F487938

General Info

Members Datasets Scaffolds Average Seq Length
1003 439 971 309

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0078149|Ga0373947_0078149_985_2022
Length 345
Sequence MAHCADWRFYAQRVHGFIVSDVGVMKELSAGTMLDPASSASFAARLDAIARDVENLLDRLLASGGEDIEITRPRRLLDAMRYGSLGGGKRLRPFLVVESASLFGVPLGNGLMAGAALECIHCYSLIHDDLPAMDNDDLRRGRPTVHRAFDDATAILAGDGLLTFAFDLLSRPETSADPAIRVELVKMLSRAAGIGGMVGGQMLDLAAEGRFAQGASNKLTERDVAVLQAMKTGALLRFACNAGAILGQASDNEAAALDRFGDAIGQAFQIADDLLDVEGDSVVVGKATGKDAAAGKATMVSILGVAGAKARLHELVAGAEDALAPFGTAGTTLVTAARFIADRRS

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
7 2643221733 Bosea sp. Root381 Isolate Unclassified
8 2643221736 Bosea sp. Root483D1 Isolate Unclassified
9 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
10 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
11 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
12 2773857925 Microvirga vignae BR3299 Isolate Unclassified
13 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
14 2818991467 Bosea vestrisii 3192 Isolate Unclassified
15 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
16 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
17 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
18 2842694124 Methylopila sp. R-72369 Isolate Unclassified
19 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
20 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
21 2851182111 Bosea sp. Tri-44 Isolate Nodule
22 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
23 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
24 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
25 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
26 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
27 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
28 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
29 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
30 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
31 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
32 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
33 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
34 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
36 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
223 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
226 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
227 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
235 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
249 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
258 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
265 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
279 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
284 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
285 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
286 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
287 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
288 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
289 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
294 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
299 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
307 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
308 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
309 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
310 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
311 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
312 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
313 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
319 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
320 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
321 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
329 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
343 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
358 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
359 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
360 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
361 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
362 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
363 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
366 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
367 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
368 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
369 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
370 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
390 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
391 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
392 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
393 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
394 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
395 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
398 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
399 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
400 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
401 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
404 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
405 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
408 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
409 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
410 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
411 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
412 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
413 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
414 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
415 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
416 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
417 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
418 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
421 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
422 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
423 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
424 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
425 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
426 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
427 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
428 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
429 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
430 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
431 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
432 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
433 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
434 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
435 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
436 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
437 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
438 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
439 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0.6
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.28
Nodule 0.6
Rhizoplane 8.37
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002311 3300001977 Bacteria 3046
2 JGI24742J22300_10001731 3300002244 Bacteria 3475
3 JGI24751J29686_10012415 3300002459 Bacteria 1757
4 JGI25406J46586_10028084 3300003203 Bacteria 2147
5 Ga0006562J51391_1044411 3300003578 Bacteria 2840
6 Ga0006562J51391_1044412 3300003578 Bacteria 2349
7 JGI25404J52841_10006833 3300003659 Bacteria 2397
8 Ga0055526_1000554 3300003771 Bacteria 29519
9 Ga0055526_1004638 3300003771 Bacteria 8178
10 Ga0055526_1007988 3300003771 Bacteria 5364
11 Ga0055524_1000283 3300003775 Bacteria 49569
12 Ga0065165_1000014 3300005262 Bacteria 292366
13 Ga0065707_10187933 3300005295 Bacteria 1378
14 Ga0070676_10059345 3300005328 Bacteria 2269
15 Ga0070676_10079333 3300005328 Bacteria 1988
16 Ga0070690_100229382 3300005330 Bacteria 1305
17 Ga0070670_100015801 3300005331 Bacteria 6480
18 Ga0070670_100152008 3300005331 Bacteria 2003
19 Ga0070677_10067371 3300005333 Bacteria 1495
20 Ga0070666_10017740 3300005335 Bacteria 4567
21 Ga0070680_100038585 3300005336 Bacteria 3863
22 Ga0070680_100087772 3300005336 Bacteria 2572
23 Ga0070682_100016862 3300005337 Bacteria 4251
24 Ga0068868_100054268 3300005338 Bacteria 3158
25 Ga0070660_100062622 3300005339 Bacteria 2890
26 Ga0070660_100269482 3300005339 Bacteria 1391
27 Ga0070689_100019555 3300005340 Bacteria 5010
28 Ga0070689_100072734 3300005340 Bacteria 2687
29 Ga0070661_100206365 3300005344 Bacteria 1503
30 Ga0070669_100066683 3300005353 Bacteria 2654
31 Ga0070675_100040621 3300005354 Bacteria 3798
32 Ga0070675_100053603 3300005354 Bacteria 3317
33 Ga0070675_100089330 3300005354 Bacteria 2580
34 Ga0070671_100000776 3300005355 Bacteria 22927
35 Ga0070671_100149828 3300005355 Bacteria 1970
36 Ga0070674_100084072 3300005356 Bacteria 2281
37 Ga0070673_100005013 3300005364 Bacteria 8447
38 Ga0070673_100010439 3300005364 Bacteria 6287
39 Ga0070688_100009732 3300005365 Bacteria 5276
40 Ga0070688_100036231 3300005365 Bacteria 2999
41 Ga0070688_100064312 3300005365 Bacteria 2328
42 Ga0070659_100020949 3300005366 Bacteria 4972
43 Ga0070659_100032106 3300005366 Bacteria 4070
44 Ga0070667_100111510 3300005367 Bacteria 2373
45 Ga0070667_100154760 3300005367 Bacteria 2016
46 Ga0070709_10235803 3300005434 Bacteria 1311
47 Ga0070714_100017639 3300005435 Bacteria 5786
48 Ga0070714_100029246 3300005435 Bacteria 4580
49 Ga0070714_100033778 3300005435 Bacteria 4279
50 Ga0070714_100229399 3300005435 Bacteria 1710
51 Ga0070714_100272207 3300005435 Bacteria 1571
52 Ga0070714_100309079 3300005435 Bacteria 1475
53 Ga0070713_100061827 3300005436 Bacteria 3134
54 Ga0070713_100178332 3300005436 Bacteria 1908
55 Ga0070713_100307697 3300005436 Bacteria 1461
56 Ga0070713_100342449 3300005436 Bacteria 1385
57 Ga0070710_10007515 3300005437 Bacteria 5280
58 Ga0070710_10136370 3300005437 Bacteria 1501
59 Ga0070710_10149188 3300005437 Bacteria 1441
60 Ga0070711_100026936 3300005439 Bacteria 3770
61 Ga0070711_100035081 3300005439 Bacteria 3351
62 Ga0070711_100067116 3300005439 Bacteria 2516
63 Ga0070708_100015368 3300005445 Bacteria 6321
64 Ga0070663_100009309 3300005455 Bacteria 6079
65 Ga0070681_10018284 3300005458 Bacteria 7006
66 Ga0070681_10110314 3300005458 Bacteria 2691
67 Ga0070681_10342099 3300005458 Bacteria 1406
68 Ga0070681_10374909 3300005458 Bacteria 1333
69 Ga0070681_10458554 3300005458 Bacteria 1187
70 Ga0070685_10142373 3300005466 Bacteria 1511
71 Ga0070707_100080461 3300005468 Bacteria 3145
72 Ga0070707_100246552 3300005468 Bacteria 1738
73 Ga0070698_100068873 3300005471 Bacteria 3555
74 Ga0070698_100370916 3300005471 Bacteria 1363
75 Ga0070699_100001669 3300005518 Bacteria 20238
76 Ga0070699_100231298 3300005518 Bacteria 1648
77 Ga0070679_100019369 3300005530 Bacteria 6614
78 Ga0070679_100053825 3300005530 Bacteria 4006
79 Ga0070679_100082513 3300005530 Bacteria 3204
80 Ga0070679_100151087 3300005530 Bacteria 2299
81 Ga0070697_100374000 3300005536 Bacteria 1233
82 Ga0068853_100028237 3300005539 Bacteria 4717
83 Ga0070672_100002368 3300005543 Bacteria 11934
84 Ga0070672_100018088 3300005543 Bacteria 5088
85 Ga0070672_100160616 3300005543 Bacteria 1864
86 Ga0070695_100051014 3300005545 Bacteria 2653
87 Ga0070693_100138542 3300005547 Bacteria 1529
88 Ga0070665_100018913 3300005548 Bacteria 6910
89 Ga0070665_100236209 3300005548 Bacteria 1828
90 Ga0070665_100305640 3300005548 Bacteria 1594
91 Ga0070665_100314505 3300005548 Bacteria 1570
92 Ga0070665_100350555 3300005548 Bacteria 1481
93 Ga0070704_100046280 3300005549 Bacteria 3033
94 Ga0070704_100174268 3300005549 Bacteria 1714
95 Ga0068855_100542362 3300005563 Bacteria 1260
96 Ga0070664_100032151 3300005564 Bacteria 4388
97 Ga0068854_100035041 3300005578 Bacteria 3511
98 Ga0068856_100017487 3300005614 Bacteria 6948
99 Ga0068856_100500857 3300005614 Bacteria 1236
100 Ga0070702_100082157 3300005615 Bacteria 1933
101 Ga0068852_100019264 3300005616 Bacteria 5396
102 Ga0068852_100194141 3300005616 Bacteria 1918
103 Ga0068859_100132355 3300005617 Bacteria 2566
104 Ga0068859_100148383 3300005617 Bacteria 2420
105 Ga0068859_100186879 3300005617 Bacteria 2156
106 Ga0068859_100357955 3300005617 Bacteria 1554
107 Ga0068864_100028321 3300005618 Bacteria 4733
108 Ga0068864_100037787 3300005618 Bacteria 4122
109 Ga0068864_100065734 3300005618 Bacteria 3146
110 Ga0068864_100207110 3300005618 Unclassified 1804
111 Ga0068864_100265780 3300005618 Bacteria 1597
112 Ga0068864_100511957 3300005618 Bacteria 1156
113 Ga0068861_100252540 3300005719 Bacteria 1505
114 Ga0068870_10000511 3300005840 Bacteria 14716
115 Ga0068863_100424690 3300005841 Bacteria 1302
116 Ga0068858_100092912 3300005842 Bacteria 2808
117 Ga0068860_100005647 3300005843 Bacteria 12635
118 Ga0068860_100123800 3300005843 Bacteria 2478
119 Ga0068862_100023093 3300005844 Bacteria 5209
120 Ga0081455_10000393 3300005937 Bacteria 57689
121 Ga0081455_10009260 3300005937 Bacteria 10142
122 Ga0081455_10009827 3300005937 Bacteria 9798
123 Ga0081538_10006793 3300005981 Bacteria 9990
124 Ga0081538_10031584 3300005981 Bacteria 3567
125 Ga0081538_10053170 3300005981 Bacteria 2410
126 Ga0081540_1000108 3300005983 Bacteria 88825
127 Ga0081540_1007873 3300005983 Bacteria 7532
128 Ga0081539_10002916 3300005985 Bacteria 22576
129 Ga0070717_10016595 3300006028 Bacteria 5713
130 Ga0070717_10023990 3300006028 Bacteria 4840
131 Ga0070717_10344410 3300006028 Bacteria 1331
132 Ga0075365_10050728 3300006038 Bacteria 2738
133 Ga0075368_10008782 3300006042 Bacteria 3616
134 Ga0075363_100014937 3300006048 Bacteria 3807
135 Ga0075363_100131748 3300006048 Bacteria 1402
136 Ga0075364_10006943 3300006051 Bacteria 6687
137 Ga0070715_10005745 3300006163 Bacteria 4166
138 Ga0070715_10011779 3300006163 Bacteria 3159
139 Ga0070716_100004357 3300006173 Bacteria 6756
140 Ga0070712_100000770 3300006175 Bacteria 18909
141 Ga0070712_100000882 3300006175 Bacteria 17917
142 Ga0070712_100015635 3300006175 Bacteria 4892
143 Ga0070712_100067116 3300006175 Bacteria 2552
144 Ga0070712_100082986 3300006175 Bacteria 2326
145 Ga0070712_100230069 3300006175 Bacteria 1472
146 Ga0075362_10000531 3300006177 Bacteria 11088
147 Ga0075362_10053515 3300006177 Bacteria 1812
148 Ga0075367_10051569 3300006178 Bacteria 2432
149 Ga0075367_10120882 3300006178 Bacteria 1614
150 Ga0075369_10021372 3300006186 Bacteria 2659
151 Ga0075366_10005359 3300006195 Bacteria 6951
152 Ga0075366_10022896 3300006195 Bacteria 3637
153 Ga0075366_10032009 3300006195 Bacteria 3096
154 Ga0097621_100324730 3300006237 Bacteria 1364
155 Ga0068871_100052246 3300006358 Bacteria 3309
156 Ga0075428_100002387 3300006844 Bacteria 20393
157 Ga0075428_100018721 3300006844 Bacteria 7655
158 Ga0075428_100260860 3300006844 Bacteria 1866
159 Ga0075430_100002327 3300006846 Bacteria 15784
160 Ga0075430_100002427 3300006846 Bacteria 15518
161 Ga0075430_100004956 3300006846 Bacteria 11205
162 Ga0075430_100062646 3300006846 Bacteria 3124
163 Ga0075431_100000881 3300006847 Bacteria 26399
164 Ga0075431_100016707 3300006847 Bacteria 7452
165 Ga0075431_100137754 3300006847 Bacteria 2517
166 Ga0075433_10070886 3300006852 Bacteria 3064
167 Ga0075433_10138908 3300006852 Bacteria 2160
168 Ga0075434_100019972 3300006871 Bacteria 6489
169 Ga0075434_100071051 3300006871 Bacteria 3472
170 Ga0075429_100002150 3300006880 Bacteria 16449
171 Ga0068865_100234807 3300006881 Bacteria 1440
172 Ga0068865_100327642 3300006881 Bacteria 1234
173 Ga0075436_100069432 3300006914 Bacteria 2434
174 Ga0097620_100132350 3300006931 Bacteria 2566
175 Ga0097620_100148390 3300006931 Bacteria 2420
176 Ga0097620_100186881 3300006931 Bacteria 2156
177 Ga0097620_100357939 3300006931 Bacteria 1554
178 Ga0075435_100005906 3300007076 Bacteria 8616
179 Ga0075435_100044761 3300007076 Bacteria 3546
180 Ga0075435_100237431 3300007076 Bacteria 1549
181 Ga0075435_100240108 3300007076 Bacteria 1541
182 Ga0075435_100364745 3300007076 Bacteria 1239
183 Ga0099795_10034848 3300007788 Bacteria 1756
184 Ga0105250_10019437 3300009092 Bacteria 2746
185 Ga0111539_10000144 3300009094 Bacteria 81842
186 Ga0111539_10022547 3300009094 Bacteria 7735
187 Ga0111539_10135467 3300009094 Bacteria 2884
188 Ga0111539_10234105 3300009094 Bacteria 2138
189 Ga0111539_10263619 3300009094 Bacteria 2006
190 Ga0105245_10245169 3300009098 Bacteria 1739
191 Ga0105245_10579770 3300009098 Bacteria 1146
192 Ga0114129_10000542 3300009147 Bacteria 46285
193 Ga0114129_10013541 3300009147 Bacteria 11623
194 Ga0114129_10065348 3300009147 Bacteria 5077
195 Ga0114129_10093762 3300009147 Bacteria 4158
196 Ga0114129_10123555 3300009147 Bacteria 3560
197 Ga0114129_10544150 3300009147 Bacteria 1511
198 Ga0114129_10668071 3300009147 Bacteria 1339
199 Ga0114129_10756344 3300009147 Bacteria 1243
200 Ga0114129_10843961 3300009147 Bacteria 1165
201 Ga0105243_10055697 3300009148 Bacteria 3142
202 Ga0105241_10078172 3300009174 Bacteria 2585
203 Ga0105248_10002898 3300009177 Bacteria 19034
204 Ga0105248_10148570 3300009177 Bacteria 2644
205 Ga0105237_10096445 3300009545 Bacteria 2947
206 Ga0105238_10026734 3300009551 Bacteria 5882
207 Ga0105249_10061178 3300009553 Bacteria 3455
208 Ga0099796_10002797 3300010159 Bacteria 3923
209 Ga0105239_10079246 3300010375 Bacteria 3615
210 Ga0105239_10106351 3300010375 Bacteria 3108
211 Ga0157373_10078078 3300013100 Bacteria 2335
212 Ga0157371_10055625 3300013102 Bacteria 2808
213 Ga0157371_10121373 3300013102 Bacteria 1858
214 Ga0157370_10114947 3300013104 Bacteria 2514
215 Ga0157370_10218409 3300013104 Bacteria 1766
216 Ga0157374_10106058 3300013296 Bacteria 2699
217 Ga0157378_10126593 3300013297 Bacteria 2360
218 Ga0157372_10056762 3300013307 Bacteria 4375
219 Ga0157372_10616725 3300013307 Bacteria 1264
220 Ga0157375_10144334 3300013308 Bacteria 2510
221 Ga0157375_10524331 3300013308 Bacteria 1348
222 Ga0163163_10010340 3300014325 Bacteria 8384
223 Ga0163163_10076230 3300014325 Bacteria 3348
224 Ga0163163_10124862 3300014325 Bacteria 2611
225 Ga0157380_10023243 3300014326 Bacteria 4674
226 Ga0157380_10135776 3300014326 Bacteria 2105
227 Ga0157380_10313027 3300014326 Bacteria 1452
228 Ga0182008_10025417 3300014497 Bacteria 3007
229 Ga0157377_10003949 3300014745 Bacteria 6758
230 Ga0157379_10009156 3300014968 Bacteria 8624
231 Ga0157376_10725703 3300014969 Bacteria 1001
232 Ga0163161_10100381 3300017792 Bacteria 2153
233 Ga0206356_10344220 3300020070 Bacteria 1797
234 Ga0213873_10021273 3300021358 Bacteria 1524
235 Ga0213872_10102814 3300021361 Bacteria 1273
236 Ga0213874_10006568 3300021377 Bacteria 2757
237 Ga0213876_10124907 3300021384 Bacteria 1366
238 Ga0209673_1024651 3300025273 Bacteria 2016
239 Ga0209130_1000024 3300025284 Bacteria 354212
240 Ga0209675_1001001 3300025291 Bacteria 17786
241 Ga0209025_1000008 3300025294 Bacteria 1130876
242 Ga0209025_1001580 3300025294 Bacteria 28793
243 Ga0209564_1000015 3300025295 Bacteria 615324
244 Ga0209564_1000031 3300025295 Bacteria 494703
245 Ga0209256_1000294 3300025299 Bacteria 87769
246 Ga0207426_1009016 3300025302 Bacteria 3972
247 Ga0207697_10138190 3300025315 Bacteria 1056
248 Ga0207656_10067678 3300025321 Bacteria 1581
249 Ga0207653_10007174 3300025885 Bacteria 3478
250 Ga0207682_10000236 3300025893 Bacteria 24920
251 Ga0207682_10005063 3300025893 Bacteria 5401
252 Ga0207642_10009702 3300025899 Bacteria 3359
253 Ga0207688_10003976 3300025901 Bacteria 8059
254 Ga0207688_10024290 3300025901 Bacteria 3323
255 Ga0207647_10015177 3300025904 Bacteria 5290
256 Ga0207647_10085701 3300025904 Bacteria 1884
257 Ga0207685_10017806 3300025905 Bacteria 2307
258 Ga0207699_10036471 3300025906 Bacteria 2803
259 Ga0207699_10128544 3300025906 Bacteria 1649
260 Ga0207645_10003639 3300025907 Bacteria 11646
261 Ga0207643_10003115 3300025908 Bacteria 8917
262 Ga0207705_10089421 3300025909 Bacteria 2254
263 Ga0207705_10234333 3300025909 Bacteria 1397
264 Ga0207707_10075933 3300025912 Bacteria 2932
265 Ga0207707_10249614 3300025912 Bacteria 1542
266 Ga0207695_10004482 3300025913 Bacteria 19022
267 Ga0207671_10197014 3300025914 Bacteria 1572
268 Ga0207693_10001021 3300025915 Bacteria 25052
269 Ga0207693_10001559 3300025915 Bacteria 20236
270 Ga0207693_10005351 3300025915 Bacteria 10726
271 Ga0207693_10010389 3300025915 Bacteria 7558
272 Ga0207693_10063266 3300025915 Bacteria 2898
273 Ga0207693_10114569 3300025915 Bacteria 2116
274 Ga0207693_10121812 3300025915 Bacteria 2048
275 Ga0207663_10024975 3300025916 Bacteria 3448
276 Ga0207663_10030171 3300025916 Bacteria 3195
277 Ga0207663_10036958 3300025916 Bacteria 2941
278 Ga0207663_10108500 3300025916 Bacteria 1879
279 Ga0207660_10003986 3300025917 Bacteria 9626
280 Ga0207660_10329556 3300025917 Bacteria 1220
281 Ga0207662_10029165 3300025918 Bacteria 3195
282 Ga0207657_10012193 3300025919 Bacteria 8493
283 Ga0207657_10023890 3300025919 Bacteria 5677
284 Ga0207657_10183571 3300025919 Bacteria 1690
285 Ga0207649_10087027 3300025920 Bacteria 2037
286 Ga0207652_10010934 3300025921 Bacteria 7316
287 Ga0207652_10039220 3300025921 Bacteria 4019
288 Ga0207652_10382817 3300025921 Bacteria 1270
289 Ga0207646_10057546 3300025922 Bacteria 3473
290 Ga0207646_10067738 3300025922 Bacteria 3187
291 Ga0207650_10032327 3300025925 Bacteria 3784
292 Ga0207650_10041512 3300025925 Bacteria 3372
293 Ga0207659_10024779 3300025926 Bacteria 4025
294 Ga0207659_10044866 3300025926 Bacteria 3113
295 Ga0207659_10132119 3300025926 Bacteria 1928
296 Ga0207700_10043684 3300025928 Bacteria 3293
297 Ga0207700_10194075 3300025928 Bacteria 1708
298 Ga0207700_10228104 3300025928 Bacteria 1582
299 Ga0207700_10384309 3300025928 Bacteria 1228
300 Ga0207664_10041788 3300025929 Bacteria 3574
301 Ga0207664_10131445 3300025929 Bacteria 2107
302 Ga0207664_10164519 3300025929 Bacteria 1894
303 Ga0207644_10072623 3300025931 Bacteria 2520
304 Ga0207690_10038360 3300025932 Bacteria 3117
305 Ga0207690_10195149 3300025932 Bacteria 1534
306 Ga0207690_10354798 3300025932 Bacteria 1160
307 Ga0207706_10001795 3300025933 Bacteria 21102
308 Ga0207709_10076406 3300025935 Bacteria 2144
309 Ga0207709_10316393 3300025935 Bacteria 1166
310 Ga0207670_10001838 3300025936 Bacteria 11075
311 Ga0207704_10012217 3300025938 Bacteria 4256
312 Ga0207704_10292830 3300025938 Bacteria 1243
313 Ga0207665_10002162 3300025939 Bacteria 13290
314 Ga0207665_10022474 3300025939 Bacteria 4149
315 Ga0207665_10064667 3300025939 Bacteria 2486
316 Ga0207665_10070566 3300025939 Bacteria 2384
317 Ga0207691_10000439 3300025940 Bacteria 41424
318 Ga0207691_10014531 3300025940 Bacteria 7509
319 Ga0207691_10060991 3300025940 Bacteria 3426
320 Ga0207691_10073771 3300025940 Bacteria 3078
321 Ga0207691_10196142 3300025940 Bacteria 1759
322 Ga0207711_10038507 3300025941 Bacteria 4066
323 Ga0207711_10064116 3300025941 Bacteria 3172
324 Ga0207689_10015672 3300025942 Bacteria 6418
325 Ga0207689_10032070 3300025942 Bacteria 4371
326 Ga0207661_10048993 3300025944 Bacteria 3361
327 Ga0207679_10107222 3300025945 Bacteria 2198
328 Ga0207667_10277171 3300025949 Bacteria 1714
329 Ga0207651_10005773 3300025960 Bacteria 6392
330 Ga0207651_10187064 3300025960 Bacteria 1648
331 Ga0207651_10204425 3300025960 Bacteria 1585
332 Ga0207651_10299281 3300025960 Bacteria 1337
333 Ga0207668_10289548 3300025972 Bacteria 1347
334 Ga0207640_10120452 3300025981 Bacteria 1879
335 Ga0207677_10028542 3300026023 Bacteria 3531
336 Ga0207677_10061026 3300026023 Bacteria 2609
337 Ga0207677_10083680 3300026023 Bacteria 2297
338 Ga0207703_10002169 3300026035 Bacteria 17240
339 Ga0207639_10101941 3300026041 Bacteria 2322
340 Ga0207639_10109120 3300026041 Bacteria 2251
341 Ga0207639_10344912 3300026041 Bacteria 1328
342 Ga0207678_10005411 3300026067 Bacteria 11434
343 Ga0207708_10006130 3300026075 Bacteria 8914
344 Ga0207702_10160682 3300026078 Bacteria 2051
345 Ga0207641_10253446 3300026088 Bacteria 1644
346 Ga0207648_10001430 3300026089 Bacteria 26279
347 Ga0207648_10014268 3300026089 Bacteria 7345
348 Ga0207648_10017205 3300026089 Bacteria 6588
349 Ga0207648_10324214 3300026089 Bacteria 1385
350 Ga0207676_10014792 3300026095 Bacteria 5620
351 Ga0207676_10018517 3300026095 Bacteria 5063
352 Ga0207676_10113020 3300026095 Bacteria 2276
353 Ga0207676_10216632 3300026095 Unclassified 1702
354 Ga0207674_10026467 3300026116 Bacteria 6158
355 Ga0207674_10216695 3300026116 Bacteria 1863
356 Ga0207675_100003488 3300026118 Bacteria 15370
357 Ga0207675_100066985 3300026118 Bacteria 3356
358 Ga0207675_100463081 3300026118 Bacteria 1258
359 Ga0207683_10007521 3300026121 Bacteria 9338
360 Ga0207683_10174021 3300026121 Bacteria 1950
361 Ga0207428_10036366 3300027907 Bacteria 4016
362 Ga0207428_10146992 3300027907 Bacteria 1796
363 Ga0265357_1002069 3300028023 Bacteria 1588
364 Ga0268266_10259631 3300028379 Bacteria 1610
365 Ga0268265_10014784 3300028380 Bacteria 5326
366 Ga0265337_1001450 3300028556 Bacteria 11646
367 Ga0265338_10015220 3300028800 Bacteria 8475
368 Ga0265324_10080010 3300029957 Bacteria 1112
369 Ga0265763_1000930 3300030763 Bacteria 1960
370 Ga0265760_10020197 3300031090 Bacteria 1922
371 Ga0265760_10020706 3300031090 Bacteria 1899
372 Ga0265330_10011418 3300031235 Bacteria 4167
373 Ga0265330_10071453 3300031235 Bacteria 1501
374 Ga0265328_10000082 3300031239 Bacteria 48539
375 Ga0265328_10002876 3300031239 Bacteria 7680
376 Ga0265328_10009220 3300031239 Bacteria 4026
377 Ga0265328_10009278 3300031239 Bacteria 4011
378 Ga0265320_10033635 3300031240 Bacteria 2614
379 Ga0265325_10000162 3300031241 Bacteria 47234
380 Ga0265325_10001726 3300031241 Bacteria 15173
381 Ga0265325_10005177 3300031241 Bacteria 8102
382 Ga0265325_10023551 3300031241 Bacteria 3359
383 Ga0265325_10064001 3300031241 Bacteria 1860
384 Ga0265329_10017381 3300031242 Bacteria 2476
385 Ga0265339_10000060 3300031249 Bacteria 97276
386 Ga0265339_10073404 3300031249 Bacteria 1819
387 Ga0265331_10000005 3300031250 Bacteria 465192
388 Ga0265331_10000806 3300031250 Bacteria 25926
389 Ga0265331_10010424 3300031250 Bacteria 5145
390 Ga0265327_10016866 3300031251 Bacteria 4613
391 Ga0265316_10018085 3300031344 Bacteria 6069
392 Ga0265316_10069276 3300031344 Bacteria 2722
393 Ga0265316_10077563 3300031344 Bacteria 2551
394 Ga0265316_10094735 3300031344 Bacteria 2275
395 Ga0265316_10195089 3300031344 Bacteria 1503
396 Ga0265316_10307722 3300031344 Bacteria 1153
397 Ga0265313_10000062 3300031595 Bacteria 106169
398 Ga0265313_10000094 3300031595 Bacteria 89774
399 Ga0265313_10007672 3300031595 Bacteria 7311
400 Ga0316575_10047580 3300031665 Bacteria 1705
401 Ga0265314_10008333 3300031711 Bacteria 8888
402 Ga0316576_10014553 3300031727 Bacteria 5257
403 Ga0307405_10038411 3300031731 Bacteria 2886
404 Ga0307413_10056746 3300031824 Bacteria 2390
405 Ga0307407_10099690 3300031903 Bacteria 1800
406 Ga0307412_10217005 3300031911 Bacteria 1464
407 Ga0307409_100058049 3300031995 Bacteria 3003
408 Ga0307416_100519326 3300032002 Bacteria 1259
409 Ga0307414_10005179 3300032004 Bacteria 7156
410 Ga0307415_100317307 3300032126 Bacteria 1298
411 Ga0316583_10001130 3300032133 Bacteria 8717
412 Ga0373959_0008928 3300034820 Bacteria 1718
413 Ga0373926_0045813 3300035083 Bacteria 1568
414 Ga0373934_0099054 3300035086 Bacteria 1178
415 Ga0373944_0000944 3300035089 Bacteria 7200
416 Ga0373944_0014925 3300035089 Bacteria 2174
417 Ga0373923_0079010 3300035111 Bacteria 1425
418 Ga0373932_0047861 3300035112 Bacteria 1258
419 Ga0373936_0005000 3300035113 Bacteria 4995
420 Ga0373936_0058991 3300035113 Bacteria 1563
421 Ga0373945_0041141 3300035116 Bacteria 1670
422 Ga0373945_0119307 3300035116 Bacteria 1047
423 Ga0373953_0003585 3300035117 Bacteria 4857
424 Ga0373953_0044878 3300035117 Bacteria 1769
425 Ga0373954_0024856 3300035118 Bacteria 2733
426 Ga0373954_0044090 3300035118 Bacteria 2081
427 Ga0373954_0073733 3300035118 Bacteria 1624
428 Ga0373956_0014953 3300035119 Bacteria 3246
429 Ga0373956_0049755 3300035119 Bacteria 1880
430 Ga0373956_0065882 3300035119 Bacteria 1646
431 Ga0373956_0066003 3300035119 Bacteria 1645
432 Ga0373957_0014429 3300035120 Bacteria 2702
433 Ga0373957_0125471 3300035120 Bacteria 1042
434 Ga0373960_0025163 3300035121 Bacteria 1616
435 Ga0373960_0047402 3300035121 Bacteria 1264
436 Ga0373960_0063683 3300035121 Bacteria 1124
437 Ga0373960_0089236 3300035121 Bacteria 983
438 Ga0373943_0000444 3300035170 Bacteria 17541
439 Ga0373943_0038446 3300035170 Bacteria 2301
440 Ga0373943_0054726 3300035170 Bacteria 1974
441 Ga0373943_0088206 3300035170 Bacteria 1602
442 Ga0373946_0000365 3300035171 Bacteria 14672
443 Ga0373946_0223251 3300035171 Bacteria 910
444 Ga0373955_0018513 3300035172 Bacteria 3465
445 Ga0373955_0075141 3300035172 Bacteria 1898
446 Ga0373955_0112793 3300035172 Bacteria 1573
447 Ga0373961_0006333 3300035241 Bacteria 2846
448 Ga0373961_0050987 3300035241 Bacteria 1227
449 Ga0373962_0002857 3300035242 Bacteria 4134
450 Ga0316574_0000639 3300035398 Bacteria 14688
451 Ga0373924_0155512 3300035410 Bacteria 1001
452 Ga0373931_0002195 3300035691 Bacteria 8620
453 Ga0373931_0002855 3300035691 Bacteria 7702
454 Ga0373931_0013544 3300035691 Bacteria 3973
455 Ga0373931_0071494 3300035691 Bacteria 1895
456 Ga0373931_0080160 3300035691 Bacteria 1800
457 Ga0373931_0089492 3300035691 Bacteria 1713
458 Ga0373935_0013611 3300035692 Bacteria 4911
459 Ga0373935_0033031 3300035692 Bacteria 3219
460 Ga0373935_0121150 3300035692 Bacteria 1748
461 Ga0373935_0349185 3300035692 Bacteria 1054
462 Ga0373927_0005292 3300035695 Bacteria 8912
463 Ga0373927_0024839 3300035695 Bacteria 3916
464 Ga0373927_0029481 3300035695 Bacteria 3577
465 Ga0373927_0063590 3300035695 Bacteria 2387
466 Ga0373927_0083964 3300035695 Bacteria 2065
467 Ga0373933_0007659 3300035724 Bacteria 5896
468 Ga0373933_0269259 3300035724 Bacteria 1099
469 Ga0373933_0328351 3300035724 Bacteria 992
470 Ga0373947_0001394 3300035725 Bacteria 14895
471 Ga0373947_0011575 3300035725 Bacteria 5060
472 Ga0373947_0076635 3300035725 Bacteria 2061
473 Ga0373947_0078149 3300035725 Bacteria 2042
474 Ga0373947_0211134 3300035725 Bacteria 1273
475 Ga0373937_0007150 3300036401 Bacteria 9649
476 Ga0373937_0007474 3300036401 Bacteria 9455
477 Ga0373937_0031420 3300036401 Bacteria 4812
478 Ga0373937_0125580 3300036401 Bacteria 2393
479 Ga0316584_0020630 3300036712 Bacteria 4781
480 Ga0373925_0004315 3300037068 Bacteria 10767
481 Ga0373925_0042730 3300037068 Bacteria 3363
482 Ga0373925_0091344 3300037068 Bacteria 2328
483 Ga0373925_0141590 3300037068 Bacteria 1882
484 Ga0373925_0250100 3300037068 Bacteria 1421
485 Ga0373925_0295252 3300037068 Bacteria 1307
486 Ga0395899_0007468 3300037312 Bacteria 8444
487 Ga0395900_0005900 3300037418 Bacteria 12790
488 Ga0395900_0087539 3300037418 Bacteria 3201
489 Ga0395900_0110828 3300037418 Bacteria 2819
490 Ga0395900_0329863 3300037418 Bacteria 1504
491 Ga0395898_0002812 3300037466 Bacteria 19956
492 Ga0395898_0009212 3300037466 Bacteria 10386
493 Ga0395905_0308872 3300037471 Bacteria 1470
494 Ga0436364_0503784 3300037853 Bacteria 2371
495 Ga0395901_0013723 3300038443 Bacteria 8233
496 Ga0395901_0080302 3300038443 Bacteria 3405
497 Ga0395901_0131267 3300038443 Bacteria 2632
498 Ga0395901_0355573 3300038443 Bacteria 1511
499 Ga0237819_05426 3300038705 Bacteria 2003
500 Ga0436365_0344984 3300039437 Bacteria 19388
501 Ga0436365_0635250 3300039437 Bacteria 10464
502 Ga0436365_1514696 3300039437 Bacteria 2553
503 Ga0436365_1568947 3300039437 Bacteria 2308
504 Ga0436361_0166397 3300039447 Bacteria 45243
505 Ga0436363_0335613 3300039450 Bacteria 1867
506 Ga0436363_0461760 3300039450 Bacteria 3201
507 Ga0436363_0675916 3300039450 Bacteria 3790
508 Ga0436362_0983170 3300039453 Bacteria 1177
509 Ga0439453_0003007 3300041408 Bacteria 2384
510 Ga0439435_0001103 3300042436 Bacteria 4813
511 Ga0466963_0004838 3300044694 Bacteria 7847
512 Ga0466971_0059504 3300044719 Bacteria 1726
513 Ga0466957_0023514 3300044842 Bacteria 3643
514 Ga0466957_0046112 3300044842 Bacteria 2645
515 Ga0466959_0027099 3300045049 Bacteria 4251
516 Ga0451576_0558837 3300045051 Bacteria 1202
517 Ga0466958_0075461 3300045836 Bacteria 2068
518 Ga0466958_0207560 3300045836 Bacteria 1247
519 Ga0466967_0000600 3300045976 Bacteria 17902
520 Ga0466967_0605673 3300045976 Bacteria 1081
521 Ga0495592_0009274 3300046454 Bacteria 7402
522 Ga0495592_0075476 3300046454 Bacteria 2448
523 Ga0495592_0165203 3300046454 Bacteria 1520
524 Ga0495603_0033614 3300046455 Bacteria 3085
525 Ga0495629_0065960 3300046459 Bacteria 2526
526 Ga0495641_0015315 3300046461 Bacteria 4101
527 Ga0495651_0003936 3300046462 Bacteria 11353
528 Ga0495651_0070751 3300046462 Bacteria 2654
529 Ga0495651_0146388 3300046462 Bacteria 1707
530 Ga0495653_0001546 3300046463 Bacteria 17971
531 Ga0495653_0016165 3300046463 Bacteria 6080
532 Ga0495653_0101288 3300046463 Bacteria 2087
533 Ga0495580_0048530 3300046472 Bacteria 3005
534 Ga0495580_0212472 3300046472 Bacteria 1331
535 Ga0495582_0015745 3300046473 Bacteria 4148
536 Ga0495605_0014539 3300046474 Bacteria 4306
537 Ga0495639_0003876 3300046475 Bacteria 6424
538 Ga0495662_0097299 3300046476 Bacteria 1438
539 Ga0495664_0015521 3300046477 Bacteria 4330
540 Ga0495664_0074735 3300046477 Bacteria 2028
541 Ga0495584_0022721 3300046491 Bacteria 3182
542 Ga0495585_0003847 3300046492 Bacteria 9983
543 Ga0495585_0067832 3300046492 Bacteria 1950
544 Ga0495608_0002461 3300046511 Bacteria 13299
545 Ga0495608_0098663 3300046511 Bacteria 1885
546 Ga0495618_0118213 3300046514 Bacteria 1698
547 Ga0495628_0008857 3300046516 Bacteria 8614
548 Ga0495628_0051189 3300046516 Bacteria 3265
549 Ga0495628_0113205 3300046516 Bacteria 2085
550 Ga0495628_0138418 3300046516 Bacteria 1859
551 Ga0495630_0014169 3300046517 Bacteria 5803
552 Ga0495630_0051618 3300046517 Bacteria 3078
553 Ga0495630_0063975 3300046517 Bacteria 2763
554 Ga0495630_0274915 3300046517 Bacteria 1287
555 Ga0495643_0019528 3300046522 Bacteria 3919
556 Ga0495666_0009741 3300046526 Bacteria 4802
557 Ga0495652_0002263 3300046529 Bacteria 20082
558 Ga0495652_0002387 3300046529 Bacteria 19430
559 Ga0495652_0049159 3300046529 Bacteria 3611
560 Ga0495665_0005950 3300046531 Bacteria 6570
561 Ga0495665_0028928 3300046531 Bacteria 2970
562 Ga0495640_0002268 3300046533 Bacteria 15432
563 Ga0495640_0006778 3300046533 Bacteria 9038
564 Ga0495640_0100265 3300046533 Bacteria 1902
565 Ga0495640_0134623 3300046533 Bacteria 1597
566 Ga0495586_0166346 3300046535 Bacteria 1245
567 Ga0495587_0000974 3300046536 Bacteria 18768
568 Ga0495587_0006801 3300046536 Bacteria 7445
569 Ga0495587_0010772 3300046536 Bacteria 5806
570 Ga0495598_0000959 3300046537 Bacteria 5559
571 Ga0495621_0022218 3300046539 Bacteria 2101
572 Ga0495645_0005094 3300046543 Bacteria 9005
573 Ga0495645_0006252 3300046543 Bacteria 8252
574 Ga0495645_0013793 3300046543 Bacteria 5726
575 Ga0495622_0042825 3300046557 Bacteria 2105
576 Ga0495633_0020617 3300046558 Bacteria 3312
577 Ga0495667_0002526 3300046559 Bacteria 12212
578 Ga0495667_0003673 3300046559 Bacteria 10325
579 Ga0495656_0026622 3300046615 Bacteria 2304
580 Ga0495634_0001554 3300046642 Bacteria 20250
581 Ga0495634_0043139 3300046642 Bacteria 3057
582 Ga0495635_0001424 3300046663 Bacteria 15965
583 Ga0495635_0005756 3300046663 Bacteria 8636
584 Ga0495635_0062865 3300046663 Bacteria 2549
585 Ga0495635_0078455 3300046663 Bacteria 2261
586 Ga0495635_0269245 3300046663 Bacteria 1146
587 Ga0495659_0002398 3300046664 Bacteria 6053
588 Ga0495661_0063393 3300046665 Bacteria 2185
589 Ga0495588_0014648 3300046674 Bacteria 3758
590 Ga0495599_0001552 3300046678 Bacteria 13225
591 Ga0495599_0002551 3300046678 Bacteria 10608
592 Ga0495599_0128260 3300046678 Bacteria 1576
593 Ga0495623_0044148 3300046679 Bacteria 2833
594 Ga0495623_0101310 3300046679 Bacteria 1754
595 Ga0495623_0143865 3300046679 Bacteria 1416
596 Ga0495646_0007710 3300046680 Bacteria 6840
597 Ga0495647_0009007 3300046681 Bacteria 3367
598 Ga0495647_0014368 3300046681 Bacteria 2757
599 Ga0495647_0047949 3300046681 Bacteria 1650
600 Ga0495658_0008108 3300046683 Bacteria 5200
601 Ga0495658_0010116 3300046683 Bacteria 4713
602 Ga0495658_0064523 3300046683 Bacteria 2110
603 Ga0495658_0256598 3300046683 Bacteria 1100
604 Ga0495669_0076514 3300046684 Bacteria 1532
605 Ga0495669_0233939 3300046684 Bacteria 882
606 Ga0495613_0110861 3300046689 Bacteria 1977
607 Ga0495613_0113254 3300046689 Bacteria 1953
608 Ga0495613_0133310 3300046689 Bacteria 1778
609 Ga0495624_0001159 3300046690 Bacteria 20880
610 Ga0495624_0056823 3300046690 Bacteria 2461
611 Ga0495624_0059969 3300046690 Bacteria 2386
612 Ga0495670_0244867 3300046691 Bacteria 955
613 Ga0495600_0005624 3300046809 Bacteria 7569
614 Ga0495600_0021678 3300046809 Bacteria 4118
615 Ga0495600_0097430 3300046809 Bacteria 1917
616 Ga0495660_0168427 3300046810 Bacteria 1069
617 Ga0495581_0003675 3300047315 Bacteria 8831
618 Ga0495581_0024208 3300047315 Bacteria 3519
619 Ga0495604_0028339 3300047317 Bacteria 4454
620 Ga0495604_0035557 3300047317 Bacteria 3934
621 Ga0495604_0060160 3300047317 Bacteria 2910
622 Ga0495604_0119476 3300047317 Bacteria 1910
623 Ga0495604_0227216 3300047317 Bacteria 1282
624 Ga0495604_0263699 3300047317 Bacteria 1170
625 Ga0495636_0130497 3300047318 Bacteria 1117
626 Ga0495674_0001794 3300047319 Bacteria 21157
627 Ga0495674_0004105 3300047319 Bacteria 14057
628 Ga0495674_0049828 3300047319 Bacteria 3697
629 Ga0495676_0012199 3300047321 Bacteria 7752
630 Ga0495676_0347744 3300047321 Bacteria 991
631 Ga0495680_0003134 3300047322 Bacteria 16480
632 Ga0495680_0033332 3300047322 Bacteria 4171
633 Ga0495680_0044275 3300047322 Bacteria 3520
634 Ga0495680_0099299 3300047322 Bacteria 2171
635 Ga0495680_0188858 3300047322 Bacteria 1483
636 Ga0495680_0210983 3300047322 Bacteria 1390
637 Ga0495675_0006989 3300047444 Bacteria 6939
638 Ga0495675_0017849 3300047444 Bacteria 4499
639 Ga0495675_0106974 3300047444 Bacteria 1748
640 Ga0495677_0081526 3300047445 Bacteria 1213
641 Ga0495684_0007486 3300047471 Bacteria 8455
642 Ga0495684_0067676 3300047471 Bacteria 2716
643 Ga0495684_0122218 3300047471 Bacteria 1960
644 Ga0495684_0171952 3300047471 Bacteria 1611
645 Ga0495684_0546352 3300047471 Bacteria 789
646 Ga0495593_0003777 3300047673 Bacteria 9044
647 Ga0495602_0005586 3300048088 Bacteria 13201
648 Ga0495602_0034361 3300048088 Bacteria 4744
649 Ga0495602_0057794 3300048088 Bacteria 3400
650 Ga0496100_0003561 3300048903 Bacteria 8137
651 Ga0496100_0007392 3300048903 Bacteria 6060
652 Ga0496100_0020821 3300048903 Bacteria 3940
653 Ga0496101_0001698 3300048904 Bacteria 13177
654 Ga0496101_0002312 3300048904 Bacteria 11667
655 Ga0496101_0011605 3300048904 Bacteria 5851
656 Ga0496101_0061483 3300048904 Bacteria 2728
657 Ga0496102_0006852 3300048905 Bacteria 9724
658 Ga0496102_0011352 3300048905 Bacteria 7675
659 Ga0496102_0069972 3300048905 Bacteria 3221
660 Ga0496102_0142489 3300048905 Bacteria 2248
661 Ga0496103_0004686 3300048906 Bacteria 8276
662 Ga0496103_0040482 3300048906 Bacteria 2863
663 Ga0496103_0135250 3300048906 Bacteria 1575
664 Ga0496103_0181616 3300048906 Bacteria 1352
665 Ga0496104_0000369 3300048907 Bacteria 39830
666 Ga0496104_0001214 3300048907 Bacteria 22174
667 Ga0496104_0003051 3300048907 Bacteria 14433
668 Ga0496104_0017246 3300048907 Bacteria 6571
669 Ga0496104_0029302 3300048907 Bacteria 5105
670 Ga0496104_0041805 3300048907 Bacteria 4299
671 Ga0496104_0129397 3300048907 Bacteria 2425
672 Ga0496104_0196091 3300048907 Bacteria 1931
673 Ga0496104_0256893 3300048907 Bacteria 1660
674 Ga0496104_0302856 3300048907 Bacteria 1510
675 Ga0496105_0009664 3300048908 Bacteria 7552
676 Ga0496105_0037536 3300048908 Bacteria 3989
677 Ga0496105_0127425 3300048908 Bacteria 2099
678 Ga0496106_0003679 3300048909 Bacteria 11431
679 Ga0496106_0004523 3300048909 Bacteria 10299
680 Ga0496106_0016334 3300048909 Bacteria 5492
681 Ga0496106_0199358 3300048909 Bacteria 1593
682 Ga0496106_0258551 3300048909 Bacteria 1393
683 Ga0496107_0001981 3300048910 Bacteria 13037
684 Ga0496107_0030776 3300048910 Bacteria 3827
685 Ga0496108_0002287 3300048911 Bacteria 15347
686 Ga0496108_0007574 3300048911 Bacteria 8793
687 Ga0496108_0008671 3300048911 Bacteria 8245
688 Ga0496108_0085789 3300048911 Bacteria 2673
689 Ga0496108_0109164 3300048911 Bacteria 2364
690 Ga0496108_0263427 3300048911 Bacteria 1500
691 Ga0496108_0420685 3300048911 Bacteria 1167
692 Ga0496109_0000561 3300048912 Bacteria 31028
693 Ga0496109_0038830 3300048912 Bacteria 4306
694 Ga0496109_0040998 3300048912 Bacteria 4194
695 Ga0496109_0082119 3300048912 Bacteria 2970
696 Ga0496109_0108961 3300048912 Bacteria 2574
697 Ga0496109_0260989 3300048912 Bacteria 1632
698 Ga0496110_0002763 3300048913 Bacteria 13254
699 Ga0496110_0003430 3300048913 Bacteria 12132
700 Ga0496110_0004859 3300048913 Bacteria 10482
701 Ga0496110_0007744 3300048913 Bacteria 8598
702 Ga0496110_0014211 3300048913 Bacteria 6605
703 Ga0496110_0038338 3300048913 Bacteria 4169
704 Ga0496110_0402752 3300048913 Bacteria 1247
705 Ga0496110_0444293 3300048913 Bacteria 1182
706 Ga0496111_0013509 3300048914 Bacteria 5560
707 Ga0496111_0022767 3300048914 Bacteria 4390
708 Ga0496111_0024178 3300048914 Bacteria 4275
709 Ga0496111_0041160 3300048914 Bacteria 3315
710 Ga0496111_0064980 3300048914 Bacteria 2647
711 Ga0496112_0000702 3300048915 Bacteria 23297
712 Ga0496112_0006926 3300048915 Bacteria 10005
713 Ga0496112_0060283 3300048915 Bacteria 3739
714 Ga0496112_0090573 3300048915 Bacteria 3027
715 Ga0496112_0113340 3300048915 Bacteria 2682
716 Ga0496112_0212104 3300048915 Bacteria 1893
717 Ga0496112_0263309 3300048915 Bacteria 1673
718 Ga0496112_0280330 3300048915 Bacteria 1614
719 Ga0496112_0494551 3300048915 Bacteria 1159
720 Ga0496113_0001074 3300048916 Bacteria 14777
721 Ga0496113_0007716 3300048916 Bacteria 6944
722 Ga0496113_0025205 3300048916 Bacteria 4236
723 Ga0496113_0063776 3300048916 Bacteria 2785
724 Ga0496114_0029829 3300048917 Bacteria 4484
725 Ga0496114_0070175 3300048917 Bacteria 2942
726 Ga0496115_0021027 3300048918 Bacteria 5036
727 Ga0496115_0100454 3300048918 Bacteria 2371
728 Ga0496115_0107355 3300048918 Bacteria 2292
729 Ga0496115_0190594 3300048918 Bacteria 1694
730 Ga0496115_0216475 3300048918 Bacteria 1581
731 Ga0496115_0277283 3300048918 Bacteria 1377
732 Ga0496115_0340091 3300048918 Bacteria 1225
733 Ga0496119_0000806 3300048922 Bacteria 41963
734 Ga0496119_0169844 3300048922 Bacteria 1153
735 Ga0496122_0006697 3300048925 Bacteria 13111
736 Ga0496122_0109323 3300048925 Bacteria 1820
737 Ga0496122_0232275 3300048925 Bacteria 1047
738 Ga0496123_0001298 3300048926 Bacteria 35561
739 Ga0496123_0033923 3300048926 Bacteria 3665
740 Ga0496125_0062184 3300048928 Bacteria 2988
741 Ga0496125_0086005 3300048928 Bacteria 2380
742 Ga0496126_0008820 3300048929 Bacteria 10813
743 Ga0496126_0114539 3300048929 Bacteria 2346
744 Ga0501031_0006090 3300049568 Bacteria 7875
745 Ga0501031_0007326 3300049568 Bacteria 7197
746 Ga0501031_0093088 3300049568 Bacteria 1967
747 Ga0501031_0230741 3300049568 Bacteria 1204
748 Ga0501032_0019344 3300049569 Bacteria 4764
749 Ga0501032_0025316 3300049569 Bacteria 4091
750 Ga0501033_0010833 3300049570 Bacteria 6993
751 Ga0501033_0055821 3300049570 Bacteria 2919
752 Ga0501033_0094154 3300049570 Bacteria 2191
753 Ga0501034_0008255 3300049571 Bacteria 11023
754 Ga0501034_0064129 3300049571 Bacteria 3688
755 Ga0501034_0075399 3300049571 Bacteria 3380
756 Ga0501034_0082996 3300049571 Bacteria 3206
757 Ga0501034_0110578 3300049571 Bacteria 2739
758 Ga0501034_0173683 3300049571 Bacteria 2121
759 Ga0501034_0184646 3300049571 Bacteria 2049
760 Ga0501034_0198380 3300049571 Bacteria 1966
761 Ga0501034_0253926 3300049571 Bacteria 1702
762 Ga0501034_0512494 3300049571 Bacteria 1112
763 Ga0501036_0002175 3300049572 Bacteria 15299
764 Ga0501036_0006160 3300049572 Bacteria 9729
765 Ga0501036_0013411 3300049572 Bacteria 6810
766 Ga0501036_0043035 3300049572 Bacteria 3824
767 Ga0501036_0226150 3300049572 Bacteria 1570
768 Ga0501037_0012077 3300049573 Bacteria 6360
769 Ga0501037_0061268 3300049573 Bacteria 2743
770 Ga0501038_0001565 3300049574 Bacteria 21184
771 Ga0501038_0016429 3300049574 Bacteria 6707
772 Ga0501038_0051377 3300049574 Bacteria 3557
773 Ga0501038_0061334 3300049574 Bacteria 3216
774 Ga0501038_0186860 3300049574 Bacteria 1669
775 Ga0501038_0237860 3300049574 Bacteria 1447
776 Ga0501039_0004448 3300049575 Bacteria 10579
777 Ga0501039_0041424 3300049575 Bacteria 3557
778 Ga0501039_0148460 3300049575 Bacteria 1842
779 Ga0501039_0297929 3300049575 Bacteria 1268
780 Ga0501041_0005072 3300049577 Bacteria 7674
781 Ga0501042_0036194 3300049578 Bacteria 3502
782 Ga0501042_0053479 3300049578 Bacteria 2881
783 Ga0501042_0139598 3300049578 Bacteria 1747
784 Ga0501042_0167717 3300049578 Bacteria 1584
785 Ga0501043_0012827 3300049579 Bacteria 6549
786 Ga0501043_0025732 3300049579 Bacteria 4616
787 Ga0501043_0031809 3300049579 Bacteria 4148
788 Ga0501043_0037121 3300049579 Bacteria 3833
789 Ga0501043_0044249 3300049579 Bacteria 3500
790 Ga0501043_0131634 3300049579 Bacteria 1960
791 Ga0501043_0191534 3300049579 Bacteria 1590
792 Ga0501046_0056941 3300049580 Bacteria 3067
793 Ga0501046_0147491 3300049580 Bacteria 1776
794 Ga0501046_0229378 3300049580 Bacteria 1373
795 Ga0501046_0348308 3300049580 Bacteria 1076
796 Ga0501047_0003841 3300049581 Bacteria 14125
797 Ga0501047_0028740 3300049581 Bacteria 5362
798 Ga0501047_0037832 3300049581 Bacteria 4666
799 Ga0501047_0083204 3300049581 Bacteria 3075
800 Ga0501047_0126074 3300049581 Bacteria 2441
801 Ga0501048_0004383 3300049582 Bacteria 10748
802 Ga0501048_0023928 3300049582 Bacteria 4461
803 Ga0501067_0024445 3300049583 Bacteria 3350
804 Ga0501067_0066324 3300049583 Bacteria 1998
805 Ga0501068_0002840 3300049584 Bacteria 9211
806 Ga0501068_0141973 3300049584 Bacteria 1506
807 Ga0501069_0001963 3300049585 Bacteria 10267
808 Ga0501070_0011466 3300049586 Bacteria 7489
809 Ga0501070_0013659 3300049586 Bacteria 6840
810 Ga0501070_0021330 3300049586 Bacteria 5435
811 Ga0501070_0031370 3300049586 Bacteria 4453
812 Ga0501071_0009884 3300049587 Bacteria 6371
813 Ga0501071_0010484 3300049587 Bacteria 6212
814 Ga0501071_0134955 3300049587 Bacteria 1836
815 Ga0501071_0198070 3300049587 Bacteria 1508
816 Ga0501072_0001393 3300049588 Bacteria 18197
817 Ga0501072_0006889 3300049588 Bacteria 8629
818 Ga0501072_0048709 3300049588 Bacteria 3336
819 Ga0501072_0107748 3300049588 Bacteria 2217
820 Ga0501072_0179207 3300049588 Bacteria 1690
821 Ga0501073_0119716 3300049589 Bacteria 1824
822 Ga0501073_0132356 3300049589 Bacteria 1729
823 Ga0501073_0175559 3300049589 Bacteria 1483
824 Ga0501074_0034107 3300049590 Bacteria 3690
825 Ga0501074_0178731 3300049590 Bacteria 1514
826 Ga0501075_0001104 3300049591 Bacteria 17384
827 Ga0501075_0061191 3300049591 Bacteria 2837
828 Ga0501075_0114781 3300049591 Bacteria 2048
829 Ga0501076_0004052 3300049592 Bacteria 10359
830 Ga0501076_0062584 3300049592 Bacteria 2964
831 Ga0501076_0075248 3300049592 Bacteria 2706
832 Ga0501076_0260478 3300049592 Bacteria 1420
833 Ga0501076_0339428 3300049592 Bacteria 1233
834 Ga0501076_0456574 3300049592 Bacteria 1052
835 Ga0501077_0020854 3300049593 Bacteria 4149
836 Ga0501238_004132 3300049671 Bacteria 1804
837 Ga0501079_0003253 3300049741 Bacteria 11904
838 Ga0501079_0036323 3300049741 Bacteria 3796
839 Ga0501079_0263230 3300049741 Bacteria 1348
840 Ga0501079_0398427 3300049741 Bacteria 1079
841 Ga0501080_0095804 3300049742 Bacteria 2755
842 Ga0501080_0102558 3300049742 Bacteria 2654
843 Ga0501080_0257257 3300049742 Bacteria 1591
844 Ga0501080_0759505 3300049742 Bacteria 852
845 Ga0501081_0001170 3300049743 Bacteria 15892
846 Ga0501081_0070925 3300049743 Bacteria 2428
847 Ga0501081_0110950 3300049743 Bacteria 1946
848 Ga0501081_0185146 3300049743 Bacteria 1507
849 Ga0501083_0000817 3300049744 Bacteria 20380
850 Ga0501083_0018751 3300049744 Bacteria 4818
851 Ga0501083_0034375 3300049744 Bacteria 3467
852 Ga0501083_0043563 3300049744 Bacteria 3040
853 Ga0501083_0229720 3300049744 Bacteria 1208
854 Ga0501083_0282335 3300049744 Bacteria 1080
855 Ga0501035_0012798 3300049822 Bacteria 7749
856 Ga0501035_0045489 3300049822 Bacteria 3949
857 Ga0501035_0280771 3300049822 Bacteria 1407
858 Ga0501044_0000509 3300049823 Bacteria 47320
859 Ga0501044_0019980 3300049823 Bacteria 7152
860 Ga0501044_0031516 3300049823 Bacteria 5580
861 Ga0501044_0058340 3300049823 Bacteria 3958
862 Ga0501044_0123557 3300049823 Bacteria 2587
863 Ga0501044_0267384 3300049823 Bacteria 1646
864 Ga0501044_0431705 3300049823 Bacteria 1226
865 Ga0501045_0028996 3300049824 Bacteria 3996
866 Ga0501045_0349566 3300049824 Bacteria 1100
867 nmdc:mga03n38_186506_c1 3300050490 Bacteria 1066
868 nmdc:mga03n38_48450_c1 3300050490 Bacteria 1885
869 nmdc:mga00v17_178781_c1 3300050491 Bacteria 1369
870 nmdc:mga00v17_23359_c1 3300050491 Bacteria 3576
871 nmdc:mga00v17_89581_c1 3300050491 Bacteria 1931
872 nmdc:mga0yw44_1031_c1 3300050492 Bacteria 10692
873 nmdc:mga0yw44_15452_c1 3300050492 Bacteria 4091
874 nmdc:mga0yw44_80427_c1 3300050492 Bacteria 2041
875 nmdc:mga0yw44_97207_c1 3300050492 Bacteria 1870
876 nmdc:mga0k408_12748_c1 3300050493 Bacteria 4598
877 nmdc:mga0k408_139321_c1 3300050493 Bacteria 1442
878 nmdc:mga0k408_41022_c1 3300050493 Bacteria 2664
879 nmdc:mga0k408_53649_c1 3300050493 Bacteria 2337
880 nmdc:mga0k408_73074_c1 3300050493 Bacteria 2003
881 nmdc:mga06z11_11761_c1 3300050494 Bacteria 3785
882 nmdc:mga06z11_125618_c1 3300050494 Bacteria 1435
883 nmdc:mga06z11_36850_c1 3300050494 Bacteria 2418
884 nmdc:mga06z11_3813_c1 3300050494 Bacteria 5872
885 nmdc:mga07m45_75485_c1 3300050496 Bacteria 1921
886 nmdc:mga05p37_119967_c1 3300050507 Bacteria 3231
887 nmdc:mga05p37_158906_c1 3300050507 Bacteria 2761
888 nmdc:mga05p37_30503_c1 3300050507 Bacteria 6579
889 nmdc:mga05p37_52_c1 3300050507 Bacteria 102932
890 nmdc:mga05p37_55172_c1 3300050507 Bacteria 4889
891 nmdc:mga05p37_619897_c1 3300050507 Bacteria 1217
892 nmdc:mga09592_219639_c1 3300050508 Bacteria 1647
893 nmdc:mga09592_356119_c1 3300050508 Bacteria 1266
894 nmdc:mga0qj67_13134_c1 3300050509 Bacteria 6253
895 nmdc:mga0qj67_298910_c1 3300050509 Bacteria 1304
896 nmdc:mga0qj67_3562_c1 3300050509 Bacteria 11238
897 nmdc:mga0qj67_62_c1 3300050509 Bacteria 79928
898 nmdc:mga06r32_169976_c1 3300050510 Bacteria 2163
899 nmdc:mga06r32_188274_c1 3300050510 Bacteria 2051
900 nmdc:mga06r32_248_c1 3300050510 Bacteria 44402
901 nmdc:mga06r32_58944_c1 3300050510 Bacteria 3691
902 nmdc:mga08y16_174418_c1 3300050511 Bacteria 2232
903 nmdc:mga08y16_185_c1 3300050511 Bacteria 55383
904 nmdc:mga08y16_19901_c1 3300050511 Bacteria 7079
905 nmdc:mga08y16_287139_c1 3300050511 Bacteria 1696
906 nmdc:mga08y16_401129_c1 3300050511 Bacteria 1403
907 nmdc:mga08y16_507966_c1 3300050511 Bacteria 1224
908 nmdc:mga0n895_142017_c1 3300050512 Bacteria 2430
909 nmdc:mga0n895_250882_c1 3300050512 Bacteria 1796
910 nmdc:mga0n895_530637_c1 3300050512 Bacteria 1184
911 nmdc:mga0n895_58287_c1 3300050512 Bacteria 3807
912 nmdc:mga0n895_80113_c1 3300050512 Bacteria 3253
913 nmdc:mga0rr50_189449_c1 3300050513 Bacteria 1685
914 nmdc:mga0rr50_33759_c1 3300050513 Bacteria 3658
915 nmdc:mga0rr50_36073_c1 3300050513 Bacteria 3557
916 nmdc:mga0rr50_418387_c1 3300050513 Bacteria 1133
917 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
918 nmdc:mga0a205_15283_c1 3300050515 Bacteria 7171
919 nmdc:mga0a205_157596_c1 3300050515 Bacteria 2168
920 nmdc:mga0a205_80963_c1 3300050515 Bacteria 3137
921 Ga0495601_0001359 3300053077 Bacteria 13454
922 Ga0495601_0006610 3300053077 Bacteria 6781
923 Ga0495601_0032644 3300053077 Bacteria 3241
924 Ga0495601_0080600 3300053077 Bacteria 2088
925 Ga0495601_0135011 3300053077 Bacteria 1608
926 Ga0495601_0169811 3300053077 Bacteria 1426
927 Ga0495601_0291067 3300053077 Bacteria 1064
928 Ga0495612_0000238 3300053078 Bacteria 23053
929 Ga0495612_0000657 3300053078 Bacteria 13923
930 Ga0495612_0000893 3300053078 Bacteria 12195
931 Ga0495612_0074184 3300053078 Bacteria 1422
932 Ga0495612_0153415 3300053078 Bacteria 1003
933 Ga0495595_0000795 3300053084 Bacteria 12010
934 Ga0495595_0007638 3300053084 Bacteria 4429
935 Ga0495595_0015118 3300053084 Bacteria 3287
936 Ga0495595_0038271 3300053084 Bacteria 2184
937 Ga0495595_0042041 3300053084 Bacteria 2094
938 Ga0495595_0042549 3300053084 Bacteria 2081
939 Ga0495595_0127452 3300053084 Bacteria 1242
940 Ga0495595_0184155 3300053084 Bacteria 1036
941 Ga0495619_0003766 3300053085 Bacteria 9762
942 Ga0495619_0016705 3300053085 Bacteria 4644
943 Ga0495619_0020949 3300053085 Bacteria 4170
944 Ga0495619_0035724 3300053085 Bacteria 3233
945 Ga0495619_0077460 3300053085 Bacteria 2233
946 Ga0495619_0151792 3300053085 Bacteria 1598
947 Ga0495619_0231289 3300053085 Bacteria 1281
948 Ga0500641_0034326 3300053096 Bacteria 2018
949 Ga0500556_0000160 3300053104 Bacteria 55309
950 Ga0500597_030665 3300053120 Bacteria 2211
951 Ga0500652_000056 3300053131 Bacteria 51871
952 Ga0500622_0027584 3300053156 Bacteria 2994
953 Ga0500636_0038640 3300053177 Bacteria 2823
954 Ga0500645_006585 3300053730 Bacteria 4126
955 Ga0501084_0011994 3300054114 Bacteria 7176
956 Ga0501084_0019517 3300054114 Bacteria 5647
957 Ga0501084_0053593 3300054114 Bacteria 3374
958 Ga0501084_0145887 3300054114 Bacteria 1993
959 Ga0501084_0146877 3300054114 Bacteria 1986
960 Ga0501084_0201072 3300054114 Bacteria 1681
961 Ga0501082_0000016 3300060353 Bacteria 115081
962 Ga0501082_0004262 3300060353 Bacteria 12496
963 Ga0501082_0030617 3300060353 Bacteria 4637
964 Ga0501082_0040534 3300060353 Bacteria 4016
965 Ga0501082_0041644 3300060353 Bacteria 3960
966 Ga0501082_0091880 3300060353 Bacteria 2621
967 Ga0466962_0012613 3300061719 Bacteria 4066
968 Ga0530510_0034068 3300061734 Bacteria 3668
969 Ga0530510_0104487 3300061734 Bacteria 2072
970 Ga0530510_0194132 3300061734 Bacteria 1507
971 Ga0530510_0258989 3300061734 Bacteria 1297

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047471 Ga0495684_0546352 Ga0495684_0546352_15_761 247
2 3300031344 Ga0265316_10069276 Ga0265316_100692762 250
3 3300049570 Ga0501033_0094154 Ga0501033_0094154_1323_2099 252
4 3300049575 Ga0501039_0148460 Ga0501039_0148460_960_1736 252
5 3300049742 Ga0501080_0759505 Ga0501080_0759505_32_808 252
6 3300049572 Ga0501036_0043035 Ga0501036_0043035_2997_3788 256
7 3300046517 Ga0495630_0014169 Ga0495630_0014169_5006_5785 259
8 iso_pu_bacteria 2508501050 2508734185 261
9 3300035083 Ga0373926_0045813 Ga0373926_0045813_47_838 262
10 3300049570 Ga0501033_0055821 Ga0501033_0055821_357_1313 262
11 3300049571 Ga0501034_0082996 Ga0501034_0082996_206_1162 262
12 3300049572 Ga0501036_0006160 Ga0501036_0006160_5343_6299 262
13 3300049573 Ga0501037_0012077 Ga0501037_0012077_383_1339 262
14 3300049574 Ga0501038_0001565 Ga0501038_0001565_15690_16646 262
15 3300049575 Ga0501039_0004448 Ga0501039_0004448_695_1651 262
16 3300049578 Ga0501042_0053479 Ga0501042_0053479_1474_2430 262
17 3300049579 Ga0501043_0012827 Ga0501043_0012827_1584_2540 262
18 3300049581 Ga0501047_0083204 Ga0501047_0083204_1584_2540 262
19 3300049582 Ga0501048_0004383 Ga0501048_0004383_510_1466 262
20 3300049583 Ga0501067_0024445 Ga0501067_0024445_1717_2673 262
21 3300049584 Ga0501068_0002840 Ga0501068_0002840_447_1403 262
22 3300049585 Ga0501069_0001963 Ga0501069_0001963_6921_7877 262
23 3300049586 Ga0501070_0013659 Ga0501070_0013659_5502_6458 262
24 3300049587 Ga0501071_0009884 Ga0501071_0009884_4570_5526 262
25 3300049589 Ga0501073_0119716 Ga0501073_0119716_512_1468 262
26 3300049592 Ga0501076_0062584 Ga0501076_0062584_510_1466 262
27 3300049741 Ga0501079_0036323 Ga0501079_0036323_2065_3021 262
28 3300049744 Ga0501083_0000817 Ga0501083_0000817_11675_12631 262
29 3300049822 Ga0501035_0280771 Ga0501035_0280771_357_1313 262
30 3300049823 Ga0501044_0267384 Ga0501044_0267384_308_1264 262
31 3300054114 Ga0501084_0053593 Ga0501084_0053593_2193_3149 262
32 3300060353 Ga0501082_0040534 Ga0501082_0040534_570_1526 262
33 3300049573 Ga0501037_0061268 Ga0501037_0061268_14_805 263
34 3300035171 Ga0373946_0223251 Ga0373946_0223251_50_844 264
35 3300035410 Ga0373924_0155512 Ga0373924_0155512_41_835 264
36 3300035724 Ga0373933_0328351 Ga0373933_0328351_35_829 264
37 3300037418 Ga0395900_0329863 Ga0395900_0329863_678_1472 264
38 3300050491 nmdc:mga00v17_89581_c1 nmdc:mga00v17_89581_c1_1114_1908 264
39 3300035121 Ga0373960_0089236 Ga0373960_0089236_37_834 265
40 3300046684 Ga0495669_0233939 Ga0495669_0233939_30_827 265
41 3300046691 Ga0495670_0244867 Ga0495670_0244867_14_811 265
42 3300050490 nmdc:mga03n38_186506_c1 nmdc:mga03n38_186506_c1_226_1023 265
43 3300061734 Ga0530510_0194132 Ga0530510_0194132_16_813 265
44 3300031250 Ga0265331_10000005 Ga0265331_10000005352 266
45 3300031239 Ga0265328_10009220 Ga0265328_100092203 267
46 3300031250 Ga0265331_10010424 Ga0265331_100104242 267
47 3300031251 Ga0265327_10016866 Ga0265327_100168663 267
48 3300031344 Ga0265316_10077563 Ga0265316_100775634 267
49 3300049571 Ga0501034_0173683 Ga0501034_0173683_523_1470 267
50 3300021377 Ga0213874_10006568 Ga0213874_100065682 274
51 3300031239 Ga0265328_10000082 Ga0265328_100000826 274
52 3300031242 Ga0265329_10017381 Ga0265329_100173813 274
53 3300031250 Ga0265331_10000806 Ga0265331_100008068 274
54 3300031344 Ga0265316_10018085 Ga0265316_100180858 274
55 3300039450 Ga0436363_0675916 Ga0436363_0675916_478_1410 274
56 3300037471 Ga0395905_0308872 Ga0395905_0308872_273_1172 276
57 3300032002 Ga0307416_100519326 Ga0307416_1005193262 277
58 3300048929 Ga0496126_0008820 Ga0496126_0008820_8868_9758 278
59 iso_pu_bacteria 2894232714 2894238447 278
60 3300035695 Ga0373927_0063590 Ga0373927_0063590_414_1277 280
61 3300049571 Ga0501034_0008255 Ga0501034_0008255_2973_3872 281
62 3300005548 Ga0070665_100305640 Ga0070665_1003056403 282
63 3300046454 Ga0495592_0165203 Ga0495592_0165203_568_1416 282
64 3300005435 Ga0070714_100017639 Ga0070714_1000176395 283
65 3300006028 Ga0070717_10023990 Ga0070717_100239902 283
66 3300006163 Ga0070715_10011779 Ga0070715_100117794 283
67 3300010375 Ga0105239_10106351 Ga0105239_101063512 283
68 3300025913 Ga0207695_10004482 Ga0207695_1000448214 283
69 3300025939 Ga0207665_10022474 Ga0207665_100224742 283
70 3300006871 Ga0075434_100019972 Ga0075434_1000199722 284
71 3300007076 Ga0075435_100044761 Ga0075435_1000447613 284
72 3300050512 nmdc:mga0n895_142017_c1 nmdc:mga0n895_142017_c1_1368_2273 284
73 3300050513 nmdc:mga0rr50_36073_c1 nmdc:mga0rr50_36073_c1_1630_2535 284
74 3300053078 Ga0495612_0153415 Ga0495612_0153415_60_917 284
75 3300060353 Ga0501082_0000016 Ga0501082_0000016_101575_102519 284
76 3300028556 Ga0265337_1001450 Ga0265337_10014505 285
77 3300049592 Ga0501076_0456574 Ga0501076_0456574_185_1042 285
78 3300005295 Ga0065707_10187933 Ga0065707_101879331 287
79 3300005548 Ga0070665_100350555 Ga0070665_1003505552 287
80 3300014326 Ga0157380_10313027 Ga0157380_103130272 287
81 3300025904 Ga0207647_10085701 Ga0207647_100857012 287
82 3300031235 Ga0265330_10011418 Ga0265330_100114183 287
83 3300031824 Ga0307413_10056746 Ga0307413_100567462 287
84 3300031903 Ga0307407_10099690 Ga0307407_100996901 287
85 3300031911 Ga0307412_10217005 Ga0307412_102170052 287
86 3300031995 Ga0307409_100058049 Ga0307409_1000580493 287
87 3300032004 Ga0307414_10005179 Ga0307414_100051794 287
88 3300050511 nmdc:mga08y16_401129_c1 nmdc:mga08y16_401129_c1_63_986 287
89 3300031731 Ga0307405_10038411 Ga0307405_100384114 288
90 3300013102 Ga0157371_10055625 Ga0157371_100556252 289
91 3300013307 Ga0157372_10616725 Ga0157372_106167251 289
92 3300025909 Ga0207705_10234333 Ga0207705_102343331 289
93 3300049575 Ga0501039_0297929 Ga0501039_0297929_105_1010 289
94 3300053085 Ga0495619_0151792 Ga0495619_0151792_659_1588 289
95 3300005437 Ga0070710_10149188 Ga0070710_101491881 290
96 3300031240 Ga0265320_10033635 Ga0265320_100336354 290
97 3300038705 Ga0237819_05426 Ga0237819_05426_869_1822 290
98 iso_pu_bacteria 3006969106 3006972819 290
99 3300025284 Ga0209130_1000024 Ga0209130_1000024256 291
100 3300025302 Ga0207426_1009016 Ga0207426_10090162 291
101 3300039437 Ga0436365_0635250 Ga0436365_0635250_1377_2321 291
102 3300005262 Ga0065165_1000014 Ga0065165_100001417 292
103 3300031344 Ga0265316_10094735 Ga0265316_100947351 292
104 iso_pu_bacteria 2522572158 2523103896 292
105 iso_pu_bacteria 2597490356 2599106008 292
106 iso_pu_bacteria 2846952575 2846955799 292
107 iso_pu_bacteria 2848858292 2848862097 292
108 3300007788 Ga0099795_10034848 Ga0099795_100348482 293
109 3300049568 Ga0501031_0007326 Ga0501031_0007326_2636_3535 293
110 3300049569 Ga0501032_0019344 Ga0501032_0019344_1378_2277 293
111 3300049572 Ga0501036_0002175 Ga0501036_0002175_4449_5348 293
112 3300049574 Ga0501038_0016429 Ga0501038_0016429_1795_2694 293
113 3300049579 Ga0501043_0044249 Ga0501043_0044249_1986_2885 293
114 3300049581 Ga0501047_0037832 Ga0501047_0037832_1280_2179 293
115 3300049586 Ga0501070_0031370 Ga0501070_0031370_511_1410 293
116 3300049822 Ga0501035_0045489 Ga0501035_0045489_882_1781 293
117 3300049823 Ga0501044_0058340 Ga0501044_0058340_1201_2100 293
118 3300049588 Ga0501072_0001393 Ga0501072_0001393_15892_16836 294
119 3300049588 Ga0501072_0006889 Ga0501072_0006889_2891_3775 294
120 3300049742 Ga0501080_0257257 Ga0501080_0257257_349_1233 294
121 3300049744 Ga0501083_0018751 Ga0501083_0018751_1916_2800 294
122 3300049744 Ga0501083_0229720 Ga0501083_0229720_51_995 294
123 3300054114 Ga0501084_0011994 Ga0501084_0011994_4826_5710 294
124 3300054114 Ga0501084_0145887 Ga0501084_0145887_631_1575 294
125 3300060353 Ga0501082_0030617 Ga0501082_0030617_2266_3150 294
126 3300060353 Ga0501082_0041644 Ga0501082_0041644_2204_3148 294
127 3300006844 Ga0075428_100260860 Ga0075428_1002608602 295
128 3300009147 Ga0114129_10544150 Ga0114129_105441501 295
129 3300042436 Ga0439435_0001103 Ga0439435_0001103_930_1868 295
130 3300046557 Ga0495622_0042825 Ga0495622_0042825_956_1843 295
131 3300048918 Ga0496115_0277283 Ga0496115_0277283_458_1345 295
132 3300050493 nmdc:mga0k408_139321_c1 nmdc:mga0k408_139321_c1_362_1300 295
133 3300053096 Ga0500641_0034326 Ga0500641_0034326_458_1408 295
134 3300009147 Ga0114129_10065348 Ga0114129_100653482 296
135 3300028800 Ga0265338_10015220 Ga0265338_100152208 296
136 3300031249 Ga0265339_10000060 Ga0265339_1000006056 296
137 3300031595 Ga0265313_10000094 Ga0265313_1000009452 296
138 3300050491 nmdc:mga00v17_178781_c1 nmdc:mga00v17_178781_c1_55_966 296
139 iso_pu_bacteria 2897803580 2897805244 296
140 iso_pu_bacteria 2904578770 2904580193 296
141 iso_pu_bacteria 2919119836 2919120134 296
142 3300025294 Ga0209025_1001580 Ga0209025_10015805 297
143 3300048907 Ga0496104_0000369 Ga0496104_0000369_11374_12333 297
144 3300048908 Ga0496105_0127425 Ga0496105_0127425_742_1701 297
145 3300048913 Ga0496110_0402752 Ga0496110_0402752_198_1157 297
146 3300048918 Ga0496115_0216475 Ga0496115_0216475_466_1425 297
147 3300053085 Ga0495619_0020949 Ga0495619_0020949_835_1791 297
148 3300031595 Ga0265313_10000062 Ga0265313_1000006285 298
149 3300048088 Ga0495602_0034361 Ga0495602_0034361_273_1193 298
150 3300049571 Ga0501034_0184646 Ga0501034_0184646_169_1095 298
151 3300049744 Ga0501083_0034375 Ga0501083_0034375_2076_3002 298
152 3300049823 Ga0501044_0123557 Ga0501044_0123557_878_1855 298
153 3300049824 Ga0501045_0349566 Ga0501045_0349566_15_956 298
154 3300061734 Ga0530510_0258989 Ga0530510_0258989_202_1161 298
155 3300005338 Ga0068868_100054268 Ga0068868_1000542684 299
156 3300005339 Ga0070660_100062622 Ga0070660_1000626223 299
157 3300005339 Ga0070660_100269482 Ga0070660_1002694821 299
158 3300005366 Ga0070659_100020949 Ga0070659_1000209495 299
159 3300005539 Ga0068853_100028237 Ga0068853_1000282373 299
160 3300005547 Ga0070693_100138542 Ga0070693_1001385423 299
161 3300005564 Ga0070664_100032151 Ga0070664_1000321513 299
162 3300005578 Ga0068854_100035041 Ga0068854_1000350411 299
163 3300005614 Ga0068856_100017487 Ga0068856_1000174872 299
164 3300005616 Ga0068852_100019264 Ga0068852_1000192645 299
165 3300005616 Ga0068852_100194141 Ga0068852_1001941413 299
166 3300009551 Ga0105238_10026734 Ga0105238_100267345 299
167 3300010375 Ga0105239_10079246 Ga0105239_100792465 299
168 3300013104 Ga0157370_10218409 Ga0157370_102184093 299
169 3300013307 Ga0157372_10056762 Ga0157372_100567625 299
170 3300025321 Ga0207656_10067678 Ga0207656_100676781 299
171 3300025909 Ga0207705_10089421 Ga0207705_100894213 299
172 3300025919 Ga0207657_10023890 Ga0207657_100238905 299
173 3300025919 Ga0207657_10183571 Ga0207657_101835712 299
174 3300025938 Ga0207704_10292830 Ga0207704_102928302 299
175 3300025940 Ga0207691_10073771 Ga0207691_100737713 299
176 3300025945 Ga0207679_10107222 Ga0207679_101072223 299
177 3300025981 Ga0207640_10120452 Ga0207640_101204522 299
178 3300026023 Ga0207677_10083680 Ga0207677_100836803 299
179 3300026041 Ga0207639_10109120 Ga0207639_101091203 299
180 3300026078 Ga0207702_10160682 Ga0207702_101606823 299
181 3300026089 Ga0207648_10014268 Ga0207648_100142687 299
182 3300026121 Ga0207683_10174021 Ga0207683_101740212 299
183 3300035691 Ga0373931_0071494 Ga0373931_0071494_860_1759 299
184 3300048922 Ga0496119_0169844 Ga0496119_0169844_190_1089 299
185 3300048925 Ga0496122_0109323 Ga0496122_0109323_767_1669 299
186 3300049568 Ga0501031_0093088 Ga0501031_0093088_91_1017 299
187 3300049578 Ga0501042_0036194 Ga0501042_0036194_755_1681 299
188 3300049579 Ga0501043_0037121 Ga0501043_0037121_140_1078 299
189 3300049580 Ga0501046_0056941 Ga0501046_0056941_1493_2419 299
190 3300049582 Ga0501048_0023928 Ga0501048_0023928_500_1426 299
191 3300049587 Ga0501071_0134955 Ga0501071_0134955_54_980 299
192 3300049741 Ga0501079_0398427 Ga0501079_0398427_73_999 299
193 3300049743 Ga0501081_0110950 Ga0501081_0110950_282_1208 299
194 3300054114 Ga0501084_0146877 Ga0501084_0146877_688_1614 299
195 3300060353 Ga0501082_0091880 Ga0501082_0091880_343_1269 299
196 3300003771 Ga0055526_1007988 Ga0055526_10079883 300
197 3300003775 Ga0055524_1000283 Ga0055524_100028324 300
198 3300005434 Ga0070709_10235803 Ga0070709_102358031 300
199 3300005435 Ga0070714_100029246 Ga0070714_1000292465 300
200 3300005436 Ga0070713_100061827 Ga0070713_1000618274 300
201 3300005437 Ga0070710_10007515 Ga0070710_100075153 300
202 3300006163 Ga0070715_10005745 Ga0070715_100057455 300
203 3300006173 Ga0070716_100004357 Ga0070716_1000043576 300
204 3300009147 Ga0114129_10668071 Ga0114129_106680711 300
205 3300025273 Ga0209673_1024651 Ga0209673_10246512 300
206 3300025291 Ga0209675_1001001 Ga0209675_100100114 300
207 3300025295 Ga0209564_1000015 Ga0209564_1000015211 300
208 3300025299 Ga0209256_1000294 Ga0209256_100029483 300
209 3300025915 Ga0207693_10005351 Ga0207693_100053511 300
210 3300025928 Ga0207700_10043684 Ga0207700_100436841 300
211 3300025939 Ga0207665_10002162 Ga0207665_100021629 300
212 3300039437 Ga0436365_1568947 Ga0436365_1568947_1015_1965 300
213 3300048915 Ga0496112_0494551 Ga0496112_0494551_97_1059 300
214 3300049571 Ga0501034_0198380 Ga0501034_0198380_946_1872 300
215 3300050492 nmdc:mga0yw44_80427_c1 nmdc:mga0yw44_80427_c1_1107_2027 300
216 3300050507 nmdc:mga05p37_619897_c1 nmdc:mga05p37_619897_c1_96_1058 300
217 iso_pu_bacteria 2765235802 2765468070 300
218 iso_pu_bacteria 2839993093 2839993155 300
219 3300005618 Ga0068864_100207110 Ga0068864_1002071102 301
220 3300026095 Ga0207676_10216632 Ga0207676_102166322 301
221 3300048905 Ga0496102_0142489 Ga0496102_0142489_350_1312 301
222 iso_pu_bacteria 2919450847 2919452165 301
223 iso_pu_bacteria 8001845381 8001845844 301
224 3300006028 Ga0070717_10016595 Ga0070717_100165954 302
225 3300025905 Ga0207685_10017806 Ga0207685_100178062 302
226 3300025906 Ga0207699_10128544 Ga0207699_101285442 302
227 3300031241 Ga0265325_10001726 Ga0265325_100017265 302
228 3300032126 Ga0307415_100317307 Ga0307415_1003173072 302
229 3300048922 Ga0496119_0000806 Ga0496119_0000806_40885_41850 302
230 3300048925 Ga0496122_0006697 Ga0496122_0006697_10_975 302
231 3300048926 Ga0496123_0001298 Ga0496123_0001298_20099_21064 302
232 3300048928 Ga0496125_0086005 Ga0496125_0086005_413_1360 302
233 3300048929 Ga0496126_0114539 Ga0496126_0114539_457_1404 302
234 3300049572 Ga0501036_0226150 Ga0501036_0226150_440_1351 302
235 3300049577 Ga0501041_0005072 Ga0501041_0005072_5545_6456 302
236 3300049578 Ga0501042_0167717 Ga0501042_0167717_143_1054 302
237 3300049579 Ga0501043_0025732 Ga0501043_0025732_3236_4147 302
238 3300049580 Ga0501046_0147491 Ga0501046_0147491_41_952 302
239 3300049589 Ga0501073_0132356 Ga0501073_0132356_298_1209 302
240 3300049590 Ga0501074_0034107 Ga0501074_0034107_601_1512 302
241 3300049591 Ga0501075_0001104 Ga0501075_0001104_10640_11551 302
242 3300049592 Ga0501076_0004052 Ga0501076_0004052_6766_7677 302
243 3300049592 Ga0501076_0260478 Ga0501076_0260478_103_1059 302
244 3300049593 Ga0501077_0020854 Ga0501077_0020854_1159_2070 302
245 3300049741 Ga0501079_0003253 Ga0501079_0003253_471_1382 302
246 3300049743 Ga0501081_0001170 Ga0501081_0001170_1617_2528 302
247 3300049824 Ga0501045_0028996 Ga0501045_0028996_2459_3370 302
248 3300053104 Ga0500556_0000160 Ga0500556_0000160_24875_25840 302
249 3300053730 Ga0500645_006585 Ga0500645_006585_1363_2274 302
250 3300054114 Ga0501084_0019517 Ga0501084_0019517_3633_4544 302
251 3300060353 Ga0501082_0004262 Ga0501082_0004262_7967_8878 302
252 3300061734 Ga0530510_0104487 Ga0530510_0104487_673_1584 302
253 iso_pu_bacteria 2508501114 2509079120 302
254 iso_pu_bacteria 2523231067 2523467776 302
255 iso_pu_bacteria 2738543031 2739349226 302
256 iso_pu_bacteria 2773857925 2774869260 302
257 iso_pu_bacteria 2775506901 2776257901 302
258 iso_pu_bacteria 2835312727 2835317379 302
259 iso_pu_bacteria 2882456835 2882457366 302
260 3300049580 Ga0501046_0348308 Ga0501046_0348308_66_1031 303
261 3300049589 Ga0501073_0175559 Ga0501073_0175559_121_1080 303
262 3300049741 Ga0501079_0263230 Ga0501079_0263230_304_1263 303
263 3300049742 Ga0501080_0102558 Ga0501080_0102558_1243_2175 303
264 3300049744 Ga0501083_0043563 Ga0501083_0043563_2072_3001 303
265 iso_pu_bacteria 2671180139 2671692230 303
266 iso_pu_bacteria 2828305725 2828306397 303
267 iso_pu_bacteria 2842694124 2842697490 303
268 iso_pu_bacteria 2917554339 2917554503 303
269 iso_pu_bacteria 8002060224 8002062339 303
270 3300020070 Ga0206356_10344220 Ga0206356_103442202 304
271 3300049578 Ga0501042_0139598 Ga0501042_0139598_466_1425 304
272 3300049584 Ga0501068_0141973 Ga0501068_0141973_118_1077 304
273 3300049591 Ga0501075_0061191 Ga0501075_0061191_570_1529 304
274 3300049592 Ga0501076_0339428 Ga0501076_0339428_94_1053 304
275 3300005618 Ga0068864_100037787 Ga0068864_1000377872 305
276 3300013308 Ga0157375_10524331 Ga0157375_105243312 305
277 3300026095 Ga0207676_10113020 Ga0207676_101130203 305
278 3300031239 Ga0265328_10009278 Ga0265328_100092781 305
279 3300048911 Ga0496108_0420685 Ga0496108_0420685_17_949 305
280 3300049671 Ga0501238_004132 Ga0501238_004132_474_1400 305
281 iso_pu_bacteria 2513237087 2513590524 305
282 3300045051 Ga0451576_0558837 Ga0451576_0558837_178_1101 306
283 3300049744 Ga0501083_0282335 Ga0501083_0282335_11_946 306
284 3300005435 Ga0070714_100272207 Ga0070714_1002722072 307
285 3300005536 Ga0070697_100374000 Ga0070697_1003740001 307
286 3300006175 Ga0070712_100000882 Ga0070712_10000088214 307
287 3300006175 Ga0070712_100230069 Ga0070712_1002300691 307
288 3300006846 Ga0075430_100062646 Ga0075430_1000626462 307
289 3300025915 Ga0207693_10001021 Ga0207693_1000102114 307
290 3300025915 Ga0207693_10121812 Ga0207693_101218122 307
291 3300025929 Ga0207664_10164519 Ga0207664_101645192 307
292 3300035089 Ga0373944_0000944 Ga0373944_0000944_5871_6797 307
293 3300035113 Ga0373936_0005000 Ga0373936_0005000_1084_2010 307
294 3300035116 Ga0373945_0041141 Ga0373945_0041141_441_1367 307
295 3300035170 Ga0373943_0000444 Ga0373943_0000444_15420_16346 307
296 3300035171 Ga0373946_0000365 Ga0373946_0000365_358_1284 307
297 3300035725 Ga0373947_0001394 Ga0373947_0001394_12605_13531 307
298 3300037068 Ga0373925_0004315 Ga0373925_0004315_8689_9615 307
299 3300046476 Ga0495662_0097299 Ga0495662_0097299_197_1123 307
300 3300046477 Ga0495664_0015521 Ga0495664_0015521_1864_2790 307
301 3300046526 Ga0495666_0009741 Ga0495666_0009741_1286_2212 307
302 3300046531 Ga0495665_0005950 Ga0495665_0005950_2478_3404 307
303 3300046531 Ga0495665_0028928 Ga0495665_0028928_983_1909 307
304 3300046533 Ga0495640_0006778 Ga0495640_0006778_29_955 307
305 3300046543 Ga0495645_0006252 Ga0495645_0006252_3473_4399 307
306 3300046642 Ga0495634_0043139 Ga0495634_0043139_1669_2595 307
307 3300046663 Ga0495635_0005756 Ga0495635_0005756_4719_5645 307
308 3300046681 Ga0495647_0014368 Ga0495647_0014368_1011_1937 307
309 3300046683 Ga0495658_0064523 Ga0495658_0064523_409_1338 307
310 3300046690 Ga0495624_0001159 Ga0495624_0001159_14888_15814 307
311 3300047315 Ga0495581_0003675 Ga0495581_0003675_7878_8804 307
312 3300047317 Ga0495604_0119476 Ga0495604_0119476_448_1374 307
313 3300047319 Ga0495674_0004105 Ga0495674_0004105_5047_5973 307
314 3300047321 Ga0495676_0012199 Ga0495676_0012199_664_1590 307
315 3300047322 Ga0495680_0188858 Ga0495680_0188858_299_1225 307
316 3300047471 Ga0495684_0007486 Ga0495684_0007486_29_955 307
317 3300047673 Ga0495593_0003777 Ga0495593_0003777_3485_4411 307
318 3300050513 nmdc:mga0rr50_418387_c1 nmdc:mga0rr50_418387_c1_104_1054 307
319 3300053077 Ga0495601_0006610 Ga0495601_0006610_528_1454 307
320 3300053078 Ga0495612_0000893 Ga0495612_0000893_1515_2441 307
321 3300053085 Ga0495619_0016705 Ga0495619_0016705_138_1064 307
322 3300029957 Ga0265324_10080010 Ga0265324_100800101 308
323 3300031235 Ga0265330_10071453 Ga0265330_100714531 308
324 3300031249 Ga0265339_10073404 Ga0265339_100734042 308
325 3300031344 Ga0265316_10307722 Ga0265316_103077221 308
326 3300035724 Ga0373933_0269259 Ga0373933_0269259_29_958 308
327 3300005336 Ga0070680_100087772 Ga0070680_1000877721 309
328 3300005435 Ga0070714_100309079 Ga0070714_1003090791 309
329 3300005615 Ga0070702_100082157 Ga0070702_1000821573 309
330 3300005617 Ga0068859_100186879 Ga0068859_1001868792 309
331 3300005618 Ga0068864_100265780 Ga0068864_1002657801 309
332 3300005937 Ga0081455_10009260 Ga0081455_100092603 309
333 3300006048 Ga0075363_100131748 Ga0075363_1001317481 309
334 3300006175 Ga0070712_100015635 Ga0070712_1000156353 309
335 3300006186 Ga0075369_10021372 Ga0075369_100213723 309
336 3300006846 Ga0075430_100002427 Ga0075430_10000242711 309
337 3300006914 Ga0075436_100069432 Ga0075436_1000694322 309
338 3300006931 Ga0097620_100186881 Ga0097620_1001868812 309
339 3300009094 Ga0111539_10234105 Ga0111539_102341052 309
340 3300009174 Ga0105241_10078172 Ga0105241_100781722 309
341 3300013100 Ga0157373_10078078 Ga0157373_100780783 309
342 3300021358 Ga0213873_10021273 Ga0213873_100212732 309
343 3300021384 Ga0213876_10124907 Ga0213876_101249072 309
344 3300025315 Ga0207697_10138190 Ga0207697_101381901 309
345 3300025906 Ga0207699_10036471 Ga0207699_100364714 309
346 3300025915 Ga0207693_10010389 Ga0207693_100103893 309
347 3300025915 Ga0207693_10063266 Ga0207693_100632662 309
348 3300025916 Ga0207663_10036958 Ga0207663_100369582 309
349 3300025917 Ga0207660_10329556 Ga0207660_103295562 309
350 3300025929 Ga0207664_10041788 Ga0207664_100417883 309
351 3300025940 Ga0207691_10196142 Ga0207691_101961422 309
352 3300025949 Ga0207667_10277171 Ga0207667_102771712 309
353 3300026041 Ga0207639_10101941 Ga0207639_101019412 309
354 3300031239 Ga0265328_10002876 Ga0265328_100028764 309
355 3300031241 Ga0265325_10000162 Ga0265325_1000016231 309
356 3300031241 Ga0265325_10023551 Ga0265325_100235513 309
357 3300031344 Ga0265316_10195089 Ga0265316_101950892 309
358 3300031595 Ga0265313_10007672 Ga0265313_100076722 309
359 3300031711 Ga0265314_10008333 Ga0265314_100083338 309
360 3300035089 Ga0373944_0014925 Ga0373944_0014925_158_1087 309
361 3300035111 Ga0373923_0079010 Ga0373923_0079010_313_1242 309
362 3300035118 Ga0373954_0044090 Ga0373954_0044090_480_1409 309
363 3300035121 Ga0373960_0047402 Ga0373960_0047402_85_1017 309
364 3300035170 Ga0373943_0088206 Ga0373943_0088206_57_986 309
365 3300035172 Ga0373955_0075141 Ga0373955_0075141_840_1769 309
366 3300035691 Ga0373931_0013544 Ga0373931_0013544_922_1854 309
367 3300035692 Ga0373935_0349185 Ga0373935_0349185_50_982 309
368 3300036401 Ga0373937_0031420 Ga0373937_0031420_2673_3602 309
369 3300037068 Ga0373925_0250100 Ga0373925_0250100_251_1183 309
370 3300037068 Ga0373925_0295252 Ga0373925_0295252_308_1240 309
371 3300037312 Ga0395899_0007468 Ga0395899_0007468_6656_7588 309
372 3300037418 Ga0395900_0005900 Ga0395900_0005900_6650_7582 309
373 3300037418 Ga0395900_0087539 Ga0395900_0087539_107_1039 309
374 3300037418 Ga0395900_0110828 Ga0395900_0110828_18_950 309
375 3300037466 Ga0395898_0002812 Ga0395898_0002812_7522_8454 309
376 3300037466 Ga0395898_0009212 Ga0395898_0009212_1273_2205 309
377 3300038443 Ga0395901_0013723 Ga0395901_0013723_1293_2225 309
378 3300038443 Ga0395901_0080302 Ga0395901_0080302_279_1211 309
379 3300038443 Ga0395901_0355573 Ga0395901_0355573_216_1148 309
380 3300039437 Ga0436365_0344984 Ga0436365_0344984_12429_13364 309
381 3300039450 Ga0436363_0335613 Ga0436363_0335613_334_1269 309
382 3300039453 Ga0436362_0983170 Ga0436362_0983170_168_1103 309
383 3300044694 Ga0466963_0004838 Ga0466963_0004838_5195_6127 309
384 3300044719 Ga0466971_0059504 Ga0466971_0059504_241_1173 309
385 3300044842 Ga0466957_0046112 Ga0466957_0046112_66_998 309
386 3300045836 Ga0466958_0207560 Ga0466958_0207560_28_960 309
387 3300045976 Ga0466967_0000600 Ga0466967_0000600_361_1293 309
388 3300045976 Ga0466967_0605673 Ga0466967_0605673_112_1044 309
389 3300046462 Ga0495651_0003936 Ga0495651_0003936_4065_4994 309
390 3300046463 Ga0495653_0016165 Ga0495653_0016165_1412_2341 309
391 3300046516 Ga0495628_0008857 Ga0495628_0008857_2266_3195 309
392 3300046517 Ga0495630_0051618 Ga0495630_0051618_1731_2663 309
393 3300046529 Ga0495652_0002263 Ga0495652_0002263_1699_2628 309
394 3300046535 Ga0495586_0166346 Ga0495586_0166346_177_1109 309
395 3300046536 Ga0495587_0006801 Ga0495587_0006801_3669_4598 309
396 3300046543 Ga0495645_0013793 Ga0495645_0013793_197_1126 309
397 3300046559 Ga0495667_0003673 Ga0495667_0003673_7460_8389 309
398 3300046663 Ga0495635_0062865 Ga0495635_0062865_71_1000 309
399 3300046678 Ga0495599_0001552 Ga0495599_0001552_10497_11426 309
400 3300046681 Ga0495647_0047949 Ga0495647_0047949_503_1435 309
401 3300046683 Ga0495658_0008108 Ga0495658_0008108_4080_5012 309
402 3300046809 Ga0495600_0005624 Ga0495600_0005624_5490_6419 309
403 3300047317 Ga0495604_0060160 Ga0495604_0060160_154_1083 309
404 3300047444 Ga0495675_0017849 Ga0495675_0017849_2020_2949 309
405 3300048088 Ga0495602_0005586 Ga0495602_0005586_2841_3770 309
406 3300048903 Ga0496100_0003561 Ga0496100_0003561_1483_2433 309
407 3300048903 Ga0496100_0020821 Ga0496100_0020821_2157_3089 309
408 3300048904 Ga0496101_0002312 Ga0496101_0002312_469_1419 309
409 3300048905 Ga0496102_0011352 Ga0496102_0011352_4863_5813 309
410 3300048906 Ga0496103_0181616 Ga0496103_0181616_67_1017 309
411 3300048907 Ga0496104_0003051 Ga0496104_0003051_10215_11165 309
412 3300048907 Ga0496104_0029302 Ga0496104_0029302_4095_5045 309
413 3300048907 Ga0496104_0041805 Ga0496104_0041805_2737_3669 309
414 3300048909 Ga0496106_0004523 Ga0496106_0004523_1157_2107 309
415 3300048910 Ga0496107_0001981 Ga0496107_0001981_1627_2577 309
416 3300048911 Ga0496108_0008671 Ga0496108_0008671_1238_2188 309
417 3300048911 Ga0496108_0109164 Ga0496108_0109164_479_1411 309
418 3300048911 Ga0496108_0263427 Ga0496108_0263427_258_1190 309
419 3300048912 Ga0496109_0108961 Ga0496109_0108961_1429_2379 309
420 3300048912 Ga0496109_0260989 Ga0496109_0260989_648_1580 309
421 3300048913 Ga0496110_0002763 Ga0496110_0002763_2035_2985 309
422 3300048913 Ga0496110_0004859 Ga0496110_0004859_3826_4776 309
423 3300048914 Ga0496111_0022767 Ga0496111_0022767_1750_2700 309
424 3300048915 Ga0496112_0006926 Ga0496112_0006926_7823_8773 309
425 3300048915 Ga0496112_0060283 Ga0496112_0060283_832_1782 309
426 3300048916 Ga0496113_0007716 Ga0496113_0007716_4720_5670 309
427 3300048917 Ga0496114_0070175 Ga0496114_0070175_1393_2325 309
428 3300048918 Ga0496115_0021027 Ga0496115_0021027_1087_2037 309
429 3300048918 Ga0496115_0107355 Ga0496115_0107355_118_1050 309
430 3300049568 Ga0501031_0230741 Ga0501031_0230741_260_1192 309
431 3300049571 Ga0501034_0253926 Ga0501034_0253926_677_1609 309
432 3300049583 Ga0501067_0066324 Ga0501067_0066324_930_1880 309
433 3300049587 Ga0501071_0198070 Ga0501071_0198070_385_1317 309
434 3300050492 nmdc:mga0yw44_97207_c1 nmdc:mga0yw44_97207_c1_617_1549 309
435 3300050494 nmdc:mga06z11_36850_c1 nmdc:mga06z11_36850_c1_342_1277 309
436 3300050496 nmdc:mga07m45_75485_c1 nmdc:mga07m45_75485_c1_126_1061 309
437 3300050509 nmdc:mga0qj67_62_c1 nmdc:mga0qj67_62_c1_42085_43017 309
438 3300050510 nmdc:mga06r32_169976_c1 nmdc:mga06r32_169976_c1_13_945 309
439 3300050511 nmdc:mga08y16_174418_c1 nmdc:mga08y16_174418_c1_101_1033 309
440 3300050512 nmdc:mga0n895_58287_c1 nmdc:mga0n895_58287_c1_1225_2157 309
441 3300050515 nmdc:mga0a205_15283_c1 nmdc:mga0a205_15283_c1_3504_4436 309
442 3300053077 Ga0495601_0001359 Ga0495601_0001359_5480_6409 309
443 3300053078 Ga0495612_0000238 Ga0495612_0000238_4902_5831 309
444 3300053084 Ga0495595_0000795 Ga0495595_0000795_4653_5582 309
445 3300053084 Ga0495595_0042549 Ga0495595_0042549_505_1437 309
446 3300053085 Ga0495619_0003766 Ga0495619_0003766_4127_5056 309
447 3300053120 Ga0500597_030665 Ga0500597_030665_980_1915 309
448 3300061719 Ga0466962_0012613 Ga0466962_0012613_2977_3909 309
449 iso_pu_bacteria 2818991467 2819719939 309
450 iso_pu_bacteria 2917699015 2917704148 309
451 3300005331 Ga0070670_100015801 Ga0070670_1000158013 310
452 3300005344 Ga0070661_100206365 Ga0070661_1002063651 310
453 3300005354 Ga0070675_100089330 Ga0070675_1000893302 310
454 3300005355 Ga0070671_100000776 Ga0070671_1000007768 310
455 3300005364 Ga0070673_100005013 Ga0070673_1000050135 310
456 3300005435 Ga0070714_100033778 Ga0070714_1000337784 310
457 3300005437 Ga0070710_10136370 Ga0070710_101363702 310
458 3300005439 Ga0070711_100067116 Ga0070711_1000671162 310
459 3300005466 Ga0070685_10142373 Ga0070685_101423732 310
460 3300005530 Ga0070679_100082513 Ga0070679_1000825133 310
461 3300005548 Ga0070665_100018913 Ga0070665_1000189134 310
462 3300005614 Ga0068856_100500857 Ga0068856_1005008571 310
463 3300005618 Ga0068864_100511957 Ga0068864_1005119572 310
464 3300006175 Ga0070712_100067116 Ga0070712_1000671163 310
465 3300006844 Ga0075428_100002387 Ga0075428_10000238719 310
466 3300006846 Ga0075430_100004956 Ga0075430_1000049561 310
467 3300006847 Ga0075431_100000881 Ga0075431_1000008815 310
468 3300006880 Ga0075429_100002150 Ga0075429_10000215011 310
469 3300009094 Ga0111539_10000144 Ga0111539_1000014463 310
470 3300009098 Ga0105245_10245169 Ga0105245_102451692 310
471 3300009147 Ga0114129_10000542 Ga0114129_1000054225 310
472 3300014325 Ga0163163_10124862 Ga0163163_101248622 310
473 3300025916 Ga0207663_10108500 Ga0207663_101085001 310
474 3300025925 Ga0207650_10041512 Ga0207650_100415123 310
475 3300025926 Ga0207659_10024779 Ga0207659_100247793 310
476 3300025928 Ga0207700_10194075 Ga0207700_101940751 310
477 3300025929 Ga0207664_10131445 Ga0207664_101314452 310
478 3300025932 Ga0207690_10195149 Ga0207690_101951492 310
479 3300025932 Ga0207690_10354798 Ga0207690_103547981 310
480 3300025939 Ga0207665_10064667 Ga0207665_100646673 310
481 3300025960 Ga0207651_10005773 Ga0207651_100057735 310
482 3300025972 Ga0207668_10289548 Ga0207668_102895482 310
483 3300027907 Ga0207428_10036366 Ga0207428_100363663 310
484 3300028023 Ga0265357_1002069 Ga0265357_10020691 310
485 3300030763 Ga0265763_1000930 Ga0265763_10009302 310
486 3300031090 Ga0265760_10020706 Ga0265760_100207062 310
487 3300035086 Ga0373934_0099054 Ga0373934_0099054_119_1054 310
488 3300035118 Ga0373954_0024856 Ga0373954_0024856_583_1518 310
489 3300035119 Ga0373956_0014953 Ga0373956_0014953_1937_2872 310
490 3300035119 Ga0373956_0049755 Ga0373956_0049755_595_1530 310
491 3300035172 Ga0373955_0018513 Ga0373955_0018513_2299_3234 310
492 3300035692 Ga0373935_0033031 Ga0373935_0033031_321_1256 310
493 3300035695 Ga0373927_0029481 Ga0373927_0029481_2348_3283 310
494 3300035724 Ga0373933_0007659 Ga0373933_0007659_2593_3528 310
495 3300035725 Ga0373947_0076635 Ga0373947_0076635_427_1362 310
496 3300036401 Ga0373937_0007150 Ga0373937_0007150_6847_7782 310
497 3300037068 Ga0373925_0042730 Ga0373925_0042730_98_1033 310
498 3300039437 Ga0436365_1514696 Ga0436365_1514696_882_1817 310
499 3300046454 Ga0495592_0009274 Ga0495592_0009274_2465_3400 310
500 3300046462 Ga0495651_0146388 Ga0495651_0146388_232_1167 310
501 3300046463 Ga0495653_0001546 Ga0495653_0001546_2860_3795 310
502 3300046463 Ga0495653_0101288 Ga0495653_0101288_738_1673 310
503 3300046472 Ga0495580_0212472 Ga0495580_0212472_316_1251 310
504 3300046477 Ga0495664_0074735 Ga0495664_0074735_816_1751 310
505 3300046511 Ga0495608_0002461 Ga0495608_0002461_3494_4429 310
506 3300046516 Ga0495628_0051189 Ga0495628_0051189_1995_2930 310
507 3300046516 Ga0495628_0113205 Ga0495628_0113205_261_1196 310
508 3300046529 Ga0495652_0002387 Ga0495652_0002387_4601_5536 310
509 3300046529 Ga0495652_0049159 Ga0495652_0049159_243_1178 310
510 3300046533 Ga0495640_0002268 Ga0495640_0002268_370_1305 310
511 3300046536 Ga0495587_0000974 Ga0495587_0000974_14257_15192 310
512 3300046543 Ga0495645_0005094 Ga0495645_0005094_535_1470 310
513 3300046559 Ga0495667_0002526 Ga0495667_0002526_7782_8717 310
514 3300046642 Ga0495634_0001554 Ga0495634_0001554_5060_5995 310
515 3300046663 Ga0495635_0001424 Ga0495635_0001424_13244_14179 310
516 3300046678 Ga0495599_0002551 Ga0495599_0002551_3277_4212 310
517 3300046679 Ga0495623_0044148 Ga0495623_0044148_226_1161 310
518 3300046679 Ga0495623_0101310 Ga0495623_0101310_459_1394 310
519 3300046680 Ga0495646_0007710 Ga0495646_0007710_793_1728 310
520 3300046683 Ga0495658_0256598 Ga0495658_0256598_83_1018 310
521 3300046689 Ga0495613_0113254 Ga0495613_0113254_787_1722 310
522 3300046690 Ga0495624_0059969 Ga0495624_0059969_1199_2134 310
523 3300046809 Ga0495600_0021678 Ga0495600_0021678_2967_3902 310
524 3300046809 Ga0495600_0097430 Ga0495600_0097430_418_1353 310
525 3300047315 Ga0495581_0024208 Ga0495581_0024208_710_1645 310
526 3300047317 Ga0495604_0028339 Ga0495604_0028339_1842_2777 310
527 3300047319 Ga0495674_0001794 Ga0495674_0001794_1985_2920 310
528 3300047321 Ga0495676_0347744 Ga0495676_0347744_13_948 310
529 3300047322 Ga0495680_0003134 Ga0495680_0003134_1203_2138 310
530 3300047322 Ga0495680_0033332 Ga0495680_0033332_948_1883 310
531 3300047444 Ga0495675_0006989 Ga0495675_0006989_2734_3669 310
532 3300047471 Ga0495684_0122218 Ga0495684_0122218_871_1806 310
533 3300048907 Ga0496104_0129397 Ga0496104_0129397_1357_2292 310
534 3300048909 Ga0496106_0199358 Ga0496106_0199358_217_1152 310
535 3300048913 Ga0496110_0444293 Ga0496110_0444293_137_1072 310
536 3300048915 Ga0496112_0212104 Ga0496112_0212104_693_1628 310
537 3300048916 Ga0496113_0063776 Ga0496113_0063776_1418_2353 310
538 3300048918 Ga0496115_0340091 Ga0496115_0340091_131_1066 310
539 3300049574 Ga0501038_0186860 Ga0501038_0186860_430_1368 310
540 3300049579 Ga0501043_0191534 Ga0501043_0191534_405_1343 310
541 3300049581 Ga0501047_0003841 Ga0501047_0003841_5329_6267 310
542 3300049586 Ga0501070_0011466 Ga0501070_0011466_1762_2700 310
543 3300049590 Ga0501074_0178731 Ga0501074_0178731_354_1292 310
544 3300049742 Ga0501080_0095804 Ga0501080_0095804_1716_2654 310
545 3300049823 Ga0501044_0019980 Ga0501044_0019980_5388_6326 310
546 3300050507 nmdc:mga05p37_52_c1 nmdc:mga05p37_52_c1_22370_23305 310
547 3300050509 nmdc:mga0qj67_3562_c1 nmdc:mga0qj67_3562_c1_9975_10910 310
548 3300050510 nmdc:mga06r32_248_c1 nmdc:mga06r32_248_c1_10972_11907 310
549 3300050511 nmdc:mga08y16_185_c1 nmdc:mga08y16_185_c1_27647_28582 310
550 3300053077 Ga0495601_0080600 Ga0495601_0080600_590_1525 310
551 3300053078 Ga0495612_0000657 Ga0495612_0000657_2547_3482 310
552 3300053084 Ga0495595_0015118 Ga0495595_0015118_10_945 310
553 3300053084 Ga0495595_0127452 Ga0495595_0127452_75_1010 310
554 iso_pu_bacteria 2643221736 2644744181 310
555 iso_pu_bacteria 2851182111 2851186011 310
556 3300005471 Ga0070698_100068873 Ga0070698_1000688732 311
557 3300005981 Ga0081538_10006793 Ga0081538_100067932 311
558 3300006048 Ga0075363_100014937 Ga0075363_1000149374 311
559 3300006051 Ga0075364_10006943 Ga0075364_100069432 311
560 3300006177 Ga0075362_10000531 Ga0075362_100005313 311
561 3300006195 Ga0075366_10005359 Ga0075366_100053597 311
562 3300010159 Ga0099796_10002797 Ga0099796_100027974 311
563 3300021361 Ga0213872_10102814 Ga0213872_101028142 311
564 3300025928 Ga0207700_10384309 Ga0207700_103843091 311
565 3300035113 Ga0373936_0058991 Ga0373936_0058991_491_1429 311
566 3300035116 Ga0373945_0119307 Ga0373945_0119307_92_1033 311
567 3300035170 Ga0373943_0038446 Ga0373943_0038446_874_1812 311
568 3300035695 Ga0373927_0024839 Ga0373927_0024839_2011_2949 311
569 3300035695 Ga0373927_0083964 Ga0373927_0083964_1025_1963 311
570 3300035725 Ga0373947_0078149 Ga0373947_0078149_985_2022 311
571 3300037853 Ga0436364_0503784 Ga0436364_0503784_312_1253 311
572 3300039450 Ga0436363_0461760 Ga0436363_0461760_1212_2153 311
573 3300046514 Ga0495618_0118213 Ga0495618_0118213_275_1312 311
574 3300046516 Ga0495628_0138418 Ga0495628_0138418_860_1801 311
575 3300046533 Ga0495640_0134623 Ga0495640_0134623_25_966 311
576 3300046678 Ga0495599_0128260 Ga0495599_0128260_329_1270 311
577 3300047322 Ga0495680_0210983 Ga0495680_0210983_323_1264 311
578 3300047471 Ga0495684_0067676 Ga0495684_0067676_1492_2433 311
579 3300048907 Ga0496104_0256893 Ga0496104_0256893_40_981 311
580 3300048911 Ga0496108_0085789 Ga0496108_0085789_1534_2475 311
581 3300048912 Ga0496109_0082119 Ga0496109_0082119_1639_2580 311
582 3300050490 nmdc:mga03n38_48450_c1 nmdc:mga03n38_48450_c1_418_1359 311
583 3300050491 nmdc:mga00v17_23359_c1 nmdc:mga00v17_23359_c1_883_1824 311
584 3300050493 nmdc:mga0k408_12748_c1 nmdc:mga0k408_12748_c1_419_1360 311
585 3300053078 Ga0495612_0074184 Ga0495612_0074184_30_971 311
586 3300053084 Ga0495595_0042041 Ga0495595_0042041_729_1670 311
587 3300053085 Ga0495619_0077460 Ga0495619_0077460_599_1540 311
588 3300003203 JGI25406J46586_10028084 JGI25406J46586_100280841 312
589 3300003578 Ga0006562J51391_1044411 Ga0006562J51391_10444112 312
590 3300003578 Ga0006562J51391_1044412 Ga0006562J51391_10444122 312
591 3300003659 JGI25404J52841_10006833 JGI25404J52841_100068332 312
592 3300003771 Ga0055526_1000554 Ga0055526_100055429 312
593 3300003771 Ga0055526_1004638 Ga0055526_10046383 312
594 3300005331 Ga0070670_100152008 Ga0070670_1001520082 312
595 3300005333 Ga0070677_10067371 Ga0070677_100673712 312
596 3300005340 Ga0070689_100072734 Ga0070689_1000727342 312
597 3300005353 Ga0070669_100066683 Ga0070669_1000666832 312
598 3300005354 Ga0070675_100053603 Ga0070675_1000536032 312
599 3300005356 Ga0070674_100084072 Ga0070674_1000840721 312
600 3300005365 Ga0070688_100064312 Ga0070688_1000643122 312
601 3300005367 Ga0070667_100154760 Ga0070667_1001547602 312
602 3300005435 Ga0070714_100229399 Ga0070714_1002293992 312
603 3300005436 Ga0070713_100178332 Ga0070713_1001783322 312
604 3300005436 Ga0070713_100342449 Ga0070713_1003424492 312
605 3300005458 Ga0070681_10342099 Ga0070681_103420991 312
606 3300005543 Ga0070672_100018088 Ga0070672_1000180882 312
607 3300005548 Ga0070665_100314505 Ga0070665_1003145052 312
608 3300005617 Ga0068859_100357955 Ga0068859_1003579552 312
609 3300005618 Ga0068864_100028321 Ga0068864_1000283212 312
610 3300005841 Ga0068863_100424690 Ga0068863_1004246901 312
611 3300005981 Ga0081538_10031584 Ga0081538_100315844 312
612 3300005983 Ga0081540_1000108 Ga0081540_100010843 312
613 3300005985 Ga0081539_10002916 Ga0081539_1000291618 312
614 3300006177 Ga0075362_10053515 Ga0075362_100535151 312
615 3300006178 Ga0075367_10051569 Ga0075367_100515693 312
616 3300006195 Ga0075366_10032009 Ga0075366_100320093 312
617 3300006931 Ga0097620_100357939 Ga0097620_1003579392 312
618 3300009098 Ga0105245_10579770 Ga0105245_105797701 312
619 3300009147 Ga0114129_10093762 Ga0114129_100937623 312
620 3300009148 Ga0105243_10055697 Ga0105243_100556972 312
621 3300014326 Ga0157380_10135776 Ga0157380_101357763 312
622 3300014969 Ga0157376_10725703 Ga0157376_107257031 312
623 3300025294 Ga0209025_1000008 Ga0209025_1000008159 312
624 3300025295 Ga0209564_1000031 Ga0209564_1000031339 312
625 3300025893 Ga0207682_10000236 Ga0207682_1000023621 312
626 3300025912 Ga0207707_10249614 Ga0207707_102496142 312
627 3300025918 Ga0207662_10029165 Ga0207662_100291652 312
628 3300025921 Ga0207652_10382817 Ga0207652_103828172 312
629 3300025931 Ga0207644_10072623 Ga0207644_100726232 312
630 3300025940 Ga0207691_10014531 Ga0207691_100145315 312
631 3300025942 Ga0207689_10032070 Ga0207689_100320704 312
632 3300025960 Ga0207651_10187064 Ga0207651_101870642 312
633 3300026041 Ga0207639_10344912 Ga0207639_103449122 312
634 3300026089 Ga0207648_10017205 Ga0207648_100172052 312
635 3300026095 Ga0207676_10014792 Ga0207676_100147924 312
636 3300026116 Ga0207674_10216695 Ga0207674_102166952 312
637 3300026118 Ga0207675_100066985 Ga0207675_1000669853 312
638 3300026121 Ga0207683_10007521 Ga0207683_100075215 312
639 3300028379 Ga0268266_10259631 Ga0268266_102596312 312
640 3300035117 Ga0373953_0044878 Ga0373953_0044878_228_1172 312
641 3300035118 Ga0373954_0073733 Ga0373954_0073733_459_1403 312
642 3300035119 Ga0373956_0066003 Ga0373956_0066003_630_1574 312
643 3300035120 Ga0373957_0125471 Ga0373957_0125471_48_992 312
644 3300036401 Ga0373937_0007474 Ga0373937_0007474_237_1181 312
645 3300046474 Ga0495605_0014539 Ga0495605_0014539_953_1897 312
646 3300046517 Ga0495630_0274915 Ga0495630_0274915_100_1044 312
647 3300047317 Ga0495604_0263699 Ga0495604_0263699_111_1055 312
648 3300047319 Ga0495674_0049828 Ga0495674_0049828_69_1013 312
649 3300048925 Ga0496122_0232275 Ga0496122_0232275_56_1003 312
650 3300048926 Ga0496123_0033923 Ga0496123_0033923_1471_2418 312
651 3300048928 Ga0496125_0062184 Ga0496125_0062184_1480_2427 312
652 3300049570 Ga0501033_0010833 Ga0501033_0010833_2347_3342 312
653 3300049571 Ga0501034_0110578 Ga0501034_0110578_279_1274 312
654 3300049574 Ga0501038_0237860 Ga0501038_0237860_107_1102 312
655 3300049579 Ga0501043_0131634 Ga0501043_0131634_912_1907 312
656 3300049581 Ga0501047_0028740 Ga0501047_0028740_819_1814 312
657 3300049823 Ga0501044_0031516 Ga0501044_0031516_816_1811 312
658 3300050493 nmdc:mga0k408_41022_c1 nmdc:mga0k408_41022_c1_503_1444 312
659 3300050507 nmdc:mga05p37_55172_c1 nmdc:mga05p37_55172_c1_2507_3496 312
660 3300050508 nmdc:mga09592_356119_c1 nmdc:mga09592_356119_c1_91_1050 312
661 3300053077 Ga0495601_0169811 Ga0495601_0169811_131_1075 312
662 3300005981 Ga0081538_10053170 Ga0081538_100531702 313
663 3300006042 Ga0075368_10008782 Ga0075368_100087823 313
664 3300013104 Ga0157370_10114947 Ga0157370_101149472 313
665 3300031665 Ga0316575_10047580 Ga0316575_100475802 313
666 3300031727 Ga0316576_10014553 Ga0316576_100145535 313
667 3300032133 Ga0316583_10001130 Ga0316583_100011305 313
668 3300035398 Ga0316574_0000639 Ga0316574_0000639_10901_11857 313
669 3300036712 Ga0316584_0020630 Ga0316584_0020630_3772_4728 313
670 3300046522 Ga0495643_0019528 Ga0495643_0019528_246_1196 313
671 3300050492 nmdc:mga0yw44_15452_c1 nmdc:mga0yw44_15452_c1_586_1536 313
672 3300050494 nmdc:mga06z11_11761_c1 nmdc:mga06z11_11761_c1_959_1909 313
673 3300053131 Ga0500652_000056 Ga0500652_000056_35523_36473 313
674 3300053156 Ga0500622_0027584 Ga0500622_0027584_1284_2234 313
675 3300053177 Ga0500636_0038640 Ga0500636_0038640_341_1291 313
676 iso_pu_bacteria 2643221733 2644732324 313
677 3300031090 Ga0265760_10020197 Ga0265760_100201972 314
678 3300044842 Ga0466957_0023514 Ga0466957_0023514_1502_2449 314
679 3300045049 Ga0466959_0027099 Ga0466959_0027099_240_1187 314
680 3300045836 Ga0466958_0075461 Ga0466958_0075461_1102_2049 314
681 3300005545 Ga0070695_100051014 Ga0070695_1000510143 316
682 3300005983 Ga0081540_1007873 Ga0081540_10078733 316
683 3300007076 Ga0075435_100237431 Ga0075435_1002374312 316
684 3300041408 Ga0439453_0003007 Ga0439453_0003007_669_1622 316
685 3300050512 nmdc:mga0n895_250882_c1 nmdc:mga0n895_250882_c1_161_1117 316
686 3300050513 nmdc:mga0rr50_189449_c1 nmdc:mga0rr50_189449_c1_343_1338 316
687 3300050514 nmdc:mga08x19_22_c1 nmdc:mga08x19_22_c1_394_1389 316
688 3300005328 Ga0070676_10059345 Ga0070676_100593453 317
689 3300005330 Ga0070690_100229382 Ga0070690_1002293822 317
690 3300005336 Ga0070680_100038585 Ga0070680_1000385853 317
691 3300005340 Ga0070689_100019555 Ga0070689_1000195555 317
692 3300005354 Ga0070675_100040621 Ga0070675_1000406215 317
693 3300005355 Ga0070671_100149828 Ga0070671_1001498282 317
694 3300005365 Ga0070688_100036231 Ga0070688_1000362314 317
695 3300005458 Ga0070681_10018284 Ga0070681_100182847 317
696 3300005458 Ga0070681_10374909 Ga0070681_103749092 317
697 3300005458 Ga0070681_10458554 Ga0070681_104585541 317
698 3300005530 Ga0070679_100053825 Ga0070679_1000538253 317
699 3300005543 Ga0070672_100160616 Ga0070672_1001606162 317
700 3300005617 Ga0068859_100132355 Ga0068859_1001323553 317
701 3300005843 Ga0068860_100123800 Ga0068860_1001238002 317
702 3300006178 Ga0075367_10120882 Ga0075367_101208822 317
703 3300006195 Ga0075366_10022896 Ga0075366_100228963 317
704 3300006237 Ga0097621_100324730 Ga0097621_1003247302 317
705 3300006881 Ga0068865_100327642 Ga0068865_1003276421 317
706 3300006931 Ga0097620_100132350 Ga0097620_1001323503 317
707 3300007076 Ga0075435_100005906 Ga0075435_1000059064 317
708 3300009094 Ga0111539_10022547 Ga0111539_100225475 317
709 3300009177 Ga0105248_10002898 Ga0105248_100028989 317
710 3300013308 Ga0157375_10144334 Ga0157375_101443342 317
711 3300014325 Ga0163163_10010340 Ga0163163_100103408 317
712 3300014497 Ga0182008_10025417 Ga0182008_100254174 317
713 3300025901 Ga0207688_10024290 Ga0207688_100242905 317
714 3300025912 Ga0207707_10075933 Ga0207707_100759332 317
715 3300025917 Ga0207660_10003986 Ga0207660_1000398610 317
716 3300025921 Ga0207652_10039220 Ga0207652_100392206 317
717 3300025926 Ga0207659_10044866 Ga0207659_100448663 317
718 3300025935 Ga0207709_10316393 Ga0207709_103163931 317
719 3300025936 Ga0207670_10001838 Ga0207670_100018385 317
720 3300025939 Ga0207665_10070566 Ga0207665_100705661 317
721 3300025940 Ga0207691_10060991 Ga0207691_100609913 317
722 3300025941 Ga0207711_10064116 Ga0207711_100641164 317
723 3300026023 Ga0207677_10061026 Ga0207677_100610263 317
724 3300026089 Ga0207648_10324214 Ga0207648_103242141 317
725 3300026118 Ga0207675_100463081 Ga0207675_1004630812 317
726 3300027907 Ga0207428_10146992 Ga0207428_101469922 317
727 3300031241 Ga0265325_10005177 Ga0265325_100051773 317
728 3300031241 Ga0265325_10064001 Ga0265325_100640012 317
729 3300034820 Ga0373959_0008928 Ga0373959_0008928_491_1447 317
730 3300035112 Ga0373932_0047861 Ga0373932_0047861_284_1240 317
731 3300035121 Ga0373960_0025163 Ga0373960_0025163_623_1579 317
732 3300035121 Ga0373960_0063683 Ga0373960_0063683_38_994 317
733 3300035172 Ga0373955_0112793 Ga0373955_0112793_280_1236 317
734 3300035241 Ga0373961_0006333 Ga0373961_0006333_165_1121 317
735 3300035241 Ga0373961_0050987 Ga0373961_0050987_203_1159 317
736 3300035242 Ga0373962_0002857 Ga0373962_0002857_2535_3491 317
737 3300035691 Ga0373931_0002195 Ga0373931_0002195_5827_6783 317
738 3300035691 Ga0373931_0002855 Ga0373931_0002855_5574_6530 317
739 3300035691 Ga0373931_0080160 Ga0373931_0080160_467_1423 317
740 3300035692 Ga0373935_0013611 Ga0373935_0013611_2258_3214 317
741 3300035692 Ga0373935_0121150 Ga0373935_0121150_753_1709 317
742 3300035725 Ga0373947_0211134 Ga0373947_0211134_254_1210 317
743 3300037068 Ga0373925_0091344 Ga0373925_0091344_858_1814 317
744 3300046454 Ga0495592_0075476 Ga0495592_0075476_231_1187 317
745 3300047317 Ga0495604_0227216 Ga0495604_0227216_135_1091 317
746 3300047322 Ga0495680_0099299 Ga0495680_0099299_978_1934 317
747 3300048903 Ga0496100_0007392 Ga0496100_0007392_3151_4107 317
748 3300048904 Ga0496101_0001698 Ga0496101_0001698_5516_6472 317
749 3300048905 Ga0496102_0006852 Ga0496102_0006852_1473_2429 317
750 3300048906 Ga0496103_0135250 Ga0496103_0135250_371_1327 317
751 3300048907 Ga0496104_0196091 Ga0496104_0196091_437_1393 317
752 3300048909 Ga0496106_0016334 Ga0496106_0016334_3098_4054 317
753 3300048909 Ga0496106_0258551 Ga0496106_0258551_238_1194 317
754 3300048911 Ga0496108_0007574 Ga0496108_0007574_5589_6545 317
755 3300048912 Ga0496109_0038830 Ga0496109_0038830_1392_2348 317
756 3300048913 Ga0496110_0003430 Ga0496110_0003430_7998_8954 317
757 3300048914 Ga0496111_0041160 Ga0496111_0041160_916_1872 317
758 3300048915 Ga0496112_0113340 Ga0496112_0113340_715_1671 317
759 3300048915 Ga0496112_0263309 Ga0496112_0263309_136_1092 317
760 3300048917 Ga0496114_0029829 Ga0496114_0029829_1750_2706 317
761 3300048918 Ga0496115_0190594 Ga0496115_0190594_568_1524 317
762 3300049568 Ga0501031_0006090 Ga0501031_0006090_3903_4859 317
763 3300049569 Ga0501032_0025316 Ga0501032_0025316_854_1810 317
764 3300049571 Ga0501034_0064129 Ga0501034_0064129_1084_2040 317
765 3300049571 Ga0501034_0075399 Ga0501034_0075399_1250_2206 317
766 3300049571 Ga0501034_0512494 Ga0501034_0512494_129_1085 317
767 3300049572 Ga0501036_0013411 Ga0501036_0013411_3017_3973 317
768 3300049574 Ga0501038_0051377 Ga0501038_0051377_1925_2881 317
769 3300049574 Ga0501038_0061334 Ga0501038_0061334_1127_2083 317
770 3300049575 Ga0501039_0041424 Ga0501039_0041424_645_1601 317
771 3300049579 Ga0501043_0031809 Ga0501043_0031809_994_1950 317
772 3300049581 Ga0501047_0126074 Ga0501047_0126074_443_1399 317
773 3300049586 Ga0501070_0021330 Ga0501070_0021330_2986_3942 317
774 3300049588 Ga0501072_0107748 Ga0501072_0107748_698_1654 317
775 3300049822 Ga0501035_0012798 Ga0501035_0012798_3877_4833 317
776 3300049823 Ga0501044_0000509 Ga0501044_0000509_17434_18390 317
777 3300049823 Ga0501044_0431705 Ga0501044_0431705_185_1141 317
778 3300050493 nmdc:mga0k408_53649_c1 nmdc:mga0k408_53649_c1_1122_2078 317
779 3300050493 nmdc:mga0k408_73074_c1 nmdc:mga0k408_73074_c1_213_1169 317
780 3300050494 nmdc:mga06z11_3813_c1 nmdc:mga06z11_3813_c1_2489_3445 317
781 3300050511 nmdc:mga08y16_19901_c1 nmdc:mga08y16_19901_c1_5710_6687 317
782 3300050513 nmdc:mga0rr50_33759_c1 nmdc:mga0rr50_33759_c1_2169_3146 317
783 3300053084 Ga0495595_0038271 Ga0495595_0038271_70_1026 317
784 3300053085 Ga0495619_0231289 Ga0495619_0231289_250_1206 317
785 3300005458 Ga0070681_10110314 Ga0070681_101103143 318
786 3300005530 Ga0070679_100151087 Ga0070679_1001510872 318
787 3300036401 Ga0373937_0125580 Ga0373937_0125580_1121_2110 318
788 3300049587 Ga0501071_0010484 Ga0501071_0010484_2063_3025 318
789 3300049588 Ga0501072_0048709 Ga0501072_0048709_2021_2983 318
790 3300049592 Ga0501076_0075248 Ga0501076_0075248_671_1633 318
791 3300049743 Ga0501081_0070925 Ga0501081_0070925_424_1386 318
792 3300050511 nmdc:mga08y16_507966_c1 nmdc:mga08y16_507966_c1_194_1183 318
793 3300061734 Ga0530510_0034068 Ga0530510_0034068_351_1313 318
794 3300001977 JGI24746J21847_1002311 JGI24746J21847_10023114 319
795 3300002244 JGI24742J22300_10001731 JGI24742J22300_100017312 319
796 3300002459 JGI24751J29686_10012415 JGI24751J29686_100124152 319
797 3300005328 Ga0070676_10079333 Ga0070676_100793333 319
798 3300005335 Ga0070666_10017740 Ga0070666_100177403 319
799 3300005337 Ga0070682_100016862 Ga0070682_1000168624 319
800 3300005364 Ga0070673_100010439 Ga0070673_1000104391 319
801 3300005365 Ga0070688_100009732 Ga0070688_1000097325 319
802 3300005366 Ga0070659_100032106 Ga0070659_1000321063 319
803 3300005367 Ga0070667_100111510 Ga0070667_1001115102 319
804 3300005436 Ga0070713_100307697 Ga0070713_1003076972 319
805 3300005439 Ga0070711_100026936 Ga0070711_1000269362 319
806 3300005439 Ga0070711_100035081 Ga0070711_1000350815 319
807 3300005445 Ga0070708_100015368 Ga0070708_1000153686 319
808 3300005455 Ga0070663_100009309 Ga0070663_1000093091 319
809 3300005468 Ga0070707_100080461 Ga0070707_1000804613 319
810 3300005468 Ga0070707_100246552 Ga0070707_1002465521 319
811 3300005471 Ga0070698_100370916 Ga0070698_1003709161 319
812 3300005518 Ga0070699_100001669 Ga0070699_1000016697 319
813 3300005518 Ga0070699_100231298 Ga0070699_1002312982 319
814 3300005530 Ga0070679_100019369 Ga0070679_1000193691 319
815 3300005543 Ga0070672_100002368 Ga0070672_1000023688 319
816 3300005548 Ga0070665_100236209 Ga0070665_1002362093 319
817 3300005549 Ga0070704_100046280 Ga0070704_1000462802 319
818 3300005549 Ga0070704_100174268 Ga0070704_1001742682 319
819 3300005563 Ga0068855_100542362 Ga0068855_1005423621 319
820 3300005617 Ga0068859_100148383 Ga0068859_1001483832 319
821 3300005618 Ga0068864_100065734 Ga0068864_1000657342 319
822 3300005719 Ga0068861_100252540 Ga0068861_1002525402 319
823 3300005840 Ga0068870_10000511 Ga0068870_100005119 319
824 3300005842 Ga0068858_100092912 Ga0068858_1000929123 319
825 3300005843 Ga0068860_100005647 Ga0068860_1000056477 319
826 3300005844 Ga0068862_100023093 Ga0068862_1000230931 319
827 3300005937 Ga0081455_10000393 Ga0081455_1000039329 319
828 3300005937 Ga0081455_10009827 Ga0081455_100098275 319
829 3300006028 Ga0070717_10344410 Ga0070717_103444101 319
830 3300006038 Ga0075365_10050728 Ga0075365_100507284 319
831 3300006175 Ga0070712_100000770 Ga0070712_10000077016 319
832 3300006175 Ga0070712_100082986 Ga0070712_1000829863 319
833 3300006358 Ga0068871_100052246 Ga0068871_1000522464 319
834 3300006844 Ga0075428_100018721 Ga0075428_1000187216 319
835 3300006846 Ga0075430_100002327 Ga0075430_1000023278 319
836 3300006847 Ga0075431_100016707 Ga0075431_1000167078 319
837 3300006847 Ga0075431_100137754 Ga0075431_1001377542 319
838 3300006852 Ga0075433_10070886 Ga0075433_100708861 319
839 3300006852 Ga0075433_10138908 Ga0075433_101389082 319
840 3300006871 Ga0075434_100071051 Ga0075434_1000710511 319
841 3300006881 Ga0068865_100234807 Ga0068865_1002348072 319
842 3300006931 Ga0097620_100148390 Ga0097620_1001483903 319
843 3300007076 Ga0075435_100240108 Ga0075435_1002401082 319
844 3300007076 Ga0075435_100364745 Ga0075435_1003647451 319
845 3300009092 Ga0105250_10019437 Ga0105250_100194373 319
846 3300009094 Ga0111539_10135467 Ga0111539_101354673 319
847 3300009094 Ga0111539_10263619 Ga0111539_102636193 319
848 3300009147 Ga0114129_10013541 Ga0114129_100135416 319
849 3300009147 Ga0114129_10123555 Ga0114129_101235552 319
850 3300009147 Ga0114129_10756344 Ga0114129_107563441 319
851 3300009147 Ga0114129_10843961 Ga0114129_108439611 319
852 3300009177 Ga0105248_10148570 Ga0105248_101485702 319
853 3300009545 Ga0105237_10096445 Ga0105237_100964453 319
854 3300009553 Ga0105249_10061178 Ga0105249_100611781 319
855 3300013102 Ga0157371_10121373 Ga0157371_101213733 319
856 3300013296 Ga0157374_10106058 Ga0157374_101060582 319
857 3300013297 Ga0157378_10126593 Ga0157378_101265931 319
858 3300014325 Ga0163163_10076230 Ga0163163_100762305 319
859 3300014326 Ga0157380_10023243 Ga0157380_100232432 319
860 3300014745 Ga0157377_10003949 Ga0157377_100039491 319
861 3300014968 Ga0157379_10009156 Ga0157379_100091564 319
862 3300017792 Ga0163161_10100381 Ga0163161_101003814 319
863 3300025885 Ga0207653_10007174 Ga0207653_100071741 319
864 3300025893 Ga0207682_10005063 Ga0207682_100050634 319
865 3300025899 Ga0207642_10009702 Ga0207642_100097023 319
866 3300025901 Ga0207688_10003976 Ga0207688_100039767 319
867 3300025904 Ga0207647_10015177 Ga0207647_100151772 319
868 3300025907 Ga0207645_10003639 Ga0207645_100036396 319
869 3300025908 Ga0207643_10003115 Ga0207643_100031158 319
870 3300025914 Ga0207671_10197014 Ga0207671_101970142 319
871 3300025915 Ga0207693_10001559 Ga0207693_100015592 319
872 3300025915 Ga0207693_10114569 Ga0207693_101145692 319
873 3300025916 Ga0207663_10024975 Ga0207663_100249751 319
874 3300025916 Ga0207663_10030171 Ga0207663_100301712 319
875 3300025919 Ga0207657_10012193 Ga0207657_100121936 319
876 3300025920 Ga0207649_10087027 Ga0207649_100870272 319
877 3300025921 Ga0207652_10010934 Ga0207652_100109343 319
878 3300025922 Ga0207646_10057546 Ga0207646_100575465 319
879 3300025922 Ga0207646_10067738 Ga0207646_100677383 319
880 3300025925 Ga0207650_10032327 Ga0207650_100323273 319
881 3300025926 Ga0207659_10132119 Ga0207659_101321191 319
882 3300025928 Ga0207700_10228104 Ga0207700_102281042 319
883 3300025932 Ga0207690_10038360 Ga0207690_100383602 319
884 3300025933 Ga0207706_10001795 Ga0207706_100017956 319
885 3300025935 Ga0207709_10076406 Ga0207709_100764062 319
886 3300025938 Ga0207704_10012217 Ga0207704_100122172 319
887 3300025940 Ga0207691_10000439 Ga0207691_1000043920 319
888 3300025941 Ga0207711_10038507 Ga0207711_100385073 319
889 3300025942 Ga0207689_10015672 Ga0207689_100156726 319
890 3300025944 Ga0207661_10048993 Ga0207661_100489933 319
891 3300025960 Ga0207651_10204425 Ga0207651_102044252 319
892 3300025960 Ga0207651_10299281 Ga0207651_102992812 319
893 3300026023 Ga0207677_10028542 Ga0207677_100285425 319
894 3300026035 Ga0207703_10002169 Ga0207703_100021699 319
895 3300026067 Ga0207678_10005411 Ga0207678_100054119 319
896 3300026075 Ga0207708_10006130 Ga0207708_100061307 319
897 3300026088 Ga0207641_10253446 Ga0207641_102534461 319
898 3300026089 Ga0207648_10001430 Ga0207648_1000143023 319
899 3300026095 Ga0207676_10018517 Ga0207676_100185174 319
900 3300026116 Ga0207674_10026467 Ga0207674_100264672 319
901 3300026118 Ga0207675_100003488 Ga0207675_1000034888 319
902 3300028380 Ga0268265_10014784 Ga0268265_100147841 319
903 3300035117 Ga0373953_0003585 Ga0373953_0003585_748_1734 319
904 3300035119 Ga0373956_0065882 Ga0373956_0065882_40_1026 319
905 3300035120 Ga0373957_0014429 Ga0373957_0014429_1566_2552 319
906 3300035170 Ga0373943_0054726 Ga0373943_0054726_154_1113 319
907 3300035691 Ga0373931_0089492 Ga0373931_0089492_54_1013 319
908 3300035695 Ga0373927_0005292 Ga0373927_0005292_4903_5862 319
909 3300035725 Ga0373947_0011575 Ga0373947_0011575_2480_3439 319
910 3300037068 Ga0373925_0141590 Ga0373925_0141590_410_1372 319
911 3300038443 Ga0395901_0131267 Ga0395901_0131267_1084_2076 319
912 3300039447 Ga0436361_0166397 Ga0436361_0166397_25707_26669 319
913 3300046455 Ga0495603_0033614 Ga0495603_0033614_2036_2995 319
914 3300046459 Ga0495629_0065960 Ga0495629_0065960_25_984 319
915 3300046461 Ga0495641_0015315 Ga0495641_0015315_2101_3060 319
916 3300046462 Ga0495651_0070751 Ga0495651_0070751_651_1637 319
917 3300046472 Ga0495580_0048530 Ga0495580_0048530_171_1130 319
918 3300046473 Ga0495582_0015745 Ga0495582_0015745_2956_3918 319
919 3300046475 Ga0495639_0003876 Ga0495639_0003876_2619_3578 319
920 3300046491 Ga0495584_0022721 Ga0495584_0022721_1410_2369 319
921 3300046492 Ga0495585_0003847 Ga0495585_0003847_3972_4931 319
922 3300046492 Ga0495585_0067832 Ga0495585_0067832_131_1090 319
923 3300046511 Ga0495608_0098663 Ga0495608_0098663_301_1287 319
924 3300046517 Ga0495630_0063975 Ga0495630_0063975_1493_2452 319
925 3300046533 Ga0495640_0100265 Ga0495640_0100265_734_1693 319
926 3300046536 Ga0495587_0010772 Ga0495587_0010772_1555_2541 319
927 3300046537 Ga0495598_0000959 Ga0495598_0000959_4283_5242 319
928 3300046539 Ga0495621_0022218 Ga0495621_0022218_286_1245 319
929 3300046558 Ga0495633_0020617 Ga0495633_0020617_1497_2456 319
930 3300046615 Ga0495656_0026622 Ga0495656_0026622_884_1843 319
931 3300046663 Ga0495635_0078455 Ga0495635_0078455_981_1967 319
932 3300046663 Ga0495635_0269245 Ga0495635_0269245_20_979 319
933 3300046664 Ga0495659_0002398 Ga0495659_0002398_3981_4940 319
934 3300046665 Ga0495661_0063393 Ga0495661_0063393_147_1106 319
935 3300046674 Ga0495588_0014648 Ga0495588_0014648_1308_2270 319
936 3300046679 Ga0495623_0143865 Ga0495623_0143865_371_1357 319
937 3300046681 Ga0495647_0009007 Ga0495647_0009007_1539_2498 319
938 3300046683 Ga0495658_0010116 Ga0495658_0010116_992_1951 319
939 3300046684 Ga0495669_0076514 Ga0495669_0076514_77_1036 319
940 3300046689 Ga0495613_0110861 Ga0495613_0110861_855_1817 319
941 3300046689 Ga0495613_0133310 Ga0495613_0133310_197_1156 319
942 3300046690 Ga0495624_0056823 Ga0495624_0056823_122_1081 319
943 3300046810 Ga0495660_0168427 Ga0495660_0168427_75_1034 319
944 3300047317 Ga0495604_0035557 Ga0495604_0035557_2884_3870 319
945 3300047318 Ga0495636_0130497 Ga0495636_0130497_74_1033 319
946 3300047322 Ga0495680_0044275 Ga0495680_0044275_285_1271 319
947 3300047444 Ga0495675_0106974 Ga0495675_0106974_27_1013 319
948 3300047445 Ga0495677_0081526 Ga0495677_0081526_53_1012 319
949 3300047471 Ga0495684_0171952 Ga0495684_0171952_126_1085 319
950 3300048088 Ga0495602_0057794 Ga0495602_0057794_2233_3219 319
951 3300048904 Ga0496101_0011605 Ga0496101_0011605_3277_4236 319
952 3300048904 Ga0496101_0061483 Ga0496101_0061483_361_1320 319
953 3300048905 Ga0496102_0069972 Ga0496102_0069972_1261_2220 319
954 3300048906 Ga0496103_0004686 Ga0496103_0004686_7242_8201 319
955 3300048906 Ga0496103_0040482 Ga0496103_0040482_124_1083 319
956 3300048907 Ga0496104_0001214 Ga0496104_0001214_13709_14668 319
957 3300048907 Ga0496104_0017246 Ga0496104_0017246_3236_4195 319
958 3300048907 Ga0496104_0302856 Ga0496104_0302856_526_1485 319
959 3300048908 Ga0496105_0009664 Ga0496105_0009664_526_1485 319
960 3300048908 Ga0496105_0037536 Ga0496105_0037536_921_1880 319
961 3300048909 Ga0496106_0003679 Ga0496106_0003679_10397_11356 319
962 3300048910 Ga0496107_0030776 Ga0496107_0030776_1947_2906 319
963 3300048911 Ga0496108_0002287 Ga0496108_0002287_13223_14182 319
964 3300048912 Ga0496109_0000561 Ga0496109_0000561_18199_19158 319
965 3300048912 Ga0496109_0040998 Ga0496109_0040998_27_986 319
966 3300048913 Ga0496110_0007744 Ga0496110_0007744_997_1959 319
967 3300048913 Ga0496110_0014211 Ga0496110_0014211_2618_3577 319
968 3300048913 Ga0496110_0038338 Ga0496110_0038338_1993_2952 319
969 3300048914 Ga0496111_0013509 Ga0496111_0013509_3654_4613 319
970 3300048914 Ga0496111_0024178 Ga0496111_0024178_3303_4265 319
971 3300048914 Ga0496111_0064980 Ga0496111_0064980_171_1130 319
972 3300048915 Ga0496112_0000702 Ga0496112_0000702_10450_11409 319
973 3300048915 Ga0496112_0090573 Ga0496112_0090573_1993_2952 319
974 3300048915 Ga0496112_0280330 Ga0496112_0280330_522_1481 319
975 3300048916 Ga0496113_0001074 Ga0496113_0001074_1190_2149 319
976 3300048916 Ga0496113_0025205 Ga0496113_0025205_69_1028 319
977 3300048918 Ga0496115_0100454 Ga0496115_0100454_966_1925 319
978 3300049580 Ga0501046_0229378 Ga0501046_0229378_272_1231 319
979 3300049588 Ga0501072_0179207 Ga0501072_0179207_278_1237 319
980 3300049591 Ga0501075_0114781 Ga0501075_0114781_443_1402 319
981 3300049743 Ga0501081_0185146 Ga0501081_0185146_52_1011 319
982 3300050492 nmdc:mga0yw44_1031_c1 nmdc:mga0yw44_1031_c1_699_1658 319
983 3300050494 nmdc:mga06z11_125618_c1 nmdc:mga06z11_125618_c1_341_1300 319
984 3300050507 nmdc:mga05p37_119967_c1 nmdc:mga05p37_119967_c1_292_1284 319
985 3300050507 nmdc:mga05p37_158906_c1 nmdc:mga05p37_158906_c1_28_987 319
986 3300050507 nmdc:mga05p37_30503_c1 nmdc:mga05p37_30503_c1_1429_2388 319
987 3300050508 nmdc:mga09592_219639_c1 nmdc:mga09592_219639_c1_565_1524 319
988 3300050509 nmdc:mga0qj67_13134_c1 nmdc:mga0qj67_13134_c1_5125_6084 319
989 3300050509 nmdc:mga0qj67_298910_c1 nmdc:mga0qj67_298910_c1_264_1223 319
990 3300050510 nmdc:mga06r32_188274_c1 nmdc:mga06r32_188274_c1_122_1114 319
991 3300050510 nmdc:mga06r32_58944_c1 nmdc:mga06r32_58944_c1_2193_3152 319
992 3300050511 nmdc:mga08y16_287139_c1 nmdc:mga08y16_287139_c1_252_1211 319
993 3300050512 nmdc:mga0n895_530637_c1 nmdc:mga0n895_530637_c1_19_981 319
994 3300050512 nmdc:mga0n895_80113_c1 nmdc:mga0n895_80113_c1_1939_2898 319
995 3300050515 nmdc:mga0a205_157596_c1 nmdc:mga0a205_157596_c1_39_998 319
996 3300050515 nmdc:mga0a205_80963_c1 nmdc:mga0a205_80963_c1_2064_3026 319
997 3300053077 Ga0495601_0032644 Ga0495601_0032644_2020_3006 319
998 3300053077 Ga0495601_0135011 Ga0495601_0135011_204_1163 319
999 3300053077 Ga0495601_0291067 Ga0495601_0291067_81_1040 319
1000 3300053084 Ga0495595_0007638 Ga0495595_0007638_358_1344 319
1001 3300053084 Ga0495595_0184155 Ga0495595_0184155_45_1004 319
1002 3300053085 Ga0495619_0035724 Ga0495619_0035724_138_1097 319
1003 3300054114 Ga0501084_0201072 Ga0501084_0201072_456_1415 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

73

324

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m0g-assembly1.cif.gz_B crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus 0.972 17 317
3m0g-assembly1.cif.gz_A crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus 0.9708 17 315
4llt-assembly1.cif.gz_B crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with two ipp and calcium bound in active site 0.9702 16 319
2h8o-assembly1.cif.gz_A-2 the 1.6a crystal structure of the geranyltransferase from agrobacterium tumefaciens 0.9674 13 315
3m0g-assembly1.cif.gz_B crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus 0.9649 17 317
ID Description Score Start End Superfamily
2h8oA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9674 13 315 1.10.600.10
3m0gA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9635 17 315 1.10.600.10
4kkmB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9567 15 314 1.10.600.10
2h8oA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.954 13 315 1.10.600.10
3m0gA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9525 17 315 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A4Q7FL91-F1-model_v4 Geranylgeranyl pyrophosphate synthase 0.9957 15 174 GO:0004659
GO:0008299
AF-A0A212QL17-F1-model_v4 deleted 0.9939 17 319
AF-Q93CJ0-F1-model_v4 Farnesyl diphosphate synthase (Polyprenyl synthetase) 0.9908 17 319 GO:0004659
GO:0005737
GO:0008299
AF-A0A1G7Q3W3-F1-model_v4 Farnesyl-diphosphate synthase 0.9896 13 319 GO:0004659
GO:0005737
GO:0008299
AF-A0A0R3MJS7-F1-model_v4 Geranylgeranyl pyrophosphate synthase 0.9885 13 319 GO:0004659
GO:0005737
GO:0008299

Feature Viewer

pLDDT pTM Quality
91.48 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map