F487976

General Info

Members Datasets Scaffolds Average Seq Length
1004 396 1004 99

Family's Representative Sequence

Representative Sequence 3300059492|Ga0587073_0158992|Ga0587073_0158992_226_525
Length 99
Sequence MIRVVLPTPLRTLARTQGAEVQLEVAEPPTLAAVLTALETSYPMLRGTLRDHTTEQRRPFIRFFACGQDLSHDPASNRLPPEVASGKEPLLVVGAMAGG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
188 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
195 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
244 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
247 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
248 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
249 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
250 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
251 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
280 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
301 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
330 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
331 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
359 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
360 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
361 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
362 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
363 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
364 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
365 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
366 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
367 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
368 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
374 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
375 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
376 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
377 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
380 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
381 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
382 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
383 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
384 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
388 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
390 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
391 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
392 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.59
Rhizosphere 95.42
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4394635 2162886012 Bacteria 1087
2 JGI24737J22298_10035235 3300001990 Bacteria 1549
3 JGI25406J46586_10082425 3300003203 Bacteria 984
4 Ga0065714_10224779 3300005288 Unclassified 831
5 Ga0065714_10345260 3300005288 Unclassified 641
6 Ga0065704_10033584 3300005289 Unclassified 1147
7 Ga0065704_10098033 3300005289 Bacteria 2368
8 Ga0065704_10209423 3300005289 Bacteria 1078
9 Ga0065704_10380402 3300005289 Unclassified 766
10 Ga0065704_10457160 3300005289 Unclassified 700
11 Ga0065712_10000625 3300005290 Bacteria 9379
12 Ga0065712_10009242 3300005290 Bacteria 3598
13 Ga0065712_10012607 3300005290 Bacteria 3589
14 Ga0065712_10090964 3300005290 Bacteria 2395
15 Ga0065712_10244232 3300005290 Unclassified 976
16 Ga0065715_10004174 3300005293 Bacteria 3632
17 Ga0065715_10011829 3300005293 Bacteria 2530
18 Ga0065715_10015359 3300005293 Bacteria 5108
19 Ga0065715_10052692 3300005293 Bacteria 809
20 Ga0065715_10095555 3300005293 Bacteria 4059
21 Ga0065715_10102208 3300005293 Bacteria 3112
22 Ga0065715_10281165 3300005293 Unclassified 1085
23 Ga0065715_10396383 3300005293 Unclassified 887
24 Ga0065715_10681365 3300005293 Bacteria 663
25 Ga0065707_10029602 3300005295 Unclassified 1503
26 Ga0065707_10044765 3300005295 Bacteria 1239
27 Ga0065707_10317336 3300005295 Bacteria 973
28 Ga0070658_10106685 3300005327 Bacteria 2318
29 Ga0070658_10573231 3300005327 Unclassified 977
30 Ga0070658_10621415 3300005327 Bacteria 937
31 Ga0070676_10004800 3300005328 Bacteria 7152
32 Ga0070676_10240783 3300005328 Unclassified 1203
33 Ga0070676_10871794 3300005328 Unclassified 669
34 Ga0070683_100035782 3300005329 Bacteria 4539
35 Ga0070683_100052420 3300005329 Bacteria 3779
36 Ga0070683_100211865 3300005329 Bacteria 1841
37 Ga0070683_100306238 3300005329 Bacteria 1511
38 Ga0070683_101377772 3300005329 Unclassified 678
39 Ga0070690_100621405 3300005330 Bacteria 822
40 Ga0070690_101100024 3300005330 Bacteria 630
41 Ga0068869_100151332 3300005334 Bacteria 1800
42 Ga0068869_100155653 3300005334 Bacteria 1776
43 Ga0068869_101946030 3300005334 Bacteria 527
44 Ga0070666_10041534 3300005335 Bacteria 3074
45 Ga0070680_100362105 3300005336 Bacteria 1234
46 Ga0070680_100896467 3300005336 Bacteria 765
47 Ga0070682_100532356 3300005337 Bacteria 916
48 Ga0068868_100027582 3300005338 Bacteria 4333
49 Ga0068868_102312435 3300005338 Unclassified 513
50 Ga0070660_100057363 3300005339 Bacteria 3016
51 Ga0070660_100463823 3300005339 Bacteria 1052
52 Ga0070689_100024392 3300005340 Bacteria 4536
53 Ga0070689_100057914 3300005340 Bacteria 3009
54 Ga0070689_100069596 3300005340 Bacteria 2746
55 Ga0070689_100110073 3300005340 Bacteria 2190
56 Ga0070689_100616962 3300005340 Bacteria 941
57 Ga0070689_100876160 3300005340 Bacteria 793
58 Ga0070689_101032025 3300005340 Unclassified 733
59 Ga0070687_100003020 3300005343 Bacteria 6470
60 Ga0070687_100215246 3300005343 Bacteria 1173
61 Ga0070661_100916387 3300005344 Bacteria 724
62 Ga0070692_10509056 3300005345 Bacteria 782
63 Ga0070692_10910394 3300005345 Unclassified 609
64 Ga0070668_100025873 3300005347 Bacteria 4450
65 Ga0070668_100174407 3300005347 Bacteria 1752
66 Ga0070668_102066745 3300005347 Unclassified 526
67 Ga0070669_100019108 3300005353 Bacteria 4898
68 Ga0070669_100536476 3300005353 Bacteria 974
69 Ga0070675_100010980 3300005354 Bacteria 7090
70 Ga0070675_100016132 3300005354 Bacteria 5922
71 Ga0070675_100020946 3300005354 Bacteria 5221
72 Ga0070675_100245171 3300005354 Bacteria 1566
73 Ga0070675_100257366 3300005354 Bacteria 1529
74 Ga0070671_100427599 3300005355 Bacteria 1135
75 Ga0070671_100481161 3300005355 Unclassified 1067
76 Ga0070671_100991826 3300005355 Bacteria 736
77 Ga0070674_100767093 3300005356 Bacteria 830
78 Ga0070674_100858158 3300005356 Bacteria 788
79 Ga0070673_100032511 3300005364 Bacteria 3929
80 Ga0070673_100084292 3300005364 Bacteria 2584
81 Ga0070673_100741470 3300005364 Unclassified 904
82 Ga0070673_100823784 3300005364 Bacteria 858
83 Ga0070673_102361174 3300005364 Bacteria 506
84 Ga0070688_100006375 3300005365 Bacteria 6305
85 Ga0070688_100029398 3300005365 Bacteria 3290
86 Ga0070688_100029494 3300005365 Bacteria 3285
87 Ga0070688_100054513 3300005365 Bacteria 2505
88 Ga0070659_100019729 3300005366 Bacteria 5115
89 Ga0070659_100056308 3300005366 Bacteria 3101
90 Ga0070659_101240376 3300005366 Bacteria 660
91 Ga0070667_100013915 3300005367 Bacteria 6652
92 Ga0070667_100042500 3300005367 Bacteria 3814
93 Ga0070667_100056475 3300005367 Bacteria 3316
94 Ga0070667_100177455 3300005367 Bacteria 1883
95 Ga0070667_100894814 3300005367 Bacteria 826
96 Ga0070667_102056487 3300005367 Bacteria 538
97 Ga0070703_10386672 3300005406 Unclassified 606
98 Ga0070709_10068002 3300005434 Bacteria 2289
99 Ga0070709_10384167 3300005434 Bacteria 1045
100 Ga0070714_100090123 3300005435 Bacteria 2685
101 Ga0070713_100601197 3300005436 Bacteria 1045
102 Ga0070710_10041420 3300005437 Bacteria 2543
103 Ga0070701_10838916 3300005438 Unclassified 630
104 Ga0070711_100052061 3300005439 Viruses 2816
105 Ga0070711_101297645 3300005439 Unclassified 632
106 Ga0070705_100508117 3300005440 Unclassified 916
107 Ga0070700_100093396 3300005441 Bacteria 1968
108 Ga0070694_100002927 3300005444 Bacteria 10148
109 Ga0070694_100141540 3300005444 Bacteria 1748
110 Ga0070694_100376525 3300005444 Bacteria 1106
111 Ga0070663_100105476 3300005455 Bacteria 2109
112 Ga0070663_100125892 3300005455 Bacteria 1941
113 Ga0070678_100030782 3300005456 Bacteria 3693
114 Ga0070678_100057554 3300005456 Bacteria 2848
115 Ga0070662_100019870 3300005457 Bacteria 4568
116 Ga0070662_100219811 3300005457 Bacteria 1515
117 Ga0070681_10158486 3300005458 Bacteria 2187
118 Ga0070681_10523537 3300005458 Bacteria 1099
119 Ga0068867_101504882 3300005459 Bacteria 627
120 Ga0070685_10004471 3300005466 Bacteria 7072
121 Ga0070685_10832587 3300005466 Unclassified 682
122 Ga0070685_11330265 3300005466 Bacteria 550
123 Ga0070706_100327051 3300005467 Bacteria 1430
124 Ga0070706_100329059 3300005467 Bacteria 1425
125 Ga0070706_100598426 3300005467 Bacteria 1025
126 Ga0070706_100936543 3300005467 Bacteria 800
127 Ga0070706_101002882 3300005467 Unclassified 770
128 Ga0070706_101666960 3300005467 Bacteria 581
129 Ga0070707_100051720 3300005468 Bacteria 3938
130 Ga0070707_100091622 3300005468 Unclassified 2943
131 Ga0070707_100370917 3300005468 Bacteria 1390
132 Ga0070707_100524120 3300005468 Unclassified 1147
133 Ga0070698_100301528 3300005471 Bacteria 1533
134 Ga0070698_100482119 3300005471 Unclassified 1177
135 Ga0070679_100974110 3300005530 Bacteria 792
136 Ga0070679_102208443 3300005530 Unclassified 500
137 Ga0070684_100020105 3300005535 Bacteria 5538
138 Ga0070684_100031426 3300005535 Bacteria 4520
139 Ga0070684_100463644 3300005535 Bacteria 1171
140 Ga0070684_100566668 3300005535 Bacteria 1055
141 Ga0070684_101096965 3300005535 Bacteria 748
142 Ga0070697_100517226 3300005536 Unclassified 1045
143 Ga0070697_100743642 3300005536 Unclassified 866
144 Ga0070697_100821865 3300005536 Bacteria 823
145 Ga0070697_101229090 3300005536 Bacteria 668
146 Ga0068853_100932860 3300005539 Unclassified 834
147 Ga0070672_100481621 3300005543 Bacteria 1071
148 Ga0070686_100131952 3300005544 Bacteria 1728
149 Ga0070686_101310968 3300005544 Bacteria 605
150 Ga0070686_101384347 3300005544 Unclassified 590
151 Ga0070695_100005952 3300005545 Bacteria 7200
152 Ga0070695_100070184 3300005545 Bacteria 2291
153 Ga0070695_100786667 3300005545 Unclassified 761
154 Ga0070696_100017047 3300005546 Bacteria 4900
155 Ga0070696_100190017 3300005546 Unclassified 1528
156 Ga0070696_101245237 3300005546 Bacteria 630
157 Ga0070693_100069579 3300005547 Bacteria 2069
158 Ga0070665_100094688 3300005548 Bacteria 2991
159 Ga0070665_100356471 3300005548 Bacteria 1468
160 Ga0070665_100689338 3300005548 Bacteria 1035
161 Ga0070665_100826454 3300005548 Unclassified 939
162 Ga0070704_100024165 3300005549 Bacteria 3984
163 Ga0070704_100063567 3300005549 Unclassified 2649
164 Ga0070664_100802744 3300005564 Unclassified 880
165 Ga0070664_101107043 3300005564 Bacteria 746
166 Ga0068856_100124531 3300005614 Bacteria 2580
167 Ga0068856_100586633 3300005614 Bacteria 1136
168 Ga0070702_101150838 3300005615 Bacteria 623
169 Ga0068859_100073768 3300005617 Bacteria 3450
170 Ga0068859_100075988 3300005617 Bacteria 3400
171 Ga0068859_101078947 3300005617 Bacteria 883
172 Ga0068859_101847872 3300005617 Unclassified 667
173 Ga0068864_100282517 3300005618 Bacteria 1550
174 Ga0068864_100630238 3300005618 Bacteria 1043
175 Ga0068861_100112660 3300005719 Unclassified 2182
176 Ga0068861_100331167 3300005719 Bacteria 1329
177 Ga0068861_101450908 3300005719 Bacteria 672
178 Ga0068851_10691505 3300005834 Unclassified 627
179 Ga0068870_10195438 3300005840 Bacteria 1223
180 Ga0068870_10660298 3300005840 Bacteria 717
181 Ga0068863_100029528 3300005841 Bacteria 5233
182 Ga0068863_100228567 3300005841 Bacteria 1794
183 Ga0068863_101395932 3300005841 Bacteria 708
184 Ga0068858_100034200 3300005842 Bacteria 4713
185 Ga0068858_100078546 3300005842 Bacteria 3067
186 Ga0068858_100118665 3300005842 Bacteria 2473
187 Ga0068858_101048204 3300005842 Bacteria 800
188 Ga0068860_100021636 3300005843 Bacteria 6226
189 Ga0068860_100280619 3300005843 Bacteria 1628
190 Ga0068862_100041613 3300005844 Bacteria 3910
191 Ga0068862_100821444 3300005844 Unclassified 909
192 Ga0081455_10001083 3300005937 Bacteria 34289
193 Ga0081455_10003380 3300005937 Bacteria 18388
194 Ga0081455_10013473 3300005937 Bacteria 8077
195 Ga0081455_10098327 3300005937 Bacteria 2356
196 Ga0081455_10311029 3300005937 Bacteria 1126
197 Ga0081455_10457364 3300005937 Unclassified 870
198 Ga0081538_10028746 3300005981 Bacteria 3815
199 Ga0081540_1024266 3300005983 Bacteria 3522
200 Ga0081540_1032511 3300005983 Bacteria 2848
201 Ga0081540_1093820 3300005983 Bacteria 1313
202 Ga0081539_10014701 3300005985 Bacteria 5757
203 Ga0070717_10036763 3300006028 Bacteria 3973
204 Ga0070717_10147250 3300006028 Bacteria 2035
205 Ga0070717_10631358 3300006028 Bacteria 972
206 Ga0070717_10638084 3300006028 Bacteria 967
207 Ga0070717_11042484 3300006028 Bacteria 745
208 Ga0070717_11473692 3300006028 Unclassified 618
209 Ga0070715_10048082 3300006163 Bacteria 1821
210 Ga0070715_10237817 3300006163 Bacteria 945
211 Ga0070715_10571178 3300006163 Unclassified 659
212 Ga0070716_100099847 3300006173 Bacteria 1777
213 Ga0070716_100476223 3300006173 Bacteria 916
214 Ga0070716_101089943 3300006173 Unclassified 636
215 Ga0070712_100044614 3300006175 Bacteria 3057
216 Ga0070712_100232801 3300006175 Bacteria 1464
217 Ga0070712_100245420 3300006175 Bacteria 1428
218 Ga0070712_100253441 3300006175 Unclassified 1407
219 Ga0070712_100446963 3300006175 Unclassified 1076
220 Ga0070712_100710701 3300006175 Unclassified 857
221 Ga0070712_101262894 3300006175 Unclassified 643
222 Ga0097621_100095130 3300006237 Bacteria 2498
223 Ga0097621_100271998 3300006237 Unclassified 1489
224 Ga0068871_100060040 3300006358 Bacteria 3100
225 Ga0075428_100011203 3300006844 Bacteria 9978
226 Ga0075428_100059664 3300006844 Bacteria 4177
227 Ga0075428_100180070 3300006844 Bacteria 2288
228 Ga0075428_100578201 3300006844 Bacteria 1200
229 Ga0075428_100918227 3300006844 Unclassified 928
230 Ga0075428_101725415 3300006844 Bacteria 653
231 Ga0075428_102374384 3300006844 Bacteria 545
232 Ga0075430_100001915 3300006846 Bacteria 17076
233 Ga0075430_100026366 3300006846 Bacteria 4946
234 Ga0075430_100036343 3300006846 Bacteria 4177
235 Ga0075430_100085507 3300006846 Bacteria 2640
236 Ga0075430_100625851 3300006846 Bacteria 888
237 Ga0075430_101681801 3300006846 Bacteria 521
238 Ga0075431_100007491 3300006847 Bacteria 10869
239 Ga0075431_100025414 3300006847 Bacteria 6070
240 Ga0075431_100035701 3300006847 Bacteria 5118
241 Ga0075431_100053137 3300006847 Bacteria 4177
242 Ga0075431_100306843 3300006847 Bacteria 1603
243 Ga0075431_100337683 3300006847 Bacteria 1516
244 Ga0075431_100597248 3300006847 Bacteria 1088
245 Ga0075431_100760500 3300006847 Bacteria 944
246 Ga0075431_100798373 3300006847 Bacteria 917
247 Ga0075431_101544295 3300006847 Bacteria 622
248 Ga0075433_10078095 3300006852 Bacteria 2917
249 Ga0075433_10299893 3300006852 Bacteria 1423
250 Ga0075433_11003209 3300006852 Bacteria 727
251 Ga0075434_100096643 3300006871 Bacteria 2959
252 Ga0075434_100111314 3300006871 Bacteria 2749
253 Ga0075434_100217380 3300006871 Bacteria 1931
254 Ga0075434_100480867 3300006871 Bacteria 1263
255 Ga0075434_101333612 3300006871 Unclassified 728
256 Ga0075434_101920156 3300006871 Unclassified 598
257 Ga0075434_102057202 3300006871 Bacteria 576
258 Ga0075429_100003072 3300006880 Bacteria 14154
259 Ga0075429_100051493 3300006880 Bacteria 3583
260 Ga0075429_100159364 3300006880 Bacteria 1976
261 Ga0075429_100240007 3300006880 Bacteria 1587
262 Ga0068865_100228975 3300006881 Unclassified 1457
263 Ga0068865_100299299 3300006881 Bacteria 1287
264 Ga0075436_101504928 3300006914 Bacteria 511
265 Ga0097620_100073767 3300006931 Bacteria 3450
266 Ga0097620_100075987 3300006931 Bacteria 3400
267 Ga0097620_101078751 3300006931 Bacteria 883
268 Ga0097620_101847439 3300006931 Unclassified 667
269 Ga0075435_100284041 3300007076 Bacteria 1413
270 Ga0075435_101613181 3300007076 Bacteria 569
271 Ga0099795_10022013 3300007788 Bacteria 2099
272 Ga0105244_10381617 3300009036 Bacteria 649
273 Ga0111539_10005737 3300009094 Bacteria 16055
274 Ga0111539_10127619 3300009094 Bacteria 2979
275 Ga0111539_10392634 3300009094 Bacteria 1616
276 Ga0111539_13551768 3300009094 Bacteria 500
277 Ga0105245_10648793 3300009098 Bacteria 1086
278 Ga0105245_11022583 3300009098 Bacteria 871
279 Ga0105245_11231782 3300009098 Bacteria 796
280 Ga0105245_11729444 3300009098 Bacteria 678
281 Ga0105245_11763135 3300009098 Bacteria 672
282 Ga0105245_11816290 3300009098 Unclassified 662
283 Ga0105247_10127501 3300009101 Bacteria 1655
284 Ga0105247_10981384 3300009101 Unclassified 658
285 Ga0114129_10002600 3300009147 Bacteria 25101
286 Ga0114129_10070807 3300009147 Bacteria 4863
287 Ga0114129_10071259 3300009147 Bacteria 4846
288 Ga0114129_10094450 3300009147 Bacteria 4142
289 Ga0114129_10275796 3300009147 Bacteria 2248
290 Ga0114129_10314759 3300009147 Bacteria 2083
291 Ga0114129_10443839 3300009147 Bacteria 1703
292 Ga0114129_10454551 3300009147 Bacteria 1679
293 Ga0114129_10874492 3300009147 Bacteria 1141
294 Ga0114129_10972651 3300009147 Bacteria 1071
295 Ga0114129_11736140 3300009147 Unclassified 761
296 Ga0105243_10327504 3300009148 Bacteria 1398
297 Ga0105243_11034396 3300009148 Bacteria 826
298 Ga0105241_10111999 3300009174 Bacteria 2186
299 Ga0105241_11287371 3300009174 Unclassified 696
300 Ga0105242_10639311 3300009176 Bacteria 1033
301 Ga0105242_11739199 3300009176 Bacteria 661
302 Ga0105248_10173972 3300009177 Bacteria 2427
303 Ga0105248_10295561 3300009177 Bacteria 1824
304 Ga0105248_10376810 3300009177 Bacteria 1597
305 Ga0105237_10575801 3300009545 Bacteria 1133
306 Ga0105237_10672651 3300009545 Unclassified 1042
307 Ga0105249_10031035 3300009553 Bacteria 4831
308 Ga0105249_10121601 3300009553 Bacteria 2481
309 Ga0105249_10206168 3300009553 Bacteria 1926
310 Ga0105249_11830032 3300009553 Unclassified 680
311 Ga0099796_10033170 3300010159 Bacteria 1697
312 Ga0099796_10125912 3300010159 Unclassified 989
313 Ga0105239_10018911 3300010375 Bacteria 7612
314 Ga0105239_10104826 3300010375 Bacteria 3131
315 Ga0105239_10158785 3300010375 Bacteria 2526
316 Ga0105239_10489041 3300010375 Bacteria 1398
317 Ga0105246_10196381 3300011119 Bacteria 1565
318 Ga0157371_10189038 3300013102 Bacteria 1474
319 Ga0157371_10237610 3300013102 Bacteria 1310
320 Ga0157370_10252645 3300013104 Bacteria 1631
321 Ga0157370_10386562 3300013104 Bacteria 1289
322 Ga0157369_10091104 3300013105 Bacteria 3255
323 Ga0157369_10099659 3300013105 Bacteria 3097
324 Ga0157374_10052870 3300013296 Bacteria 3785
325 Ga0157374_10110448 3300013296 Bacteria 2644
326 Ga0157374_10127668 3300013296 Bacteria 2459
327 Ga0157374_10140991 3300013296 Bacteria 2340
328 Ga0157374_10144922 3300013296 Bacteria 2307
329 Ga0157374_10265918 3300013296 Bacteria 1690
330 Ga0157374_11443083 3300013296 Bacteria 711
331 Ga0157378_10014270 3300013297 Bacteria 6955
332 Ga0157378_10203079 3300013297 Bacteria 1875
333 Ga0157378_10487171 3300013297 Bacteria 1230
334 Ga0157378_10698935 3300013297 Bacteria 1033
335 Ga0157378_10711758 3300013297 Bacteria 1024
336 Ga0157378_10900510 3300013297 Bacteria 915
337 Ga0157378_11103868 3300013297 Bacteria 830
338 Ga0157378_12204185 3300013297 Unclassified 602
339 Ga0163162_10015388 3300013306 Bacteria 7473
340 Ga0163162_10094062 3300013306 Bacteria 3083
341 Ga0163162_10380908 3300013306 Bacteria 1544
342 Ga0163162_10868601 3300013306 Bacteria 1016
343 Ga0163162_13329667 3300013306 Unclassified 514
344 Ga0157372_10035572 3300013307 Bacteria 5484
345 Ga0157372_10055060 3300013307 Bacteria 4440
346 Ga0157372_10095387 3300013307 Bacteria 3389
347 Ga0157372_10970471 3300013307 Bacteria 985
348 Ga0157375_10018336 3300013308 Bacteria 6346
349 Ga0157375_10846195 3300013308 Unclassified 1061
350 Ga0157375_11001309 3300013308 Bacteria 975
351 Ga0157375_11038360 3300013308 Bacteria 958
352 Ga0157375_11108362 3300013308 Bacteria 927
353 Ga0157375_11114413 3300013308 Bacteria 924
354 Ga0157375_11598055 3300013308 Unclassified 771
355 Ga0163163_10555492 3300014325 Bacteria 1211
356 Ga0163163_10671017 3300014325 Bacteria 1100
357 Ga0163163_10943805 3300014325 Bacteria 926
358 Ga0163163_10976876 3300014325 Bacteria 910
359 Ga0182008_10032361 3300014497 Bacteria 2628
360 Ga0182008_10145039 3300014497 Unclassified 1189
361 Ga0157377_10096046 3300014745 Bacteria 1758
362 Ga0157377_10476494 3300014745 Unclassified 867
363 Ga0157377_10623923 3300014745 Unclassified 772
364 Ga0157379_10051616 3300014968 Bacteria 3673
365 Ga0157379_10352184 3300014968 Bacteria 1348
366 Ga0157379_10762448 3300014968 Bacteria 911
367 Ga0157379_11168237 3300014968 Bacteria 739
368 Ga0157376_10138274 3300014969 Bacteria 2182
369 Ga0157376_10459161 3300014969 Unclassified 1244
370 Ga0157376_10565818 3300014969 Bacteria 1127
371 Ga0157376_11143054 3300014969 Bacteria 805
372 Ga0157376_12215554 3300014969 Bacteria 588
373 Ga0157376_12690401 3300014969 Bacteria 537
374 Ga0182005_1063808 3300015265 Unclassified 1007
375 Ga0163161_10903774 3300017792 Bacteria 748
376 Ga0206354_10138387 3300020081 Bacteria 688
377 Ga0213873_10095422 3300021358 Bacteria 849
378 Ga0213872_10000378 3300021361 Bacteria 37429
379 Ga0213876_10004175 3300021384 Bacteria 8108
380 Ga0213875_10553157 3300021388 Bacteria 555
381 Ga0207666_1011002 3300025271 Unclassified 1246
382 Ga0207666_1018614 3300025271 Bacteria 1009
383 Ga0207673_1009654 3300025290 Bacteria 1235
384 Ga0207673_1011046 3300025290 Bacteria 1167
385 Ga0207673_1027021 3300025290 Unclassified 788
386 Ga0207697_10003372 3300025315 Bacteria 7931
387 Ga0207697_10003736 3300025315 Bacteria 7446
388 Ga0207697_10006400 3300025315 Bacteria 5332
389 Ga0207697_10037374 3300025315 Bacteria 1989
390 Ga0207697_10039285 3300025315 Bacteria 1941
391 Ga0207697_10088169 3300025315 Bacteria 1313
392 Ga0207697_10199035 3300025315 Bacteria 881
393 Ga0207653_10040172 3300025885 Bacteria 1533
394 Ga0207653_10304369 3300025885 Bacteria 618
395 Ga0207692_10427451 3300025898 Bacteria 830
396 Ga0207680_10072808 3300025903 Bacteria 2134
397 Ga0207647_10019407 3300025904 Bacteria 4573
398 Ga0207699_10081423 3300025906 Bacteria 2008
399 Ga0207699_10401900 3300025906 Bacteria 976
400 Ga0207645_10002865 3300025907 Bacteria 13362
401 Ga0207645_10044381 3300025907 Bacteria 2845
402 Ga0207645_10747642 3300025907 Bacteria 665
403 Ga0207705_10491855 3300025909 Bacteria 952
404 Ga0207684_10127241 3300025910 Unclassified 2186
405 Ga0207684_10280468 3300025910 Bacteria 1437
406 Ga0207684_10561714 3300025910 Bacteria 976
407 Ga0207684_10764564 3300025910 Bacteria 818
408 Ga0207707_10638898 3300025912 Bacteria 898
409 Ga0207671_10449412 3300025914 Unclassified 1026
410 Ga0207671_10516282 3300025914 Unclassified 952
411 Ga0207693_10023334 3300025915 Bacteria 4912
412 Ga0207693_10054152 3300025915 Bacteria 3148
413 Ga0207693_10057952 3300025915 Bacteria 3035
414 Ga0207693_10270654 3300025915 Bacteria 1331
415 Ga0207693_10377099 3300025915 Unclassified 1109
416 Ga0207693_10543651 3300025915 Unclassified 906
417 Ga0207693_10671726 3300025915 Unclassified 804
418 Ga0207693_10814619 3300025915 Bacteria 719
419 Ga0207693_11095387 3300025915 Unclassified 605
420 Ga0207663_10231756 3300025916 Bacteria 1350
421 Ga0207663_10396562 3300025916 Bacteria 1054
422 Ga0207663_10899913 3300025916 Bacteria 708
423 Ga0207663_11532077 3300025916 Unclassified 537
424 Ga0207662_10006880 3300025918 Bacteria 6161
425 Ga0207662_10245863 3300025918 Bacteria 1173
426 Ga0207657_10045562 3300025919 Bacteria 3848
427 Ga0207657_10071180 3300025919 Bacteria 2945
428 Ga0207652_10332966 3300025921 Bacteria 1371
429 Ga0207652_11389634 3300025921 Bacteria 605
430 Ga0207646_10077427 3300025922 Bacteria 2972
431 Ga0207646_10215294 3300025922 Bacteria 1735
432 Ga0207646_10233100 3300025922 Unclassified 1663
433 Ga0207646_11073981 3300025922 Bacteria 709
434 Ga0207646_11652580 3300025922 Bacteria 551
435 Ga0207681_10008159 3300025923 Bacteria 6401
436 Ga0207681_10832090 3300025923 Bacteria 772
437 Ga0207659_10021721 3300025926 Bacteria 4266
438 Ga0207659_10023201 3300025926 Bacteria 4138
439 Ga0207659_10066527 3300025926 Bacteria 2616
440 Ga0207659_10281783 3300025926 Bacteria 1359
441 Ga0207659_10654320 3300025926 Unclassified 898
442 Ga0207659_11047651 3300025926 Bacteria 702
443 Ga0207687_10394818 3300025927 Bacteria 1136
444 Ga0207700_10024764 3300025928 Bacteria 4158
445 Ga0207664_10086772 3300025929 Bacteria 2557
446 Ga0207644_10114526 3300025931 Bacteria 2043
447 Ga0207644_10561735 3300025931 Bacteria 945
448 Ga0207644_10574125 3300025931 Bacteria 935
449 Ga0207690_10122155 3300025932 Bacteria 1893
450 Ga0207690_10457390 3300025932 Unclassified 1027
451 Ga0207690_10632951 3300025932 Bacteria 875
452 Ga0207706_10026220 3300025933 Bacteria 5216
453 Ga0207706_10228671 3300025933 Bacteria 1628
454 Ga0207706_10633998 3300025933 Unclassified 916
455 Ga0207706_10916160 3300025933 Unclassified 740
456 Ga0207709_10825196 3300025935 Bacteria 750
457 Ga0207670_10000021 3300025936 Bacteria 155646
458 Ga0207670_10011904 3300025936 Bacteria 5066
459 Ga0207670_10024611 3300025936 Bacteria 3765
460 Ga0207670_10088725 3300025936 Bacteria 2181
461 Ga0207670_10152646 3300025936 Bacteria 1715
462 Ga0207670_10178356 3300025936 Bacteria 1598
463 Ga0207670_10560922 3300025936 Bacteria 934
464 Ga0207704_10359153 3300025938 Unclassified 1137
465 Ga0207665_10013313 3300025939 Bacteria 5406
466 Ga0207665_11655587 3300025939 Bacteria 507
467 Ga0207691_10034931 3300025940 Bacteria 4671
468 Ga0207711_10098700 3300025941 Bacteria 2581
469 Ga0207711_10127639 3300025941 Bacteria 2277
470 Ga0207689_10056964 3300025942 Bacteria 3215
471 Ga0207689_10496306 3300025942 Bacteria 1023
472 Ga0207661_10034334 3300025944 Bacteria 3943
473 Ga0207661_10115633 3300025944 Bacteria 2276
474 Ga0207661_10270540 3300025944 Bacteria 1516
475 Ga0207661_10316294 3300025944 Bacteria 1402
476 Ga0207661_10804851 3300025944 Bacteria 865
477 Ga0207661_10956352 3300025944 Unclassified 789
478 Ga0207679_10018603 3300025945 Bacteria 4657
479 Ga0207679_10146618 3300025945 Bacteria 1915
480 Ga0207679_10762433 3300025945 Unclassified 880
481 Ga0207651_12059937 3300025960 Unclassified 513
482 Ga0207712_10031248 3300025961 Bacteria 3585
483 Ga0207712_10065405 3300025961 Bacteria 2595
484 Ga0207712_10486107 3300025961 Unclassified 1053
485 Ga0207668_10007215 3300025972 Bacteria 6600
486 Ga0207668_10124714 3300025972 Bacteria 1956
487 Ga0207668_10155590 3300025972 Bacteria 1776
488 Ga0207640_10926036 3300025981 Unclassified 763
489 Ga0207658_10020950 3300025986 Bacteria 4531
490 Ga0207658_11444016 3300025986 Bacteria 629
491 Ga0207658_11971881 3300025986 Bacteria 531
492 Ga0207677_10020052 3300026023 Bacteria 4051
493 Ga0207703_10020759 3300026035 Bacteria 5140
494 Ga0207703_10161344 3300026035 Bacteria 1964
495 Ga0207703_11762263 3300026035 Bacteria 595
496 Ga0207703_11932930 3300026035 Bacteria 566
497 Ga0207639_10111178 3300026041 Bacteria 2233
498 Ga0207678_10033052 3300026067 Bacteria 4508
499 Ga0207678_10116710 3300026067 Bacteria 2277
500 Ga0207708_10262170 3300026075 Bacteria 1395
501 Ga0207708_11557173 3300026075 Bacteria 581
502 Ga0207702_10309229 3300026078 Bacteria 1502
503 Ga0207702_10627982 3300026078 Bacteria 1055
504 Ga0207641_10164231 3300026088 Bacteria 2021
505 Ga0207676_10411439 3300026095 Bacteria 1266
506 Ga0207676_10556710 3300026095 Bacteria 1096
507 Ga0207675_100237546 3300026118 Bacteria 1760
508 Ga0207675_101167344 3300026118 Unclassified 790
509 Ga0207675_101848717 3300026118 Bacteria 623
510 Ga0207683_10088748 3300026121 Bacteria 2752
511 Ga0210002_1108051 3300027617 Bacteria 505
512 Ga0209998_10059150 3300027717 Unclassified 900
513 Ga0209974_10219800 3300027876 Bacteria 707
514 Ga0207428_10040322 3300027907 Bacteria 3789
515 Ga0207428_10184683 3300027907 Bacteria 1574
516 Ga0268266_10204709 3300028379 Bacteria 1807
517 Ga0268266_11204648 3300028379 Unclassified 732
518 Ga0268266_11283747 3300028379 Bacteria 707
519 Ga0268266_11556726 3300028379 Bacteria 637
520 Ga0268265_10019225 3300028380 Bacteria 4744
521 Ga0268264_10042385 3300028381 Bacteria 3768
522 Ga0268264_10049735 3300028381 Bacteria 3489
523 Ga0268264_12660968 3300028381 Unclassified 504
524 Ga0265326_10082652 3300028558 Bacteria 908
525 Ga0265323_10040665 3300028653 Bacteria 1690
526 Ga0265327_10063801 3300031251 Bacteria 1869
527 Ga0307408_100040831 3300031548 Bacteria 3287
528 Ga0307408_100139665 3300031548 Bacteria 1900
529 Ga0307408_101391132 3300031548 Unclassified 660
530 Ga0316579_10502126 3300031691 Bacteria 587
531 Ga0265314_10128452 3300031711 Bacteria 1584
532 Ga0265342_10027518 3300031712 Bacteria 3552
533 Ga0316576_10825821 3300031727 Bacteria 666
534 Ga0316578_10255383 3300031728 Bacteria 1051
535 Ga0307405_10293073 3300031731 Bacteria 1231
536 Ga0307405_10444504 3300031731 Bacteria 1026
537 Ga0307405_10496314 3300031731 Bacteria 977
538 Ga0307405_10930105 3300031731 Bacteria 737
539 Ga0316577_10835322 3300031733 Unclassified 522
540 Ga0307413_10035530 3300031824 Bacteria 2860
541 Ga0307410_10068439 3300031852 Bacteria 2452
542 Ga0307410_10237853 3300031852 Bacteria 1410
543 Ga0307410_10516420 3300031852 Bacteria 985
544 Ga0307410_10852106 3300031852 Unclassified 778
545 Ga0307406_10345085 3300031901 Bacteria 1161
546 Ga0307406_10401696 3300031901 Bacteria 1086
547 Ga0307407_10305365 3300031903 Bacteria 1111
548 Ga0307412_10293265 3300031911 Bacteria 1282
549 Ga0307409_100034733 3300031995 Bacteria 3687
550 Ga0307409_100198618 3300031995 Bacteria 1792
551 Ga0307409_100385465 3300031995 Bacteria 1334
552 Ga0307409_102540235 3300031995 Bacteria 541
553 Ga0307416_100037330 3300032002 Bacteria 3737
554 Ga0307416_100234993 3300032002 Bacteria 1770
555 Ga0307416_101418723 3300032002 Bacteria 800
556 Ga0307414_10088334 3300032004 Bacteria 2294
557 Ga0307414_10101533 3300032004 Bacteria 2166
558 Ga0307411_10010437 3300032005 Bacteria 4952
559 Ga0307411_10110875 3300032005 Bacteria 1963
560 Ga0307411_10133724 3300032005 Bacteria 1817
561 Ga0307415_100282685 3300032126 Bacteria 1365
562 Ga0307415_100379256 3300032126 Bacteria 1200
563 Ga0307415_101122121 3300032126 Bacteria 737
564 Ga0316593_10170347 3300032168 Bacteria 798
565 Ga0373938_0042998 3300034957 Bacteria 1009
566 Ga0373934_0243286 3300035086 Bacteria 743
567 Ga0373934_0286019 3300035086 Bacteria 683
568 Ga0373934_0489000 3300035086 Unclassified 517
569 Ga0373940_0059650 3300035088 Bacteria 1089
570 Ga0373923_0126601 3300035111 Bacteria 1145
571 Ga0373923_0201467 3300035111 Bacteria 920
572 Ga0373932_0084953 3300035112 Bacteria 1006
573 Ga0373932_0121943 3300035112 Bacteria 870
574 Ga0373932_0227489 3300035112 Bacteria 673
575 Ga0373936_0498815 3300035113 Unclassified 566
576 Ga0373939_0215436 3300035114 Bacteria 733
577 Ga0373939_0292483 3300035114 Bacteria 647
578 Ga0373941_0115567 3300035115 Bacteria 951
579 Ga0373953_0148355 3300035117 Bacteria 1004
580 Ga0373953_0196340 3300035117 Bacteria 872
581 Ga0373954_0208374 3300035118 Unclassified 961
582 Ga0373956_0124709 3300035119 Bacteria 1204
583 Ga0373956_0259708 3300035119 Bacteria 826
584 Ga0373956_0641237 3300035119 Bacteria 507
585 Ga0373957_0029426 3300035120 Bacteria 2007
586 Ga0373957_0204186 3300035120 Bacteria 824
587 Ga0373943_0122325 3300035170 Bacteria 1384
588 Ga0373955_0169424 3300035172 Bacteria 1292
589 Ga0373955_0349175 3300035172 Bacteria 896
590 Ga0373955_0648238 3300035172 Unclassified 647
591 Ga0373942_0025484 3300035207 Bacteria 1525
592 Ga0373961_0301746 3300035241 Bacteria 593
593 Ga0373962_0073255 3300035242 Bacteria 1027
594 Ga0316574_0766334 3300035398 Unclassified 589
595 Ga0373935_0229708 3300035692 Bacteria 1292
596 Ga0373927_0002811 3300035695 Bacteria 12708
597 Ga0373927_0184193 3300035695 Bacteria 1370
598 Ga0373927_0301055 3300035695 Unclassified 1055
599 Ga0373927_0887304 3300035695 Bacteria 589
600 Ga0373933_0106704 3300035724 Bacteria 1743
601 Ga0373933_0938569 3300035724 Unclassified 570
602 Ga0373947_0258016 3300035725 Bacteria 1154
603 Ga0373947_0993968 3300035725 Unclassified 572
604 Ga0373947_1157194 3300035725 Unclassified 527
605 Ga0373937_0103062 3300036401 Bacteria 2650
606 Ga0373937_0126691 3300036401 Bacteria 2383
607 Ga0373937_0179190 3300036401 Bacteria 1990
608 Ga0373937_0339702 3300036401 Bacteria 1422
609 Ga0373937_0384119 3300036401 Unclassified 1332
610 Ga0373937_0877594 3300036401 Bacteria 846
611 Ga0373937_1565220 3300036401 Bacteria 606
612 Ga0316582_0012184 3300036647 Bacteria 4788
613 Ga0316584_0017857 3300036712 Bacteria 5109
614 Ga0316584_0267267 3300036712 Unclassified 1245
615 Ga0373925_0100046 3300037068 Bacteria 2228
616 Ga0395900_0101330 3300037418 Unclassified 2958
617 Ga0395900_0814081 3300037418 Unclassified 861
618 Ga0395900_1073238 3300037418 Unclassified 723
619 Ga0395898_0462286 3300037466 Unclassified 1208
620 Ga0395905_0560245 3300037471 Unclassified 1044
621 Ga0436364_1092155 3300037853 Bacteria 743
622 Ga0436364_1460655 3300037853 Bacteria 626
623 Ga0395901_0532730 3300038443 Bacteria 1192
624 Ga0436365_0224016 3300039437 Unclassified 613
625 Ga0436365_1476328 3300039437 Bacteria 212791
626 Ga0436361_0786779 3300039447 Bacteria 144856
627 Ga0436362_0793938 3300039453 Bacteria 1389
628 Ga0451849_1440942 3300041505 Bacteria 1102
629 Ga0451851_0871010 3300041507 Bacteria 1089
630 Ga0451853_2446995 3300041512 Unclassified 799
631 Ga0439448_0055755 3300042005 Bacteria 1300
632 Ga0439451_049454 3300042009 Bacteria 842
633 Ga0439458_0007203 3300042157 Bacteria 2475
634 Ga0439435_0156769 3300042436 Bacteria 733
635 Ga0439464_0017396 3300042439 Bacteria 1949
636 Ga0439460_0015422 3300042461 Bacteria 2023
637 Ga0439460_0240051 3300042461 Bacteria 625
638 Ga0451577_0042049 3300042876 Bacteria 4099
639 Ga0451577_0692071 3300042876 Bacteria 924
640 Ga0451577_0841633 3300042876 Bacteria 828
641 Ga0451577_0876750 3300042876 Bacteria 809
642 Ga0451577_1817317 3300042876 Unclassified 535
643 Ga0453683_0002195 3300044673 Bacteria 15518
644 Ga0453683_0135726 3300044673 Bacteria 1551
645 Ga0466966_0008342 3300044684 Bacteria 6861
646 Ga0466963_0868561 3300044694 Unclassified 636
647 Ga0466964_0334482 3300044706 Unclassified 773
648 Ga0453684_0056727 3300044712 Bacteria 5077
649 Ga0453684_0170452 3300044712 Unclassified 2565
650 Ga0453684_0277627 3300044712 Bacteria 1912
651 Ga0453684_0485039 3300044712 Bacteria 1371
652 Ga0453684_0574587 3300044712 Bacteria 1239
653 Ga0453684_1147918 3300044712 Bacteria 818
654 Ga0466959_0293038 3300045049 Bacteria 1115
655 Ga0451576_0413151 3300045051 Bacteria 1415
656 Ga0451576_2183154 3300045051 Bacteria 569
657 Ga0451576_2523353 3300045051 Bacteria 525
658 Ga0466967_0105899 3300045976 Bacteria 2577
659 Ga0466967_0845278 3300045976 Bacteria 909
660 Ga0495592_0020273 3300046454 Bacteria 5057
661 Ga0495603_0049371 3300046455 Bacteria 2505
662 Ga0495603_0156048 3300046455 Unclassified 1325
663 Ga0495629_0001099 3300046459 Bacteria 21423
664 Ga0495629_0084139 3300046459 Unclassified 2220
665 Ga0495629_0254391 3300046459 Unclassified 1208
666 Ga0495641_0035385 3300046461 Bacteria 2355
667 Ga0495641_0060507 3300046461 Bacteria 1711
668 Ga0495651_0290267 3300046462 Bacteria 1101
669 Ga0495651_0498431 3300046462 Unclassified 780
670 Ga0495653_0086911 3300046463 Bacteria 2297
671 Ga0495653_0654885 3300046463 Unclassified 641
672 Ga0495653_0759320 3300046463 Unclassified 585
673 Ga0495653_0828994 3300046463 Unclassified 554
674 Ga0495580_0178155 3300046472 Bacteria 1468
675 Ga0495580_1015991 3300046472 Bacteria 528
676 Ga0495582_0011615 3300046473 Bacteria 4854
677 Ga0495582_0053264 3300046473 Bacteria 2232
678 Ga0495582_0538493 3300046473 Bacteria 675
679 Ga0495639_0047642 3300046475 Bacteria 1942
680 Ga0495639_0517273 3300046475 Bacteria 610
681 Ga0495639_0533918 3300046475 Bacteria 600
682 Ga0495639_0630901 3300046475 Unclassified 552
683 Ga0495662_0171116 3300046476 Bacteria 1070
684 Ga0495662_0331137 3300046476 Unclassified 749
685 Ga0495662_0678010 3300046476 Unclassified 503
686 Ga0495664_0024014 3300046477 Bacteria 3541
687 Ga0495664_0534803 3300046477 Bacteria 699
688 Ga0495585_0572150 3300046492 Unclassified 533
689 Ga0495594_0006555 3300046499 Bacteria 5988
690 Ga0495594_0008374 3300046499 Bacteria 5327
691 Ga0495607_0451831 3300046501 Unclassified 577
692 Ga0495608_0162766 3300046511 Unclassified 1418
693 Ga0495608_0342425 3300046511 Bacteria 921
694 Ga0495618_0015458 3300046514 Bacteria 4660
695 Ga0495618_0214412 3300046514 Unclassified 1216
696 Ga0495628_0044764 3300046516 Bacteria 3519
697 Ga0495628_0196802 3300046516 Bacteria 1520
698 Ga0495628_0490409 3300046516 Bacteria 888
699 Ga0495630_0024804 3300046517 Bacteria 4433
700 Ga0495630_0040314 3300046517 Bacteria 3490
701 Ga0495630_0316882 3300046517 Unclassified 1192
702 Ga0495630_0390217 3300046517 Unclassified 1066
703 Ga0495637_0184711 3300046520 Unclassified 772
704 Ga0495644_0342905 3300046523 Unclassified 588
705 Ga0495666_0035153 3300046526 Bacteria 2443
706 Ga0495666_0241262 3300046526 Unclassified 825
707 Ga0495652_0060309 3300046529 Bacteria 3206
708 Ga0495652_0255004 3300046529 Bacteria 1298
709 Ga0495665_0634456 3300046531 Bacteria 532
710 Ga0495640_0057781 3300046533 Bacteria 2647
711 Ga0495640_0062753 3300046533 Bacteria 2519
712 Ga0495640_0941790 3300046533 Bacteria 510
713 Ga0495586_0044188 3300046535 Bacteria 2399
714 Ga0495586_0059714 3300046535 Bacteria 2072
715 Ga0495586_0087441 3300046535 Bacteria 1718
716 Ga0495586_0383120 3300046535 Unclassified 809
717 Ga0495586_0931272 3300046535 Unclassified 501
718 Ga0495587_0048084 3300046536 Bacteria 2527
719 Ga0495587_0052430 3300046536 Bacteria 2407
720 Ga0495587_0469760 3300046536 Unclassified 696
721 Ga0495587_0526367 3300046536 Unclassified 653
722 Ga0495645_0003220 3300046543 Bacteria 11078
723 Ga0495645_0077919 3300046543 Bacteria 2383
724 Ga0495645_0229600 3300046543 Bacteria 1244
725 Ga0495645_0440512 3300046543 Bacteria 823
726 Ga0495667_0482072 3300046559 Unclassified 778
727 Ga0495667_0516005 3300046559 Bacteria 748
728 Ga0495634_0080075 3300046642 Bacteria 2138
729 Ga0495634_0149284 3300046642 Bacteria 1479
730 Ga0495611_0198955 3300046648 Bacteria 935
731 Ga0495635_0005233 3300046663 Bacteria 9027
732 Ga0495635_0403481 3300046663 Bacteria 908
733 Ga0495635_0947418 3300046663 Unclassified 550
734 Ga0495657_0188742 3300046675 Bacteria 1261
735 Ga0495657_0834615 3300046675 Bacteria 526
736 Ga0495599_0006509 3300046678 Bacteria 7046
737 Ga0495623_0009108 3300046679 Bacteria 6440
738 Ga0495623_0305510 3300046679 Bacteria 878
739 Ga0495623_0719139 3300046679 Bacteria 510
740 Ga0495646_0108517 3300046680 Bacteria 1582
741 Ga0495647_0016331 3300046681 Bacteria 2612
742 Ga0495647_0060970 3300046681 Bacteria 1488
743 Ga0495658_0002224 3300046683 Bacteria 9809
744 Ga0495658_0047774 3300046683 Bacteria 2411
745 Ga0495658_0123254 3300046683 Bacteria 1570
746 Ga0495658_0273510 3300046683 Bacteria 1065
747 Ga0495658_0480102 3300046683 Bacteria 795
748 Ga0495669_0413907 3300046684 Unclassified 654
749 Ga0495613_0002740 3300046689 Bacteria 13235
750 Ga0495613_0028292 3300046689 Bacteria 4168
751 Ga0495613_0072994 3300046689 Bacteria 2501
752 Ga0495613_0752221 3300046689 Bacteria 639
753 Ga0495624_0313102 3300046690 Bacteria 946
754 Ga0495600_0193625 3300046809 Bacteria 1307
755 Ga0495581_0004247 3300047315 Bacteria 8263
756 Ga0495581_0222804 3300047315 Unclassified 1103
757 Ga0495581_0312131 3300047315 Unclassified 919
758 Ga0495581_0618525 3300047315 Bacteria 627
759 Ga0495604_0324751 3300047317 Bacteria 1028
760 Ga0495674_0062901 3300047319 Bacteria 3230
761 Ga0495674_0802101 3300047319 Bacteria 732
762 Ga0495674_0927350 3300047319 Unclassified 671
763 Ga0495676_0259471 3300047321 Bacteria 1183
764 Ga0495676_0290060 3300047321 Bacteria 1106
765 Ga0495680_0001823 3300047322 Bacteria 22500
766 Ga0495680_0602878 3300047322 Unclassified 735
767 Ga0495675_0046827 3300047444 Bacteria 2752
768 Ga0495684_0091335 3300047471 Bacteria 2306
769 Ga0495684_0132989 3300047471 Bacteria 1867
770 Ga0495684_0832316 3300047471 Unclassified 600
771 Ga0495593_0107907 3300047673 Bacteria 1423
772 Ga0495602_0049168 3300048088 Bacteria 3780
773 Ga0495602_0714855 3300048088 Bacteria 679
774 Ga0495614_0004515 3300048089 Bacteria 6279
775 Ga0496100_0036655 3300048903 Unclassified 3096
776 Ga0496100_0210224 3300048903 Unclassified 1423
777 Ga0496101_0407012 3300048904 Bacteria 1072
778 Ga0496101_0743474 3300048904 Bacteria 774
779 Ga0496102_0152597 3300048905 Bacteria 2171
780 Ga0496102_0162326 3300048905 Bacteria 2102
781 Ga0496102_0702019 3300048905 Unclassified 935
782 Ga0496103_0070109 3300048906 Bacteria 2193
783 Ga0496103_0209653 3300048906 Bacteria 1253
784 Ga0496104_0084018 3300048907 Bacteria 3037
785 Ga0496104_0141876 3300048907 Bacteria 2308
786 Ga0496104_0340856 3300048907 Bacteria 1412
787 Ga0496105_0071581 3300048908 Bacteria 2865
788 Ga0496105_0489254 3300048908 Bacteria 967
789 Ga0496106_0027205 3300048909 Bacteria 4259
790 Ga0496106_0156683 3300048909 Bacteria 1799
791 Ga0496107_0324934 3300048910 Bacteria 1145
792 Ga0496108_0006877 3300048911 Bacteria 9205
793 Ga0496109_0005698 3300048912 Bacteria 10427
794 Ga0496109_0864380 3300048912 Bacteria 842
795 Ga0496109_1166504 3300048912 Bacteria 707
796 Ga0496110_0054349 3300048913 Bacteria 3522
797 Ga0496111_0064511 3300048914 Unclassified 2657
798 Ga0496111_0320652 3300048914 Unclassified 1148
799 Ga0496112_0047502 3300048915 Bacteria 4211
800 Ga0496112_0095053 3300048915 Bacteria 2951
801 Ga0496112_0101887 3300048915 Bacteria 2841
802 Ga0496112_0129670 3300048915 Bacteria 2493
803 Ga0496112_0613018 3300048915 Bacteria 1020
804 Ga0496112_1434622 3300048915 Bacteria 605
805 Ga0496113_0014627 3300048916 Bacteria 5362
806 Ga0496114_0099938 3300048917 Bacteria 2475
807 Ga0496115_0014127 3300048918 Bacteria 6042
808 Ga0496115_0046704 3300048918 Bacteria 3462
809 Ga0496115_0155585 3300048918 Bacteria 1889
810 Ga0496115_0592420 3300048918 Bacteria 882
811 Ga0496126_0000027 3300048929 Bacteria 396518
812 Ga0501291_024184 3300049514 Bacteria 986
813 Ga0501297_056380 3300049520 Unclassified 591
814 Ga0501298_131132 3300049521 Bacteria 599
815 Ga0501031_0018229 3300049568 Bacteria 4568
816 Ga0501031_0167702 3300049568 Bacteria 1435
817 Ga0501031_0248802 3300049568 Bacteria 1155
818 Ga0501031_0539712 3300049568 Bacteria 751
819 Ga0501032_0003383 3300049569 Bacteria 12235
820 Ga0501032_0167591 3300049569 Bacteria 1441
821 Ga0501032_0239273 3300049569 Bacteria 1179
822 Ga0501033_0006909 3300049570 Bacteria 8861
823 Ga0501033_0007700 3300049570 Bacteria 8356
824 Ga0501033_0085701 3300049570 Bacteria 2307
825 Ga0501034_0027970 3300049571 Bacteria 5733
826 Ga0501034_0594484 3300049571 Bacteria 1012
827 Ga0501036_0011871 3300049572 Bacteria 7220
828 Ga0501036_0030043 3300049572 Bacteria 4591
829 Ga0501036_0037388 3300049572 Bacteria 4107
830 Ga0501036_0376816 3300049572 Bacteria 1184
831 Ga0501036_0566641 3300049572 Bacteria 943
832 Ga0501037_0002059 3300049573 Bacteria 14585
833 Ga0501037_0003998 3300049573 Bacteria 10688
834 Ga0501038_0002739 3300049574 Bacteria 16418
835 Ga0501038_0004476 3300049574 Bacteria 12994
836 Ga0501038_0022090 3300049574 Bacteria 5704
837 Ga0501038_0488687 3300049574 Bacteria 943
838 Ga0501039_0008614 3300049575 Bacteria 7775
839 Ga0501039_0044377 3300049575 Bacteria 3433
840 Ga0501040_0001593 3300049576 Bacteria 14460
841 Ga0501040_0152070 3300049576 Bacteria 1633
842 Ga0501040_0517971 3300049576 Bacteria 860
843 Ga0501040_0654286 3300049576 Bacteria 759
844 Ga0501040_1123033 3300049576 Bacteria 570
845 Ga0501041_0003041 3300049577 Bacteria 9621
846 Ga0501041_0085880 3300049577 Bacteria 1941
847 Ga0501042_0012537 3300049578 Bacteria 5744
848 Ga0501042_0021094 3300049578 Bacteria 4536
849 Ga0501042_0166820 3300049578 Bacteria 1589
850 Ga0501042_0244400 3300049578 Bacteria 1295
851 Ga0501043_0010777 3300049579 Bacteria 7159
852 Ga0501043_0037467 3300049579 Bacteria 3814
853 Ga0501043_0089788 3300049579 Bacteria 2415
854 Ga0501046_0005343 3300049580 Bacteria 11489
855 Ga0501046_0019262 3300049580 Bacteria 5660
856 Ga0501046_0072456 3300049580 Bacteria 2674
857 Ga0501047_0038159 3300049581 Bacteria 4646
858 Ga0501047_0107733 3300049581 Bacteria 2668
859 Ga0501048_0028583 3300049582 Bacteria 4047
860 Ga0501048_0030914 3300049582 Bacteria 3875
861 Ga0501048_0252761 3300049582 Bacteria 1251
862 Ga0501067_0234157 3300049583 Bacteria 1022
863 Ga0501068_0044955 3300049584 Bacteria 2660
864 Ga0501068_0048138 3300049584 Bacteria 2573
865 Ga0501068_0057085 3300049584 Bacteria 2366
866 Ga0501069_0005632 3300049585 Bacteria 6517
867 Ga0501069_0038958 3300049585 Bacteria 2624
868 Ga0501070_0004715 3300049586 Bacteria 11683
869 Ga0501070_0014953 3300049586 Bacteria 6529
870 Ga0501070_0099251 3300049586 Bacteria 2409
871 Ga0501070_0538842 3300049586 Bacteria 935
872 Ga0501071_0007897 3300049587 Bacteria 7015
873 Ga0501071_0009794 3300049587 Bacteria 6395
874 Ga0501071_0132551 3300049587 Bacteria 1852
875 Ga0501072_0003614 3300049588 Bacteria 11639
876 Ga0501072_0021126 3300049588 Bacteria 5050
877 Ga0501072_0066999 3300049588 Bacteria 2833
878 Ga0501072_0132127 3300049588 Bacteria 1990
879 Ga0501072_0641779 3300049588 Bacteria 836
880 Ga0501073_0016233 3300049589 Bacteria 5397
881 Ga0501073_0017742 3300049589 Bacteria 5151
882 Ga0501074_0017399 3300049590 Bacteria 5215
883 Ga0501074_0035170 3300049590 Bacteria 3629
884 Ga0501074_0040296 3300049590 Bacteria 3384
885 Ga0501074_0138096 3300049590 Bacteria 1744
886 Ga0501074_0793606 3300049590 Bacteria 667
887 Ga0501075_0013585 3300049591 Bacteria 5814
888 Ga0501075_0199990 3300049591 Bacteria 1524
889 Ga0501075_0342902 3300049591 Bacteria 1139
890 Ga0501076_0014603 3300049592 Bacteria 5920
891 Ga0501076_0138152 3300049592 Bacteria 1979
892 Ga0501076_0179220 3300049592 Bacteria 1727
893 Ga0501077_0000195 3300049593 Bacteria 34941
894 Ga0501209_281424 3300049656 Unclassified 522
895 Ga0501216_179218 3300049660 Unclassified 516
896 Ga0501217_139282 3300049661 Bacteria 717
897 Ga0501217_158879 3300049661 Unclassified 681
898 Ga0501224_048024 3300049664 Unclassified 651
899 Ga0501235_105739 3300049669 Unclassified 692
900 Ga0501236_121645 3300049670 Bacteria 531
901 Ga0501246_047655 3300049676 Bacteria 529
902 Ga0501249_155783 3300049679 Unclassified 577
903 Ga0501253_068374 3300049683 Bacteria 780
904 Ga0501259_173066 3300049688 Unclassified 544
905 Ga0501225_0047104 3300049705 Unclassified 1196
906 Ga0501079_0000550 3300049741 Bacteria 24508
907 Ga0501079_0004103 3300049741 Bacteria 10774
908 Ga0501079_0024449 3300049741 Bacteria 4635
909 Ga0501079_0273200 3300049741 Bacteria 1321
910 Ga0501080_0039009 3300049742 Bacteria 4432
911 Ga0501080_0057753 3300049742 Bacteria 3612
912 Ga0501080_0128792 3300049742 Bacteria 2343
913 Ga0501080_0617136 3300049742 Unclassified 961
914 Ga0501080_0655368 3300049742 Bacteria 929
915 Ga0501080_0963360 3300049742 Bacteria 741
916 Ga0501080_1069596 3300049742 Unclassified 697
917 Ga0501081_0000417 3300049743 Bacteria 23491
918 Ga0501081_0606153 3300049743 Bacteria 820
919 Ga0501083_0140019 3300049744 Bacteria 1584
920 Ga0501083_0199946 3300049744 Bacteria 1303
921 Ga0501265_043223 3300049762 Bacteria 687
922 Ga0501268_063414 3300049765 Bacteria 736
923 Ga0501268_067290 3300049765 Unclassified 719
924 Ga0501270_143501 3300049767 Unclassified 538
925 Ga0501275_095455 3300049772 Unclassified 500
926 Ga0501035_0000755 3300049822 Bacteria 34825
927 Ga0501035_0004158 3300049822 Bacteria 13758
928 Ga0501035_0119843 3300049822 Bacteria 2301
929 Ga0501035_0178236 3300049822 Bacteria 1832
930 Ga0501044_0000720 3300049823 Bacteria 39907
931 Ga0501044_0006098 3300049823 Bacteria 13299
932 Ga0501044_0119802 3300049823 Bacteria 2633
933 Ga0501045_0004294 3300049824 Bacteria 9831
934 Ga0501045_0161908 3300049824 Bacteria 1666
935 Ga0501045_0550843 3300049824 Bacteria 855
936 Ga0501045_0715067 3300049824 Bacteria 739
937 nmdc:mga05p37_102127_c1 3300050507 Bacteria 3531
938 nmdc:mga05p37_164566_c1 3300050507 Bacteria 2708
939 nmdc:mga05p37_1678919_c1 3300050507 Bacteria 621
940 nmdc:mga05p37_174928_c1 3300050507 Bacteria 2616
941 nmdc:mga05p37_194455_c1 3300050507 Bacteria 2460
942 nmdc:mga05p37_365514_c1 3300050507 Bacteria 1695
943 nmdc:mga05p37_490851_c1 3300050507 Bacteria 1412
944 nmdc:mga05p37_534663_c1 3300050507 Bacteria 1338
945 nmdc:mga05p37_607250_c1 3300050507 Bacteria 1234
946 nmdc:mga05p37_633_c1 3300050507 Bacteria 38921
947 nmdc:mga09592_184992_c1 3300050508 Bacteria 1802
948 nmdc:mga09592_2699_c1 3300050508 Bacteria 14350
949 nmdc:mga09592_349494_c1 3300050508 Bacteria 1280
950 nmdc:mga09592_430577_c1 3300050508 Bacteria 1139
951 nmdc:mga09592_831524_c1 3300050508 Bacteria 780
952 nmdc:mga09592_94227_c1 3300050508 Bacteria 2560
953 nmdc:mga0qj67_120247_c1 3300050509 Bacteria 2124
954 nmdc:mga0qj67_1232144_c1 3300050509 Unclassified 581
955 nmdc:mga0qj67_201930_c1 3300050509 Bacteria 1615
956 nmdc:mga0qj67_45433_c1 3300050509 Bacteria 3466
957 nmdc:mga0qj67_653897_c1 3300050509 Bacteria 838
958 nmdc:mga0qj67_7159_c1 3300050509 Bacteria 8229
959 nmdc:mga06r32_181086_c1 3300050510 Bacteria 2093
960 nmdc:mga06r32_249004_c1 3300050510 Bacteria 1764
961 nmdc:mga06r32_295506_c1 3300050510 Bacteria 1606
962 nmdc:mga06r32_522930_c1 3300050510 Bacteria 1162
963 nmdc:mga06r32_529778_c1 3300050510 Bacteria 1153
964 nmdc:mga06r32_55823_c1 3300050510 Bacteria 3790
965 nmdc:mga06r32_740158_c1 3300050510 Bacteria 947
966 nmdc:mga06r32_9119_c1 3300050510 Bacteria 8944
967 nmdc:mga08y16_126451_c1 3300050511 Bacteria 2659
968 nmdc:mga08y16_43032_c1 3300050511 Bacteria 4731
969 nmdc:mga08y16_661696_c1 3300050511 Bacteria 1047
970 nmdc:mga08y16_690683_c1 3300050511 Bacteria 1021
971 nmdc:mga08y16_733777_c1 3300050511 Bacteria 985
972 nmdc:mga0n895_1038255_c1 3300050512 Unclassified 799
973 nmdc:mga0n895_432797_c1 3300050512 Bacteria 1329
974 nmdc:mga0n895_500980_c1 3300050512 Bacteria 1223
975 nmdc:mga0rr50_143618_c1 3300050513 Bacteria 1922
976 nmdc:mga0rr50_248599_c1 3300050513 Bacteria 1476
977 nmdc:mga0rr50_924910_c1 3300050513 Unclassified 743
978 nmdc:mga08x19_1301049_c1 3300050514 Bacteria 515
979 nmdc:mga0a205_147129_c1 3300050515 Bacteria 2256
980 nmdc:mga0a205_1535753_c1 3300050515 Unclassified 514
981 nmdc:mga0a205_2526_c1 3300050515 Bacteria 16122
982 Ga0495601_0592659 3300053077 Bacteria 712
983 Ga0495601_0951339 3300053077 Unclassified 541
984 Ga0495601_1006588 3300053077 Unclassified 524
985 Ga0495612_0293078 3300053078 Bacteria 729
986 Ga0495595_0151108 3300053084 Bacteria 1143
987 Ga0495619_0002333 3300053085 Bacteria 12496
988 Ga0495619_0140233 3300053085 Unclassified 1664
989 Ga0495619_0167688 3300053085 Unclassified 1518
990 Ga0495619_0372981 3300053085 Bacteria 986
991 Ga0501084_0001686 3300054114 Bacteria 17565
992 Ga0501084_0013262 3300054114 Bacteria 6820
993 Ga0501084_0074012 3300054114 Bacteria 2852
994 Ga0501084_0288161 3300054114 Bacteria 1387
995 Ga0501084_0613396 3300054114 Bacteria 919
996 Ga0587073_0158992 3300059492 Bacteria 646
997 Ga0501082_0003168 3300060353 Bacteria 14339
998 Ga0501082_0006761 3300060353 Bacteria 9912
999 Ga0501082_0027927 3300060353 Bacteria 4859
1000 Ga0501082_0096896 3300060353 Bacteria 2550
1001 Ga0501082_1207546 3300060353 Unclassified 661
1002 Ga0530510_0008140 3300061734 Bacteria 7314
1003 Ga0530510_0407184 3300061734 Bacteria 1026
1004 Ga0530510_0867635 3300061734 Bacteria 689

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0000027 Ga0496126_0000027_332651_332941 96
2 3300035119 Ga0373956_0641237 Ga0373956_0641237_94_387 97
3 3300036401 Ga0373937_0339702 Ga0373937_0339702_83_376 97
4 3300036401 Ga0373937_1565220 Ga0373937_1565220_282_575 97
5 3300046516 Ga0495628_0196802 Ga0495628_0196802_748_1041 97
6 3300046536 Ga0495587_0052430 Ga0495587_0052430_2097_2390 97
7 3300046559 Ga0495667_0516005 Ga0495667_0516005_275_568 97
8 3300046679 Ga0495623_0305510 Ga0495623_0305510_153_446 97
9 3300046689 Ga0495613_0752221 Ga0495613_0752221_151_444 97
10 2162886012 MBSR1b_contig_4394635 MBSR1b_0332.00000220 98
11 3300001990 JGI24737J22298_10035235 JGI24737J22298_100352352 98
12 3300003203 JGI25406J46586_10082425 JGI25406J46586_100824252 98
13 3300005288 Ga0065714_10224779 Ga0065714_102247792 98
14 3300005288 Ga0065714_10345260 Ga0065714_103452602 98
15 3300005289 Ga0065704_10033584 Ga0065704_100335842 98
16 3300005289 Ga0065704_10098033 Ga0065704_100980333 98
17 3300005289 Ga0065704_10209423 Ga0065704_102094231 98
18 3300005289 Ga0065704_10380402 Ga0065704_103804022 98
19 3300005289 Ga0065704_10457160 Ga0065704_104571602 98
20 3300005290 Ga0065712_10000625 Ga0065712_100006259 98
21 3300005290 Ga0065712_10009242 Ga0065712_100092423 98
22 3300005290 Ga0065712_10012607 Ga0065712_100126072 98
23 3300005290 Ga0065712_10090964 Ga0065712_100909643 98
24 3300005290 Ga0065712_10244232 Ga0065712_102442322 98
25 3300005293 Ga0065715_10004174 Ga0065715_100041742 98
26 3300005293 Ga0065715_10011829 Ga0065715_100118292 98
27 3300005293 Ga0065715_10015359 Ga0065715_100153594 98
28 3300005293 Ga0065715_10052692 Ga0065715_100526922 98
29 3300005293 Ga0065715_10095555 Ga0065715_100955552 98
30 3300005293 Ga0065715_10102208 Ga0065715_101022083 98
31 3300005293 Ga0065715_10281165 Ga0065715_102811652 98
32 3300005293 Ga0065715_10396383 Ga0065715_103963831 98
33 3300005293 Ga0065715_10681365 Ga0065715_106813652 98
34 3300005295 Ga0065707_10029602 Ga0065707_100296022 98
35 3300005295 Ga0065707_10044765 Ga0065707_100447652 98
36 3300005295 Ga0065707_10317336 Ga0065707_103173362 98
37 3300005327 Ga0070658_10106685 Ga0070658_101066852 98
38 3300005327 Ga0070658_10573231 Ga0070658_105732312 98
39 3300005327 Ga0070658_10621415 Ga0070658_106214152 98
40 3300005328 Ga0070676_10004800 Ga0070676_100048008 98
41 3300005328 Ga0070676_10240783 Ga0070676_102407832 98
42 3300005328 Ga0070676_10871794 Ga0070676_108717942 98
43 3300005329 Ga0070683_100035782 Ga0070683_1000357823 98
44 3300005329 Ga0070683_100052420 Ga0070683_1000524204 98
45 3300005329 Ga0070683_100211865 Ga0070683_1002118652 98
46 3300005329 Ga0070683_100306238 Ga0070683_1003062382 98
47 3300005329 Ga0070683_101377772 Ga0070683_1013777722 98
48 3300005330 Ga0070690_100621405 Ga0070690_1006214052 98
49 3300005330 Ga0070690_101100024 Ga0070690_1011000242 98
50 3300005334 Ga0068869_100151332 Ga0068869_1001513321 98
51 3300005334 Ga0068869_100155653 Ga0068869_1001556533 98
52 3300005334 Ga0068869_101946030 Ga0068869_1019460302 98
53 3300005335 Ga0070666_10041534 Ga0070666_100415343 98
54 3300005336 Ga0070680_100362105 Ga0070680_1003621052 98
55 3300005336 Ga0070680_100896467 Ga0070680_1008964672 98
56 3300005337 Ga0070682_100532356 Ga0070682_1005323562 98
57 3300005338 Ga0068868_100027582 Ga0068868_1000275823 98
58 3300005338 Ga0068868_102312435 Ga0068868_1023124351 98
59 3300005339 Ga0070660_100057363 Ga0070660_1000573634 98
60 3300005339 Ga0070660_100463823 Ga0070660_1004638231 98
61 3300005340 Ga0070689_100024392 Ga0070689_1000243924 98
62 3300005340 Ga0070689_100057914 Ga0070689_1000579143 98
63 3300005340 Ga0070689_100069596 Ga0070689_1000695963 98
64 3300005340 Ga0070689_100110073 Ga0070689_1001100732 98
65 3300005340 Ga0070689_100616962 Ga0070689_1006169622 98
66 3300005340 Ga0070689_100876160 Ga0070689_1008761602 98
67 3300005340 Ga0070689_101032025 Ga0070689_1010320252 98
68 3300005343 Ga0070687_100003020 Ga0070687_1000030207 98
69 3300005343 Ga0070687_100215246 Ga0070687_1002152462 98
70 3300005344 Ga0070661_100916387 Ga0070661_1009163871 98
71 3300005345 Ga0070692_10509056 Ga0070692_105090562 98
72 3300005345 Ga0070692_10910394 Ga0070692_109103941 98
73 3300005347 Ga0070668_100025873 Ga0070668_1000258738 98
74 3300005347 Ga0070668_100174407 Ga0070668_1001744072 98
75 3300005347 Ga0070668_102066745 Ga0070668_1020667452 98
76 3300005353 Ga0070669_100019108 Ga0070669_1000191089 98
77 3300005353 Ga0070669_100536476 Ga0070669_1005364762 98
78 3300005354 Ga0070675_100010980 Ga0070675_1000109804 98
79 3300005354 Ga0070675_100016132 Ga0070675_1000161323 98
80 3300005354 Ga0070675_100020946 Ga0070675_1000209462 98
81 3300005354 Ga0070675_100245171 Ga0070675_1002451712 98
82 3300005354 Ga0070675_100257366 Ga0070675_1002573662 98
83 3300005355 Ga0070671_100427599 Ga0070671_1004275992 98
84 3300005355 Ga0070671_100481161 Ga0070671_1004811612 98
85 3300005355 Ga0070671_100991826 Ga0070671_1009918261 98
86 3300005356 Ga0070674_100767093 Ga0070674_1007670932 98
87 3300005356 Ga0070674_100858158 Ga0070674_1008581582 98
88 3300005364 Ga0070673_100032511 Ga0070673_1000325112 98
89 3300005364 Ga0070673_100084292 Ga0070673_1000842922 98
90 3300005364 Ga0070673_100741470 Ga0070673_1007414702 98
91 3300005364 Ga0070673_100823784 Ga0070673_1008237841 98
92 3300005364 Ga0070673_102361174 Ga0070673_1023611741 98
93 3300005365 Ga0070688_100006375 Ga0070688_1000063752 98
94 3300005365 Ga0070688_100029398 Ga0070688_1000293984 98
95 3300005365 Ga0070688_100029494 Ga0070688_1000294943 98
96 3300005365 Ga0070688_100054513 Ga0070688_1000545132 98
97 3300005366 Ga0070659_100019729 Ga0070659_1000197296 98
98 3300005366 Ga0070659_100056308 Ga0070659_1000563084 98
99 3300005366 Ga0070659_101240376 Ga0070659_1012403761 98
100 3300005367 Ga0070667_100013915 Ga0070667_1000139153 98
101 3300005367 Ga0070667_100042500 Ga0070667_1000425005 98
102 3300005367 Ga0070667_100056475 Ga0070667_1000564754 98
103 3300005367 Ga0070667_100177455 Ga0070667_1001774552 98
104 3300005367 Ga0070667_100894814 Ga0070667_1008948142 98
105 3300005367 Ga0070667_102056487 Ga0070667_1020564871 98
106 3300005406 Ga0070703_10386672 Ga0070703_103866721 98
107 3300005434 Ga0070709_10068002 Ga0070709_100680022 98
108 3300005434 Ga0070709_10384167 Ga0070709_103841672 98
109 3300005435 Ga0070714_100090123 Ga0070714_1000901233 98
110 3300005436 Ga0070713_100601197 Ga0070713_1006011972 98
111 3300005437 Ga0070710_10041420 Ga0070710_100414202 98
112 3300005438 Ga0070701_10838916 Ga0070701_108389162 98
113 3300005439 Ga0070711_100052061 Ga0070711_1000520612 98
114 3300005439 Ga0070711_101297645 Ga0070711_1012976451 98
115 3300005440 Ga0070705_100508117 Ga0070705_1005081172 98
116 3300005441 Ga0070700_100093396 Ga0070700_1000933961 98
117 3300005444 Ga0070694_100002927 Ga0070694_1000029276 98
118 3300005444 Ga0070694_100141540 Ga0070694_1001415402 98
119 3300005444 Ga0070694_100376525 Ga0070694_1003765252 98
120 3300005455 Ga0070663_100105476 Ga0070663_1001054762 98
121 3300005455 Ga0070663_100125892 Ga0070663_1001258922 98
122 3300005456 Ga0070678_100030782 Ga0070678_1000307822 98
123 3300005456 Ga0070678_100057554 Ga0070678_1000575542 98
124 3300005457 Ga0070662_100019870 Ga0070662_1000198702 98
125 3300005457 Ga0070662_100219811 Ga0070662_1002198111 98
126 3300005458 Ga0070681_10158486 Ga0070681_101584863 98
127 3300005458 Ga0070681_10523537 Ga0070681_105235372 98
128 3300005459 Ga0068867_101504882 Ga0068867_1015048821 98
129 3300005466 Ga0070685_10004471 Ga0070685_100044714 98
130 3300005466 Ga0070685_10832587 Ga0070685_108325871 98
131 3300005466 Ga0070685_11330265 Ga0070685_113302652 98
132 3300005467 Ga0070706_100327051 Ga0070706_1003270513 98
133 3300005467 Ga0070706_100329059 Ga0070706_1003290593 98
134 3300005467 Ga0070706_100598426 Ga0070706_1005984262 98
135 3300005467 Ga0070706_100936543 Ga0070706_1009365432 98
136 3300005467 Ga0070706_101002882 Ga0070706_1010028821 98
137 3300005467 Ga0070706_101666960 Ga0070706_1016669601 98
138 3300005468 Ga0070707_100051720 Ga0070707_1000517203 98
139 3300005468 Ga0070707_100091622 Ga0070707_1000916222 98
140 3300005468 Ga0070707_100370917 Ga0070707_1003709173 98
141 3300005468 Ga0070707_100524120 Ga0070707_1005241202 98
142 3300005471 Ga0070698_100301528 Ga0070698_1003015282 98
143 3300005471 Ga0070698_100482119 Ga0070698_1004821192 98
144 3300005530 Ga0070679_100974110 Ga0070679_1009741102 98
145 3300005530 Ga0070679_102208443 Ga0070679_1022084431 98
146 3300005535 Ga0070684_100020105 Ga0070684_1000201053 98
147 3300005535 Ga0070684_100031426 Ga0070684_1000314264 98
148 3300005535 Ga0070684_100463644 Ga0070684_1004636442 98
149 3300005535 Ga0070684_100566668 Ga0070684_1005666681 98
150 3300005535 Ga0070684_101096965 Ga0070684_1010969652 98
151 3300005536 Ga0070697_100517226 Ga0070697_1005172261 98
152 3300005536 Ga0070697_100743642 Ga0070697_1007436422 98
153 3300005536 Ga0070697_100821865 Ga0070697_1008218652 98
154 3300005536 Ga0070697_101229090 Ga0070697_1012290902 98
155 3300005539 Ga0068853_100932860 Ga0068853_1009328601 98
156 3300005543 Ga0070672_100481621 Ga0070672_1004816212 98
157 3300005544 Ga0070686_100131952 Ga0070686_1001319522 98
158 3300005544 Ga0070686_101310968 Ga0070686_1013109682 98
159 3300005544 Ga0070686_101384347 Ga0070686_1013843471 98
160 3300005545 Ga0070695_100005952 Ga0070695_1000059524 98
161 3300005545 Ga0070695_100070184 Ga0070695_1000701842 98
162 3300005545 Ga0070695_100786667 Ga0070695_1007866672 98
163 3300005546 Ga0070696_100017047 Ga0070696_1000170472 98
164 3300005546 Ga0070696_100190017 Ga0070696_1001900172 98
165 3300005546 Ga0070696_101245237 Ga0070696_1012452371 98
166 3300005547 Ga0070693_100069579 Ga0070693_1000695792 98
167 3300005548 Ga0070665_100094688 Ga0070665_1000946883 98
168 3300005548 Ga0070665_100356471 Ga0070665_1003564712 98
169 3300005548 Ga0070665_100689338 Ga0070665_1006893381 98
170 3300005548 Ga0070665_100826454 Ga0070665_1008264542 98
171 3300005549 Ga0070704_100024165 Ga0070704_1000241655 98
172 3300005549 Ga0070704_100063567 Ga0070704_1000635672 98
173 3300005564 Ga0070664_100802744 Ga0070664_1008027442 98
174 3300005564 Ga0070664_101107043 Ga0070664_1011070431 98
175 3300005614 Ga0068856_100124531 Ga0068856_1001245312 98
176 3300005614 Ga0068856_100586633 Ga0068856_1005866332 98
177 3300005615 Ga0070702_101150838 Ga0070702_1011508382 98
178 3300005617 Ga0068859_100073768 Ga0068859_1000737682 98
179 3300005617 Ga0068859_100075988 Ga0068859_1000759884 98
180 3300005617 Ga0068859_101078947 Ga0068859_1010789472 98
181 3300005617 Ga0068859_101847872 Ga0068859_1018478722 98
182 3300005618 Ga0068864_100282517 Ga0068864_1002825172 98
183 3300005618 Ga0068864_100630238 Ga0068864_1006302382 98
184 3300005719 Ga0068861_100112660 Ga0068861_1001126603 98
185 3300005719 Ga0068861_100331167 Ga0068861_1003311672 98
186 3300005719 Ga0068861_101450908 Ga0068861_1014509081 98
187 3300005834 Ga0068851_10691505 Ga0068851_106915051 98
188 3300005840 Ga0068870_10195438 Ga0068870_101954382 98
189 3300005840 Ga0068870_10660298 Ga0068870_106602982 98
190 3300005841 Ga0068863_100029528 Ga0068863_1000295285 98
191 3300005841 Ga0068863_100228567 Ga0068863_1002285673 98
192 3300005841 Ga0068863_101395932 Ga0068863_1013959322 98
193 3300005842 Ga0068858_100034200 Ga0068858_1000342004 98
194 3300005842 Ga0068858_100078546 Ga0068858_1000785462 98
195 3300005842 Ga0068858_100118665 Ga0068858_1001186652 98
196 3300005842 Ga0068858_101048204 Ga0068858_1010482042 98
197 3300005843 Ga0068860_100021636 Ga0068860_1000216365 98
198 3300005843 Ga0068860_100280619 Ga0068860_1002806193 98
199 3300005844 Ga0068862_100041613 Ga0068862_1000416132 98
200 3300005844 Ga0068862_100821444 Ga0068862_1008214442 98
201 3300005937 Ga0081455_10001083 Ga0081455_1000108317 98
202 3300005937 Ga0081455_10003380 Ga0081455_1000338015 98
203 3300005937 Ga0081455_10013473 Ga0081455_100134734 98
204 3300005937 Ga0081455_10098327 Ga0081455_100983273 98
205 3300005937 Ga0081455_10311029 Ga0081455_103110292 98
206 3300005937 Ga0081455_10457364 Ga0081455_104573642 98
207 3300005981 Ga0081538_10028746 Ga0081538_100287462 98
208 3300005983 Ga0081540_1024266 Ga0081540_10242662 98
209 3300005983 Ga0081540_1032511 Ga0081540_10325113 98
210 3300005983 Ga0081540_1093820 Ga0081540_10938201 98
211 3300005985 Ga0081539_10014701 Ga0081539_100147017 98
212 3300006028 Ga0070717_10036763 Ga0070717_100367635 98
213 3300006028 Ga0070717_10147250 Ga0070717_101472503 98
214 3300006028 Ga0070717_10631358 Ga0070717_106313582 98
215 3300006028 Ga0070717_10638084 Ga0070717_106380842 98
216 3300006028 Ga0070717_11042484 Ga0070717_110424842 98
217 3300006028 Ga0070717_11473692 Ga0070717_114736921 98
218 3300006163 Ga0070715_10048082 Ga0070715_100480822 98
219 3300006163 Ga0070715_10237817 Ga0070715_102378172 98
220 3300006163 Ga0070715_10571178 Ga0070715_105711782 98
221 3300006173 Ga0070716_100099847 Ga0070716_1000998472 98
222 3300006173 Ga0070716_100476223 Ga0070716_1004762231 98
223 3300006173 Ga0070716_101089943 Ga0070716_1010899431 98
224 3300006175 Ga0070712_100044614 Ga0070712_1000446142 98
225 3300006175 Ga0070712_100232801 Ga0070712_1002328012 98
226 3300006175 Ga0070712_100245420 Ga0070712_1002454201 98
227 3300006175 Ga0070712_100253441 Ga0070712_1002534412 98
228 3300006175 Ga0070712_100446963 Ga0070712_1004469631 98
229 3300006175 Ga0070712_100710701 Ga0070712_1007107012 98
230 3300006175 Ga0070712_101262894 Ga0070712_1012628942 98
231 3300006237 Ga0097621_100095130 Ga0097621_1000951303 98
232 3300006237 Ga0097621_100271998 Ga0097621_1002719982 98
233 3300006358 Ga0068871_100060040 Ga0068871_1000600405 98
234 3300006844 Ga0075428_100011203 Ga0075428_10001120313 98
235 3300006844 Ga0075428_100059664 Ga0075428_1000596642 98
236 3300006844 Ga0075428_100180070 Ga0075428_1001800702 98
237 3300006844 Ga0075428_100578201 Ga0075428_1005782013 98
238 3300006844 Ga0075428_100918227 Ga0075428_1009182272 98
239 3300006844 Ga0075428_101725415 Ga0075428_1017254151 98
240 3300006844 Ga0075428_102374384 Ga0075428_1023743842 98
241 3300006846 Ga0075430_100001915 Ga0075430_1000019152 98
242 3300006846 Ga0075430_100026366 Ga0075430_1000263662 98
243 3300006846 Ga0075430_100036343 Ga0075430_1000363437 98
244 3300006846 Ga0075430_100085507 Ga0075430_1000855073 98
245 3300006846 Ga0075430_100625851 Ga0075430_1006258512 98
246 3300006846 Ga0075430_101681801 Ga0075430_1016818012 98
247 3300006847 Ga0075431_100007491 Ga0075431_1000074916 98
248 3300006847 Ga0075431_100025414 Ga0075431_1000254147 98
249 3300006847 Ga0075431_100035701 Ga0075431_1000357012 98
250 3300006847 Ga0075431_100053137 Ga0075431_1000531377 98
251 3300006847 Ga0075431_100306843 Ga0075431_1003068431 98
252 3300006847 Ga0075431_100337683 Ga0075431_1003376833 98
253 3300006847 Ga0075431_100597248 Ga0075431_1005972481 98
254 3300006847 Ga0075431_100760500 Ga0075431_1007605002 98
255 3300006847 Ga0075431_100798373 Ga0075431_1007983733 98
256 3300006847 Ga0075431_101544295 Ga0075431_1015442952 98
257 3300006852 Ga0075433_10078095 Ga0075433_100780952 98
258 3300006852 Ga0075433_10299893 Ga0075433_102998932 98
259 3300006852 Ga0075433_11003209 Ga0075433_110032092 98
260 3300006871 Ga0075434_100096643 Ga0075434_1000966434 98
261 3300006871 Ga0075434_100111314 Ga0075434_1001113142 98
262 3300006871 Ga0075434_100217380 Ga0075434_1002173803 98
263 3300006871 Ga0075434_100480867 Ga0075434_1004808673 98
264 3300006871 Ga0075434_101333612 Ga0075434_1013336122 98
265 3300006871 Ga0075434_101920156 Ga0075434_1019201561 98
266 3300006871 Ga0075434_102057202 Ga0075434_1020572021 98
267 3300006880 Ga0075429_100003072 Ga0075429_10000307210 98
268 3300006880 Ga0075429_100051493 Ga0075429_1000514932 98
269 3300006880 Ga0075429_100159364 Ga0075429_1001593643 98
270 3300006880 Ga0075429_100240007 Ga0075429_1002400072 98
271 3300006881 Ga0068865_100228975 Ga0068865_1002289752 98
272 3300006881 Ga0068865_100299299 Ga0068865_1002992992 98
273 3300006914 Ga0075436_101504928 Ga0075436_1015049282 98
274 3300006931 Ga0097620_100073767 Ga0097620_1000737675 98
275 3300006931 Ga0097620_100075987 Ga0097620_1000759872 98
276 3300006931 Ga0097620_101078751 Ga0097620_1010787512 98
277 3300006931 Ga0097620_101847439 Ga0097620_1018474392 98
278 3300007076 Ga0075435_100284041 Ga0075435_1002840412 98
279 3300007076 Ga0075435_101613181 Ga0075435_1016131812 98
280 3300007788 Ga0099795_10022013 Ga0099795_100220132 98
281 3300009036 Ga0105244_10381617 Ga0105244_103816171 98
282 3300009094 Ga0111539_10005737 Ga0111539_100057379 98
283 3300009094 Ga0111539_10127619 Ga0111539_101276194 98
284 3300009094 Ga0111539_10392634 Ga0111539_103926342 98
285 3300009094 Ga0111539_13551768 Ga0111539_135517681 98
286 3300009098 Ga0105245_10648793 Ga0105245_106487932 98
287 3300009098 Ga0105245_11022583 Ga0105245_110225832 98
288 3300009098 Ga0105245_11231782 Ga0105245_112317821 98
289 3300009098 Ga0105245_11729444 Ga0105245_117294442 98
290 3300009098 Ga0105245_11763135 Ga0105245_117631352 98
291 3300009098 Ga0105245_11816290 Ga0105245_118162901 98
292 3300009101 Ga0105247_10127501 Ga0105247_101275012 98
293 3300009101 Ga0105247_10981384 Ga0105247_109813842 98
294 3300009147 Ga0114129_10002600 Ga0114129_100026004 98
295 3300009147 Ga0114129_10070807 Ga0114129_100708074 98
296 3300009147 Ga0114129_10071259 Ga0114129_100712596 98
297 3300009147 Ga0114129_10094450 Ga0114129_100944502 98
298 3300009147 Ga0114129_10275796 Ga0114129_102757963 98
299 3300009147 Ga0114129_10314759 Ga0114129_103147592 98
300 3300009147 Ga0114129_10443839 Ga0114129_104438393 98
301 3300009147 Ga0114129_10454551 Ga0114129_104545512 98
302 3300009147 Ga0114129_10874492 Ga0114129_108744922 98
303 3300009147 Ga0114129_10972651 Ga0114129_109726512 98
304 3300009147 Ga0114129_11736140 Ga0114129_117361402 98
305 3300009148 Ga0105243_10327504 Ga0105243_103275042 98
306 3300009148 Ga0105243_11034396 Ga0105243_110343962 98
307 3300009174 Ga0105241_10111999 Ga0105241_101119992 98
308 3300009174 Ga0105241_11287371 Ga0105241_112873712 98
309 3300009176 Ga0105242_10639311 Ga0105242_106393112 98
310 3300009176 Ga0105242_11739199 Ga0105242_117391991 98
311 3300009177 Ga0105248_10173972 Ga0105248_101739722 98
312 3300009177 Ga0105248_10295561 Ga0105248_102955612 98
313 3300009177 Ga0105248_10376810 Ga0105248_103768102 98
314 3300009545 Ga0105237_10575801 Ga0105237_105758012 98
315 3300009545 Ga0105237_10672651 Ga0105237_106726512 98
316 3300009553 Ga0105249_10031035 Ga0105249_100310353 98
317 3300009553 Ga0105249_10121601 Ga0105249_101216012 98
318 3300009553 Ga0105249_10206168 Ga0105249_102061682 98
319 3300009553 Ga0105249_11830032 Ga0105249_118300322 98
320 3300010159 Ga0099796_10033170 Ga0099796_100331702 98
321 3300010159 Ga0099796_10125912 Ga0099796_101259122 98
322 3300010375 Ga0105239_10018911 Ga0105239_1001891110 98
323 3300010375 Ga0105239_10104826 Ga0105239_101048264 98
324 3300010375 Ga0105239_10158785 Ga0105239_101587852 98
325 3300010375 Ga0105239_10489041 Ga0105239_104890412 98
326 3300011119 Ga0105246_10196381 Ga0105246_101963812 98
327 3300013102 Ga0157371_10189038 Ga0157371_101890382 98
328 3300013102 Ga0157371_10237610 Ga0157371_102376102 98
329 3300013104 Ga0157370_10252645 Ga0157370_102526452 98
330 3300013104 Ga0157370_10386562 Ga0157370_103865622 98
331 3300013105 Ga0157369_10091104 Ga0157369_100911044 98
332 3300013105 Ga0157369_10099659 Ga0157369_100996592 98
333 3300013296 Ga0157374_10052870 Ga0157374_100528705 98
334 3300013296 Ga0157374_10110448 Ga0157374_101104482 98
335 3300013296 Ga0157374_10127668 Ga0157374_101276683 98
336 3300013296 Ga0157374_10140991 Ga0157374_101409913 98
337 3300013296 Ga0157374_10144922 Ga0157374_101449223 98
338 3300013296 Ga0157374_10265918 Ga0157374_102659182 98
339 3300013296 Ga0157374_11443083 Ga0157374_114430832 98
340 3300013297 Ga0157378_10014270 Ga0157378_100142707 98
341 3300013297 Ga0157378_10203079 Ga0157378_102030792 98
342 3300013297 Ga0157378_10487171 Ga0157378_104871712 98
343 3300013297 Ga0157378_10698935 Ga0157378_106989352 98
344 3300013297 Ga0157378_10711758 Ga0157378_107117582 98
345 3300013297 Ga0157378_10900510 Ga0157378_109005102 98
346 3300013297 Ga0157378_11103868 Ga0157378_111038682 98
347 3300013297 Ga0157378_12204185 Ga0157378_122041852 98
348 3300013306 Ga0163162_10015388 Ga0163162_100153888 98
349 3300013306 Ga0163162_10094062 Ga0163162_100940622 98
350 3300013306 Ga0163162_10380908 Ga0163162_103809082 98
351 3300013306 Ga0163162_10868601 Ga0163162_108686012 98
352 3300013306 Ga0163162_13329667 Ga0163162_133296671 98
353 3300013307 Ga0157372_10035572 Ga0157372_100355722 98
354 3300013307 Ga0157372_10055060 Ga0157372_100550605 98
355 3300013307 Ga0157372_10095387 Ga0157372_100953872 98
356 3300013307 Ga0157372_10970471 Ga0157372_109704711 98
357 3300013308 Ga0157375_10018336 Ga0157375_100183366 98
358 3300013308 Ga0157375_10846195 Ga0157375_108461951 98
359 3300013308 Ga0157375_11001309 Ga0157375_110013092 98
360 3300013308 Ga0157375_11038360 Ga0157375_110383602 98
361 3300013308 Ga0157375_11108362 Ga0157375_111083622 98
362 3300013308 Ga0157375_11114413 Ga0157375_111144132 98
363 3300013308 Ga0157375_11598055 Ga0157375_115980552 98
364 3300014325 Ga0163163_10555492 Ga0163163_105554922 98
365 3300014325 Ga0163163_10671017 Ga0163163_106710172 98
366 3300014325 Ga0163163_10943805 Ga0163163_109438052 98
367 3300014325 Ga0163163_10976876 Ga0163163_109768762 98
368 3300014497 Ga0182008_10032361 Ga0182008_100323612 98
369 3300014497 Ga0182008_10145039 Ga0182008_101450392 98
370 3300014745 Ga0157377_10096046 Ga0157377_100960461 98
371 3300014745 Ga0157377_10476494 Ga0157377_104764942 98
372 3300014745 Ga0157377_10623923 Ga0157377_106239231 98
373 3300014968 Ga0157379_10051616 Ga0157379_100516163 98
374 3300014968 Ga0157379_10352184 Ga0157379_103521842 98
375 3300014968 Ga0157379_10762448 Ga0157379_107624482 98
376 3300014968 Ga0157379_11168237 Ga0157379_111682372 98
377 3300014969 Ga0157376_10138274 Ga0157376_101382742 98
378 3300014969 Ga0157376_10459161 Ga0157376_104591612 98
379 3300014969 Ga0157376_10565818 Ga0157376_105658182 98
380 3300014969 Ga0157376_11143054 Ga0157376_111430542 98
381 3300014969 Ga0157376_12215554 Ga0157376_122155542 98
382 3300014969 Ga0157376_12690401 Ga0157376_126904011 98
383 3300015265 Ga0182005_1063808 Ga0182005_10638082 98
384 3300017792 Ga0163161_10903774 Ga0163161_109037742 98
385 3300020081 Ga0206354_10138387 Ga0206354_101383872 98
386 3300021358 Ga0213873_10095422 Ga0213873_100954222 98
387 3300021361 Ga0213872_10000378 Ga0213872_1000037827 98
388 3300021384 Ga0213876_10004175 Ga0213876_100041756 98
389 3300021388 Ga0213875_10553157 Ga0213875_105531571 98
390 3300025271 Ga0207666_1011002 Ga0207666_10110022 98
391 3300025271 Ga0207666_1018614 Ga0207666_10186142 98
392 3300025290 Ga0207673_1009654 Ga0207673_10096542 98
393 3300025290 Ga0207673_1011046 Ga0207673_10110462 98
394 3300025290 Ga0207673_1027021 Ga0207673_10270212 98
395 3300025315 Ga0207697_10003372 Ga0207697_100033725 98
396 3300025315 Ga0207697_10003736 Ga0207697_100037367 98
397 3300025315 Ga0207697_10006400 Ga0207697_100064004 98
398 3300025315 Ga0207697_10037374 Ga0207697_100373742 98
399 3300025315 Ga0207697_10039285 Ga0207697_100392852 98
400 3300025315 Ga0207697_10088169 Ga0207697_100881692 98
401 3300025315 Ga0207697_10199035 Ga0207697_101990352 98
402 3300025885 Ga0207653_10040172 Ga0207653_100401721 98
403 3300025885 Ga0207653_10304369 Ga0207653_103043692 98
404 3300025898 Ga0207692_10427451 Ga0207692_104274512 98
405 3300025903 Ga0207680_10072808 Ga0207680_100728083 98
406 3300025904 Ga0207647_10019407 Ga0207647_100194075 98
407 3300025906 Ga0207699_10081423 Ga0207699_100814232 98
408 3300025906 Ga0207699_10401900 Ga0207699_104019002 98
409 3300025907 Ga0207645_10002865 Ga0207645_1000286516 98
410 3300025907 Ga0207645_10044381 Ga0207645_100443812 98
411 3300025907 Ga0207645_10747642 Ga0207645_107476422 98
412 3300025909 Ga0207705_10491855 Ga0207705_104918552 98
413 3300025910 Ga0207684_10127241 Ga0207684_101272412 98
414 3300025910 Ga0207684_10280468 Ga0207684_102804682 98
415 3300025910 Ga0207684_10561714 Ga0207684_105617141 98
416 3300025910 Ga0207684_10764564 Ga0207684_107645641 98
417 3300025912 Ga0207707_10638898 Ga0207707_106388982 98
418 3300025914 Ga0207671_10449412 Ga0207671_104494122 98
419 3300025914 Ga0207671_10516282 Ga0207671_105162822 98
420 3300025915 Ga0207693_10023334 Ga0207693_100233343 98
421 3300025915 Ga0207693_10054152 Ga0207693_100541523 98
422 3300025915 Ga0207693_10057952 Ga0207693_100579522 98
423 3300025915 Ga0207693_10270654 Ga0207693_102706542 98
424 3300025915 Ga0207693_10377099 Ga0207693_103770992 98
425 3300025915 Ga0207693_10543651 Ga0207693_105436512 98
426 3300025915 Ga0207693_10671726 Ga0207693_106717261 98
427 3300025915 Ga0207693_10814619 Ga0207693_108146191 98
428 3300025915 Ga0207693_11095387 Ga0207693_110953872 98
429 3300025916 Ga0207663_10231756 Ga0207663_102317562 98
430 3300025916 Ga0207663_10396562 Ga0207663_103965622 98
431 3300025916 Ga0207663_10899913 Ga0207663_108999131 98
432 3300025916 Ga0207663_11532077 Ga0207663_115320772 98
433 3300025918 Ga0207662_10006880 Ga0207662_1000688010 98
434 3300025918 Ga0207662_10245863 Ga0207662_102458632 98
435 3300025919 Ga0207657_10045562 Ga0207657_100455624 98
436 3300025919 Ga0207657_10071180 Ga0207657_100711802 98
437 3300025921 Ga0207652_10332966 Ga0207652_103329661 98
438 3300025921 Ga0207652_11389634 Ga0207652_113896342 98
439 3300025922 Ga0207646_10077427 Ga0207646_100774272 98
440 3300025922 Ga0207646_10215294 Ga0207646_102152942 98
441 3300025922 Ga0207646_10233100 Ga0207646_102331003 98
442 3300025922 Ga0207646_11073981 Ga0207646_110739811 98
443 3300025922 Ga0207646_11652580 Ga0207646_116525802 98
444 3300025923 Ga0207681_10008159 Ga0207681_100081593 98
445 3300025923 Ga0207681_10832090 Ga0207681_108320902 98
446 3300025926 Ga0207659_10021721 Ga0207659_100217217 98
447 3300025926 Ga0207659_10023201 Ga0207659_100232013 98
448 3300025926 Ga0207659_10066527 Ga0207659_100665272 98
449 3300025926 Ga0207659_10281783 Ga0207659_102817832 98
450 3300025926 Ga0207659_10654320 Ga0207659_106543202 98
451 3300025926 Ga0207659_11047651 Ga0207659_110476511 98
452 3300025927 Ga0207687_10394818 Ga0207687_103948182 98
453 3300025928 Ga0207700_10024764 Ga0207700_100247645 98
454 3300025929 Ga0207664_10086772 Ga0207664_100867723 98
455 3300025931 Ga0207644_10114526 Ga0207644_101145263 98
456 3300025931 Ga0207644_10561735 Ga0207644_105617352 98
457 3300025931 Ga0207644_10574125 Ga0207644_105741252 98
458 3300025932 Ga0207690_10122155 Ga0207690_101221552 98
459 3300025932 Ga0207690_10457390 Ga0207690_104573902 98
460 3300025932 Ga0207690_10632951 Ga0207690_106329511 98
461 3300025933 Ga0207706_10026220 Ga0207706_100262203 98
462 3300025933 Ga0207706_10228671 Ga0207706_102286712 98
463 3300025933 Ga0207706_10633998 Ga0207706_106339981 98
464 3300025933 Ga0207706_10916160 Ga0207706_109161601 98
465 3300025935 Ga0207709_10825196 Ga0207709_108251962 98
466 3300025936 Ga0207670_10000021 Ga0207670_1000002199 98
467 3300025936 Ga0207670_10011904 Ga0207670_100119045 98
468 3300025936 Ga0207670_10024611 Ga0207670_100246112 98
469 3300025936 Ga0207670_10088725 Ga0207670_100887252 98
470 3300025936 Ga0207670_10152646 Ga0207670_101526462 98
471 3300025936 Ga0207670_10178356 Ga0207670_101783562 98
472 3300025936 Ga0207670_10560922 Ga0207670_105609222 98
473 3300025938 Ga0207704_10359153 Ga0207704_103591532 98
474 3300025939 Ga0207665_10013313 Ga0207665_100133135 98
475 3300025939 Ga0207665_11655587 Ga0207665_116555872 98
476 3300025940 Ga0207691_10034931 Ga0207691_100349318 98
477 3300025941 Ga0207711_10098700 Ga0207711_100987002 98
478 3300025941 Ga0207711_10127639 Ga0207711_101276394 98
479 3300025942 Ga0207689_10056964 Ga0207689_100569643 98
480 3300025942 Ga0207689_10496306 Ga0207689_104963062 98
481 3300025944 Ga0207661_10034334 Ga0207661_100343344 98
482 3300025944 Ga0207661_10115633 Ga0207661_101156332 98
483 3300025944 Ga0207661_10270540 Ga0207661_102705402 98
484 3300025944 Ga0207661_10316294 Ga0207661_103162941 98
485 3300025944 Ga0207661_10804851 Ga0207661_108048512 98
486 3300025944 Ga0207661_10956352 Ga0207661_109563522 98
487 3300025945 Ga0207679_10018603 Ga0207679_100186032 98
488 3300025945 Ga0207679_10146618 Ga0207679_101466182 98
489 3300025945 Ga0207679_10762433 Ga0207679_107624332 98
490 3300025960 Ga0207651_12059937 Ga0207651_120599371 98
491 3300025961 Ga0207712_10031248 Ga0207712_100312483 98
492 3300025961 Ga0207712_10065405 Ga0207712_100654054 98
493 3300025961 Ga0207712_10486107 Ga0207712_104861072 98
494 3300025972 Ga0207668_10007215 Ga0207668_100072153 98
495 3300025972 Ga0207668_10124714 Ga0207668_101247142 98
496 3300025972 Ga0207668_10155590 Ga0207668_101555902 98
497 3300025981 Ga0207640_10926036 Ga0207640_109260362 98
498 3300025986 Ga0207658_10020950 Ga0207658_100209501 98
499 3300025986 Ga0207658_11444016 Ga0207658_114440162 98
500 3300025986 Ga0207658_11971881 Ga0207658_119718812 98
501 3300026023 Ga0207677_10020052 Ga0207677_100200526 98
502 3300026035 Ga0207703_10020759 Ga0207703_100207595 98
503 3300026035 Ga0207703_10161344 Ga0207703_101613442 98
504 3300026035 Ga0207703_11762263 Ga0207703_117622632 98
505 3300026035 Ga0207703_11932930 Ga0207703_119329302 98
506 3300026041 Ga0207639_10111178 Ga0207639_101111783 98
507 3300026067 Ga0207678_10033052 Ga0207678_100330522 98
508 3300026067 Ga0207678_10116710 Ga0207678_101167103 98
509 3300026075 Ga0207708_10262170 Ga0207708_102621702 98
510 3300026075 Ga0207708_11557173 Ga0207708_115571731 98
511 3300026078 Ga0207702_10309229 Ga0207702_103092292 98
512 3300026078 Ga0207702_10627982 Ga0207702_106279822 98
513 3300026088 Ga0207641_10164231 Ga0207641_101642311 98
514 3300026095 Ga0207676_10411439 Ga0207676_104114391 98
515 3300026095 Ga0207676_10556710 Ga0207676_105567102 98
516 3300026118 Ga0207675_100237546 Ga0207675_1002375463 98
517 3300026118 Ga0207675_101167344 Ga0207675_1011673442 98
518 3300026118 Ga0207675_101848717 Ga0207675_1018487171 98
519 3300026121 Ga0207683_10088748 Ga0207683_100887482 98
520 3300027617 Ga0210002_1108051 Ga0210002_11080511 98
521 3300027717 Ga0209998_10059150 Ga0209998_100591502 98
522 3300027876 Ga0209974_10219800 Ga0209974_102198002 98
523 3300027907 Ga0207428_10040322 Ga0207428_100403222 98
524 3300027907 Ga0207428_10184683 Ga0207428_101846831 98
525 3300028379 Ga0268266_10204709 Ga0268266_102047091 98
526 3300028379 Ga0268266_11204648 Ga0268266_112046481 98
527 3300028379 Ga0268266_11283747 Ga0268266_112837472 98
528 3300028379 Ga0268266_11556726 Ga0268266_115567262 98
529 3300028380 Ga0268265_10019225 Ga0268265_100192255 98
530 3300028381 Ga0268264_10042385 Ga0268264_100423855 98
531 3300028381 Ga0268264_10049735 Ga0268264_100497353 98
532 3300028381 Ga0268264_12660968 Ga0268264_126609681 98
533 3300028558 Ga0265326_10082652 Ga0265326_100826522 98
534 3300028653 Ga0265323_10040665 Ga0265323_100406652 98
535 3300031251 Ga0265327_10063801 Ga0265327_100638012 98
536 3300031548 Ga0307408_100040831 Ga0307408_1000408312 98
537 3300031548 Ga0307408_100139665 Ga0307408_1001396652 98
538 3300031548 Ga0307408_101391132 Ga0307408_1013911322 98
539 3300031691 Ga0316579_10502126 Ga0316579_105021262 98
540 3300031711 Ga0265314_10128452 Ga0265314_101284522 98
541 3300031712 Ga0265342_10027518 Ga0265342_100275183 98
542 3300031727 Ga0316576_10825821 Ga0316576_108258211 98
543 3300031728 Ga0316578_10255383 Ga0316578_102553832 98
544 3300031731 Ga0307405_10293073 Ga0307405_102930733 98
545 3300031731 Ga0307405_10444504 Ga0307405_104445042 98
546 3300031731 Ga0307405_10496314 Ga0307405_104963141 98
547 3300031731 Ga0307405_10930105 Ga0307405_109301051 98
548 3300031733 Ga0316577_10835322 Ga0316577_108353222 98
549 3300031824 Ga0307413_10035530 Ga0307413_100355305 98
550 3300031852 Ga0307410_10068439 Ga0307410_100684392 98
551 3300031852 Ga0307410_10237853 Ga0307410_102378532 98
552 3300031852 Ga0307410_10516420 Ga0307410_105164203 98
553 3300031852 Ga0307410_10852106 Ga0307410_108521062 98
554 3300031901 Ga0307406_10345085 Ga0307406_103450852 98
555 3300031901 Ga0307406_10401696 Ga0307406_104016962 98
556 3300031903 Ga0307407_10305365 Ga0307407_103053652 98
557 3300031911 Ga0307412_10293265 Ga0307412_102932652 98
558 3300031995 Ga0307409_100034733 Ga0307409_1000347336 98
559 3300031995 Ga0307409_100198618 Ga0307409_1001986182 98
560 3300031995 Ga0307409_100385465 Ga0307409_1003854652 98
561 3300031995 Ga0307409_102540235 Ga0307409_1025402352 98
562 3300032002 Ga0307416_100037330 Ga0307416_1000373307 98
563 3300032002 Ga0307416_100234993 Ga0307416_1002349932 98
564 3300032002 Ga0307416_101418723 Ga0307416_1014187231 98
565 3300032004 Ga0307414_10088334 Ga0307414_100883343 98
566 3300032004 Ga0307414_10101533 Ga0307414_101015332 98
567 3300032005 Ga0307411_10010437 Ga0307411_100104377 98
568 3300032005 Ga0307411_10110875 Ga0307411_101108751 98
569 3300032005 Ga0307411_10133724 Ga0307411_101337242 98
570 3300032126 Ga0307415_100282685 Ga0307415_1002826851 98
571 3300032126 Ga0307415_100379256 Ga0307415_1003792562 98
572 3300032126 Ga0307415_101122121 Ga0307415_1011221212 98
573 3300032168 Ga0316593_10170347 Ga0316593_101703471 98
574 3300034957 Ga0373938_0042998 Ga0373938_0042998_657_953 98
575 3300035086 Ga0373934_0243286 Ga0373934_0243286_140_436 98
576 3300035086 Ga0373934_0286019 Ga0373934_0286019_230_526 98
577 3300035086 Ga0373934_0489000 Ga0373934_0489000_147_443 98
578 3300035088 Ga0373940_0059650 Ga0373940_0059650_476_772 98
579 3300035111 Ga0373923_0126601 Ga0373923_0126601_474_770 98
580 3300035111 Ga0373923_0201467 Ga0373923_0201467_520_816 98
581 3300035112 Ga0373932_0084953 Ga0373932_0084953_695_991 98
582 3300035112 Ga0373932_0121943 Ga0373932_0121943_415_711 98
583 3300035112 Ga0373932_0227489 Ga0373932_0227489_40_336 98
584 3300035113 Ga0373936_0498815 Ga0373936_0498815_128_424 98
585 3300035114 Ga0373939_0215436 Ga0373939_0215436_19_315 98
586 3300035114 Ga0373939_0292483 Ga0373939_0292483_212_508 98
587 3300035115 Ga0373941_0115567 Ga0373941_0115567_210_506 98
588 3300035117 Ga0373953_0148355 Ga0373953_0148355_208_504 98
589 3300035117 Ga0373953_0196340 Ga0373953_0196340_541_837 98
590 3300035118 Ga0373954_0208374 Ga0373954_0208374_277_573 98
591 3300035119 Ga0373956_0124709 Ga0373956_0124709_325_621 98
592 3300035119 Ga0373956_0259708 Ga0373956_0259708_267_563 98
593 3300035120 Ga0373957_0029426 Ga0373957_0029426_1255_1551 98
594 3300035120 Ga0373957_0204186 Ga0373957_0204186_381_677 98
595 3300035170 Ga0373943_0122325 Ga0373943_0122325_890_1186 98
596 3300035172 Ga0373955_0169424 Ga0373955_0169424_286_582 98
597 3300035172 Ga0373955_0349175 Ga0373955_0349175_75_371 98
598 3300035172 Ga0373955_0648238 Ga0373955_0648238_215_511 98
599 3300035207 Ga0373942_0025484 Ga0373942_0025484_262_558 98
600 3300035241 Ga0373961_0301746 Ga0373961_0301746_146_442 98
601 3300035242 Ga0373962_0073255 Ga0373962_0073255_198_494 98
602 3300035398 Ga0316574_0766334 Ga0316574_0766334_81_377 98
603 3300035692 Ga0373935_0229708 Ga0373935_0229708_444_740 98
604 3300035695 Ga0373927_0002811 Ga0373927_0002811_8917_9213 98
605 3300035695 Ga0373927_0184193 Ga0373927_0184193_953_1249 98
606 3300035695 Ga0373927_0301055 Ga0373927_0301055_19_315 98
607 3300035695 Ga0373927_0887304 Ga0373927_0887304_39_335 98
608 3300035724 Ga0373933_0106704 Ga0373933_0106704_1065_1361 98
609 3300035724 Ga0373933_0938569 Ga0373933_0938569_245_541 98
610 3300035725 Ga0373947_0258016 Ga0373947_0258016_714_1010 98
611 3300035725 Ga0373947_0993968 Ga0373947_0993968_97_393 98
612 3300035725 Ga0373947_1157194 Ga0373947_1157194_29_385 98
613 3300036401 Ga0373937_0103062 Ga0373937_0103062_694_990 98
614 3300036401 Ga0373937_0126691 Ga0373937_0126691_323_619 98
615 3300036401 Ga0373937_0179190 Ga0373937_0179190_1535_1831 98
616 3300036401 Ga0373937_0384119 Ga0373937_0384119_104_400 98
617 3300036401 Ga0373937_0877594 Ga0373937_0877594_68_367 98
618 3300036647 Ga0316582_0012184 Ga0316582_0012184_2414_2710 98
619 3300036712 Ga0316584_0017857 Ga0316584_0017857_669_965 98
620 3300036712 Ga0316584_0267267 Ga0316584_0267267_114_428 98
621 3300037068 Ga0373925_0100046 Ga0373925_0100046_1417_1713 98
622 3300037418 Ga0395900_0101330 Ga0395900_0101330_493_789 98
623 3300037418 Ga0395900_0814081 Ga0395900_0814081_401_697 98
624 3300037418 Ga0395900_1073238 Ga0395900_1073238_299_595 98
625 3300037466 Ga0395898_0462286 Ga0395898_0462286_44_340 98
626 3300037471 Ga0395905_0560245 Ga0395905_0560245_268_564 98
627 3300037853 Ga0436364_1092155 Ga0436364_1092155_352_648 98
628 3300037853 Ga0436364_1460655 Ga0436364_1460655_258_554 98
629 3300038443 Ga0395901_0532730 Ga0395901_0532730_674_970 98
630 3300039437 Ga0436365_0224016 Ga0436365_0224016_198_494 98
631 3300039437 Ga0436365_1476328 Ga0436365_1476328_7448_7744 98
632 3300039447 Ga0436361_0786779 Ga0436361_0786779_128474_128770 98
633 3300039453 Ga0436362_0793938 Ga0436362_0793938_676_972 98
634 3300041505 Ga0451849_1440942 Ga0451849_1440942_489_785 98
635 3300041507 Ga0451851_0871010 Ga0451851_0871010_483_779 98
636 3300041512 Ga0451853_2446995 Ga0451853_2446995_456_752 98
637 3300042005 Ga0439448_0055755 Ga0439448_0055755_871_1167 98
638 3300042009 Ga0439451_049454 Ga0439451_049454_320_616 98
639 3300042157 Ga0439458_0007203 Ga0439458_0007203_792_1088 98
640 3300042436 Ga0439435_0156769 Ga0439435_0156769_85_384 98
641 3300042439 Ga0439464_0017396 Ga0439464_0017396_513_821 98
642 3300042461 Ga0439460_0015422 Ga0439460_0015422_223_519 98
643 3300042461 Ga0439460_0240051 Ga0439460_0240051_281_589 98
644 3300042876 Ga0451577_0042049 Ga0451577_0042049_2660_2956 98
645 3300042876 Ga0451577_0692071 Ga0451577_0692071_610_906 98
646 3300042876 Ga0451577_0841633 Ga0451577_0841633_58_354 98
647 3300042876 Ga0451577_0876750 Ga0451577_0876750_156_452 98
648 3300042876 Ga0451577_1817317 Ga0451577_1817317_145_444 98
649 3300044673 Ga0453683_0002195 Ga0453683_0002195_9912_10208 98
650 3300044673 Ga0453683_0135726 Ga0453683_0135726_981_1277 98
651 3300044684 Ga0466966_0008342 Ga0466966_0008342_204_503 98
652 3300044694 Ga0466963_0868561 Ga0466963_0868561_162_458 98
653 3300044706 Ga0466964_0334482 Ga0466964_0334482_206_502 98
654 3300044712 Ga0453684_0056727 Ga0453684_0056727_2801_3097 98
655 3300044712 Ga0453684_0170452 Ga0453684_0170452_1925_2221 98
656 3300044712 Ga0453684_0277627 Ga0453684_0277627_1032_1328 98
657 3300044712 Ga0453684_0485039 Ga0453684_0485039_914_1210 98
658 3300044712 Ga0453684_0574587 Ga0453684_0574587_815_1111 98
659 3300044712 Ga0453684_1147918 Ga0453684_1147918_223_519 98
660 3300045049 Ga0466959_0293038 Ga0466959_0293038_143_442 98
661 3300045051 Ga0451576_0413151 Ga0451576_0413151_693_989 98
662 3300045051 Ga0451576_2183154 Ga0451576_2183154_132_428 98
663 3300045051 Ga0451576_2523353 Ga0451576_2523353_77_373 98
664 3300045976 Ga0466967_0105899 Ga0466967_0105899_2230_2526 98
665 3300045976 Ga0466967_0845278 Ga0466967_0845278_271_567 98
666 3300046454 Ga0495592_0020273 Ga0495592_0020273_2198_2494 98
667 3300046455 Ga0495603_0049371 Ga0495603_0049371_706_1002 98
668 3300046455 Ga0495603_0156048 Ga0495603_0156048_740_1036 98
669 3300046459 Ga0495629_0001099 Ga0495629_0001099_12720_13016 98
670 3300046459 Ga0495629_0084139 Ga0495629_0084139_1880_2176 98
671 3300046459 Ga0495629_0254391 Ga0495629_0254391_334_630 98
672 3300046461 Ga0495641_0035385 Ga0495641_0035385_505_801 98
673 3300046461 Ga0495641_0060507 Ga0495641_0060507_646_942 98
674 3300046462 Ga0495651_0290267 Ga0495651_0290267_721_1017 98
675 3300046462 Ga0495651_0498431 Ga0495651_0498431_277_573 98
676 3300046463 Ga0495653_0086911 Ga0495653_0086911_1562_1858 98
677 3300046463 Ga0495653_0654885 Ga0495653_0654885_291_587 98
678 3300046463 Ga0495653_0759320 Ga0495653_0759320_260_556 98
679 3300046463 Ga0495653_0828994 Ga0495653_0828994_28_324 98
680 3300046472 Ga0495580_0178155 Ga0495580_0178155_565_861 98
681 3300046472 Ga0495580_1015991 Ga0495580_1015991_148_444 98
682 3300046473 Ga0495582_0011615 Ga0495582_0011615_2465_2761 98
683 3300046473 Ga0495582_0053264 Ga0495582_0053264_1649_1945 98
684 3300046473 Ga0495582_0538493 Ga0495582_0538493_19_315 98
685 3300046475 Ga0495639_0047642 Ga0495639_0047642_795_1091 98
686 3300046475 Ga0495639_0517273 Ga0495639_0517273_216_512 98
687 3300046475 Ga0495639_0533918 Ga0495639_0533918_239_535 98
688 3300046475 Ga0495639_0630901 Ga0495639_0630901_199_495 98
689 3300046476 Ga0495662_0171116 Ga0495662_0171116_424_720 98
690 3300046476 Ga0495662_0331137 Ga0495662_0331137_285_581 98
691 3300046476 Ga0495662_0678010 Ga0495662_0678010_18_314 98
692 3300046477 Ga0495664_0024014 Ga0495664_0024014_1059_1355 98
693 3300046477 Ga0495664_0534803 Ga0495664_0534803_101_397 98
694 3300046492 Ga0495585_0572150 Ga0495585_0572150_13_309 98
695 3300046499 Ga0495594_0006555 Ga0495594_0006555_1015_1311 98
696 3300046499 Ga0495594_0008374 Ga0495594_0008374_2675_2971 98
697 3300046501 Ga0495607_0451831 Ga0495607_0451831_85_381 98
698 3300046511 Ga0495608_0162766 Ga0495608_0162766_122_418 98
699 3300046511 Ga0495608_0342425 Ga0495608_0342425_73_369 98
700 3300046514 Ga0495618_0015458 Ga0495618_0015458_2867_3163 98
701 3300046514 Ga0495618_0214412 Ga0495618_0214412_661_957 98
702 3300046516 Ga0495628_0044764 Ga0495628_0044764_3021_3317 98
703 3300046516 Ga0495628_0490409 Ga0495628_0490409_496_792 98
704 3300046517 Ga0495630_0024804 Ga0495630_0024804_2756_3052 98
705 3300046517 Ga0495630_0040314 Ga0495630_0040314_609_905 98
706 3300046517 Ga0495630_0316882 Ga0495630_0316882_581_877 98
707 3300046517 Ga0495630_0390217 Ga0495630_0390217_327_623 98
708 3300046520 Ga0495637_0184711 Ga0495637_0184711_173_469 98
709 3300046523 Ga0495644_0342905 Ga0495644_0342905_180_476 98
710 3300046526 Ga0495666_0035153 Ga0495666_0035153_1478_1774 98
711 3300046526 Ga0495666_0241262 Ga0495666_0241262_216_512 98
712 3300046529 Ga0495652_0060309 Ga0495652_0060309_890_1186 98
713 3300046529 Ga0495652_0255004 Ga0495652_0255004_315_611 98
714 3300046531 Ga0495665_0634456 Ga0495665_0634456_143_439 98
715 3300046533 Ga0495640_0057781 Ga0495640_0057781_1684_1980 98
716 3300046533 Ga0495640_0062753 Ga0495640_0062753_1575_1871 98
717 3300046533 Ga0495640_0941790 Ga0495640_0941790_66_362 98
718 3300046535 Ga0495586_0044188 Ga0495586_0044188_1945_2241 98
719 3300046535 Ga0495586_0059714 Ga0495586_0059714_181_477 98
720 3300046535 Ga0495586_0087441 Ga0495586_0087441_64_360 98
721 3300046535 Ga0495586_0383120 Ga0495586_0383120_241_537 98
722 3300046535 Ga0495586_0931272 Ga0495586_0931272_150_452 98
723 3300046536 Ga0495587_0048084 Ga0495587_0048084_838_1134 98
724 3300046536 Ga0495587_0469760 Ga0495587_0469760_318_614 98
725 3300046536 Ga0495587_0526367 Ga0495587_0526367_22_318 98
726 3300046543 Ga0495645_0003220 Ga0495645_0003220_9263_9559 98
727 3300046543 Ga0495645_0077919 Ga0495645_0077919_1716_2012 98
728 3300046543 Ga0495645_0229600 Ga0495645_0229600_207_509 98
729 3300046543 Ga0495645_0440512 Ga0495645_0440512_197_493 98
730 3300046559 Ga0495667_0482072 Ga0495667_0482072_195_491 98
731 3300046642 Ga0495634_0080075 Ga0495634_0080075_251_547 98
732 3300046642 Ga0495634_0149284 Ga0495634_0149284_712_1008 98
733 3300046648 Ga0495611_0198955 Ga0495611_0198955_439_735 98
734 3300046663 Ga0495635_0005233 Ga0495635_0005233_4243_4539 98
735 3300046663 Ga0495635_0403481 Ga0495635_0403481_198_494 98
736 3300046663 Ga0495635_0947418 Ga0495635_0947418_30_326 98
737 3300046675 Ga0495657_0188742 Ga0495657_0188742_833_1129 98
738 3300046675 Ga0495657_0834615 Ga0495657_0834615_166_468 98
739 3300046678 Ga0495599_0006509 Ga0495599_0006509_4808_5104 98
740 3300046679 Ga0495623_0009108 Ga0495623_0009108_4865_5161 98
741 3300046679 Ga0495623_0719139 Ga0495623_0719139_49_345 98
742 3300046680 Ga0495646_0108517 Ga0495646_0108517_1205_1501 98
743 3300046681 Ga0495647_0016331 Ga0495647_0016331_1362_1658 98
744 3300046681 Ga0495647_0060970 Ga0495647_0060970_661_957 98
745 3300046683 Ga0495658_0002224 Ga0495658_0002224_4794_5090 98
746 3300046683 Ga0495658_0047774 Ga0495658_0047774_369_665 98
747 3300046683 Ga0495658_0123254 Ga0495658_0123254_814_1116 98
748 3300046683 Ga0495658_0273510 Ga0495658_0273510_495_791 98
749 3300046683 Ga0495658_0480102 Ga0495658_0480102_280_576 98
750 3300046684 Ga0495669_0413907 Ga0495669_0413907_82_378 98
751 3300046689 Ga0495613_0002740 Ga0495613_0002740_3300_3596 98
752 3300046689 Ga0495613_0028292 Ga0495613_0028292_1458_1754 98
753 3300046689 Ga0495613_0072994 Ga0495613_0072994_2144_2440 98
754 3300046690 Ga0495624_0313102 Ga0495624_0313102_398_694 98
755 3300046809 Ga0495600_0193625 Ga0495600_0193625_922_1218 98
756 3300047315 Ga0495581_0004247 Ga0495581_0004247_2117_2413 98
757 3300047315 Ga0495581_0222804 Ga0495581_0222804_226_522 98
758 3300047315 Ga0495581_0312131 Ga0495581_0312131_226_522 98
759 3300047315 Ga0495581_0618525 Ga0495581_0618525_302_598 98
760 3300047317 Ga0495604_0324751 Ga0495604_0324751_117_413 98
761 3300047319 Ga0495674_0062901 Ga0495674_0062901_2811_3107 98
762 3300047319 Ga0495674_0802101 Ga0495674_0802101_328_624 98
763 3300047319 Ga0495674_0927350 Ga0495674_0927350_69_365 98
764 3300047321 Ga0495676_0259471 Ga0495676_0259471_663_959 98
765 3300047321 Ga0495676_0290060 Ga0495676_0290060_786_1082 98
766 3300047322 Ga0495680_0001823 Ga0495680_0001823_13805_14101 98
767 3300047322 Ga0495680_0602878 Ga0495680_0602878_242_538 98
768 3300047444 Ga0495675_0046827 Ga0495675_0046827_1036_1332 98
769 3300047471 Ga0495684_0091335 Ga0495684_0091335_224_520 98
770 3300047471 Ga0495684_0132989 Ga0495684_0132989_151_447 98
771 3300047471 Ga0495684_0832316 Ga0495684_0832316_95_391 98
772 3300047673 Ga0495593_0107907 Ga0495593_0107907_651_947 98
773 3300048088 Ga0495602_0049168 Ga0495602_0049168_2751_3047 98
774 3300048088 Ga0495602_0714855 Ga0495602_0714855_222_518 98
775 3300048089 Ga0495614_0004515 Ga0495614_0004515_5437_5733 98
776 3300048903 Ga0496100_0036655 Ga0496100_0036655_1811_2107 98
777 3300048903 Ga0496100_0210224 Ga0496100_0210224_1036_1332 98
778 3300048904 Ga0496101_0407012 Ga0496101_0407012_424_720 98
779 3300048904 Ga0496101_0743474 Ga0496101_0743474_375_671 98
780 3300048905 Ga0496102_0152597 Ga0496102_0152597_1715_2011 98
781 3300048905 Ga0496102_0162326 Ga0496102_0162326_1374_1670 98
782 3300048905 Ga0496102_0702019 Ga0496102_0702019_394_690 98
783 3300048906 Ga0496103_0070109 Ga0496103_0070109_1857_2153 98
784 3300048906 Ga0496103_0209653 Ga0496103_0209653_207_503 98
785 3300048907 Ga0496104_0084018 Ga0496104_0084018_2002_2298 98
786 3300048907 Ga0496104_0141876 Ga0496104_0141876_1158_1454 98
787 3300048907 Ga0496104_0340856 Ga0496104_0340856_781_1077 98
788 3300048908 Ga0496105_0071581 Ga0496105_0071581_603_899 98
789 3300048908 Ga0496105_0489254 Ga0496105_0489254_201_497 98
790 3300048909 Ga0496106_0027205 Ga0496106_0027205_1820_2116 98
791 3300048909 Ga0496106_0156683 Ga0496106_0156683_970_1266 98
792 3300048910 Ga0496107_0324934 Ga0496107_0324934_232_528 98
793 3300048911 Ga0496108_0006877 Ga0496108_0006877_2585_2881 98
794 3300048912 Ga0496109_0005698 Ga0496109_0005698_6331_6627 98
795 3300048912 Ga0496109_0864380 Ga0496109_0864380_373_669 98
796 3300048912 Ga0496109_1166504 Ga0496109_1166504_60_356 98
797 3300048913 Ga0496110_0054349 Ga0496110_0054349_1982_2278 98
798 3300048914 Ga0496111_0064511 Ga0496111_0064511_2036_2332 98
799 3300048914 Ga0496111_0320652 Ga0496111_0320652_53_349 98
800 3300048915 Ga0496112_0047502 Ga0496112_0047502_1681_1977 98
801 3300048915 Ga0496112_0095053 Ga0496112_0095053_1271_1567 98
802 3300048915 Ga0496112_0101887 Ga0496112_0101887_781_1077 98
803 3300048915 Ga0496112_0129670 Ga0496112_0129670_1315_1611 98
804 3300048915 Ga0496112_0613018 Ga0496112_0613018_226_522 98
805 3300048915 Ga0496112_1434622 Ga0496112_1434622_213_509 98
806 3300048916 Ga0496113_0014627 Ga0496113_0014627_2250_2546 98
807 3300048917 Ga0496114_0099938 Ga0496114_0099938_811_1113 98
808 3300048918 Ga0496115_0014127 Ga0496115_0014127_3746_4042 98
809 3300048918 Ga0496115_0046704 Ga0496115_0046704_2613_2909 98
810 3300048918 Ga0496115_0155585 Ga0496115_0155585_594_890 98
811 3300048918 Ga0496115_0592420 Ga0496115_0592420_206_502 98
812 3300049514 Ga0501291_024184 Ga0501291_024184_551_859 98
813 3300049520 Ga0501297_056380 Ga0501297_056380_26_322 98
814 3300049521 Ga0501298_131132 Ga0501298_131132_145_441 98
815 3300049568 Ga0501031_0018229 Ga0501031_0018229_1014_1313 98
816 3300049568 Ga0501031_0167702 Ga0501031_0167702_944_1240 98
817 3300049568 Ga0501031_0248802 Ga0501031_0248802_540_836 98
818 3300049568 Ga0501031_0539712 Ga0501031_0539712_151_450 98
819 3300049569 Ga0501032_0003383 Ga0501032_0003383_7526_7825 98
820 3300049569 Ga0501032_0167591 Ga0501032_0167591_206_502 98
821 3300049569 Ga0501032_0239273 Ga0501032_0239273_655_954 98
822 3300049570 Ga0501033_0006909 Ga0501033_0006909_5624_5923 98
823 3300049570 Ga0501033_0007700 Ga0501033_0007700_1669_1968 98
824 3300049570 Ga0501033_0085701 Ga0501033_0085701_1285_1581 98
825 3300049571 Ga0501034_0027970 Ga0501034_0027970_2929_3228 98
826 3300049571 Ga0501034_0594484 Ga0501034_0594484_507_806 98
827 3300049572 Ga0501036_0011871 Ga0501036_0011871_3992_4291 98
828 3300049572 Ga0501036_0030043 Ga0501036_0030043_1314_1610 98
829 3300049572 Ga0501036_0037388 Ga0501036_0037388_133_432 98
830 3300049572 Ga0501036_0376816 Ga0501036_0376816_771_1067 98
831 3300049572 Ga0501036_0566641 Ga0501036_0566641_435_731 98
832 3300049573 Ga0501037_0002059 Ga0501037_0002059_933_1232 98
833 3300049573 Ga0501037_0003998 Ga0501037_0003998_5983_6282 98
834 3300049574 Ga0501038_0002739 Ga0501038_0002739_3676_3975 98
835 3300049574 Ga0501038_0004476 Ga0501038_0004476_8908_9207 98
836 3300049574 Ga0501038_0022090 Ga0501038_0022090_1310_1606 98
837 3300049574 Ga0501038_0488687 Ga0501038_0488687_613_909 98
838 3300049575 Ga0501039_0008614 Ga0501039_0008614_102_401 98
839 3300049575 Ga0501039_0044377 Ga0501039_0044377_1868_2164 98
840 3300049576 Ga0501040_0001593 Ga0501040_0001593_10700_10996 98
841 3300049576 Ga0501040_0152070 Ga0501040_0152070_529_825 98
842 3300049576 Ga0501040_0517971 Ga0501040_0517971_552_848 98
843 3300049576 Ga0501040_0654286 Ga0501040_0654286_209_505 98
844 3300049576 Ga0501040_1123033 Ga0501040_1123033_231_533 98
845 3300049577 Ga0501041_0003041 Ga0501041_0003041_8031_8327 98
846 3300049577 Ga0501041_0085880 Ga0501041_0085880_676_972 98
847 3300049578 Ga0501042_0012537 Ga0501042_0012537_1354_1650 98
848 3300049578 Ga0501042_0021094 Ga0501042_0021094_1854_2153 98
849 3300049578 Ga0501042_0166820 Ga0501042_0166820_1034_1333 98
850 3300049578 Ga0501042_0244400 Ga0501042_0244400_921_1217 98
851 3300049579 Ga0501043_0010777 Ga0501043_0010777_5887_6186 98
852 3300049579 Ga0501043_0037467 Ga0501043_0037467_2922_3218 98
853 3300049579 Ga0501043_0089788 Ga0501043_0089788_419_718 98
854 3300049580 Ga0501046_0005343 Ga0501046_0005343_8166_8462 98
855 3300049580 Ga0501046_0019262 Ga0501046_0019262_4411_4710 98
856 3300049580 Ga0501046_0072456 Ga0501046_0072456_1230_1529 98
857 3300049581 Ga0501047_0038159 Ga0501047_0038159_3764_4063 98
858 3300049581 Ga0501047_0107733 Ga0501047_0107733_2135_2437 98
859 3300049582 Ga0501048_0028583 Ga0501048_0028583_2620_2916 98
860 3300049582 Ga0501048_0030914 Ga0501048_0030914_2283_2582 98
861 3300049582 Ga0501048_0252761 Ga0501048_0252761_88_387 98
862 3300049583 Ga0501067_0234157 Ga0501067_0234157_624_920 98
863 3300049584 Ga0501068_0044955 Ga0501068_0044955_1300_1596 98
864 3300049584 Ga0501068_0048138 Ga0501068_0048138_429_728 98
865 3300049584 Ga0501068_0057085 Ga0501068_0057085_225_524 98
866 3300049585 Ga0501069_0005632 Ga0501069_0005632_1949_2248 98
867 3300049585 Ga0501069_0038958 Ga0501069_0038958_2049_2348 98
868 3300049586 Ga0501070_0004715 Ga0501070_0004715_933_1232 98
869 3300049586 Ga0501070_0014953 Ga0501070_0014953_1640_1939 98
870 3300049586 Ga0501070_0099251 Ga0501070_0099251_1186_1482 98
871 3300049586 Ga0501070_0538842 Ga0501070_0538842_443_745 98
872 3300049587 Ga0501071_0007897 Ga0501071_0007897_1281_1577 98
873 3300049587 Ga0501071_0009794 Ga0501071_0009794_3321_3620 98
874 3300049587 Ga0501071_0132551 Ga0501071_0132551_575_871 98
875 3300049588 Ga0501072_0003614 Ga0501072_0003614_1365_1661 98
876 3300049588 Ga0501072_0021126 Ga0501072_0021126_3326_3625 98
877 3300049588 Ga0501072_0066999 Ga0501072_0066999_1334_1633 98
878 3300049588 Ga0501072_0132127 Ga0501072_0132127_509_805 98
879 3300049588 Ga0501072_0641779 Ga0501072_0641779_147_443 98
880 3300049589 Ga0501073_0016233 Ga0501073_0016233_1843_2142 98
881 3300049589 Ga0501073_0017742 Ga0501073_0017742_442_741 98
882 3300049590 Ga0501074_0017399 Ga0501074_0017399_2411_2710 98
883 3300049590 Ga0501074_0035170 Ga0501074_0035170_2566_2865 98
884 3300049590 Ga0501074_0040296 Ga0501074_0040296_1297_1593 98
885 3300049590 Ga0501074_0138096 Ga0501074_0138096_40_336 98
886 3300049590 Ga0501074_0793606 Ga0501074_0793606_154_450 98
887 3300049591 Ga0501075_0013585 Ga0501075_0013585_1323_1619 98
888 3300049591 Ga0501075_0199990 Ga0501075_0199990_607_903 98
889 3300049591 Ga0501075_0342902 Ga0501075_0342902_550_846 98
890 3300049592 Ga0501076_0014603 Ga0501076_0014603_1370_1666 98
891 3300049592 Ga0501076_0138152 Ga0501076_0138152_1439_1735 98
892 3300049592 Ga0501076_0179220 Ga0501076_0179220_1163_1462 98
893 3300049593 Ga0501077_0000195 Ga0501077_0000195_27499_27795 98
894 3300049656 Ga0501209_281424 Ga0501209_281424_146_442 98
895 3300049660 Ga0501216_179218 Ga0501216_179218_69_365 98
896 3300049661 Ga0501217_139282 Ga0501217_139282_315_623 98
897 3300049661 Ga0501217_158879 Ga0501217_158879_204_500 98
898 3300049664 Ga0501224_048024 Ga0501224_048024_295_603 98
899 3300049669 Ga0501235_105739 Ga0501235_105739_107_403 98
900 3300049670 Ga0501236_121645 Ga0501236_121645_42_350 98
901 3300049676 Ga0501246_047655 Ga0501246_047655_172_480 98
902 3300049679 Ga0501249_155783 Ga0501249_155783_79_375 98
903 3300049683 Ga0501253_068374 Ga0501253_068374_468_764 98
904 3300049688 Ga0501259_173066 Ga0501259_173066_125_421 98
905 3300049705 Ga0501225_0047104 Ga0501225_0047104_378_674 98
906 3300049741 Ga0501079_0000550 Ga0501079_0000550_23666_23962 98
907 3300049741 Ga0501079_0004103 Ga0501079_0004103_1687_1986 98
908 3300049741 Ga0501079_0024449 Ga0501079_0024449_2697_2996 98
909 3300049741 Ga0501079_0273200 Ga0501079_0273200_506_802 98
910 3300049742 Ga0501080_0039009 Ga0501080_0039009_1139_1435 98
911 3300049742 Ga0501080_0057753 Ga0501080_0057753_2530_2829 98
912 3300049742 Ga0501080_0128792 Ga0501080_0128792_890_1192 98
913 3300049742 Ga0501080_0617136 Ga0501080_0617136_79_378 98
914 3300049742 Ga0501080_0655368 Ga0501080_0655368_329_625 98
915 3300049742 Ga0501080_0963360 Ga0501080_0963360_74_370 98
916 3300049742 Ga0501080_1069596 Ga0501080_1069596_317_613 98
917 3300049743 Ga0501081_0000417 Ga0501081_0000417_2242_2538 98
918 3300049743 Ga0501081_0606153 Ga0501081_0606153_342_638 98
919 3300049744 Ga0501083_0140019 Ga0501083_0140019_765_1064 98
920 3300049744 Ga0501083_0199946 Ga0501083_0199946_472_768 98
921 3300049762 Ga0501265_043223 Ga0501265_043223_264_572 98
922 3300049765 Ga0501268_063414 Ga0501268_063414_241_549 98
923 3300049765 Ga0501268_067290 Ga0501268_067290_52_348 98
924 3300049767 Ga0501270_143501 Ga0501270_143501_21_317 98
925 3300049772 Ga0501275_095455 Ga0501275_095455_50_346 98
926 3300049822 Ga0501035_0000755 Ga0501035_0000755_3892_4191 98
927 3300049822 Ga0501035_0004158 Ga0501035_0004158_13101_13400 98
928 3300049822 Ga0501035_0119843 Ga0501035_0119843_892_1188 98
929 3300049822 Ga0501035_0178236 Ga0501035_0178236_542_838 98
930 3300049823 Ga0501044_0000720 Ga0501044_0000720_27340_27642 98
931 3300049823 Ga0501044_0006098 Ga0501044_0006098_6533_6829 98
932 3300049823 Ga0501044_0119802 Ga0501044_0119802_420_719 98
933 3300049824 Ga0501045_0004294 Ga0501045_0004294_1130_1426 98
934 3300049824 Ga0501045_0161908 Ga0501045_0161908_191_490 98
935 3300049824 Ga0501045_0550843 Ga0501045_0550843_289_585 98
936 3300049824 Ga0501045_0715067 Ga0501045_0715067_353_649 98
937 3300050507 nmdc:mga05p37_102127_c1 nmdc:mga05p37_102127_c1_3199_3495 98
938 3300050507 nmdc:mga05p37_164566_c1 nmdc:mga05p37_164566_c1_1469_1765 98
939 3300050507 nmdc:mga05p37_1678919_c1 nmdc:mga05p37_1678919_c1_91_387 98
940 3300050507 nmdc:mga05p37_174928_c1 nmdc:mga05p37_174928_c1_1721_2017 98
941 3300050507 nmdc:mga05p37_194455_c1 nmdc:mga05p37_194455_c1_1197_1493 98
942 3300050507 nmdc:mga05p37_365514_c1 nmdc:mga05p37_365514_c1_1083_1379 98
943 3300050507 nmdc:mga05p37_490851_c1 nmdc:mga05p37_490851_c1_432_728 98
944 3300050507 nmdc:mga05p37_534663_c1 nmdc:mga05p37_534663_c1_442_738 98
945 3300050507 nmdc:mga05p37_607250_c1 nmdc:mga05p37_607250_c1_758_1054 98
946 3300050507 nmdc:mga05p37_633_c1 nmdc:mga05p37_633_c1_20546_20854 98
947 3300050508 nmdc:mga09592_184992_c1 nmdc:mga09592_184992_c1_1448_1747 98
948 3300050508 nmdc:mga09592_2699_c1 nmdc:mga09592_2699_c1_7154_7450 98
949 3300050508 nmdc:mga09592_349494_c1 nmdc:mga09592_349494_c1_890_1189 98
950 3300050508 nmdc:mga09592_430577_c1 nmdc:mga09592_430577_c1_664_960 98
951 3300050508 nmdc:mga09592_831524_c1 nmdc:mga09592_831524_c1_330_638 98
952 3300050508 nmdc:mga09592_94227_c1 nmdc:mga09592_94227_c1_1246_1542 98
953 3300050509 nmdc:mga0qj67_120247_c1 nmdc:mga0qj67_120247_c1_1570_1869 98
954 3300050509 nmdc:mga0qj67_1232144_c1 nmdc:mga0qj67_1232144_c1_137_433 98
955 3300050509 nmdc:mga0qj67_201930_c1 nmdc:mga0qj67_201930_c1_474_770 98
956 3300050509 nmdc:mga0qj67_45433_c1 nmdc:mga0qj67_45433_c1_1366_1662 98
957 3300050509 nmdc:mga0qj67_653897_c1 nmdc:mga0qj67_653897_c1_67_366 98
958 3300050509 nmdc:mga0qj67_7159_c1 nmdc:mga0qj67_7159_c1_5328_5636 98
959 3300050510 nmdc:mga06r32_181086_c1 nmdc:mga06r32_181086_c1_792_1088 98
960 3300050510 nmdc:mga06r32_249004_c1 nmdc:mga06r32_249004_c1_236_535 98
961 3300050510 nmdc:mga06r32_295506_c1 nmdc:mga06r32_295506_c1_797_1093 98
962 3300050510 nmdc:mga06r32_522930_c1 nmdc:mga06r32_522930_c1_814_1110 98
963 3300050510 nmdc:mga06r32_529778_c1 nmdc:mga06r32_529778_c1_561_857 98
964 3300050510 nmdc:mga06r32_55823_c1 nmdc:mga06r32_55823_c1_1551_1859 98
965 3300050510 nmdc:mga06r32_740158_c1 nmdc:mga06r32_740158_c1_542_841 98
966 3300050510 nmdc:mga06r32_9119_c1 nmdc:mga06r32_9119_c1_3354_3650 98
967 3300050511 nmdc:mga08y16_126451_c1 nmdc:mga08y16_126451_c1_2275_2574 98
968 3300050511 nmdc:mga08y16_43032_c1 nmdc:mga08y16_43032_c1_3013_3321 98
969 3300050511 nmdc:mga08y16_661696_c1 nmdc:mga08y16_661696_c1_88_384 98
970 3300050511 nmdc:mga08y16_690683_c1 nmdc:mga08y16_690683_c1_142_438 98
971 3300050511 nmdc:mga08y16_733777_c1 nmdc:mga08y16_733777_c1_178_474 98
972 3300050512 nmdc:mga0n895_1038255_c1 nmdc:mga0n895_1038255_c1_181_477 98
973 3300050512 nmdc:mga0n895_432797_c1 nmdc:mga0n895_432797_c1_294_590 98
974 3300050512 nmdc:mga0n895_500980_c1 nmdc:mga0n895_500980_c1_192_488 98
975 3300050513 nmdc:mga0rr50_143618_c1 nmdc:mga0rr50_143618_c1_993_1289 98
976 3300050513 nmdc:mga0rr50_248599_c1 nmdc:mga0rr50_248599_c1_140_436 98
977 3300050513 nmdc:mga0rr50_924910_c1 nmdc:mga0rr50_924910_c1_364_660 98
978 3300050514 nmdc:mga08x19_1301049_c1 nmdc:mga08x19_1301049_c1_198_494 98
979 3300050515 nmdc:mga0a205_147129_c1 nmdc:mga0a205_147129_c1_1509_1805 98
980 3300050515 nmdc:mga0a205_1535753_c1 nmdc:mga0a205_1535753_c1_87_383 98
981 3300050515 nmdc:mga0a205_2526_c1 nmdc:mga0a205_2526_c1_5809_6105 98
982 3300053077 Ga0495601_0592659 Ga0495601_0592659_399_695 98
983 3300053077 Ga0495601_0951339 Ga0495601_0951339_100_396 98
984 3300053077 Ga0495601_1006588 Ga0495601_1006588_25_321 98
985 3300053078 Ga0495612_0293078 Ga0495612_0293078_304_600 98
986 3300053084 Ga0495595_0151108 Ga0495595_0151108_33_329 98
987 3300053085 Ga0495619_0002333 Ga0495619_0002333_1363_1659 98
988 3300053085 Ga0495619_0140233 Ga0495619_0140233_266_562 98
989 3300053085 Ga0495619_0167688 Ga0495619_0167688_31_387 98
990 3300053085 Ga0495619_0372981 Ga0495619_0372981_325_621 98
991 3300054114 Ga0501084_0001686 Ga0501084_0001686_1295_1591 98
992 3300054114 Ga0501084_0013262 Ga0501084_0013262_4528_4827 98
993 3300054114 Ga0501084_0074012 Ga0501084_0074012_2442_2741 98
994 3300054114 Ga0501084_0288161 Ga0501084_0288161_211_507 98
995 3300054114 Ga0501084_0613396 Ga0501084_0613396_434_730 98
996 3300059492 Ga0587073_0158992 Ga0587073_0158992_226_525 98
997 3300060353 Ga0501082_0003168 Ga0501082_0003168_12790_13089 98
998 3300060353 Ga0501082_0006761 Ga0501082_0006761_8199_8495 98
999 3300060353 Ga0501082_0027927 Ga0501082_0027927_98_397 98
1000 3300060353 Ga0501082_0096896 Ga0501082_0096896_1451_1753 98
1001 3300060353 Ga0501082_1207546 Ga0501082_1207546_162_458 98
1002 3300061734 Ga0530510_0008140 Ga0530510_0008140_6472_6768 98
1003 3300061734 Ga0530510_0407184 Ga0530510_0407184_501_797 98
1004 3300061734 Ga0530510_0867635 Ga0530510_0867635_23_319 98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8565 3 95
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8345 3 98
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8129 3 95
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8082 3 93
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8013 3 98
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8565 3 95 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8129 3 95 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8124 1 98 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8096 3 94 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.806 2 95 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 0.9965 1 46
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9924 1 94
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.9893 1 84
AF-A0A3N5W3B6-F1-model_v4 MoaD/ThiS family protein 0.9886 1 67
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9882 1 85

Feature Viewer

pLDDT pTM Quality
92.32 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map