 | 98 |
| 256 | 3300006847 | Ga0075431_101544295 | Ga0075431_1015442952 | 98 |
| 257 | 3300006852 | Ga0075433_10078095 | Ga0075433_100780952 | 98 |
| 258 | 3300006852 | Ga0075433_10299893 | Ga0075433_102998932 | 98 |
| 259 | 3300006852 | Ga0075433_11003209 | Ga0075433_110032092 | 98 |
| 260 | 3300006871 | Ga0075434_100096643 | Ga0075434_1000966434 | 98 |
| 261 | 3300006871 | Ga0075434_100111314 | Ga0075434_1001113142 | 98 |
| 262 | 3300006871 | Ga0075434_100217380 | Ga0075434_1002173803 | 98 |
| 263 | 3300006871 | Ga0075434_100480867 | Ga0075434_1004808673 | 98 |
| 264 | 3300006871 | Ga0075434_101333612 | Ga0075434_1013336122 | 98 |
| 265 | 3300006871 | Ga0075434_101920156 | Ga0075434_1019201561 | 98 |
| 266 | 3300006871 | Ga0075434_102057202 | Ga0075434_1020572021 | 98 |
| 267 | 3300006880 | Ga0075429_100003072 | Ga0075429_10000307210 | 98 |
| 268 | 3300006880 | Ga0075429_100051493 | Ga0075429_1000514932 | 98 |
| 269 | 3300006880 | Ga0075429_100159364 | Ga0075429_1001593643 | 98 |
| 270 | 3300006880 | Ga0075429_100240007 | Ga0075429_1002400072 | 98 |
| 271 | 3300006881 | Ga0068865_100228975 | Ga0068865_1002289752 | 98 |
| 272 | 3300006881 | Ga0068865_100299299 | Ga0068865_1002992992 | 98 |
| 273 | 3300006914 | Ga0075436_101504928 | Ga0075436_1015049282 | 98 |
| 274 | 3300006931 | Ga0097620_100073767 | Ga0097620_1000737675 | 98 |
| 275 | 3300006931 | Ga0097620_100075987 | Ga0097620_1000759872 | 98 |
| 276 | 3300006931 | Ga0097620_101078751 | Ga0097620_1010787512 | 98 |
| 277 | 3300006931 | Ga0097620_101847439 | Ga0097620_1018474392 | 98 |
| 278 | 3300007076 | Ga0075435_100284041 | Ga0075435_1002840412 | 98 |
| 279 | 3300007076 | Ga0075435_101613181 | Ga0075435_1016131812 | 98 |
| 280 | 3300007788 | Ga0099795_10022013 | Ga0099795_100220132 | 98 |
| 281 | 3300009036 | Ga0105244_10381617 | Ga0105244_103816171 | 98 |
| 282 | 3300009094 | Ga0111539_10005737 | Ga0111539_100057379 | 98 |
| 283 | 3300009094 | Ga0111539_10127619 | Ga0111539_101276194 | 98 |
| 284 | 3300009094 | Ga0111539_10392634 | Ga0111539_103926342 | 98 |
| 285 | 3300009094 | Ga0111539_13551768 | Ga0111539_135517681 | 98 |
| 286 | 3300009098 | Ga0105245_10648793 | Ga0105245_106487932 | 98 |
| 287 | 3300009098 | Ga0105245_11022583 | Ga0105245_110225832 | 98 |
| 288 | 3300009098 | Ga0105245_11231782 | Ga0105245_112317821 | 98 |
| 289 | 3300009098 | Ga0105245_11729444 | Ga0105245_117294442 | 98 |
| 290 | 3300009098 | Ga0105245_11763135 | Ga0105245_117631352 | 98 |
| 291 | 3300009098 | Ga0105245_11816290 | Ga0105245_118162901 | 98 |
| 292 | 3300009101 | Ga0105247_10127501 | Ga0105247_101275012 | 98 |
| 293 | 3300009101 | Ga0105247_10981384 | Ga0105247_109813842 | 98 |
| 294 | 3300009147 | Ga0114129_10002600 | Ga0114129_100026004 | 98 |
| 295 | 3300009147 | Ga0114129_10070807 | Ga0114129_100708074 | 98 |
| 296 | 3300009147 | Ga0114129_10071259 | Ga0114129_100712596 | 98 |
| 297 | 3300009147 | Ga0114129_10094450 | Ga0114129_100944502 | 98 |
| 298 | 3300009147 | Ga0114129_10275796 | Ga0114129_102757963 | 98 |
| 299 | 3300009147 | Ga0114129_10314759 | Ga0114129_103147592 | 98 |
| 300 | 3300009147 | Ga0114129_10443839 | Ga0114129_104438393 | 98 |
| 301 | 3300009147 | Ga0114129_10454551 | Ga0114129_104545512 | 98 |
| 302 | 3300009147 | Ga0114129_10874492 | Ga0114129_108744922 | 98 |
| 303 | 3300009147 | Ga0114129_10972651 | Ga0114129_109726512 | 98 |
| 304 | 3300009147 | Ga0114129_11736140 | Ga0114129_117361402 | 98 |
| 305 | 3300009148 | Ga0105243_10327504 | Ga0105243_103275042 | 98 |
| 306 | 3300009148 | Ga0105243_11034396 | Ga0105243_110343962 | 98 |
| 307 | 3300009174 | Ga0105241_10111999 | Ga0105241_101119992 | 98 |
| 308 | 3300009174 | Ga0105241_11287371 | Ga0105241_112873712 | 98 |
| 309 | 3300009176 | Ga0105242_10639311 | Ga0105242_106393112 | 98 |
| 310 | 3300009176 | Ga0105242_11739199 | Ga0105242_117391991 | 98 |
| 311 | 3300009177 | Ga0105248_10173972 | Ga0105248_101739722 | 98 |
| 312 | 3300009177 | Ga0105248_10295561 | Ga0105248_102955612 | 98 |
| 313 | 3300009177 | Ga0105248_10376810 | Ga0105248_103768102 | 98 |
| 314 | 3300009545 | Ga0105237_10575801 | Ga0105237_105758012 | 98 |
| 315 | 3300009545 | Ga0105237_10672651 | Ga0105237_106726512 | 98 |
| 316 | 3300009553 | Ga0105249_10031035 | Ga0105249_100310353 | 98 |
| 317 | 3300009553 | Ga0105249_10121601 | Ga0105249_101216012 | 98 |
| 318 | 3300009553 | Ga0105249_10206168 | Ga0105249_102061682 | 98 |
| 319 | 3300009553 | Ga0105249_11830032 | Ga0105249_118300322 | 98 |
| 320 | 3300010159 | Ga0099796_10033170 | Ga0099796_100331702 | 98 |
| 321 | 3300010159 | Ga0099796_10125912 | Ga0099796_101259122 | 98 |
| 322 | 3300010375 | Ga0105239_10018911 | Ga0105239_1001891110 | 98 |
| 323 | 3300010375 | Ga0105239_10104826 | Ga0105239_101048264 | 98 |
| 324 | 3300010375 | Ga0105239_10158785 | Ga0105239_101587852 | 98 |
| 325 | 3300010375 | Ga0105239_10489041 | Ga0105239_104890412 | 98 |
| 326 | 3300011119 | Ga0105246_10196381 | Ga0105246_101963812 | 98 |
| 327 | 3300013102 | Ga0157371_10189038 | Ga0157371_101890382 | 98 |
| 328 | 3300013102 | Ga0157371_10237610 | Ga0157371_102376102 | 98 |
| 329 | 3300013104 | Ga0157370_10252645 | Ga0157370_102526452 | 98 |
| 330 | 3300013104 | Ga0157370_10386562 | Ga0157370_103865622 | 98 |
| 331 | 3300013105 | Ga0157369_10091104 | Ga0157369_100911044 | 98 |
| 332 | 3300013105 | Ga0157369_10099659 | Ga0157369_100996592 | 98 |
| 333 | 3300013296 | Ga0157374_10052870 | Ga0157374_100528705 | 98 |
| 334 | 3300013296 | Ga0157374_10110448 | Ga0157374_101104482 | 98 |
| 335 | 3300013296 | Ga0157374_10127668 | Ga0157374_101276683 | 98 |
| 336 | 3300013296 | Ga0157374_10140991 | Ga0157374_101409913 | 98 |
| 337 | 3300013296 | Ga0157374_10144922 | Ga0157374_101449223 | 98 |
| 338 | 3300013296 | Ga0157374_10265918 | Ga0157374_102659182 | 98 |
| 339 | 3300013296 | Ga0157374_11443083 | Ga0157374_114430832 | 98 |
| 340 | 3300013297 | Ga0157378_10014270 | Ga0157378_100142707 | 98 |
| 341 | 3300013297 | Ga0157378_10203079 | Ga0157378_102030792 | 98 |
| 342 | 3300013297 | Ga0157378_10487171 | Ga0157378_104871712 | 98 |
| 343 | 3300013297 | Ga0157378_10698935 | Ga0157378_106989352 | 98 |
| 344 | 3300013297 | Ga0157378_10711758 | Ga0157378_107117582 | 98 |
| 345 | 3300013297 | Ga0157378_10900510 | Ga0157378_109005102 | 98 |
| 346 | 3300013297 | Ga0157378_11103868 | Ga0157378_111038682 | 98 |
| 347 | 3300013297 | Ga0157378_12204185 | Ga0157378_122041852 | 98 |
| 348 | 3300013306 | Ga0163162_10015388 | Ga0163162_100153888 | 98 |
| 349 | 3300013306 | Ga0163162_10094062 | Ga0163162_100940622 | 98 |
| 350 | 3300013306 | Ga0163162_10380908 | Ga0163162_103809082 | 98 |
| 351 | 3300013306 | Ga0163162_10868601 | Ga0163162_108686012 | 98 |
| 352 | 3300013306 | Ga0163162_13329667 | Ga0163162_133296671 | 98 |
| 353 | 3300013307 | Ga0157372_10035572 | Ga0157372_100355722 | 98 |
| 354 | 3300013307 | Ga0157372_10055060 | Ga0157372_100550605 | 98 |
| 355 | 3300013307 | Ga0157372_10095387 | Ga0157372_100953872 | 98 |
| 356 | 3300013307 | Ga0157372_10970471 | Ga0157372_109704711 | 98 |
| 357 | 3300013308 | Ga0157375_10018336 | Ga0157375_100183366 | 98 |
| 358 | 3300013308 | Ga0157375_10846195 | Ga0157375_108461951 | 98 |
| 359 | 3300013308 | Ga0157375_11001309 | Ga0157375_110013092 | 98 |
| 360 | 3300013308 | Ga0157375_11038360 | Ga0157375_110383602 | 98 |
| 361 | 3300013308 | Ga0157375_11108362 | Ga0157375_111083622 | 98 |
| 362 | 3300013308 | Ga0157375_11114413 | Ga0157375_111144132 | 98 |
| 363 | 3300013308 | Ga0157375_11598055 | Ga0157375_115980552 | 98 |
| 364 | 3300014325 | Ga0163163_10555492 | Ga0163163_105554922 | 98 |
| 365 | 3300014325 | Ga0163163_10671017 | Ga0163163_106710172 | 98 |
| 366 | 3300014325 | Ga0163163_10943805 | Ga0163163_109438052 | 98 |
| 367 | 3300014325 | Ga0163163_10976876 | Ga0163163_109768762 | 98 |
| 368 | 3300014497 | Ga0182008_10032361 | Ga0182008_100323612 | 98 |
| 369 | 3300014497 | Ga0182008_10145039 | Ga0182008_101450392 | 98 |
| 370 | 3300014745 | Ga0157377_10096046 | Ga0157377_100960461 | 98 |
| 371 | 3300014745 | Ga0157377_10476494 | Ga0157377_104764942 | 98 |
| 372 | 3300014745 | Ga0157377_10623923 | Ga0157377_106239231 | 98 |
| 373 | 3300014968 | Ga0157379_10051616 | Ga0157379_100516163 | 98 |
| 374 | 3300014968 | Ga0157379_10352184 | Ga0157379_103521842 | 98 |
| 375 | 3300014968 | Ga0157379_10762448 | Ga0157379_107624482 | 98 |
| 376 | 3300014968 | Ga0157379_11168237 | Ga0157379_111682372 | 98 |
| 377 | 3300014969 | Ga0157376_10138274 | Ga0157376_101382742 | 98 |
| 378 | 3300014969 | Ga0157376_10459161 | Ga0157376_104591612 | 98 |
| 379 | 3300014969 | Ga0157376_10565818 | Ga0157376_105658182 | 98 |
| 380 | 3300014969 | Ga0157376_11143054 | Ga0157376_111430542 | 98 |
| 381 | 3300014969 | Ga0157376_12215554 | Ga0157376_122155542 | 98 |
| 382 | 3300014969 | Ga0157376_12690401 | Ga0157376_126904011 | 98 |
| 383 | 3300015265 | Ga0182005_1063808 | Ga0182005_10638082 | 98 |
| 384 | 3300017792 | Ga0163161_10903774 | Ga0163161_109037742 | 98 |
| 385 | 3300020081 | Ga0206354_10138387 | Ga0206354_101383872 | 98 |
| 386 | 3300021358 | Ga0213873_10095422 | Ga0213873_100954222 | 98 |
| 387 | 3300021361 | Ga0213872_10000378 | Ga0213872_1000037827 | 98 |
| 388 | 3300021384 | Ga0213876_10004175 | Ga0213876_100041756 | 98 |
| 389 | 3300021388 | Ga0213875_10553157 | Ga0213875_105531571 | 98 |
| 390 | 3300025271 | Ga0207666_1011002 | Ga0207666_10110022 | 98 |
| 391 | 3300025271 | Ga0207666_1018614 | Ga0207666_10186142 | 98 |
| 392 | 3300025290 | Ga0207673_1009654 | Ga0207673_10096542 | 98 |
| 393 | 3300025290 | Ga0207673_1011046 | Ga0207673_10110462 | 98 |
| 394 | 3300025290 | Ga0207673_1027021 | Ga0207673_10270212 | 98 |
| 395 | 3300025315 | Ga0207697_10003372 | Ga0207697_100033725 | 98 |
| 396 | 3300025315 | Ga0207697_10003736 | Ga0207697_100037367 | 98 |
| 397 | 3300025315 | Ga0207697_10006400 | Ga0207697_100064004 | 98 |
| 398 | 3300025315 | Ga0207697_10037374 | Ga0207697_100373742 | 98 |
| 399 | 3300025315 | Ga0207697_10039285 | Ga0207697_100392852 | 98 |
| 400 | 3300025315 | Ga0207697_10088169 | Ga0207697_100881692 | 98 |
| 401 | 3300025315 | Ga0207697_10199035 | Ga0207697_101990352 | 98 |
| 402 | 3300025885 | Ga0207653_10040172 | Ga0207653_100401721 | 98 |
| 403 | 3300025885 | Ga0207653_10304369 | Ga0207653_103043692 | 98 |
| 404 | 3300025898 | Ga0207692_10427451 | Ga0207692_104274512 | 98 |
| 405 | 3300025903 | Ga0207680_10072808 | Ga0207680_100728083 | 98 |
| 406 | 3300025904 | Ga0207647_10019407 | Ga0207647_100194075 | 98 |
| 407 | 3300025906 | Ga0207699_10081423 | Ga0207699_100814232 | 98 |
| 408 | 3300025906 | Ga0207699_10401900 | Ga0207699_104019002 | 98 |
| 409 | 3300025907 | Ga0207645_10002865 | Ga0207645_1000286516 | 98 |
| 410 | 3300025907 | Ga0207645_10044381 | Ga0207645_100443812 | 98 |
| 411 | 3300025907 | Ga0207645_10747642 | Ga0207645_107476422 | 98 |
| 412 | 3300025909 | Ga0207705_10491855 | Ga0207705_104918552 | 98 |
| 413 | 3300025910 | Ga0207684_10127241 | Ga0207684_101272412 | 98 |
| 414 | 3300025910 | Ga0207684_10280468 | Ga0207684_102804682 | 98 |
| 415 | 3300025910 | Ga0207684_10561714 | Ga0207684_105617141 | 98 |
| 416 | 3300025910 | Ga0207684_10764564 | Ga0207684_107645641 | 98 |
| 417 | 3300025912 | Ga0207707_10638898 | Ga0207707_106388982 | 98 |
| 418 | 3300025914 | Ga0207671_10449412 | Ga0207671_104494122 | 98 |
| 419 | 3300025914 | Ga0207671_10516282 | Ga0207671_105162822 | 98 |
| 420 | 3300025915 | Ga0207693_10023334 | Ga0207693_100233343 | 98 |
| 421 | 3300025915 | Ga0207693_10054152 | Ga0207693_100541523 | 98 |
| 422 | 3300025915 | Ga0207693_10057952 | Ga0207693_100579522 | 98 |
| 423 | 3300025915 | Ga0207693_10270654 | Ga0207693_102706542 | 98 |
| 424 | 3300025915 | Ga0207693_10377099 | Ga0207693_103770992 | 98 |
| 425 | 3300025915 | Ga0207693_10543651 | Ga0207693_105436512 | 98 |
| 426 | 3300025915 | Ga0207693_10671726 | Ga0207693_106717261 | 98 |
| 427 | 3300025915 | Ga0207693_10814619 | Ga0207693_108146191 | 98 |
| 428 | 3300025915 | Ga0207693_11095387 | Ga0207693_110953872 | 98 |
| 429 | 3300025916 | Ga0207663_10231756 | Ga0207663_102317562 | 98 |
| 430 | 3300025916 | Ga0207663_10396562 | Ga0207663_103965622 | 98 |
| 431 | 3300025916 | Ga0207663_10899913 | Ga0207663_108999131 | 98 |
| 432 | 3300025916 | Ga0207663_11532077 | Ga0207663_115320772 | 98 |
| 433 | 3300025918 | Ga0207662_10006880 | Ga0207662_1000688010 | 98 |
| 434 | 3300025918 | Ga0207662_10245863 | Ga0207662_102458632 | 98 |
| 435 | 3300025919 | Ga0207657_10045562 | Ga0207657_100455624 | 98 |
| 436 | 3300025919 | Ga0207657_10071180 | Ga0207657_100711802 | 98 |
| 437 | 3300025921 | Ga0207652_10332966 | Ga0207652_103329661 | 98 |
| 438 | 3300025921 | Ga0207652_11389634 | Ga0207652_113896342 | 98 |
| 439 | 3300025922 | Ga0207646_10077427 | Ga0207646_100774272 | 98 |
| 440 | 3300025922 | Ga0207646_10215294 | Ga0207646_102152942 | 98 |
| 441 | 3300025922 | Ga0207646_10233100 | Ga0207646_102331003 | 98 |
| 442 | 3300025922 | Ga0207646_11073981 | Ga0207646_110739811 | 98 |
| 443 | 3300025922 | Ga0207646_11652580 | Ga0207646_116525802 | 98 |
| 444 | 3300025923 | Ga0207681_10008159 | Ga0207681_100081593 | 98 |
| 445 | 3300025923 | Ga0207681_10832090 | Ga0207681_108320902 | 98 |
| 446 | 3300025926 | Ga0207659_10021721 | Ga0207659_100217217 | 98 |
| 447 | 3300025926 | Ga0207659_10023201 | Ga0207659_100232013 | 98 |
| 448 | 3300025926 | Ga0207659_10066527 | Ga0207659_100665272 | 98 |
| 449 | 3300025926 | Ga0207659_10281783 | Ga0207659_102817832 | 98 |
| 450 | 3300025926 | Ga0207659_10654320 | Ga0207659_106543202 | 98 |
| 451 | 3300025926 | Ga0207659_11047651 | Ga0207659_110476511 | 98 |
| 452 | 3300025927 | Ga0207687_10394818 | Ga0207687_103948182 | 98 |
| 453 | 3300025928 | Ga0207700_10024764 | Ga0207700_100247645 | 98 |
| 454 | 3300025929 | Ga0207664_10086772 | Ga0207664_100867723 | 98 |
| 455 | 3300025931 | Ga0207644_10114526 | Ga0207644_101145263 | 98 |
| 456 | 3300025931 | Ga0207644_10561735 | Ga0207644_105617352 | 98 |
| 457 | 3300025931 | Ga0207644_10574125 | Ga0207644_105741252 | 98 |
| 458 | 3300025932 | Ga0207690_10122155 | Ga0207690_101221552 | 98 |
| 459 | 3300025932 | Ga0207690_10457390 | Ga0207690_104573902 | 98 |
| 460 | 3300025932 | Ga0207690_10632951 | Ga0207690_106329511 | 98 |
| 461 | 3300025933 | Ga0207706_10026220 | Ga0207706_100262203 | 98 |
| 462 | 3300025933 | Ga0207706_10228671 | Ga0207706_102286712 | 98 |
| 463 | 3300025933 | Ga0207706_10633998 | Ga0207706_106339981 | 98 |
| 464 | 3300025933 | Ga0207706_10916160 | Ga0207706_109161601 | 98 |
| 465 | 3300025935 | Ga0207709_10825196 | Ga0207709_108251962 | 98 |
| 466 | 3300025936 | Ga0207670_10000021 | Ga0207670_1000002199 | 98 |
| 467 | 3300025936 | Ga0207670_10011904 | Ga0207670_100119045 | 98 |
| 468 | 3300025936 | Ga0207670_10024611 | Ga0207670_100246112 | 98 |
| 469 | 3300025936 | Ga0207670_10088725 | Ga0207670_100887252 | 98 |
| 470 | 3300025936 | Ga0207670_10152646 | Ga0207670_101526462 | 98 |
| 471 | 3300025936 | Ga0207670_10178356 | Ga0207670_101783562 | 98 |
| 472 | 3300025936 | Ga0207670_10560922 | Ga0207670_105609222 | 98 |
| 473 | 3300025938 | Ga0207704_10359153 | Ga0207704_103591532 | 98 |
| 474 | 3300025939 | Ga0207665_10013313 | Ga0207665_100133135 | 98 |
| 475 | 3300025939 | Ga0207665_11655587 | Ga0207665_116555872 | 98 |
| 476 | 3300025940 | Ga0207691_10034931 | Ga0207691_100349318 | 98 |
| 477 | 3300025941 | Ga0207711_10098700 | Ga0207711_100987002 | 98 |
| 478 | 3300025941 | Ga0207711_10127639 | Ga0207711_101276394 | 98 |
| 479 | 3300025942 | Ga0207689_10056964 | Ga0207689_100569643 | 98 |
| 480 | 3300025942 | Ga0207689_10496306 | Ga0207689_104963062 | 98 |
| 481 | 3300025944 | Ga0207661_10034334 | Ga0207661_100343344 | 98 |
| 482 | 3300025944 | Ga0207661_10115633 | Ga0207661_101156332 | 98 |
| 483 | 3300025944 | Ga0207661_10270540 | Ga0207661_102705402 | 98 |
| 484 | 3300025944 | Ga0207661_10316294 | Ga0207661_103162941 | 98 |
| 485 | 3300025944 | Ga0207661_10804851 | Ga0207661_108048512 | 98 |
| 486 | 3300025944 | Ga0207661_10956352 | Ga0207661_109563522 | 98 |
| 487 | 3300025945 | Ga0207679_10018603 | Ga0207679_100186032 | 98 |
| 488 | 3300025945 | Ga0207679_10146618 | Ga0207679_101466182 | 98 |
| 489 | 3300025945 | Ga0207679_10762433 | Ga0207679_107624332 | 98 |
| 490 | 3300025960 | Ga0207651_12059937 | Ga0207651_120599371 | 98 |
| 491 | 3300025961 | Ga0207712_10031248 | Ga0207712_100312483 | 98 |
| 492 | 3300025961 | Ga0207712_10065405 | Ga0207712_100654054 | 98 |
| 493 | 3300025961 | Ga0207712_10486107 | Ga0207712_104861072 | 98 |
| 494 | 3300025972 | Ga0207668_10007215 | Ga0207668_100072153 | 98 |
| 495 | 3300025972 | Ga0207668_10124714 | Ga0207668_101247142 | 98 |
| 496 | 3300025972 | Ga0207668_10155590 | Ga0207668_101555902 | 98 |
| 497 | 3300025981 | Ga0207640_10926036 | Ga0207640_109260362 | 98 |
| 498 | 3300025986 | Ga0207658_10020950 | Ga0207658_100209501 | 98 |
| 499 | 3300025986 | Ga0207658_11444016 | Ga0207658_114440162 | 98 |
| 500 | 3300025986 | Ga0207658_11971881 | Ga0207658_119718812 | 98 |
| 501 | 3300026023 | Ga0207677_10020052 | Ga0207677_100200526 | 98 |
| 502 | 3300026035 | Ga0207703_10020759 | Ga0207703_100207595 | 98 |
| 503 | 3300026035 | Ga0207703_10161344 | Ga0207703_101613442 | 98 |
| 504 | 3300026035 | Ga0207703_11762263 | Ga0207703_117622632 | 98 |
| 505 | 3300026035 | Ga0207703_11932930 | Ga0207703_119329302 | 98 |
| 506 | 3300026041 | Ga0207639_10111178 | Ga0207639_101111783 | 98 |
| 507 | 3300026067 | Ga0207678_10033052 | Ga0207678_100330522 | 98 |
| 508 | 3300026067 | Ga0207678_10116710 | Ga0207678_101167103 | 98 |
| 509 | 3300026075 | Ga0207708_10262170 | Ga0207708_102621702 | 98 |
| 510 | 3300026075 | Ga0207708_11557173 | Ga0207708_115571731 | 98 |
| 511 | 3300026078 | Ga0207702_10309229 | Ga0207702_103092292 | 98 |
| 512 | 3300026078 | Ga0207702_10627982 | Ga0207702_106279822 | 98 |
| 513 | 3300026088 | Ga0207641_10164231 | Ga0207641_101642311 | 98 |
| 514 | 3300026095 | Ga0207676_10411439 | Ga0207676_104114391 | 98 |
| 515 | 3300026095 | Ga0207676_10556710 | Ga0207676_105567102 | 98 |
| 516 | 3300026118 | Ga0207675_100237546 | Ga0207675_1002375463 | 98 |
| 517 | 3300026118 | Ga0207675_101167344 | Ga0207675_1011673442 | 98 |
| 518 | 3300026118 | Ga0207675_101848717 | Ga0207675_1018487171 | 98 |
| 519 | 3300026121 | Ga0207683_10088748 | Ga0207683_100887482 | 98 |
| 520 | 3300027617 | Ga0210002_1108051 | Ga0210002_11080511 | 98 |
| 521 | 3300027717 | Ga0209998_10059150 | Ga0209998_100591502 | 98 |
| 522 | 3300027876 | Ga0209974_10219800 | Ga0209974_102198002 | 98 |
| 523 | 3300027907 | Ga0207428_10040322 | Ga0207428_100403222 | 98 |
| 524 | 3300027907 | Ga0207428_10184683 | Ga0207428_101846831 | 98 |
| 525 | 3300028379 | Ga0268266_10204709 | Ga0268266_102047091 | 98 |
| 526 | 3300028379 | Ga0268266_11204648 | Ga0268266_112046481 | 98 |
| 527 | 3300028379 | Ga0268266_11283747 | Ga0268266_112837472 | 98 |
| 528 | 3300028379 | Ga0268266_11556726 | Ga0268266_115567262 | 98 |
| 529 | 3300028380 | Ga0268265_10019225 | Ga0268265_100192255 | 98 |
| 530 | 3300028381 | Ga0268264_10042385 | Ga0268264_100423855 | 98 |
| 531 | 3300028381 | Ga0268264_10049735 | Ga0268264_100497353 | 98 |
| 532 | 3300028381 | Ga0268264_12660968 | Ga0268264_126609681 | 98 |
| 533 | 3300028558 | Ga0265326_10082652 | Ga0265326_100826522 | 98 |
| 534 | 3300028653 | Ga0265323_10040665 | Ga0265323_100406652 | 98 |
| 535 | 3300031251 | Ga0265327_10063801 | Ga0265327_100638012 | 98 |
| 536 | 3300031548 | Ga0307408_100040831 | Ga0307408_1000408312 | 98 |
| 537 | 3300031548 | Ga0307408_100139665 | Ga0307408_1001396652 | 98 |
| 538 | 3300031548 | Ga0307408_101391132 | Ga0307408_1013911322 | 98 |
| 539 | 3300031691 | Ga0316579_10502126 | Ga0316579_105021262 | 98 |
| 540 | 3300031711 | Ga0265314_10128452 | Ga0265314_101284522 | 98 |
| 541 | 3300031712 | Ga0265342_10027518 | Ga0265342_100275183 | 98 |
| 542 | 3300031727 | Ga0316576_10825821 | Ga0316576_108258211 | 98 |
| 543 | 3300031728 | Ga0316578_10255383 | Ga0316578_102553832 | 98 |
| 544 | 3300031731 | Ga0307405_10293073 | Ga0307405_102930733 | 98 |
| 545 | 3300031731 | Ga0307405_10444504 | Ga0307405_104445042 | 98 |
| 546 | 3300031731 | Ga0307405_10496314 | Ga0307405_104963141 | 98 |
| 547 | 3300031731 | Ga0307405_10930105 | Ga0307405_109301051 | 98 |
| 548 | 3300031733 | Ga0316577_10835322 | Ga0316577_108353222 | 98 |
| 549 | 3300031824 | Ga0307413_10035530 | Ga0307413_100355305 | 98 |
| 550 | 3300031852 | Ga0307410_10068439 | Ga0307410_100684392 | 98 |
| 551 | 3300031852 | Ga0307410_10237853 | Ga0307410_102378532 | 98 |
| 552 | 3300031852 | Ga0307410_10516420 | Ga0307410_105164203 | 98 |
| 553 | 3300031852 | Ga0307410_10852106 | Ga0307410_108521062 | 98 |
| 554 | 3300031901 | Ga0307406_10345085 | Ga0307406_103450852 | 98 |
| 555 | 3300031901 | Ga0307406_10401696 | Ga0307406_104016962 | 98 |
| 556 | 3300031903 | Ga0307407_10305365 | Ga0307407_103053652 | 98 |
| 557 | 3300031911 | Ga0307412_10293265 | Ga0307412_102932652 | 98 |
| 558 | 3300031995 | Ga0307409_100034733 | Ga0307409_1000347336 | 98 |
| 559 | 3300031995 | Ga0307409_100198618 | Ga0307409_1001986182 | 98 |
| 560 | 3300031995 | Ga0307409_100385465 | Ga0307409_1003854652 | 98 |
| 561 | 3300031995 | Ga0307409_102540235 | Ga0307409_1025402352 | 98 |
| 562 | 3300032002 | Ga0307416_100037330 | Ga0307416_1000373307 | 98 |
| 563 | 3300032002 | Ga0307416_100234993 | Ga0307416_1002349932 | 98 |
| 564 | 3300032002 | Ga0307416_101418723 | Ga0307416_1014187231 | 98 |
| 565 | 3300032004 | Ga0307414_10088334 | Ga0307414_100883343 | 98 |
| 566 | 3300032004 | Ga0307414_10101533 | Ga0307414_101015332 | 98 |
| 567 | 3300032005 | Ga0307411_10010437 | Ga0307411_100104377 | 98 |
| 568 | 3300032005 | Ga0307411_10110875 | Ga0307411_101108751 | 98 |
| 569 | 3300032005 | Ga0307411_10133724 | Ga0307411_101337242 | 98 |
| 570 | 3300032126 | Ga0307415_100282685 | Ga0307415_1002826851 | 98 |
| 571 | 3300032126 | Ga0307415_100379256 | Ga0307415_1003792562 | 98 |
| 572 | 3300032126 | Ga0307415_101122121 | Ga0307415_1011221212 | 98 |
| 573 | 3300032168 | Ga0316593_10170347 | Ga0316593_101703471 | 98 |
| 574 | 3300034957 | Ga0373938_0042998 | Ga0373938_0042998_657_953 | 98 |
| 575 | 3300035086 | Ga0373934_0243286 | Ga0373934_0243286_140_436 | 98 |
| 576 | 3300035086 | Ga0373934_0286019 | Ga0373934_0286019_230_526 | 98 |
| 577 | 3300035086 | Ga0373934_0489000 | Ga0373934_0489000_147_443 | 98 |
| 578 | 3300035088 | Ga0373940_0059650 | Ga0373940_0059650_476_772 | 98 |
| 579 | 3300035111 | Ga0373923_0126601 | Ga0373923_0126601_474_770 | 98 |
| 580 | 3300035111 | Ga0373923_0201467 | Ga0373923_0201467_520_816 | 98 |
| 581 | 3300035112 | Ga0373932_0084953 | Ga0373932_0084953_695_991 | 98 |
| 582 | 3300035112 | Ga0373932_0121943 | Ga0373932_0121943_415_711 | 98 |
| 583 | 3300035112 | Ga0373932_0227489 | Ga0373932_0227489_40_336 | 98 |
| 584 | 3300035113 | Ga0373936_0498815 | Ga0373936_0498815_128_424 | 98 |
| 585 | 3300035114 | Ga0373939_0215436 | Ga0373939_0215436_19_315 | 98 |
| 586 | 3300035114 | Ga0373939_0292483 | Ga0373939_0292483_212_508 | 98 |
| 587 | 3300035115 | Ga0373941_0115567 | Ga0373941_0115567_210_506 | 98 |
| 588 | 3300035117 | Ga0373953_0148355 | Ga0373953_0148355_208_504 | 98 |
| 589 | 3300035117 | Ga0373953_0196340 | Ga0373953_0196340_541_837 | 98 |
| 590 | 3300035118 | Ga0373954_0208374 | Ga0373954_0208374_277_573 | 98 |
| 591 | 3300035119 | Ga0373956_0124709 | Ga0373956_0124709_325_621 | 98 |
| 592 | 3300035119 | Ga0373956_0259708 | Ga0373956_0259708_267_563 | 98 |
| 593 | 3300035120 | Ga0373957_0029426 | Ga0373957_0029426_1255_1551 | 98 |
| 594 | 3300035120 | Ga0373957_0204186 | Ga0373957_0204186_381_677 | 98 |
| 595 | 3300035170 | Ga0373943_0122325 | Ga0373943_0122325_890_1186 | 98 |
| 596 | 3300035172 | Ga0373955_0169424 | Ga0373955_0169424_286_582 | 98 |
| 597 | 3300035172 | Ga0373955_0349175 | Ga0373955_0349175_75_371 | 98 |
| 598 | 3300035172 | Ga0373955_0648238 | Ga0373955_0648238_215_511 | 98 |
| 599 | 3300035207 | Ga0373942_0025484 | Ga0373942_0025484_262_558 | 98 |
| 600 | 3300035241 | Ga0373961_0301746 | Ga0373961_0301746_146_442 | 98 |
| 601 | 3300035242 | Ga0373962_0073255 | Ga0373962_0073255_198_494 | 98 |
| 602 | 3300035398 | Ga0316574_0766334 | Ga0316574_0766334_81_377 | 98 |
| 603 | 3300035692 | Ga0373935_0229708 | Ga0373935_0229708_444_740 | 98 |
| 604 | 3300035695 | Ga0373927_0002811 | Ga0373927_0002811_8917_9213 | 98 |
| 605 | 3300035695 | Ga0373927_0184193 | Ga0373927_0184193_953_1249 | 98 |
| 606 | 3300035695 | Ga0373927_0301055 | Ga0373927_0301055_19_315 | 98 |
| 607 | 3300035695 | Ga0373927_0887304 | Ga0373927_0887304_39_335 | 98 |
| 608 | 3300035724 | Ga0373933_0106704 | Ga0373933_0106704_1065_1361 | 98 |
| 609 | 3300035724 | Ga0373933_0938569 | Ga0373933_0938569_245_541 | 98 |
| 610 | 3300035725 | Ga0373947_0258016 | Ga0373947_0258016_714_1010 | 98 |
| 611 | 3300035725 | Ga0373947_0993968 | Ga0373947_0993968_97_393 | 98 |
| 612 | 3300035725 | Ga0373947_1157194 | Ga0373947_1157194_29_385 | 98 |
| 613 | 3300036401 | Ga0373937_0103062 | Ga0373937_0103062_694_990 | 98 |
| 614 | 3300036401 | Ga0373937_0126691 | Ga0373937_0126691_323_619 | 98 |
| 615 | 3300036401 | Ga0373937_0179190 | Ga0373937_0179190_1535_1831 | 98 |
| 616 | 3300036401 | Ga0373937_0384119 | Ga0373937_0384119_104_400 | 98 |
| 617 | 3300036401 | Ga0373937_0877594 | Ga0373937_0877594_68_367 | 98 |
| 618 | 3300036647 | Ga0316582_0012184 | Ga0316582_0012184_2414_2710 | 98 |
| 619 | 3300036712 | Ga0316584_0017857 | Ga0316584_0017857_669_965 | 98 |
| 620 | 3300036712 | Ga0316584_0267267 | Ga0316584_0267267_114_428 | 98 |
| 621 | 3300037068 | Ga0373925_0100046 | Ga0373925_0100046_1417_1713 | 98 |
| 622 | 3300037418 | Ga0395900_0101330 | Ga0395900_0101330_493_789 | 98 |
| 623 | 3300037418 | Ga0395900_0814081 | Ga0395900_0814081_401_697 | 98 |
| 624 | 3300037418 | Ga0395900_1073238 | Ga0395900_1073238_299_595 | 98 |
| 625 | 3300037466 | Ga0395898_0462286 | Ga0395898_0462286_44_340 | 98 |
| 626 | 3300037471 | Ga0395905_0560245 | Ga0395905_0560245_268_564 | 98 |
| 627 | 3300037853 | Ga0436364_1092155 | Ga0436364_1092155_352_648 | 98 |
| 628 | 3300037853 | Ga0436364_1460655 | Ga0436364_1460655_258_554 | 98 |
| 629 | 3300038443 | Ga0395901_0532730 | Ga0395901_0532730_674_970 | 98 |
| 630 | 3300039437 | Ga0436365_0224016 | Ga0436365_0224016_198_494 | 98 |
| 631 | 3300039437 | Ga0436365_1476328 | Ga0436365_1476328_7448_7744 | 98 |
| 632 | 3300039447 | Ga0436361_0786779 | Ga0436361_0786779_128474_128770 | 98 |
| 633 | 3300039453 | Ga0436362_0793938 | Ga0436362_0793938_676_972 | 98 |
| 634 | 3300041505 | Ga0451849_1440942 | Ga0451849_1440942_489_785 | 98 |
| 635 | 3300041507 | Ga0451851_0871010 | Ga0451851_0871010_483_779 | 98 |
| 636 | 3300041512 | Ga0451853_2446995 | Ga0451853_2446995_456_752 | 98 |
| 637 | 3300042005 | Ga0439448_0055755 | Ga0439448_0055755_871_1167 | 98 |
| 638 | 3300042009 | Ga0439451_049454 | Ga0439451_049454_320_616 | 98 |
| 639 | 3300042157 | Ga0439458_0007203 | Ga0439458_0007203_792_1088 | 98 |
| 640 | 3300042436 | Ga0439435_0156769 | Ga0439435_0156769_85_384 | 98 |
| 641 | 3300042439 | Ga0439464_0017396 | Ga0439464_0017396_513_821 | 98 |
| 642 | 3300042461 | Ga0439460_0015422 | Ga0439460_0015422_223_519 | 98 |
| 643 | 3300042461 | Ga0439460_0240051 | Ga0439460_0240051_281_589 | 98 |
| 644 | 3300042876 | Ga0451577_0042049 | Ga0451577_0042049_2660_2956 | 98 |
| 645 | 3300042876 | Ga0451577_0692071 | Ga0451577_0692071_610_906 | 98 |
| 646 | 3300042876 | Ga0451577_0841633 | Ga0451577_0841633_58_354 | 98 |
| 647 | 3300042876 | Ga0451577_0876750 | Ga0451577_0876750_156_452 | 98 |
| 648 | 3300042876 | Ga0451577_1817317 | Ga0451577_1817317_145_444 | 98 |
| 649 | 3300044673 | Ga0453683_0002195 | Ga0453683_0002195_9912_10208 | 98 |
| 650 | 3300044673 | Ga0453683_0135726 | Ga0453683_0135726_981_1277 | 98 |
| 651 | 3300044684 | Ga0466966_0008342 | Ga0466966_0008342_204_503 | 98 |
| 652 | 3300044694 | Ga0466963_0868561 | Ga0466963_0868561_162_458 | 98 |
| 653 | 3300044706 | Ga0466964_0334482 | Ga0466964_0334482_206_502 | 98 |
| 654 | 3300044712 | Ga0453684_0056727 | Ga0453684_0056727_2801_3097 | 98 |
| 655 | 3300044712 | Ga0453684_0170452 | Ga0453684_0170452_1925_2221 | 98 |
| 656 | 3300044712 | Ga0453684_0277627 | Ga0453684_0277627_1032_1328 | 98 |
| 657 | 3300044712 | Ga0453684_0485039 | Ga0453684_0485039_914_1210 | 98 |
| 658 | 3300044712 | Ga0453684_0574587 | Ga0453684_0574587_815_1111 | 98 |
| 659 | 3300044712 | Ga0453684_1147918 | Ga0453684_1147918_223_519 | 98 |
| 660 | 3300045049 | Ga0466959_0293038 | Ga0466959_0293038_143_442 | 98 |
| 661 | 3300045051 | Ga0451576_0413151 | Ga0451576_0413151_693_989 | 98 |
| 662 | 3300045051 | Ga0451576_2183154 | Ga0451576_2183154_132_428 | 98 |
| 663 | 3300045051 | Ga0451576_2523353 | Ga0451576_2523353_77_373 | 98 |
| 664 | 3300045976 | Ga0466967_0105899 | Ga0466967_0105899_2230_2526 | 98 |
| 665 | 3300045976 | Ga0466967_0845278 | Ga0466967_0845278_271_567 | 98 |
| 666 | 3300046454 | Ga0495592_0020273 | Ga0495592_0020273_2198_2494 | 98 |
| 667 | 3300046455 | Ga0495603_0049371 | Ga0495603_0049371_706_1002 | 98 |
| 668 | 3300046455 | Ga0495603_0156048 | Ga0495603_0156048_740_1036 | 98 |
| 669 | 3300046459 | Ga0495629_0001099 | Ga0495629_0001099_12720_13016 | 98 |
| 670 | 3300046459 | Ga0495629_0084139 | Ga0495629_0084139_1880_2176 | 98 |
| 671 | 3300046459 | Ga0495629_0254391 | Ga0495629_0254391_334_630 | 98 |
| 672 | 3300046461 | Ga0495641_0035385 | Ga0495641_0035385_505_801 | 98 |
| 673 | 3300046461 | Ga0495641_0060507 | Ga0495641_0060507_646_942 | 98 |
| 674 | 3300046462 | Ga0495651_0290267 | Ga0495651_0290267_721_1017 | 98 |
| 675 | 3300046462 | Ga0495651_0498431 | Ga0495651_0498431_277_573 | 98 |
| 676 | 3300046463 | Ga0495653_0086911 | Ga0495653_0086911_1562_1858 | 98 |
| 677 | 3300046463 | Ga0495653_0654885 | Ga0495653_0654885_291_587 | 98 |
| 678 | 3300046463 | Ga0495653_0759320 | Ga0495653_0759320_260_556 | 98 |
| 679 | 3300046463 | Ga0495653_0828994 | Ga0495653_0828994_28_324 | 98 |
| 680 | 3300046472 | Ga0495580_0178155 | Ga0495580_0178155_565_861 | 98 |
| 681 | 3300046472 | Ga0495580_1015991 | Ga0495580_1015991_148_444 | 98 |
| 682 | 3300046473 | Ga0495582_0011615 | Ga0495582_0011615_2465_2761 | 98 |
| 683 | 3300046473 | Ga0495582_0053264 | Ga0495582_0053264_1649_1945 | 98 |
| 684 | 3300046473 | Ga0495582_0538493 | Ga0495582_0538493_19_315 | 98 |
| 685 | 3300046475 | Ga0495639_0047642 | Ga0495639_0047642_795_1091 | 98 |
| 686 | 3300046475 | Ga0495639_0517273 | Ga0495639_0517273_216_512 | 98 |
| 687 | 3300046475 | Ga0495639_0533918 | Ga0495639_0533918_239_535 | 98 |
| 688 | 3300046475 | Ga0495639_0630901 | Ga0495639_0630901_199_495 | 98 |
| 689 | 3300046476 | Ga0495662_0171116 | Ga0495662_0171116_424_720 | 98 |
| 690 | 3300046476 | Ga0495662_0331137 | Ga0495662_0331137_285_581 | 98 |
| 691 | 3300046476 | Ga0495662_0678010 | Ga0495662_0678010_18_314 | 98 |
| 692 | 3300046477 | Ga0495664_0024014 | Ga0495664_0024014_1059_1355 | 98 |
| 693 | 3300046477 | Ga0495664_0534803 | Ga0495664_0534803_101_397 | 98 |
| 694 | 3300046492 | Ga0495585_0572150 | Ga0495585_0572150_13_309 | 98 |
| 695 | 3300046499 | Ga0495594_0006555 | Ga0495594_0006555_1015_1311 | 98 |
| 696 | 3300046499 | Ga0495594_0008374 | Ga0495594_0008374_2675_2971 | 98 |
| 697 | 3300046501 | Ga0495607_0451831 | Ga0495607_0451831_85_381 | 98 |
| 698 | 3300046511 | Ga0495608_0162766 | Ga0495608_0162766_122_418 | 98 |
| 699 | 3300046511 | Ga0495608_0342425 | Ga0495608_0342425_73_369 | 98 |
| 700 | 3300046514 | Ga0495618_0015458 | Ga0495618_0015458_2867_3163 | 98 |
| 701 | 3300046514 | Ga0495618_0214412 | Ga0495618_0214412_661_957 | 98 |
| 702 | 3300046516 | Ga0495628_0044764 | Ga0495628_0044764_3021_3317 | 98 |
| 703 | 3300046516 | Ga0495628_0490409 | Ga0495628_0490409_496_792 | 98 |
| 704 | 3300046517 | Ga0495630_0024804 | Ga0495630_0024804_2756_3052 | 98 |
| 705 | 3300046517 | Ga0495630_0040314 | Ga0495630_0040314_609_905 | 98 |
| 706 | 3300046517 | Ga0495630_0316882 | Ga0495630_0316882_581_877 | 98 |
| 707 | 3300046517 | Ga0495630_0390217 | Ga0495630_0390217_327_623 | 98 |
| 708 | 3300046520 | Ga0495637_0184711 | Ga0495637_0184711_173_469 | 98 |
| 709 | 3300046523 | Ga0495644_0342905 | Ga0495644_0342905_180_476 | 98 |
| 710 | 3300046526 | Ga0495666_0035153 | Ga0495666_0035153_1478_1774 | 98 |
| 711 | 3300046526 | Ga0495666_0241262 | Ga0495666_0241262_216_512 | 98 |
| 712 | 3300046529 | Ga0495652_0060309 | Ga0495652_0060309_890_1186 | 98 |
| 713 | 3300046529 | Ga0495652_0255004 | Ga0495652_0255004_315_611 | 98 |
| 714 | 3300046531 | Ga0495665_0634456 | Ga0495665_0634456_143_439 | 98 |
| 715 | 3300046533 | Ga0495640_0057781 | Ga0495640_0057781_1684_1980 | 98 |
| 716 | 3300046533 | Ga0495640_0062753 | Ga0495640_0062753_1575_1871 | 98 |
| 717 | 3300046533 | Ga0495640_0941790 | Ga0495640_0941790_66_362 | 98 |
| 718 | 3300046535 | Ga0495586_0044188 | Ga0495586_0044188_1945_2241 | 98 |
| 719 | 3300046535 | Ga0495586_0059714 | Ga0495586_0059714_181_477 | 98 |
| 720 | 3300046535 | Ga0495586_0087441 | Ga0495586_0087441_64_360 | 98 |
| 721 | 3300046535 | Ga0495586_0383120 | Ga0495586_0383120_241_537 | 98 |
| 722 | 3300046535 | Ga0495586_0931272 | Ga0495586_0931272_150_452 | 98 |
| 723 | 3300046536 | Ga0495587_0048084 | Ga0495587_0048084_838_1134 | 98 |
| 724 | 3300046536 | Ga0495587_0469760 | Ga0495587_0469760_318_614 | 98 |
| 725 | 3300046536 | Ga0495587_0526367 | Ga0495587_0526367_22_318 | 98 |
| 726 | 3300046543 | Ga0495645_0003220 | Ga0495645_0003220_9263_9559 | 98 |
| 727 | 3300046543 | Ga0495645_0077919 | Ga0495645_0077919_1716_2012 | 98 |
| 728 | 3300046543 | Ga0495645_0229600 | Ga0495645_0229600_207_509 | 98 |
| 729 | 3300046543 | Ga0495645_0440512 | Ga0495645_0440512_197_493 | 98 |
| 730 | 3300046559 | Ga0495667_0482072 | Ga0495667_0482072_195_491 | 98 |
| 731 | 3300046642 | Ga0495634_0080075 | Ga0495634_0080075_251_547 | 98 |
| 732 | 3300046642 | Ga0495634_0149284 | Ga0495634_0149284_712_1008 | 98 |
| 733 | 3300046648 | Ga0495611_0198955 | Ga0495611_0198955_439_735 | 98 |
| 734 | 3300046663 | Ga0495635_0005233 | Ga0495635_0005233_4243_4539 | 98 |
| 735 | 3300046663 | Ga0495635_0403481 | Ga0495635_0403481_198_494 | 98 |
| 736 | 3300046663 | Ga0495635_0947418 | Ga0495635_0947418_30_326 | 98 |
| 737 | 3300046675 | Ga0495657_0188742 | Ga0495657_0188742_833_1129 | 98 |
| 738 | 3300046675 | Ga0495657_0834615 | Ga0495657_0834615_166_468 | 98 |
| 739 | 3300046678 | Ga0495599_0006509 | Ga0495599_0006509_4808_5104 | 98 |
| 740 | 3300046679 | Ga0495623_0009108 | Ga0495623_0009108_4865_5161 | 98 |
| 741 | 3300046679 | Ga0495623_0719139 | Ga0495623_0719139_49_345 | 98 |
| 742 | 3300046680 | Ga0495646_0108517 | Ga0495646_0108517_1205_1501 | 98 |
| 743 | 3300046681 | Ga0495647_0016331 | Ga0495647_0016331_1362_1658 | 98 |
| 744 | 3300046681 | Ga0495647_0060970 | Ga0495647_0060970_661_957 | 98 |
| 745 | 3300046683 | Ga0495658_0002224 | Ga0495658_0002224_4794_5090 | 98 |
| 746 | 3300046683 | Ga0495658_0047774 | Ga0495658_0047774_369_665 | 98 |
| 747 | 3300046683 | Ga0495658_0123254 | Ga0495658_0123254_814_1116 | 98 |
| 748 | 3300046683 | Ga0495658_0273510 | Ga0495658_0273510_495_791 | 98 |
| 749 | 3300046683 | Ga0495658_0480102 | Ga0495658_0480102_280_576 | 98 |
| 750 | 3300046684 | Ga0495669_0413907 | Ga0495669_0413907_82_378 | 98 |
| 751 | 3300046689 | Ga0495613_0002740 | Ga0495613_0002740_3300_3596 | 98 |
| 752 | 3300046689 | Ga0495613_0028292 | Ga0495613_0028292_1458_1754 | 98 |
| 753 | 3300046689 | Ga0495613_0072994 | Ga0495613_0072994_2144_2440 | 98 |
| 754 | 3300046690 | Ga0495624_0313102 | Ga0495624_0313102_398_694 | 98 |
| 755 | 3300046809 | Ga0495600_0193625 | Ga0495600_0193625_922_1218 | 98 |
| 756 | 3300047315 | Ga0495581_0004247 | Ga0495581_0004247_2117_2413 | 98 |
| 757 | 3300047315 | Ga0495581_0222804 | Ga0495581_0222804_226_522 | 98 |
| 758 | 3300047315 | Ga0495581_0312131 | Ga0495581_0312131_226_522 | 98 |
| 759 | 3300047315 | Ga0495581_0618525 | Ga0495581_0618525_302_598 | 98 |
| 760 | 3300047317 | Ga0495604_0324751 | Ga0495604_0324751_117_413 | 98 |
| 761 | 3300047319 | Ga0495674_0062901 | Ga0495674_0062901_2811_3107 | 98 |
| 762 | 3300047319 | Ga0495674_0802101 | Ga0495674_0802101_328_624 | 98 |
| 763 | 3300047319 | Ga0495674_0927350 | Ga0495674_0927350_69_365 | 98 |
| 764 | 3300047321 | Ga0495676_0259471 | Ga0495676_0259471_663_959 | 98 |
| 765 | 3300047321 | Ga0495676_0290060 | Ga0495676_0290060_786_1082 | 98 |
| 766 | 3300047322 | Ga0495680_0001823 | Ga0495680_0001823_13805_14101 | 98 |
| 767 | 3300047322 | Ga0495680_0602878 | Ga0495680_0602878_242_538 | 98 |
| 768 | 3300047444 | Ga0495675_0046827 | Ga0495675_0046827_1036_1332 | 98 |
| 769 | 3300047471 | Ga0495684_0091335 | Ga0495684_0091335_224_520 | 98 |
| 770 | 3300047471 | Ga0495684_0132989 | Ga0495684_0132989_151_447 | 98 |
| 771 | 3300047471 | Ga0495684_0832316 | Ga0495684_0832316_95_391 | 98 |
| 772 | 3300047673 | Ga0495593_0107907 | Ga0495593_0107907_651_947 | 98 |
| 773 | 3300048088 | Ga0495602_0049168 | Ga0495602_0049168_2751_3047 | 98 |
| 774 | 3300048088 | Ga0495602_0714855 | Ga0495602_0714855_222_518 | 98 |
| 775 | 3300048089 | Ga0495614_0004515 | Ga0495614_0004515_5437_5733 | 98 |
| 776 | 3300048903 | Ga0496100_0036655 | Ga0496100_0036655_1811_2107 | 98 |
| 777 | 3300048903 | Ga0496100_0210224 | Ga0496100_0210224_1036_1332 | 98 |
| 778 | 3300048904 | Ga0496101_0407012 | Ga0496101_0407012_424_720 | 98 |
| 779 | 3300048904 | Ga0496101_0743474 | Ga0496101_0743474_375_671 | 98 |
| 780 | 3300048905 | Ga0496102_0152597 | Ga0496102_0152597_1715_2011 | 98 |
| 781 | 3300048905 | Ga0496102_0162326 | Ga0496102_0162326_1374_1670 | 98 |
| 782 | 3300048905 | Ga0496102_0702019 | Ga0496102_0702019_394_690 | 98 |
| 783 | 3300048906 | Ga0496103_0070109 | Ga0496103_0070109_1857_2153 | 98 |
| 784 | 3300048906 | Ga0496103_0209653 | Ga0496103_0209653_207_503 | 98 |
| 785 | 3300048907 | Ga0496104_0084018 | Ga0496104_0084018_2002_2298 | 98 |
| 786 | 3300048907 | Ga0496104_0141876 | Ga0496104_0141876_1158_1454 | 98 |
| 787 | 3300048907 | Ga0496104_0340856 | Ga0496104_0340856_781_1077 | 98 |
| 788 | 3300048908 | Ga0496105_0071581 | Ga0496105_0071581_603_899 | 98 |
| 789 | 3300048908 | Ga0496105_0489254 | Ga0496105_0489254_201_497 | 98 |
| 790 | 3300048909 | Ga0496106_0027205 | Ga0496106_0027205_1820_2116 | 98 |
| 791 | 3300048909 | Ga0496106_0156683 | Ga0496106_0156683_970_1266 | 98 |
| 792 | 3300048910 | Ga0496107_0324934 | Ga0496107_0324934_232_528 | 98 |
| 793 | 3300048911 | Ga0496108_0006877 | Ga0496108_0006877_2585_2881 | 98 |
| 794 | 3300048912 | Ga0496109_0005698 | Ga0496109_0005698_6331_6627 | 98 |
| 795 | 3300048912 | Ga0496109_0864380 | Ga0496109_0864380_373_669 | 98 |
| 796 | 3300048912 | Ga0496109_1166504 | Ga0496109_1166504_60_356 | 98 |
| 797 | 3300048913 | Ga0496110_0054349 | Ga0496110_0054349_1982_2278 | 98 |
| 798 | 3300048914 | Ga0496111_0064511 | Ga0496111_0064511_2036_2332 | 98 |
| 799 | 3300048914 | Ga0496111_0320652 | Ga0496111_0320652_53_349 | 98 |
| 800 | 3300048915 | Ga0496112_0047502 | Ga0496112_0047502_1681_1977 | 98 |
| 801 | 3300048915 | Ga0496112_0095053 | Ga0496112_0095053_1271_1567 | 98 |
| 802 | 3300048915 | Ga0496112_0101887 | Ga0496112_0101887_781_1077 | 98 |
| 803 | 3300048915 | Ga0496112_0129670 | Ga0496112_0129670_1315_1611 | 98 |
| 804 | 3300048915 | Ga0496112_0613018 | Ga0496112_0613018_226_522 | 98 |
| 805 | 3300048915 | Ga0496112_1434622 | Ga0496112_1434622_213_509 | 98 |
| 806 | 3300048916 | Ga0496113_0014627 | Ga0496113_0014627_2250_2546 | 98 |
| 807 | 3300048917 | Ga0496114_0099938 | Ga0496114_0099938_811_1113 | 98 |
| 808 | 3300048918 | Ga0496115_0014127 | Ga0496115_0014127_3746_4042 | 98 |
| 809 | 3300048918 | Ga0496115_0046704 | Ga0496115_0046704_2613_2909 | 98 |
| 810 | 3300048918 | Ga0496115_0155585 | Ga0496115_0155585_594_890 | 98 |
| 811 | 3300048918 | Ga0496115_0592420 | Ga0496115_0592420_206_502 | 98 |
| 812 | 3300049514 | Ga0501291_024184 | Ga0501291_024184_551_859 | 98 |
| 813 | 3300049520 | Ga0501297_056380 | Ga0501297_056380_26_322 | 98 |
| 814 | 3300049521 | Ga0501298_131132 | Ga0501298_131132_145_441 | 98 |
| 815 | 3300049568 | Ga0501031_0018229 | Ga0501031_0018229_1014_1313 | 98 |
| 816 | 3300049568 | Ga0501031_0167702 | Ga0501031_0167702_944_1240 | 98 |
| 817 | 3300049568 | Ga0501031_0248802 | Ga0501031_0248802_540_836 | 98 |
| 818 | 3300049568 | Ga0501031_0539712 | Ga0501031_0539712_151_450 | 98 |
| 819 | 3300049569 | Ga0501032_0003383 | Ga0501032_0003383_7526_7825 | 98 |
| 820 | 3300049569 | Ga0501032_0167591 | Ga0501032_0167591_206_502 | 98 |
| 821 | 3300049569 | Ga0501032_0239273 | Ga0501032_0239273_655_954 | 98 |
| 822 | 3300049570 | Ga0501033_0006909 | Ga0501033_0006909_5624_5923 | 98 |
| 823 | 3300049570 | Ga0501033_0007700 | Ga0501033_0007700_1669_1968 | 98 |
| 824 | 3300049570 | Ga0501033_0085701 | Ga0501033_0085701_1285_1581 | 98 |
| 825 | 3300049571 | Ga0501034_0027970 | Ga0501034_0027970_2929_3228 | 98 |
| 826 | 3300049571 | Ga0501034_0594484 | Ga0501034_0594484_507_806 | 98 |
| 827 | 3300049572 | Ga0501036_0011871 | Ga0501036_0011871_3992_4291 | 98 |
| 828 | 3300049572 | Ga0501036_0030043 | Ga0501036_0030043_1314_1610 | 98 |
| 829 | 3300049572 | Ga0501036_0037388 | Ga0501036_0037388_133_432 | 98 |
| 830 | 3300049572 | Ga0501036_0376816 | Ga0501036_0376816_771_1067 | 98 |
| 831 | 3300049572 | Ga0501036_0566641 | Ga0501036_0566641_435_731 | 98 |
| 832 | 3300049573 | Ga0501037_0002059 | Ga0501037_0002059_933_1232 | 98 |
| 833 | 3300049573 | Ga0501037_0003998 | Ga0501037_0003998_5983_6282 | 98 |
| 834 | 3300049574 | Ga0501038_0002739 | Ga0501038_0002739_3676_3975 | 98 |
| 835 | 3300049574 | Ga0501038_0004476 | Ga0501038_0004476_8908_9207 | 98 |
| 836 | 3300049574 | Ga0501038_0022090 | Ga0501038_0022090_1310_1606 | 98 |
| 837 | 3300049574 | Ga0501038_0488687 | Ga0501038_0488687_613_909 | 98 |
| 838 | 3300049575 | Ga0501039_0008614 | Ga0501039_0008614_102_401 | 98 |
| 839 | 3300049575 | Ga0501039_0044377 | Ga0501039_0044377_1868_2164 | 98 |
| 840 | 3300049576 | Ga0501040_0001593 | Ga0501040_0001593_10700_10996 | 98 |
| 841 | 3300049576 | Ga0501040_0152070 | Ga0501040_0152070_529_825 | 98 |
| 842 | 3300049576 | Ga0501040_0517971 | Ga0501040_0517971_552_848 | 98 |
| 843 | 3300049576 | Ga0501040_0654286 | Ga0501040_0654286_209_505 | 98 |
| 844 | 3300049576 | Ga0501040_1123033 | Ga0501040_1123033_231_533 | 98 |
| 845 | 3300049577 | Ga0501041_0003041 | Ga0501041_0003041_8031_8327 | 98 |
| 846 | 3300049577 | Ga0501041_0085880 | Ga0501041_0085880_676_972 | 98 |
| 847 | 3300049578 | Ga0501042_0012537 | Ga0501042_0012537_1354_1650 | 98 |
| 848 | 3300049578 | Ga0501042_0021094 | Ga0501042_0021094_1854_2153 | 98 |
| 849 | 3300049578 | Ga0501042_0166820 | Ga0501042_0166820_1034_1333 | 98 |
| 850 | 3300049578 | Ga0501042_0244400 | Ga0501042_0244400_921_1217 | 98 |
| 851 | 3300049579 | Ga0501043_0010777 | Ga0501043_0010777_5887_6186 | 98 |
| 852 | 3300049579 | Ga0501043_0037467 | Ga0501043_0037467_2922_3218 | 98 |
| 853 | 3300049579 | Ga0501043_0089788 | Ga0501043_0089788_419_718 | 98 |
| 854 | 3300049580 | Ga0501046_0005343 | Ga0501046_0005343_8166_8462 | 98 |
| 855 | 3300049580 | Ga0501046_0019262 | Ga0501046_0019262_4411_4710 | 98 |
| 856 | 3300049580 | Ga0501046_0072456 | Ga0501046_0072456_1230_1529 | 98 |
| 857 | 3300049581 | Ga0501047_0038159 | Ga0501047_0038159_3764_4063 | 98 |
| 858 | 3300049581 | Ga0501047_0107733 | Ga0501047_0107733_2135_2437 | 98 |
| 859 | 3300049582 | Ga0501048_0028583 | Ga0501048_0028583_2620_2916 | 98 |
| 860 | 3300049582 | Ga0501048_0030914 | Ga0501048_0030914_2283_2582 | 98 |
| 861 | 3300049582 | Ga0501048_0252761 | Ga0501048_0252761_88_387 | 98 |
| 862 | 3300049583 | Ga0501067_0234157 | Ga0501067_0234157_624_920 | 98 |
| 863 | 3300049584 | Ga0501068_0044955 | Ga0501068_0044955_1300_1596 | 98 |
| 864 | 3300049584 | Ga0501068_0048138 | Ga0501068_0048138_429_728 | 98 |
| 865 | 3300049584 | Ga0501068_0057085 | Ga0501068_0057085_225_524 | 98 |
| 866 | 3300049585 | Ga0501069_0005632 | Ga0501069_0005632_1949_2248 | 98 |
| 867 | 3300049585 | Ga0501069_0038958 | Ga0501069_0038958_2049_2348 | 98 |
| 868 | 3300049586 | Ga0501070_0004715 | Ga0501070_0004715_933_1232 | 98 |
| 869 | 3300049586 | Ga0501070_0014953 | Ga0501070_0014953_1640_1939 | 98 |
| 870 | 3300049586 | Ga0501070_0099251 | Ga0501070_0099251_1186_1482 | 98 |
| 871 | 3300049586 | Ga0501070_0538842 | Ga0501070_0538842_443_745 | 98 |
| 872 | 3300049587 | Ga0501071_0007897 | Ga0501071_0007897_1281_1577 | 98 |
| 873 | 3300049587 | Ga0501071_0009794 | Ga0501071_0009794_3321_3620 | 98 |
| 874 | 3300049587 | Ga0501071_0132551 | Ga0501071_0132551_575_871 | 98 |
| 875 | 3300049588 | Ga0501072_0003614 | Ga0501072_0003614_1365_1661 | 98 |
| 876 | 3300049588 | Ga0501072_0021126 | Ga0501072_0021126_3326_3625 | 98 |
| 877 | 3300049588 | Ga0501072_0066999 | Ga0501072_0066999_1334_1633 | 98 |
| 878 | 3300049588 | Ga0501072_0132127 | Ga0501072_0132127_509_805 | 98 |
| 879 | 3300049588 | Ga0501072_0641779 | Ga0501072_0641779_147_443 | 98 |
| 880 | 3300049589 | Ga0501073_0016233 | Ga0501073_0016233_1843_2142 | 98 |
| 881 | 3300049589 | Ga0501073_0017742 | Ga0501073_0017742_442_741 | 98 |
| 882 | 3300049590 | Ga0501074_0017399 | Ga0501074_0017399_2411_2710 | 98 |
| 883 | 3300049590 | Ga0501074_0035170 | Ga0501074_0035170_2566_2865 | 98 |
| 884 | 3300049590 | Ga0501074_0040296 | Ga0501074_0040296_1297_1593 | 98 |
| 885 | 3300049590 | Ga0501074_0138096 | Ga0501074_0138096_40_336 | 98 |
| 886 | 3300049590 | Ga0501074_0793606 | Ga0501074_0793606_154_450 | 98 |
| 887 | 3300049591 | Ga0501075_0013585 | Ga0501075_0013585_1323_1619 | 98 |
| 888 | 3300049591 | Ga0501075_0199990 | Ga0501075_0199990_607_903 | 98 |
| 889 | 3300049591 | Ga0501075_0342902 | Ga0501075_0342902_550_846 | 98 |
| 890 | 3300049592 | Ga0501076_0014603 | Ga0501076_0014603_1370_1666 | 98 |
| 891 | 3300049592 | Ga0501076_0138152 | Ga0501076_0138152_1439_1735 | 98 |
| 892 | 3300049592 | Ga0501076_0179220 | Ga0501076_0179220_1163_1462 | 98 |
| 893 | 3300049593 | Ga0501077_0000195 | Ga0501077_0000195_27499_27795 | 98 |
| 894 | 3300049656 | Ga0501209_281424 | Ga0501209_281424_146_442 | 98 |
| 895 | 3300049660 | Ga0501216_179218 | Ga0501216_179218_69_365 | 98 |
| 896 | 3300049661 | Ga0501217_139282 | Ga0501217_139282_315_623 | 98 |
| 897 | 3300049661 | Ga0501217_158879 | Ga0501217_158879_204_500 | 98 |
| 898 | 3300049664 | Ga0501224_048024 | Ga0501224_048024_295_603 | 98 |
| 899 | 3300049669 | Ga0501235_105739 | Ga0501235_105739_107_403 | 98 |
| 900 | 3300049670 | Ga0501236_121645 | Ga0501236_121645_42_350 | 98 |
| 901 | 3300049676 | Ga0501246_047655 | Ga0501246_047655_172_480 | 98 |
| 902 | 3300049679 | Ga0501249_155783 | Ga0501249_155783_79_375 | 98 |
| 903 | 3300049683 | Ga0501253_068374 | Ga0501253_068374_468_764 | 98 |
| 904 | 3300049688 | Ga0501259_173066 | Ga0501259_173066_125_421 | 98 |
| 905 | 3300049705 | Ga0501225_0047104 | Ga0501225_0047104_378_674 | 98 |
| 906 | 3300049741 | Ga0501079_0000550 | Ga0501079_0000550_23666_23962 | 98 |
| 907 | 3300049741 | Ga0501079_0004103 | Ga0501079_0004103_1687_1986 | 98 |
| 908 | 3300049741 | Ga0501079_0024449 | Ga0501079_0024449_2697_2996 | 98 |
| 909 | 3300049741 | Ga0501079_0273200 | Ga0501079_0273200_506_802 | 98 |
| 910 | 3300049742 | Ga0501080_0039009 | Ga0501080_0039009_1139_1435 | 98 |
| 911 | 3300049742 | Ga0501080_0057753 | Ga0501080_0057753_2530_2829 | 98 |
| 912 | 3300049742 | Ga0501080_0128792 | Ga0501080_0128792_890_1192 | 98 |
| 913 | 3300049742 | Ga0501080_0617136 | Ga0501080_0617136_79_378 | 98 |
| 914 | 3300049742 | Ga0501080_0655368 | Ga0501080_0655368_329_625 | 98 |
| 915 | 3300049742 | Ga0501080_0963360 | Ga0501080_0963360_74_370 | 98 |
| 916 | 3300049742 | Ga0501080_1069596 | Ga0501080_1069596_317_613 | 98 |
| 917 | 3300049743 | Ga0501081_0000417 | Ga0501081_0000417_2242_2538 | 98 |
| 918 | 3300049743 | Ga0501081_0606153 | Ga0501081_0606153_342_638 | 98 |
| 919 | 3300049744 | Ga0501083_0140019 | Ga0501083_0140019_765_1064 | 98 |
| 920 | 3300049744 | Ga0501083_0199946 | Ga0501083_0199946_472_768 | 98 |
| 921 | 3300049762 | Ga0501265_043223 | Ga0501265_043223_264_572 | 98 |
| 922 | 3300049765 | Ga0501268_063414 | Ga0501268_063414_241_549 | 98 |
| 923 | 3300049765 | Ga0501268_067290 | Ga0501268_067290_52_348 | 98 |
| 924 | 3300049767 | Ga0501270_143501 | Ga0501270_143501_21_317 | 98 |
| 925 | 3300049772 | Ga0501275_095455 | Ga0501275_095455_50_346 | 98 |
| 926 | 3300049822 | Ga0501035_0000755 | Ga0501035_0000755_3892_4191 | 98 |
| 927 | 3300049822 | Ga0501035_0004158 | Ga0501035_0004158_13101_13400 | 98 |
| 928 | 3300049822 | Ga0501035_0119843 | Ga0501035_0119843_892_1188 | 98 |
| 929 | 3300049822 | Ga0501035_0178236 | Ga0501035_0178236_542_838 | 98 |
| 930 | 3300049823 | Ga0501044_0000720 | Ga0501044_0000720_27340_27642 | 98 |
| 931 | 3300049823 | Ga0501044_0006098 | Ga0501044_0006098_6533_6829 | 98 |
| 932 | 3300049823 | Ga0501044_0119802 | Ga0501044_0119802_420_719 | 98 |
| 933 | 3300049824 | Ga0501045_0004294 | Ga0501045_0004294_1130_1426 | 98 |
| 934 | 3300049824 | Ga0501045_0161908 | Ga0501045_0161908_191_490 | 98 |
| 935 | 3300049824 | Ga0501045_0550843 | Ga0501045_0550843_289_585 | 98 |
| 936 | 3300049824 | Ga0501045_0715067 | Ga0501045_0715067_353_649 | 98 |
| 937 | 3300050507 | nmdc:mga05p37_102127_c1 | nmdc:mga05p37_102127_c1_3199_3495 | 98 |
| 938 | 3300050507 | nmdc:mga05p37_164566_c1 | nmdc:mga05p37_164566_c1_1469_1765 | 98 |
| 939 | 3300050507 | nmdc:mga05p37_1678919_c1 | nmdc:mga05p37_1678919_c1_91_387 | 98 |
| 940 | 3300050507 | nmdc:mga05p37_174928_c1 | nmdc:mga05p37_174928_c1_1721_2017 | 98 |
| 941 | 3300050507 | nmdc:mga05p37_194455_c1 | nmdc:mga05p37_194455_c1_1197_1493 | 98 |
| 942 | 3300050507 | nmdc:mga05p37_365514_c1 | nmdc:mga05p37_365514_c1_1083_1379 | 98 |
| 943 | 3300050507 | nmdc:mga05p37_490851_c1 | nmdc:mga05p37_490851_c1_432_728 | 98 |
| 944 | 3300050507 | nmdc:mga05p37_534663_c1 | nmdc:mga05p37_534663_c1_442_738 | 98 |
| 945 | 3300050507 | nmdc:mga05p37_607250_c1 | nmdc:mga05p37_607250_c1_758_1054 | 98 |
| 946 | 3300050507 | nmdc:mga05p37_633_c1 | nmdc:mga05p37_633_c1_20546_20854 | 98 |
| 947 | 3300050508 | nmdc:mga09592_184992_c1 | nmdc:mga09592_184992_c1_1448_1747 | 98 |
| 948 | 3300050508 | nmdc:mga09592_2699_c1 | nmdc:mga09592_2699_c1_7154_7450 | 98 |
| 949 | 3300050508 | nmdc:mga09592_349494_c1 | nmdc:mga09592_349494_c1_890_1189 | 98 |
| 950 | 3300050508 | nmdc:mga09592_430577_c1 | nmdc:mga09592_430577_c1_664_960 | 98 |
| 951 | 3300050508 | nmdc:mga09592_831524_c1 | nmdc:mga09592_831524_c1_330_638 | 98 |
| 952 | 3300050508 | nmdc:mga09592_94227_c1 | nmdc:mga09592_94227_c1_1246_1542 | 98 |
| 953 | 3300050509 | nmdc:mga0qj67_120247_c1 | nmdc:mga0qj67_120247_c1_1570_1869 | 98 |
| 954 | 3300050509 | nmdc:mga0qj67_1232144_c1 | nmdc:mga0qj67_1232144_c1_137_433 | 98 |
| 955 | 3300050509 | nmdc:mga0qj67_201930_c1 | nmdc:mga0qj67_201930_c1_474_770 | 98 |
| 956 | 3300050509 | nmdc:mga0qj67_45433_c1 | nmdc:mga0qj67_45433_c1_1366_1662 | 98 |
| 957 | 3300050509 | nmdc:mga0qj67_653897_c1 | nmdc:mga0qj67_653897_c1_67_366 | 98 |
| 958 | 3300050509 | nmdc:mga0qj67_7159_c1 | nmdc:mga0qj67_7159_c1_5328_5636 | 98 |
| 959 | 3300050510 | nmdc:mga06r32_181086_c1 | nmdc:mga06r32_181086_c1_792_1088 | 98 |
| 960 | 3300050510 | nmdc:mga06r32_249004_c1 | nmdc:mga06r32_249004_c1_236_535 | 98 |
| 961 | 3300050510 | nmdc:mga06r32_295506_c1 | nmdc:mga06r32_295506_c1_797_1093 | 98 |
| 962 | 3300050510 | nmdc:mga06r32_522930_c1 | nmdc:mga06r32_522930_c1_814_1110 | 98 |
| 963 | 3300050510 | nmdc:mga06r32_529778_c1 | nmdc:mga06r32_529778_c1_561_857 | 98 |
| 964 | 3300050510 | nmdc:mga06r32_55823_c1 | nmdc:mga06r32_55823_c1_1551_1859 | 98 |
| 965 | 3300050510 | nmdc:mga06r32_740158_c1 | nmdc:mga06r32_740158_c1_542_841 | 98 |
| 966 | 3300050510 | nmdc:mga06r32_9119_c1 | nmdc:mga06r32_9119_c1_3354_3650 | 98 |
| 967 | 3300050511 | nmdc:mga08y16_126451_c1 | nmdc:mga08y16_126451_c1_2275_2574 | 98 |
| 968 | 3300050511 | nmdc:mga08y16_43032_c1 | nmdc:mga08y16_43032_c1_3013_3321 | 98 |
| 969 | 3300050511 | nmdc:mga08y16_661696_c1 | nmdc:mga08y16_661696_c1_88_384 | 98 |
| 970 | 3300050511 | nmdc:mga08y16_690683_c1 | nmdc:mga08y16_690683_c1_142_438 | 98 |
| 971 | 3300050511 | nmdc:mga08y16_733777_c1 | nmdc:mga08y16_733777_c1_178_474 | 98 |
| 972 | 3300050512 | nmdc:mga0n895_1038255_c1 | nmdc:mga0n895_1038255_c1_181_477 | 98 |
| 973 | 3300050512 | nmdc:mga0n895_432797_c1 | nmdc:mga0n895_432797_c1_294_590 | 98 |
| 974 | 3300050512 | nmdc:mga0n895_500980_c1 | nmdc:mga0n895_500980_c1_192_488 | 98 |
| 975 | 3300050513 | nmdc:mga0rr50_143618_c1 | nmdc:mga0rr50_143618_c1_993_1289 | 98 |
| 976 | 3300050513 | nmdc:mga0rr50_248599_c1 | nmdc:mga0rr50_248599_c1_140_436 | 98 |
| 977 | 3300050513 | nmdc:mga0rr50_924910_c1 | nmdc:mga0rr50_924910_c1_364_660 | 98 |
| 978 | 3300050514 | nmdc:mga08x19_1301049_c1 | nmdc:mga08x19_1301049_c1_198_494 | 98 |
| 979 | 3300050515 | nmdc:mga0a205_147129_c1 | nmdc:mga0a205_147129_c1_1509_1805 | 98 |
| 980 | 3300050515 | nmdc:mga0a205_1535753_c1 | nmdc:mga0a205_1535753_c1_87_383 | 98 |
| 981 | 3300050515 | nmdc:mga0a205_2526_c1 | nmdc:mga0a205_2526_c1_5809_6105 | 98 |
| 982 | 3300053077 | Ga0495601_0592659 | Ga0495601_0592659_399_695 | 98 |
| 983 | 3300053077 | Ga0495601_0951339 | Ga0495601_0951339_100_396 | 98 |
| 984 | 3300053077 | Ga0495601_1006588 | Ga0495601_1006588_25_321 | 98 |
| 985 | 3300053078 | Ga0495612_0293078 | Ga0495612_0293078_304_600 | 98 |
| 986 | 3300053084 | Ga0495595_0151108 | Ga0495595_0151108_33_329 | 98 |
| 987 | 3300053085 | Ga0495619_0002333 | Ga0495619_0002333_1363_1659 | 98 |
| 988 | 3300053085 | Ga0495619_0140233 | Ga0495619_0140233_266_562 | 98 |
| 989 | 3300053085 | Ga0495619_0167688 | Ga0495619_0167688_31_387 | 98 |
| 990 | 3300053085 | Ga0495619_0372981 | Ga0495619_0372981_325_621 | 98 |
| 991 | 3300054114 | Ga0501084_0001686 | Ga0501084_0001686_1295_1591 | 98 |
| 992 | 3300054114 | Ga0501084_0013262 | Ga0501084_0013262_4528_4827 | 98 |
| 993 | 3300054114 | Ga0501084_0074012 | Ga0501084_0074012_2442_2741 | 98 |
| 994 | 3300054114 | Ga0501084_0288161 | Ga0501084_0288161_211_507 | 98 |
| 995 | 3300054114 | Ga0501084_0613396 | Ga0501084_0613396_434_730 | 98 |
| 996 | 3300059492 | Ga0587073_0158992 | Ga0587073_0158992_226_525 | 98 |
| 997 | 3300060353 | Ga0501082_0003168 | Ga0501082_0003168_12790_13089 | 98 |
| 998 | 3300060353 | Ga0501082_0006761 | Ga0501082_0006761_8199_8495 | 98 |
| 999 | 3300060353 | Ga0501082_0027927 | Ga0501082_0027927_98_397 | 98 |
| 1000 | 3300060353 | Ga0501082_0096896 | Ga0501082_0096896_1451_1753 | 98 |
| 1001 | 3300060353 | Ga0501082_1207546 | Ga0501082_1207546_162_458 | 98 |
| 1002 | 3300061734 | Ga0530510_0008140 | Ga0530510_0008140_6472_6768 | 98 |
| 1003 | 3300061734 | Ga0530510_0407184 | Ga0530510_0407184_501_797 | 98 |
| 1004 | 3300061734 | Ga0530510_0867635 | Ga0530510_0867635_23_319 | 98 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hro-assembly1.cif.gz_A | crystal structure of h. volcanii small archaeal modifier protein 1 | 0.8565 | 3 | 95 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.8345 | 3 | 98 |
| 4hro-assembly1.cif.gz_A | crystal structure of h. volcanii small archaeal modifier protein 1 | 0.8129 | 3 | 95 |
| 1v8c-assembly3.cif.gz_B | crystal structure of moad related protein from thermus thermophilus hb8 | 0.8082 | 3 | 93 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.8013 | 3 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8565 | 3 | 95 | 3.10.20.30 |
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8129 | 3 | 95 | 3.10.20.30 |
| af_Q54NM8_4_86_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8124 | 1 | 98 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8096 | 3 | 94 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.806 | 2 | 95 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535NE45-F1-model_v4 | MoaD/ThiS family protein | 0.9965 | 1 | 46 |
|
| AF-A0A1F8SIJ2-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9924 | 1 | 94 |
|
| AF-A0A534ZY62-F1-model_v4 | MoaD/ThiS family protein | 0.9893 | 1 | 84 |
|
| AF-A0A3N5W3B6-F1-model_v4 | MoaD/ThiS family protein | 0.9886 | 1 | 67 |
|
| AF-A0A1G0SXB6-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9882 | 1 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar