F487938
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1003 | 439 | 971 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300035725|Ga0373947_0078149|Ga0373947_0078149_985_2022 |
| Length | 345 |
| Sequence | MAHCADWRFYAQRVHGFIVSDVGVMKELSAGTMLDPASSASFAARLDAIARDVENLLDRLLASGGEDIEITRPRRLLDAMRYGSLGGGKRLRPFLVVESASLFGVPLGNGLMAGAALECIHCYSLIHDDLPAMDNDDLRRGRPTVHRAFDDATAILAGDGLLTFAFDLLSRPETSADPAIRVELVKMLSRAAGIGGMVGGQMLDLAAEGRFAQGASNKLTERDVAVLQAMKTGALLRFACNAGAILGQASDNEAAALDRFGDAIGQAFQIADDLLDVEGDSVVVGKATGKDAAAGKATMVSILGVAGAKARLHELVAGAEDALAPFGTAGTTLVTAARFIADRRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 4 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 5 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 6 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 7 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 8 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 9 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 10 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 11 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 12 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 13 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 14 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 15 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 16 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 17 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 18 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 19 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 20 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 21 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 22 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 23 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 24 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 25 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 26 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 27 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 28 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 29 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 30 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 31 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 32 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 33 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 34 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 36 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 151 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 152 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 227 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 229 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 240 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 247 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 249 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 259 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 265 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 266 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 274 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 276 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 277 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 278 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 279 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 280 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 281 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 282 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 283 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 284 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 285 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 286 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 287 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 288 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 289 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 290 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 291 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 292 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 293 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 294 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 295 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 366 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 367 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 368 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 369 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 370 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 401 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 409 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 410 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 411 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 412 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 413 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 414 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 428 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 429 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 431 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 432 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 434 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 437 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 438 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 439 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.21 |
| Metatranscriptomes | 0.6 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.28 |
| Nodule | 0.6 |
| Rhizoplane | 8.37 |
| Rhizosphere | 81.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1002311 | 3300001977 | Bacteria | 3046 |
| 2 | JGI24742J22300_10001731 | 3300002244 | Bacteria | 3475 |
| 3 | JGI24751J29686_10012415 | 3300002459 | Bacteria | 1757 |
| 4 | JGI25406J46586_10028084 | 3300003203 | Bacteria | 2147 |
| 5 | Ga0006562J51391_1044411 | 3300003578 | Bacteria | 2840 |
| 6 | Ga0006562J51391_1044412 | 3300003578 | Bacteria | 2349 |
| 7 | JGI25404J52841_10006833 | 3300003659 | Bacteria | 2397 |
| 8 | Ga0055526_1000554 | 3300003771 | Bacteria | 29519 |
| 9 | Ga0055526_1004638 | 3300003771 | Bacteria | 8178 |
| 10 | Ga0055526_1007988 | 3300003771 | Bacteria | 5364 |
| 11 | Ga0055524_1000283 | 3300003775 | Bacteria | 49569 |
| 12 | Ga0065165_1000014 | 3300005262 | Bacteria | 292366 |
| 13 | Ga0065707_10187933 | 3300005295 | Bacteria | 1378 |
| 14 | Ga0070676_10059345 | 3300005328 | Bacteria | 2269 |
| 15 | Ga0070676_10079333 | 3300005328 | Bacteria | 1988 |
| 16 | Ga0070690_100229382 | 3300005330 | Bacteria | 1305 |
| 17 | Ga0070670_100015801 | 3300005331 | Bacteria | 6480 |
| 18 | Ga0070670_100152008 | 3300005331 | Bacteria | 2003 |
| 19 | Ga0070677_10067371 | 3300005333 | Bacteria | 1495 |
| 20 | Ga0070666_10017740 | 3300005335 | Bacteria | 4567 |
| 21 | Ga0070680_100038585 | 3300005336 | Bacteria | 3863 |
| 22 | Ga0070680_100087772 | 3300005336 | Bacteria | 2572 |
| 23 | Ga0070682_100016862 | 3300005337 | Bacteria | 4251 |
| 24 | Ga0068868_100054268 | 3300005338 | Bacteria | 3158 |
| 25 | Ga0070660_100062622 | 3300005339 | Bacteria | 2890 |
| 26 | Ga0070660_100269482 | 3300005339 | Bacteria | 1391 |
| 27 | Ga0070689_100019555 | 3300005340 | Bacteria | 5010 |
| 28 | Ga0070689_100072734 | 3300005340 | Bacteria | 2687 |
| 29 | Ga0070661_100206365 | 3300005344 | Bacteria | 1503 |
| 30 | Ga0070669_100066683 | 3300005353 | Bacteria | 2654 |
| 31 | Ga0070675_100040621 | 3300005354 | Bacteria | 3798 |
| 32 | Ga0070675_100053603 | 3300005354 | Bacteria | 3317 |
| 33 | Ga0070675_100089330 | 3300005354 | Bacteria | 2580 |
| 34 | Ga0070671_100000776 | 3300005355 | Bacteria | 22927 |
| 35 | Ga0070671_100149828 | 3300005355 | Bacteria | 1970 |
| 36 | Ga0070674_100084072 | 3300005356 | Bacteria | 2281 |
| 37 | Ga0070673_100005013 | 3300005364 | Bacteria | 8447 |
| 38 | Ga0070673_100010439 | 3300005364 | Bacteria | 6287 |
| 39 | Ga0070688_100009732 | 3300005365 | Bacteria | 5276 |
| 40 | Ga0070688_100036231 | 3300005365 | Bacteria | 2999 |
| 41 | Ga0070688_100064312 | 3300005365 | Bacteria | 2328 |
| 42 | Ga0070659_100020949 | 3300005366 | Bacteria | 4972 |
| 43 | Ga0070659_100032106 | 3300005366 | Bacteria | 4070 |
| 44 | Ga0070667_100111510 | 3300005367 | Bacteria | 2373 |
| 45 | Ga0070667_100154760 | 3300005367 | Bacteria | 2016 |
| 46 | Ga0070709_10235803 | 3300005434 | Bacteria | 1311 |
| 47 | Ga0070714_100017639 | 3300005435 | Bacteria | 5786 |
| 48 | Ga0070714_100029246 | 3300005435 | Bacteria | 4580 |
| 49 | Ga0070714_100033778 | 3300005435 | Bacteria | 4279 |
| 50 | Ga0070714_100229399 | 3300005435 | Bacteria | 1710 |
| 51 | Ga0070714_100272207 | 3300005435 | Bacteria | 1571 |
| 52 | Ga0070714_100309079 | 3300005435 | Bacteria | 1475 |
| 53 | Ga0070713_100061827 | 3300005436 | Bacteria | 3134 |
| 54 | Ga0070713_100178332 | 3300005436 | Bacteria | 1908 |
| 55 | Ga0070713_100307697 | 3300005436 | Bacteria | 1461 |
| 56 | Ga0070713_100342449 | 3300005436 | Bacteria | 1385 |
| 57 | Ga0070710_10007515 | 3300005437 | Bacteria | 5280 |
| 58 | Ga0070710_10136370 | 3300005437 | Bacteria | 1501 |
| 59 | Ga0070710_10149188 | 3300005437 | Bacteria | 1441 |
| 60 | Ga0070711_100026936 | 3300005439 | Bacteria | 3770 |
| 61 | Ga0070711_100035081 | 3300005439 | Bacteria | 3351 |
| 62 | Ga0070711_100067116 | 3300005439 | Bacteria | 2516 |
| 63 | Ga0070708_100015368 | 3300005445 | Bacteria | 6321 |
| 64 | Ga0070663_100009309 | 3300005455 | Bacteria | 6079 |
| 65 | Ga0070681_10018284 | 3300005458 | Bacteria | 7006 |
| 66 | Ga0070681_10110314 | 3300005458 | Bacteria | 2691 |
| 67 | Ga0070681_10342099 | 3300005458 | Bacteria | 1406 |
| 68 | Ga0070681_10374909 | 3300005458 | Bacteria | 1333 |
| 69 | Ga0070681_10458554 | 3300005458 | Bacteria | 1187 |
| 70 | Ga0070685_10142373 | 3300005466 | Bacteria | 1511 |
| 71 | Ga0070707_100080461 | 3300005468 | Bacteria | 3145 |
| 72 | Ga0070707_100246552 | 3300005468 | Bacteria | 1738 |
| 73 | Ga0070698_100068873 | 3300005471 | Bacteria | 3555 |
| 74 | Ga0070698_100370916 | 3300005471 | Bacteria | 1363 |
| 75 | Ga0070699_100001669 | 3300005518 | Bacteria | 20238 |
| 76 | Ga0070699_100231298 | 3300005518 | Bacteria | 1648 |
| 77 | Ga0070679_100019369 | 3300005530 | Bacteria | 6614 |
| 78 | Ga0070679_100053825 | 3300005530 | Bacteria | 4006 |
| 79 | Ga0070679_100082513 | 3300005530 | Bacteria | 3204 |
| 80 | Ga0070679_100151087 | 3300005530 | Bacteria | 2299 |
| 81 | Ga0070697_100374000 | 3300005536 | Bacteria | 1233 |
| 82 | Ga0068853_100028237 | 3300005539 | Bacteria | 4717 |
| 83 | Ga0070672_100002368 | 3300005543 | Bacteria | 11934 |
| 84 | Ga0070672_100018088 | 3300005543 | Bacteria | 5088 |
| 85 | Ga0070672_100160616 | 3300005543 | Bacteria | 1864 |
| 86 | Ga0070695_100051014 | 3300005545 | Bacteria | 2653 |
| 87 | Ga0070693_100138542 | 3300005547 | Bacteria | 1529 |
| 88 | Ga0070665_100018913 | 3300005548 | Bacteria | 6910 |
| 89 | Ga0070665_100236209 | 3300005548 | Bacteria | 1828 |
| 90 | Ga0070665_100305640 | 3300005548 | Bacteria | 1594 |
| 91 | Ga0070665_100314505 | 3300005548 | Bacteria | 1570 |
| 92 | Ga0070665_100350555 | 3300005548 | Bacteria | 1481 |
| 93 | Ga0070704_100046280 | 3300005549 | Bacteria | 3033 |
| 94 | Ga0070704_100174268 | 3300005549 | Bacteria | 1714 |
| 95 | Ga0068855_100542362 | 3300005563 | Bacteria | 1260 |
| 96 | Ga0070664_100032151 | 3300005564 | Bacteria | 4388 |
| 97 | Ga0068854_100035041 | 3300005578 | Bacteria | 3511 |
| 98 | Ga0068856_100017487 | 3300005614 | Bacteria | 6948 |
| 99 | Ga0068856_100500857 | 3300005614 | Bacteria | 1236 |
| 100 | Ga0070702_100082157 | 3300005615 | Bacteria | 1933 |
| 101 | Ga0068852_100019264 | 3300005616 | Bacteria | 5396 |
| 102 | Ga0068852_100194141 | 3300005616 | Bacteria | 1918 |
| 103 | Ga0068859_100132355 | 3300005617 | Bacteria | 2566 |
| 104 | Ga0068859_100148383 | 3300005617 | Bacteria | 2420 |
| 105 | Ga0068859_100186879 | 3300005617 | Bacteria | 2156 |
| 106 | Ga0068859_100357955 | 3300005617 | Bacteria | 1554 |
| 107 | Ga0068864_100028321 | 3300005618 | Bacteria | 4733 |
| 108 | Ga0068864_100037787 | 3300005618 | Bacteria | 4122 |
| 109 | Ga0068864_100065734 | 3300005618 | Bacteria | 3146 |
| 110 | Ga0068864_100207110 | 3300005618 | Unclassified | 1804 |
| 111 | Ga0068864_100265780 | 3300005618 | Bacteria | 1597 |
| 112 | Ga0068864_100511957 | 3300005618 | Bacteria | 1156 |
| 113 | Ga0068861_100252540 | 3300005719 | Bacteria | 1505 |
| 114 | Ga0068870_10000511 | 3300005840 | Bacteria | 14716 |
| 115 | Ga0068863_100424690 | 3300005841 | Bacteria | 1302 |
| 116 | Ga0068858_100092912 | 3300005842 | Bacteria | 2808 |
| 117 | Ga0068860_100005647 | 3300005843 | Bacteria | 12635 |
| 118 | Ga0068860_100123800 | 3300005843 | Bacteria | 2478 |
| 119 | Ga0068862_100023093 | 3300005844 | Bacteria | 5209 |
| 120 | Ga0081455_10000393 | 3300005937 | Bacteria | 57689 |
| 121 | Ga0081455_10009260 | 3300005937 | Bacteria | 10142 |
| 122 | Ga0081455_10009827 | 3300005937 | Bacteria | 9798 |
| 123 | Ga0081538_10006793 | 3300005981 | Bacteria | 9990 |
| 124 | Ga0081538_10031584 | 3300005981 | Bacteria | 3567 |
| 125 | Ga0081538_10053170 | 3300005981 | Bacteria | 2410 |
| 126 | Ga0081540_1000108 | 3300005983 | Bacteria | 88825 |
| 127 | Ga0081540_1007873 | 3300005983 | Bacteria | 7532 |
| 128 | Ga0081539_10002916 | 3300005985 | Bacteria | 22576 |
| 129 | Ga0070717_10016595 | 3300006028 | Bacteria | 5713 |
| 130 | Ga0070717_10023990 | 3300006028 | Bacteria | 4840 |
| 131 | Ga0070717_10344410 | 3300006028 | Bacteria | 1331 |
| 132 | Ga0075365_10050728 | 3300006038 | Bacteria | 2738 |
| 133 | Ga0075368_10008782 | 3300006042 | Bacteria | 3616 |
| 134 | Ga0075363_100014937 | 3300006048 | Bacteria | 3807 |
| 135 | Ga0075363_100131748 | 3300006048 | Bacteria | 1402 |
| 136 | Ga0075364_10006943 | 3300006051 | Bacteria | 6687 |
| 137 | Ga0070715_10005745 | 3300006163 | Bacteria | 4166 |
| 138 | Ga0070715_10011779 | 3300006163 | Bacteria | 3159 |
| 139 | Ga0070716_100004357 | 3300006173 | Bacteria | 6756 |
| 140 | Ga0070712_100000770 | 3300006175 | Bacteria | 18909 |
| 141 | Ga0070712_100000882 | 3300006175 | Bacteria | 17917 |
| 142 | Ga0070712_100015635 | 3300006175 | Bacteria | 4892 |
| 143 | Ga0070712_100067116 | 3300006175 | Bacteria | 2552 |
| 144 | Ga0070712_100082986 | 3300006175 | Bacteria | 2326 |
| 145 | Ga0070712_100230069 | 3300006175 | Bacteria | 1472 |
| 146 | Ga0075362_10000531 | 3300006177 | Bacteria | 11088 |
| 147 | Ga0075362_10053515 | 3300006177 | Bacteria | 1812 |
| 148 | Ga0075367_10051569 | 3300006178 | Bacteria | 2432 |
| 149 | Ga0075367_10120882 | 3300006178 | Bacteria | 1614 |
| 150 | Ga0075369_10021372 | 3300006186 | Bacteria | 2659 |
| 151 | Ga0075366_10005359 | 3300006195 | Bacteria | 6951 |
| 152 | Ga0075366_10022896 | 3300006195 | Bacteria | 3637 |
| 153 | Ga0075366_10032009 | 3300006195 | Bacteria | 3096 |
| 154 | Ga0097621_100324730 | 3300006237 | Bacteria | 1364 |
| 155 | Ga0068871_100052246 | 3300006358 | Bacteria | 3309 |
| 156 | Ga0075428_100002387 | 3300006844 | Bacteria | 20393 |
| 157 | Ga0075428_100018721 | 3300006844 | Bacteria | 7655 |
| 158 | Ga0075428_100260860 | 3300006844 | Bacteria | 1866 |
| 159 | Ga0075430_100002327 | 3300006846 | Bacteria | 15784 |
| 160 | Ga0075430_100002427 | 3300006846 | Bacteria | 15518 |
| 161 | Ga0075430_100004956 | 3300006846 | Bacteria | 11205 |
| 162 | Ga0075430_100062646 | 3300006846 | Bacteria | 3124 |
| 163 | Ga0075431_100000881 | 3300006847 | Bacteria | 26399 |
| 164 | Ga0075431_100016707 | 3300006847 | Bacteria | 7452 |
| 165 | Ga0075431_100137754 | 3300006847 | Bacteria | 2517 |
| 166 | Ga0075433_10070886 | 3300006852 | Bacteria | 3064 |
| 167 | Ga0075433_10138908 | 3300006852 | Bacteria | 2160 |
| 168 | Ga0075434_100019972 | 3300006871 | Bacteria | 6489 |
| 169 | Ga0075434_100071051 | 3300006871 | Bacteria | 3472 |
| 170 | Ga0075429_100002150 | 3300006880 | Bacteria | 16449 |
| 171 | Ga0068865_100234807 | 3300006881 | Bacteria | 1440 |
| 172 | Ga0068865_100327642 | 3300006881 | Bacteria | 1234 |
| 173 | Ga0075436_100069432 | 3300006914 | Bacteria | 2434 |
| 174 | Ga0097620_100132350 | 3300006931 | Bacteria | 2566 |
| 175 | Ga0097620_100148390 | 3300006931 | Bacteria | 2420 |
| 176 | Ga0097620_100186881 | 3300006931 | Bacteria | 2156 |
| 177 | Ga0097620_100357939 | 3300006931 | Bacteria | 1554 |
| 178 | Ga0075435_100005906 | 3300007076 | Bacteria | 8616 |
| 179 | Ga0075435_100044761 | 3300007076 | Bacteria | 3546 |
| 180 | Ga0075435_100237431 | 3300007076 | Bacteria | 1549 |
| 181 | Ga0075435_100240108 | 3300007076 | Bacteria | 1541 |
| 182 | Ga0075435_100364745 | 3300007076 | Bacteria | 1239 |
| 183 | Ga0099795_10034848 | 3300007788 | Bacteria | 1756 |
| 184 | Ga0105250_10019437 | 3300009092 | Bacteria | 2746 |
| 185 | Ga0111539_10000144 | 3300009094 | Bacteria | 81842 |
| 186 | Ga0111539_10022547 | 3300009094 | Bacteria | 7735 |
| 187 | Ga0111539_10135467 | 3300009094 | Bacteria | 2884 |
| 188 | Ga0111539_10234105 | 3300009094 | Bacteria | 2138 |
| 189 | Ga0111539_10263619 | 3300009094 | Bacteria | 2006 |
| 190 | Ga0105245_10245169 | 3300009098 | Bacteria | 1739 |
| 191 | Ga0105245_10579770 | 3300009098 | Bacteria | 1146 |
| 192 | Ga0114129_10000542 | 3300009147 | Bacteria | 46285 |
| 193 | Ga0114129_10013541 | 3300009147 | Bacteria | 11623 |
| 194 | Ga0114129_10065348 | 3300009147 | Bacteria | 5077 |
| 195 | Ga0114129_10093762 | 3300009147 | Bacteria | 4158 |
| 196 | Ga0114129_10123555 | 3300009147 | Bacteria | 3560 |
| 197 | Ga0114129_10544150 | 3300009147 | Bacteria | 1511 |
| 198 | Ga0114129_10668071 | 3300009147 | Bacteria | 1339 |
| 199 | Ga0114129_10756344 | 3300009147 | Bacteria | 1243 |
| 200 | Ga0114129_10843961 | 3300009147 | Bacteria | 1165 |
| 201 | Ga0105243_10055697 | 3300009148 | Bacteria | 3142 |
| 202 | Ga0105241_10078172 | 3300009174 | Bacteria | 2585 |
| 203 | Ga0105248_10002898 | 3300009177 | Bacteria | 19034 |
| 204 | Ga0105248_10148570 | 3300009177 | Bacteria | 2644 |
| 205 | Ga0105237_10096445 | 3300009545 | Bacteria | 2947 |
| 206 | Ga0105238_10026734 | 3300009551 | Bacteria | 5882 |
| 207 | Ga0105249_10061178 | 3300009553 | Bacteria | 3455 |
| 208 | Ga0099796_10002797 | 3300010159 | Bacteria | 3923 |
| 209 | Ga0105239_10079246 | 3300010375 | Bacteria | 3615 |
| 210 | Ga0105239_10106351 | 3300010375 | Bacteria | 3108 |
| 211 | Ga0157373_10078078 | 3300013100 | Bacteria | 2335 |
| 212 | Ga0157371_10055625 | 3300013102 | Bacteria | 2808 |
| 213 | Ga0157371_10121373 | 3300013102 | Bacteria | 1858 |
| 214 | Ga0157370_10114947 | 3300013104 | Bacteria | 2514 |
| 215 | Ga0157370_10218409 | 3300013104 | Bacteria | 1766 |
| 216 | Ga0157374_10106058 | 3300013296 | Bacteria | 2699 |
| 217 | Ga0157378_10126593 | 3300013297 | Bacteria | 2360 |
| 218 | Ga0157372_10056762 | 3300013307 | Bacteria | 4375 |
| 219 | Ga0157372_10616725 | 3300013307 | Bacteria | 1264 |
| 220 | Ga0157375_10144334 | 3300013308 | Bacteria | 2510 |
| 221 | Ga0157375_10524331 | 3300013308 | Bacteria | 1348 |
| 222 | Ga0163163_10010340 | 3300014325 | Bacteria | 8384 |
| 223 | Ga0163163_10076230 | 3300014325 | Bacteria | 3348 |
| 224 | Ga0163163_10124862 | 3300014325 | Bacteria | 2611 |
| 225 | Ga0157380_10023243 | 3300014326 | Bacteria | 4674 |
| 226 | Ga0157380_10135776 | 3300014326 | Bacteria | 2105 |
| 227 | Ga0157380_10313027 | 3300014326 | Bacteria | 1452 |
| 228 | Ga0182008_10025417 | 3300014497 | Bacteria | 3007 |
| 229 | Ga0157377_10003949 | 3300014745 | Bacteria | 6758 |
| 230 | Ga0157379_10009156 | 3300014968 | Bacteria | 8624 |
| 231 | Ga0157376_10725703 | 3300014969 | Bacteria | 1001 |
| 232 | Ga0163161_10100381 | 3300017792 | Bacteria | 2153 |
| 233 | Ga0206356_10344220 | 3300020070 | Bacteria | 1797 |
| 234 | Ga0213873_10021273 | 3300021358 | Bacteria | 1524 |
| 235 | Ga0213872_10102814 | 3300021361 | Bacteria | 1273 |
| 236 | Ga0213874_10006568 | 3300021377 | Bacteria | 2757 |
| 237 | Ga0213876_10124907 | 3300021384 | Bacteria | 1366 |
| 238 | Ga0209673_1024651 | 3300025273 | Bacteria | 2016 |
| 239 | Ga0209130_1000024 | 3300025284 | Bacteria | 354212 |
| 240 | Ga0209675_1001001 | 3300025291 | Bacteria | 17786 |
| 241 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 242 | Ga0209025_1001580 | 3300025294 | Bacteria | 28793 |
| 243 | Ga0209564_1000015 | 3300025295 | Bacteria | 615324 |
| 244 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 245 | Ga0209256_1000294 | 3300025299 | Bacteria | 87769 |
| 246 | Ga0207426_1009016 | 3300025302 | Bacteria | 3972 |
| 247 | Ga0207697_10138190 | 3300025315 | Bacteria | 1056 |
| 248 | Ga0207656_10067678 | 3300025321 | Bacteria | 1581 |
| 249 | Ga0207653_10007174 | 3300025885 | Bacteria | 3478 |
| 250 | Ga0207682_10000236 | 3300025893 | Bacteria | 24920 |
| 251 | Ga0207682_10005063 | 3300025893 | Bacteria | 5401 |
| 252 | Ga0207642_10009702 | 3300025899 | Bacteria | 3359 |
| 253 | Ga0207688_10003976 | 3300025901 | Bacteria | 8059 |
| 254 | Ga0207688_10024290 | 3300025901 | Bacteria | 3323 |
| 255 | Ga0207647_10015177 | 3300025904 | Bacteria | 5290 |
| 256 | Ga0207647_10085701 | 3300025904 | Bacteria | 1884 |
| 257 | Ga0207685_10017806 | 3300025905 | Bacteria | 2307 |
| 258 | Ga0207699_10036471 | 3300025906 | Bacteria | 2803 |
| 259 | Ga0207699_10128544 | 3300025906 | Bacteria | 1649 |
| 260 | Ga0207645_10003639 | 3300025907 | Bacteria | 11646 |
| 261 | Ga0207643_10003115 | 3300025908 | Bacteria | 8917 |
| 262 | Ga0207705_10089421 | 3300025909 | Bacteria | 2254 |
| 263 | Ga0207705_10234333 | 3300025909 | Bacteria | 1397 |
| 264 | Ga0207707_10075933 | 3300025912 | Bacteria | 2932 |
| 265 | Ga0207707_10249614 | 3300025912 | Bacteria | 1542 |
| 266 | Ga0207695_10004482 | 3300025913 | Bacteria | 19022 |
| 267 | Ga0207671_10197014 | 3300025914 | Bacteria | 1572 |
| 268 | Ga0207693_10001021 | 3300025915 | Bacteria | 25052 |
| 269 | Ga0207693_10001559 | 3300025915 | Bacteria | 20236 |
| 270 | Ga0207693_10005351 | 3300025915 | Bacteria | 10726 |
| 271 | Ga0207693_10010389 | 3300025915 | Bacteria | 7558 |
| 272 | Ga0207693_10063266 | 3300025915 | Bacteria | 2898 |
| 273 | Ga0207693_10114569 | 3300025915 | Bacteria | 2116 |
| 274 | Ga0207693_10121812 | 3300025915 | Bacteria | 2048 |
| 275 | Ga0207663_10024975 | 3300025916 | Bacteria | 3448 |
| 276 | Ga0207663_10030171 | 3300025916 | Bacteria | 3195 |
| 277 | Ga0207663_10036958 | 3300025916 | Bacteria | 2941 |
| 278 | Ga0207663_10108500 | 3300025916 | Bacteria | 1879 |
| 279 | Ga0207660_10003986 | 3300025917 | Bacteria | 9626 |
| 280 | Ga0207660_10329556 | 3300025917 | Bacteria | 1220 |
| 281 | Ga0207662_10029165 | 3300025918 | Bacteria | 3195 |
| 282 | Ga0207657_10012193 | 3300025919 | Bacteria | 8493 |
| 283 | Ga0207657_10023890 | 3300025919 | Bacteria | 5677 |
| 284 | Ga0207657_10183571 | 3300025919 | Bacteria | 1690 |
| 285 | Ga0207649_10087027 | 3300025920 | Bacteria | 2037 |
| 286 | Ga0207652_10010934 | 3300025921 | Bacteria | 7316 |
| 287 | Ga0207652_10039220 | 3300025921 | Bacteria | 4019 |
| 288 | Ga0207652_10382817 | 3300025921 | Bacteria | 1270 |
| 289 | Ga0207646_10057546 | 3300025922 | Bacteria | 3473 |
| 290 | Ga0207646_10067738 | 3300025922 | Bacteria | 3187 |
| 291 | Ga0207650_10032327 | 3300025925 | Bacteria | 3784 |
| 292 | Ga0207650_10041512 | 3300025925 | Bacteria | 3372 |
| 293 | Ga0207659_10024779 | 3300025926 | Bacteria | 4025 |
| 294 | Ga0207659_10044866 | 3300025926 | Bacteria | 3113 |
| 295 | Ga0207659_10132119 | 3300025926 | Bacteria | 1928 |
| 296 | Ga0207700_10043684 | 3300025928 | Bacteria | 3293 |
| 297 | Ga0207700_10194075 | 3300025928 | Bacteria | 1708 |
| 298 | Ga0207700_10228104 | 3300025928 | Bacteria | 1582 |
| 299 | Ga0207700_10384309 | 3300025928 | Bacteria | 1228 |
| 300 | Ga0207664_10041788 | 3300025929 | Bacteria | 3574 |
| 301 | Ga0207664_10131445 | 3300025929 | Bacteria | 2107 |
| 302 | Ga0207664_10164519 | 3300025929 | Bacteria | 1894 |
| 303 | Ga0207644_10072623 | 3300025931 | Bacteria | 2520 |
| 304 | Ga0207690_10038360 | 3300025932 | Bacteria | 3117 |
| 305 | Ga0207690_10195149 | 3300025932 | Bacteria | 1534 |
| 306 | Ga0207690_10354798 | 3300025932 | Bacteria | 1160 |
| 307 | Ga0207706_10001795 | 3300025933 | Bacteria | 21102 |
| 308 | Ga0207709_10076406 | 3300025935 | Bacteria | 2144 |
| 309 | Ga0207709_10316393 | 3300025935 | Bacteria | 1166 |
| 310 | Ga0207670_10001838 | 3300025936 | Bacteria | 11075 |
| 311 | Ga0207704_10012217 | 3300025938 | Bacteria | 4256 |
| 312 | Ga0207704_10292830 | 3300025938 | Bacteria | 1243 |
| 313 | Ga0207665_10002162 | 3300025939 | Bacteria | 13290 |
| 314 | Ga0207665_10022474 | 3300025939 | Bacteria | 4149 |
| 315 | Ga0207665_10064667 | 3300025939 | Bacteria | 2486 |
| 316 | Ga0207665_10070566 | 3300025939 | Bacteria | 2384 |
| 317 | Ga0207691_10000439 | 3300025940 | Bacteria | 41424 |
| 318 | Ga0207691_10014531 | 3300025940 | Bacteria | 7509 |
| 319 | Ga0207691_10060991 | 3300025940 | Bacteria | 3426 |
| 320 | Ga0207691_10073771 | 3300025940 | Bacteria | 3078 |
| 321 | Ga0207691_10196142 | 3300025940 | Bacteria | 1759 |
| 322 | Ga0207711_10038507 | 3300025941 | Bacteria | 4066 |
| 323 | Ga0207711_10064116 | 3300025941 | Bacteria | 3172 |
| 324 | Ga0207689_10015672 | 3300025942 | Bacteria | 6418 |
| 325 | Ga0207689_10032070 | 3300025942 | Bacteria | 4371 |
| 326 | Ga0207661_10048993 | 3300025944 | Bacteria | 3361 |
| 327 | Ga0207679_10107222 | 3300025945 | Bacteria | 2198 |
| 328 | Ga0207667_10277171 | 3300025949 | Bacteria | 1714 |
| 329 | Ga0207651_10005773 | 3300025960 | Bacteria | 6392 |
| 330 | Ga0207651_10187064 | 3300025960 | Bacteria | 1648 |
| 331 | Ga0207651_10204425 | 3300025960 | Bacteria | 1585 |
| 332 | Ga0207651_10299281 | 3300025960 | Bacteria | 1337 |
| 333 | Ga0207668_10289548 | 3300025972 | Bacteria | 1347 |
| 334 | Ga0207640_10120452 | 3300025981 | Bacteria | 1879 |
| 335 | Ga0207677_10028542 | 3300026023 | Bacteria | 3531 |
| 336 | Ga0207677_10061026 | 3300026023 | Bacteria | 2609 |
| 337 | Ga0207677_10083680 | 3300026023 | Bacteria | 2297 |
| 338 | Ga0207703_10002169 | 3300026035 | Bacteria | 17240 |
| 339 | Ga0207639_10101941 | 3300026041 | Bacteria | 2322 |
| 340 | Ga0207639_10109120 | 3300026041 | Bacteria | 2251 |
| 341 | Ga0207639_10344912 | 3300026041 | Bacteria | 1328 |
| 342 | Ga0207678_10005411 | 3300026067 | Bacteria | 11434 |
| 343 | Ga0207708_10006130 | 3300026075 | Bacteria | 8914 |
| 344 | Ga0207702_10160682 | 3300026078 | Bacteria | 2051 |
| 345 | Ga0207641_10253446 | 3300026088 | Bacteria | 1644 |
| 346 | Ga0207648_10001430 | 3300026089 | Bacteria | 26279 |
| 347 | Ga0207648_10014268 | 3300026089 | Bacteria | 7345 |
| 348 | Ga0207648_10017205 | 3300026089 | Bacteria | 6588 |
| 349 | Ga0207648_10324214 | 3300026089 | Bacteria | 1385 |
| 350 | Ga0207676_10014792 | 3300026095 | Bacteria | 5620 |
| 351 | Ga0207676_10018517 | 3300026095 | Bacteria | 5063 |
| 352 | Ga0207676_10113020 | 3300026095 | Bacteria | 2276 |
| 353 | Ga0207676_10216632 | 3300026095 | Unclassified | 1702 |
| 354 | Ga0207674_10026467 | 3300026116 | Bacteria | 6158 |
| 355 | Ga0207674_10216695 | 3300026116 | Bacteria | 1863 |
| 356 | Ga0207675_100003488 | 3300026118 | Bacteria | 15370 |
| 357 | Ga0207675_100066985 | 3300026118 | Bacteria | 3356 |
| 358 | Ga0207675_100463081 | 3300026118 | Bacteria | 1258 |
| 359 | Ga0207683_10007521 | 3300026121 | Bacteria | 9338 |
| 360 | Ga0207683_10174021 | 3300026121 | Bacteria | 1950 |
| 361 | Ga0207428_10036366 | 3300027907 | Bacteria | 4016 |
| 362 | Ga0207428_10146992 | 3300027907 | Bacteria | 1796 |
| 363 | Ga0265357_1002069 | 3300028023 | Bacteria | 1588 |
| 364 | Ga0268266_10259631 | 3300028379 | Bacteria | 1610 |
| 365 | Ga0268265_10014784 | 3300028380 | Bacteria | 5326 |
| 366 | Ga0265337_1001450 | 3300028556 | Bacteria | 11646 |
| 367 | Ga0265338_10015220 | 3300028800 | Bacteria | 8475 |
| 368 | Ga0265324_10080010 | 3300029957 | Bacteria | 1112 |
| 369 | Ga0265763_1000930 | 3300030763 | Bacteria | 1960 |
| 370 | Ga0265760_10020197 | 3300031090 | Bacteria | 1922 |
| 371 | Ga0265760_10020706 | 3300031090 | Bacteria | 1899 |
| 372 | Ga0265330_10011418 | 3300031235 | Bacteria | 4167 |
| 373 | Ga0265330_10071453 | 3300031235 | Bacteria | 1501 |
| 374 | Ga0265328_10000082 | 3300031239 | Bacteria | 48539 |
| 375 | Ga0265328_10002876 | 3300031239 | Bacteria | 7680 |
| 376 | Ga0265328_10009220 | 3300031239 | Bacteria | 4026 |
| 377 | Ga0265328_10009278 | 3300031239 | Bacteria | 4011 |
| 378 | Ga0265320_10033635 | 3300031240 | Bacteria | 2614 |
| 379 | Ga0265325_10000162 | 3300031241 | Bacteria | 47234 |
| 380 | Ga0265325_10001726 | 3300031241 | Bacteria | 15173 |
| 381 | Ga0265325_10005177 | 3300031241 | Bacteria | 8102 |
| 382 | Ga0265325_10023551 | 3300031241 | Bacteria | 3359 |
| 383 | Ga0265325_10064001 | 3300031241 | Bacteria | 1860 |
| 384 | Ga0265329_10017381 | 3300031242 | Bacteria | 2476 |
| 385 | Ga0265339_10000060 | 3300031249 | Bacteria | 97276 |
| 386 | Ga0265339_10073404 | 3300031249 | Bacteria | 1819 |
| 387 | Ga0265331_10000005 | 3300031250 | Bacteria | 465192 |
| 388 | Ga0265331_10000806 | 3300031250 | Bacteria | 25926 |
| 389 | Ga0265331_10010424 | 3300031250 | Bacteria | 5145 |
| 390 | Ga0265327_10016866 | 3300031251 | Bacteria | 4613 |
| 391 | Ga0265316_10018085 | 3300031344 | Bacteria | 6069 |
| 392 | Ga0265316_10069276 | 3300031344 | Bacteria | 2722 |
| 393 | Ga0265316_10077563 | 3300031344 | Bacteria | 2551 |
| 394 | Ga0265316_10094735 | 3300031344 | Bacteria | 2275 |
| 395 | Ga0265316_10195089 | 3300031344 | Bacteria | 1503 |
| 396 | Ga0265316_10307722 | 3300031344 | Bacteria | 1153 |
| 397 | Ga0265313_10000062 | 3300031595 | Bacteria | 106169 |
| 398 | Ga0265313_10000094 | 3300031595 | Bacteria | 89774 |
| 399 | Ga0265313_10007672 | 3300031595 | Bacteria | 7311 |
| 400 | Ga0316575_10047580 | 3300031665 | Bacteria | 1705 |
| 401 | Ga0265314_10008333 | 3300031711 | Bacteria | 8888 |
| 402 | Ga0316576_10014553 | 3300031727 | Bacteria | 5257 |
| 403 | Ga0307405_10038411 | 3300031731 | Bacteria | 2886 |
| 404 | Ga0307413_10056746 | 3300031824 | Bacteria | 2390 |
| 405 | Ga0307407_10099690 | 3300031903 | Bacteria | 1800 |
| 406 | Ga0307412_10217005 | 3300031911 | Bacteria | 1464 |
| 407 | Ga0307409_100058049 | 3300031995 | Bacteria | 3003 |
| 408 | Ga0307416_100519326 | 3300032002 | Bacteria | 1259 |
| 409 | Ga0307414_10005179 | 3300032004 | Bacteria | 7156 |
| 410 | Ga0307415_100317307 | 3300032126 | Bacteria | 1298 |
| 411 | Ga0316583_10001130 | 3300032133 | Bacteria | 8717 |
| 412 | Ga0373959_0008928 | 3300034820 | Bacteria | 1718 |
| 413 | Ga0373926_0045813 | 3300035083 | Bacteria | 1568 |
| 414 | Ga0373934_0099054 | 3300035086 | Bacteria | 1178 |
| 415 | Ga0373944_0000944 | 3300035089 | Bacteria | 7200 |
| 416 | Ga0373944_0014925 | 3300035089 | Bacteria | 2174 |
| 417 | Ga0373923_0079010 | 3300035111 | Bacteria | 1425 |
| 418 | Ga0373932_0047861 | 3300035112 | Bacteria | 1258 |
| 419 | Ga0373936_0005000 | 3300035113 | Bacteria | 4995 |
| 420 | Ga0373936_0058991 | 3300035113 | Bacteria | 1563 |
| 421 | Ga0373945_0041141 | 3300035116 | Bacteria | 1670 |
| 422 | Ga0373945_0119307 | 3300035116 | Bacteria | 1047 |
| 423 | Ga0373953_0003585 | 3300035117 | Bacteria | 4857 |
| 424 | Ga0373953_0044878 | 3300035117 | Bacteria | 1769 |
| 425 | Ga0373954_0024856 | 3300035118 | Bacteria | 2733 |
| 426 | Ga0373954_0044090 | 3300035118 | Bacteria | 2081 |
| 427 | Ga0373954_0073733 | 3300035118 | Bacteria | 1624 |
| 428 | Ga0373956_0014953 | 3300035119 | Bacteria | 3246 |
| 429 | Ga0373956_0049755 | 3300035119 | Bacteria | 1880 |
| 430 | Ga0373956_0065882 | 3300035119 | Bacteria | 1646 |
| 431 | Ga0373956_0066003 | 3300035119 | Bacteria | 1645 |
| 432 | Ga0373957_0014429 | 3300035120 | Bacteria | 2702 |
| 433 | Ga0373957_0125471 | 3300035120 | Bacteria | 1042 |
| 434 | Ga0373960_0025163 | 3300035121 | Bacteria | 1616 |
| 435 | Ga0373960_0047402 | 3300035121 | Bacteria | 1264 |
| 436 | Ga0373960_0063683 | 3300035121 | Bacteria | 1124 |
| 437 | Ga0373960_0089236 | 3300035121 | Bacteria | 983 |
| 438 | Ga0373943_0000444 | 3300035170 | Bacteria | 17541 |
| 439 | Ga0373943_0038446 | 3300035170 | Bacteria | 2301 |
| 440 | Ga0373943_0054726 | 3300035170 | Bacteria | 1974 |
| 441 | Ga0373943_0088206 | 3300035170 | Bacteria | 1602 |
| 442 | Ga0373946_0000365 | 3300035171 | Bacteria | 14672 |
| 443 | Ga0373946_0223251 | 3300035171 | Bacteria | 910 |
| 444 | Ga0373955_0018513 | 3300035172 | Bacteria | 3465 |
| 445 | Ga0373955_0075141 | 3300035172 | Bacteria | 1898 |
| 446 | Ga0373955_0112793 | 3300035172 | Bacteria | 1573 |
| 447 | Ga0373961_0006333 | 3300035241 | Bacteria | 2846 |
| 448 | Ga0373961_0050987 | 3300035241 | Bacteria | 1227 |
| 449 | Ga0373962_0002857 | 3300035242 | Bacteria | 4134 |
| 450 | Ga0316574_0000639 | 3300035398 | Bacteria | 14688 |
| 451 | Ga0373924_0155512 | 3300035410 | Bacteria | 1001 |
| 452 | Ga0373931_0002195 | 3300035691 | Bacteria | 8620 |
| 453 | Ga0373931_0002855 | 3300035691 | Bacteria | 7702 |
| 454 | Ga0373931_0013544 | 3300035691 | Bacteria | 3973 |
| 455 | Ga0373931_0071494 | 3300035691 | Bacteria | 1895 |
| 456 | Ga0373931_0080160 | 3300035691 | Bacteria | 1800 |
| 457 | Ga0373931_0089492 | 3300035691 | Bacteria | 1713 |
| 458 | Ga0373935_0013611 | 3300035692 | Bacteria | 4911 |
| 459 | Ga0373935_0033031 | 3300035692 | Bacteria | 3219 |
| 460 | Ga0373935_0121150 | 3300035692 | Bacteria | 1748 |
| 461 | Ga0373935_0349185 | 3300035692 | Bacteria | 1054 |
| 462 | Ga0373927_0005292 | 3300035695 | Bacteria | 8912 |
| 463 | Ga0373927_0024839 | 3300035695 | Bacteria | 3916 |
| 464 | Ga0373927_0029481 | 3300035695 | Bacteria | 3577 |
| 465 | Ga0373927_0063590 | 3300035695 | Bacteria | 2387 |
| 466 | Ga0373927_0083964 | 3300035695 | Bacteria | 2065 |
| 467 | Ga0373933_0007659 | 3300035724 | Bacteria | 5896 |
| 468 | Ga0373933_0269259 | 3300035724 | Bacteria | 1099 |
| 469 | Ga0373933_0328351 | 3300035724 | Bacteria | 992 |
| 470 | Ga0373947_0001394 | 3300035725 | Bacteria | 14895 |
| 471 | Ga0373947_0011575 | 3300035725 | Bacteria | 5060 |
| 472 | Ga0373947_0076635 | 3300035725 | Bacteria | 2061 |
| 473 | Ga0373947_0078149 | 3300035725 | Bacteria | 2042 |
| 474 | Ga0373947_0211134 | 3300035725 | Bacteria | 1273 |
| 475 | Ga0373937_0007150 | 3300036401 | Bacteria | 9649 |
| 476 | Ga0373937_0007474 | 3300036401 | Bacteria | 9455 |
| 477 | Ga0373937_0031420 | 3300036401 | Bacteria | 4812 |
| 478 | Ga0373937_0125580 | 3300036401 | Bacteria | 2393 |
| 479 | Ga0316584_0020630 | 3300036712 | Bacteria | 4781 |
| 480 | Ga0373925_0004315 | 3300037068 | Bacteria | 10767 |
| 481 | Ga0373925_0042730 | 3300037068 | Bacteria | 3363 |
| 482 | Ga0373925_0091344 | 3300037068 | Bacteria | 2328 |
| 483 | Ga0373925_0141590 | 3300037068 | Bacteria | 1882 |
| 484 | Ga0373925_0250100 | 3300037068 | Bacteria | 1421 |
| 485 | Ga0373925_0295252 | 3300037068 | Bacteria | 1307 |
| 486 | Ga0395899_0007468 | 3300037312 | Bacteria | 8444 |
| 487 | Ga0395900_0005900 | 3300037418 | Bacteria | 12790 |
| 488 | Ga0395900_0087539 | 3300037418 | Bacteria | 3201 |
| 489 | Ga0395900_0110828 | 3300037418 | Bacteria | 2819 |
| 490 | Ga0395900_0329863 | 3300037418 | Bacteria | 1504 |
| 491 | Ga0395898_0002812 | 3300037466 | Bacteria | 19956 |
| 492 | Ga0395898_0009212 | 3300037466 | Bacteria | 10386 |
| 493 | Ga0395905_0308872 | 3300037471 | Bacteria | 1470 |
| 494 | Ga0436364_0503784 | 3300037853 | Bacteria | 2371 |
| 495 | Ga0395901_0013723 | 3300038443 | Bacteria | 8233 |
| 496 | Ga0395901_0080302 | 3300038443 | Bacteria | 3405 |
| 497 | Ga0395901_0131267 | 3300038443 | Bacteria | 2632 |
| 498 | Ga0395901_0355573 | 3300038443 | Bacteria | 1511 |
| 499 | Ga0237819_05426 | 3300038705 | Bacteria | 2003 |
| 500 | Ga0436365_0344984 | 3300039437 | Bacteria | 19388 |
| 501 | Ga0436365_0635250 | 3300039437 | Bacteria | 10464 |
| 502 | Ga0436365_1514696 | 3300039437 | Bacteria | 2553 |
| 503 | Ga0436365_1568947 | 3300039437 | Bacteria | 2308 |
| 504 | Ga0436361_0166397 | 3300039447 | Bacteria | 45243 |
| 505 | Ga0436363_0335613 | 3300039450 | Bacteria | 1867 |
| 506 | Ga0436363_0461760 | 3300039450 | Bacteria | 3201 |
| 507 | Ga0436363_0675916 | 3300039450 | Bacteria | 3790 |
| 508 | Ga0436362_0983170 | 3300039453 | Bacteria | 1177 |
| 509 | Ga0439453_0003007 | 3300041408 | Bacteria | 2384 |
| 510 | Ga0439435_0001103 | 3300042436 | Bacteria | 4813 |
| 511 | Ga0466963_0004838 | 3300044694 | Bacteria | 7847 |
| 512 | Ga0466971_0059504 | 3300044719 | Bacteria | 1726 |
| 513 | Ga0466957_0023514 | 3300044842 | Bacteria | 3643 |
| 514 | Ga0466957_0046112 | 3300044842 | Bacteria | 2645 |
| 515 | Ga0466959_0027099 | 3300045049 | Bacteria | 4251 |
| 516 | Ga0451576_0558837 | 3300045051 | Bacteria | 1202 |
| 517 | Ga0466958_0075461 | 3300045836 | Bacteria | 2068 |
| 518 | Ga0466958_0207560 | 3300045836 | Bacteria | 1247 |
| 519 | Ga0466967_0000600 | 3300045976 | Bacteria | 17902 |
| 520 | Ga0466967_0605673 | 3300045976 | Bacteria | 1081 |
| 521 | Ga0495592_0009274 | 3300046454 | Bacteria | 7402 |
| 522 | Ga0495592_0075476 | 3300046454 | Bacteria | 2448 |
| 523 | Ga0495592_0165203 | 3300046454 | Bacteria | 1520 |
| 524 | Ga0495603_0033614 | 3300046455 | Bacteria | 3085 |
| 525 | Ga0495629_0065960 | 3300046459 | Bacteria | 2526 |
| 526 | Ga0495641_0015315 | 3300046461 | Bacteria | 4101 |
| 527 | Ga0495651_0003936 | 3300046462 | Bacteria | 11353 |
| 528 | Ga0495651_0070751 | 3300046462 | Bacteria | 2654 |
| 529 | Ga0495651_0146388 | 3300046462 | Bacteria | 1707 |
| 530 | Ga0495653_0001546 | 3300046463 | Bacteria | 17971 |
| 531 | Ga0495653_0016165 | 3300046463 | Bacteria | 6080 |
| 532 | Ga0495653_0101288 | 3300046463 | Bacteria | 2087 |
| 533 | Ga0495580_0048530 | 3300046472 | Bacteria | 3005 |
| 534 | Ga0495580_0212472 | 3300046472 | Bacteria | 1331 |
| 535 | Ga0495582_0015745 | 3300046473 | Bacteria | 4148 |
| 536 | Ga0495605_0014539 | 3300046474 | Bacteria | 4306 |
| 537 | Ga0495639_0003876 | 3300046475 | Bacteria | 6424 |
| 538 | Ga0495662_0097299 | 3300046476 | Bacteria | 1438 |
| 539 | Ga0495664_0015521 | 3300046477 | Bacteria | 4330 |
| 540 | Ga0495664_0074735 | 3300046477 | Bacteria | 2028 |
| 541 | Ga0495584_0022721 | 3300046491 | Bacteria | 3182 |
| 542 | Ga0495585_0003847 | 3300046492 | Bacteria | 9983 |
| 543 | Ga0495585_0067832 | 3300046492 | Bacteria | 1950 |
| 544 | Ga0495608_0002461 | 3300046511 | Bacteria | 13299 |
| 545 | Ga0495608_0098663 | 3300046511 | Bacteria | 1885 |
| 546 | Ga0495618_0118213 | 3300046514 | Bacteria | 1698 |
| 547 | Ga0495628_0008857 | 3300046516 | Bacteria | 8614 |
| 548 | Ga0495628_0051189 | 3300046516 | Bacteria | 3265 |
| 549 | Ga0495628_0113205 | 3300046516 | Bacteria | 2085 |
| 550 | Ga0495628_0138418 | 3300046516 | Bacteria | 1859 |
| 551 | Ga0495630_0014169 | 3300046517 | Bacteria | 5803 |
| 552 | Ga0495630_0051618 | 3300046517 | Bacteria | 3078 |
| 553 | Ga0495630_0063975 | 3300046517 | Bacteria | 2763 |
| 554 | Ga0495630_0274915 | 3300046517 | Bacteria | 1287 |
| 555 | Ga0495643_0019528 | 3300046522 | Bacteria | 3919 |
| 556 | Ga0495666_0009741 | 3300046526 | Bacteria | 4802 |
| 557 | Ga0495652_0002263 | 3300046529 | Bacteria | 20082 |
| 558 | Ga0495652_0002387 | 3300046529 | Bacteria | 19430 |
| 559 | Ga0495652_0049159 | 3300046529 | Bacteria | 3611 |
| 560 | Ga0495665_0005950 | 3300046531 | Bacteria | 6570 |
| 561 | Ga0495665_0028928 | 3300046531 | Bacteria | 2970 |
| 562 | Ga0495640_0002268 | 3300046533 | Bacteria | 15432 |
| 563 | Ga0495640_0006778 | 3300046533 | Bacteria | 9038 |
| 564 | Ga0495640_0100265 | 3300046533 | Bacteria | 1902 |
| 565 | Ga0495640_0134623 | 3300046533 | Bacteria | 1597 |
| 566 | Ga0495586_0166346 | 3300046535 | Bacteria | 1245 |
| 567 | Ga0495587_0000974 | 3300046536 | Bacteria | 18768 |
| 568 | Ga0495587_0006801 | 3300046536 | Bacteria | 7445 |
| 569 | Ga0495587_0010772 | 3300046536 | Bacteria | 5806 |
| 570 | Ga0495598_0000959 | 3300046537 | Bacteria | 5559 |
| 571 | Ga0495621_0022218 | 3300046539 | Bacteria | 2101 |
| 572 | Ga0495645_0005094 | 3300046543 | Bacteria | 9005 |
| 573 | Ga0495645_0006252 | 3300046543 | Bacteria | 8252 |
| 574 | Ga0495645_0013793 | 3300046543 | Bacteria | 5726 |
| 575 | Ga0495622_0042825 | 3300046557 | Bacteria | 2105 |
| 576 | Ga0495633_0020617 | 3300046558 | Bacteria | 3312 |
| 577 | Ga0495667_0002526 | 3300046559 | Bacteria | 12212 |
| 578 | Ga0495667_0003673 | 3300046559 | Bacteria | 10325 |
| 579 | Ga0495656_0026622 | 3300046615 | Bacteria | 2304 |
| 580 | Ga0495634_0001554 | 3300046642 | Bacteria | 20250 |
| 581 | Ga0495634_0043139 | 3300046642 | Bacteria | 3057 |
| 582 | Ga0495635_0001424 | 3300046663 | Bacteria | 15965 |
| 583 | Ga0495635_0005756 | 3300046663 | Bacteria | 8636 |
| 584 | Ga0495635_0062865 | 3300046663 | Bacteria | 2549 |
| 585 | Ga0495635_0078455 | 3300046663 | Bacteria | 2261 |
| 586 | Ga0495635_0269245 | 3300046663 | Bacteria | 1146 |
| 587 | Ga0495659_0002398 | 3300046664 | Bacteria | 6053 |
| 588 | Ga0495661_0063393 | 3300046665 | Bacteria | 2185 |
| 589 | Ga0495588_0014648 | 3300046674 | Bacteria | 3758 |
| 590 | Ga0495599_0001552 | 3300046678 | Bacteria | 13225 |
| 591 | Ga0495599_0002551 | 3300046678 | Bacteria | 10608 |
| 592 | Ga0495599_0128260 | 3300046678 | Bacteria | 1576 |
| 593 | Ga0495623_0044148 | 3300046679 | Bacteria | 2833 |
| 594 | Ga0495623_0101310 | 3300046679 | Bacteria | 1754 |
| 595 | Ga0495623_0143865 | 3300046679 | Bacteria | 1416 |
| 596 | Ga0495646_0007710 | 3300046680 | Bacteria | 6840 |
| 597 | Ga0495647_0009007 | 3300046681 | Bacteria | 3367 |
| 598 | Ga0495647_0014368 | 3300046681 | Bacteria | 2757 |
| 599 | Ga0495647_0047949 | 3300046681 | Bacteria | 1650 |
| 600 | Ga0495658_0008108 | 3300046683 | Bacteria | 5200 |
| 601 | Ga0495658_0010116 | 3300046683 | Bacteria | 4713 |
| 602 | Ga0495658_0064523 | 3300046683 | Bacteria | 2110 |
| 603 | Ga0495658_0256598 | 3300046683 | Bacteria | 1100 |
| 604 | Ga0495669_0076514 | 3300046684 | Bacteria | 1532 |
| 605 | Ga0495669_0233939 | 3300046684 | Bacteria | 882 |
| 606 | Ga0495613_0110861 | 3300046689 | Bacteria | 1977 |
| 607 | Ga0495613_0113254 | 3300046689 | Bacteria | 1953 |
| 608 | Ga0495613_0133310 | 3300046689 | Bacteria | 1778 |
| 609 | Ga0495624_0001159 | 3300046690 | Bacteria | 20880 |
| 610 | Ga0495624_0056823 | 3300046690 | Bacteria | 2461 |
| 611 | Ga0495624_0059969 | 3300046690 | Bacteria | 2386 |
| 612 | Ga0495670_0244867 | 3300046691 | Bacteria | 955 |
| 613 | Ga0495600_0005624 | 3300046809 | Bacteria | 7569 |
| 614 | Ga0495600_0021678 | 3300046809 | Bacteria | 4118 |
| 615 | Ga0495600_0097430 | 3300046809 | Bacteria | 1917 |
| 616 | Ga0495660_0168427 | 3300046810 | Bacteria | 1069 |
| 617 | Ga0495581_0003675 | 3300047315 | Bacteria | 8831 |
| 618 | Ga0495581_0024208 | 3300047315 | Bacteria | 3519 |
| 619 | Ga0495604_0028339 | 3300047317 | Bacteria | 4454 |
| 620 | Ga0495604_0035557 | 3300047317 | Bacteria | 3934 |
| 621 | Ga0495604_0060160 | 3300047317 | Bacteria | 2910 |
| 622 | Ga0495604_0119476 | 3300047317 | Bacteria | 1910 |
| 623 | Ga0495604_0227216 | 3300047317 | Bacteria | 1282 |
| 624 | Ga0495604_0263699 | 3300047317 | Bacteria | 1170 |
| 625 | Ga0495636_0130497 | 3300047318 | Bacteria | 1117 |
| 626 | Ga0495674_0001794 | 3300047319 | Bacteria | 21157 |
| 627 | Ga0495674_0004105 | 3300047319 | Bacteria | 14057 |
| 628 | Ga0495674_0049828 | 3300047319 | Bacteria | 3697 |
| 629 | Ga0495676_0012199 | 3300047321 | Bacteria | 7752 |
| 630 | Ga0495676_0347744 | 3300047321 | Bacteria | 991 |
| 631 | Ga0495680_0003134 | 3300047322 | Bacteria | 16480 |
| 632 | Ga0495680_0033332 | 3300047322 | Bacteria | 4171 |
| 633 | Ga0495680_0044275 | 3300047322 | Bacteria | 3520 |
| 634 | Ga0495680_0099299 | 3300047322 | Bacteria | 2171 |
| 635 | Ga0495680_0188858 | 3300047322 | Bacteria | 1483 |
| 636 | Ga0495680_0210983 | 3300047322 | Bacteria | 1390 |
| 637 | Ga0495675_0006989 | 3300047444 | Bacteria | 6939 |
| 638 | Ga0495675_0017849 | 3300047444 | Bacteria | 4499 |
| 639 | Ga0495675_0106974 | 3300047444 | Bacteria | 1748 |
| 640 | Ga0495677_0081526 | 3300047445 | Bacteria | 1213 |
| 641 | Ga0495684_0007486 | 3300047471 | Bacteria | 8455 |
| 642 | Ga0495684_0067676 | 3300047471 | Bacteria | 2716 |
| 643 | Ga0495684_0122218 | 3300047471 | Bacteria | 1960 |
| 644 | Ga0495684_0171952 | 3300047471 | Bacteria | 1611 |
| 645 | Ga0495684_0546352 | 3300047471 | Bacteria | 789 |
| 646 | Ga0495593_0003777 | 3300047673 | Bacteria | 9044 |
| 647 | Ga0495602_0005586 | 3300048088 | Bacteria | 13201 |
| 648 | Ga0495602_0034361 | 3300048088 | Bacteria | 4744 |
| 649 | Ga0495602_0057794 | 3300048088 | Bacteria | 3400 |
| 650 | Ga0496100_0003561 | 3300048903 | Bacteria | 8137 |
| 651 | Ga0496100_0007392 | 3300048903 | Bacteria | 6060 |
| 652 | Ga0496100_0020821 | 3300048903 | Bacteria | 3940 |
| 653 | Ga0496101_0001698 | 3300048904 | Bacteria | 13177 |
| 654 | Ga0496101_0002312 | 3300048904 | Bacteria | 11667 |
| 655 | Ga0496101_0011605 | 3300048904 | Bacteria | 5851 |
| 656 | Ga0496101_0061483 | 3300048904 | Bacteria | 2728 |
| 657 | Ga0496102_0006852 | 3300048905 | Bacteria | 9724 |
| 658 | Ga0496102_0011352 | 3300048905 | Bacteria | 7675 |
| 659 | Ga0496102_0069972 | 3300048905 | Bacteria | 3221 |
| 660 | Ga0496102_0142489 | 3300048905 | Bacteria | 2248 |
| 661 | Ga0496103_0004686 | 3300048906 | Bacteria | 8276 |
| 662 | Ga0496103_0040482 | 3300048906 | Bacteria | 2863 |
| 663 | Ga0496103_0135250 | 3300048906 | Bacteria | 1575 |
| 664 | Ga0496103_0181616 | 3300048906 | Bacteria | 1352 |
| 665 | Ga0496104_0000369 | 3300048907 | Bacteria | 39830 |
| 666 | Ga0496104_0001214 | 3300048907 | Bacteria | 22174 |
| 667 | Ga0496104_0003051 | 3300048907 | Bacteria | 14433 |
| 668 | Ga0496104_0017246 | 3300048907 | Bacteria | 6571 |
| 669 | Ga0496104_0029302 | 3300048907 | Bacteria | 5105 |
| 670 | Ga0496104_0041805 | 3300048907 | Bacteria | 4299 |
| 671 | Ga0496104_0129397 | 3300048907 | Bacteria | 2425 |
| 672 | Ga0496104_0196091 | 3300048907 | Bacteria | 1931 |
| 673 | Ga0496104_0256893 | 3300048907 | Bacteria | 1660 |
| 674 | Ga0496104_0302856 | 3300048907 | Bacteria | 1510 |
| 675 | Ga0496105_0009664 | 3300048908 | Bacteria | 7552 |
| 676 | Ga0496105_0037536 | 3300048908 | Bacteria | 3989 |
| 677 | Ga0496105_0127425 | 3300048908 | Bacteria | 2099 |
| 678 | Ga0496106_0003679 | 3300048909 | Bacteria | 11431 |
| 679 | Ga0496106_0004523 | 3300048909 | Bacteria | 10299 |
| 680 | Ga0496106_0016334 | 3300048909 | Bacteria | 5492 |
| 681 | Ga0496106_0199358 | 3300048909 | Bacteria | 1593 |
| 682 | Ga0496106_0258551 | 3300048909 | Bacteria | 1393 |
| 683 | Ga0496107_0001981 | 3300048910 | Bacteria | 13037 |
| 684 | Ga0496107_0030776 | 3300048910 | Bacteria | 3827 |
| 685 | Ga0496108_0002287 | 3300048911 | Bacteria | 15347 |
| 686 | Ga0496108_0007574 | 3300048911 | Bacteria | 8793 |
| 687 | Ga0496108_0008671 | 3300048911 | Bacteria | 8245 |
| 688 | Ga0496108_0085789 | 3300048911 | Bacteria | 2673 |
| 689 | Ga0496108_0109164 | 3300048911 | Bacteria | 2364 |
| 690 | Ga0496108_0263427 | 3300048911 | Bacteria | 1500 |
| 691 | Ga0496108_0420685 | 3300048911 | Bacteria | 1167 |
| 692 | Ga0496109_0000561 | 3300048912 | Bacteria | 31028 |
| 693 | Ga0496109_0038830 | 3300048912 | Bacteria | 4306 |
| 694 | Ga0496109_0040998 | 3300048912 | Bacteria | 4194 |
| 695 | Ga0496109_0082119 | 3300048912 | Bacteria | 2970 |
| 696 | Ga0496109_0108961 | 3300048912 | Bacteria | 2574 |
| 697 | Ga0496109_0260989 | 3300048912 | Bacteria | 1632 |
| 698 | Ga0496110_0002763 | 3300048913 | Bacteria | 13254 |
| 699 | Ga0496110_0003430 | 3300048913 | Bacteria | 12132 |
| 700 | Ga0496110_0004859 | 3300048913 | Bacteria | 10482 |
| 701 | Ga0496110_0007744 | 3300048913 | Bacteria | 8598 |
| 702 | Ga0496110_0014211 | 3300048913 | Bacteria | 6605 |
| 703 | Ga0496110_0038338 | 3300048913 | Bacteria | 4169 |
| 704 | Ga0496110_0402752 | 3300048913 | Bacteria | 1247 |
| 705 | Ga0496110_0444293 | 3300048913 | Bacteria | 1182 |
| 706 | Ga0496111_0013509 | 3300048914 | Bacteria | 5560 |
| 707 | Ga0496111_0022767 | 3300048914 | Bacteria | 4390 |
| 708 | Ga0496111_0024178 | 3300048914 | Bacteria | 4275 |
| 709 | Ga0496111_0041160 | 3300048914 | Bacteria | 3315 |
| 710 | Ga0496111_0064980 | 3300048914 | Bacteria | 2647 |
| 711 | Ga0496112_0000702 | 3300048915 | Bacteria | 23297 |
| 712 | Ga0496112_0006926 | 3300048915 | Bacteria | 10005 |
| 713 | Ga0496112_0060283 | 3300048915 | Bacteria | 3739 |
| 714 | Ga0496112_0090573 | 3300048915 | Bacteria | 3027 |
| 715 | Ga0496112_0113340 | 3300048915 | Bacteria | 2682 |
| 716 | Ga0496112_0212104 | 3300048915 | Bacteria | 1893 |
| 717 | Ga0496112_0263309 | 3300048915 | Bacteria | 1673 |
| 718 | Ga0496112_0280330 | 3300048915 | Bacteria | 1614 |
| 719 | Ga0496112_0494551 | 3300048915 | Bacteria | 1159 |
| 720 | Ga0496113_0001074 | 3300048916 | Bacteria | 14777 |
| 721 | Ga0496113_0007716 | 3300048916 | Bacteria | 6944 |
| 722 | Ga0496113_0025205 | 3300048916 | Bacteria | 4236 |
| 723 | Ga0496113_0063776 | 3300048916 | Bacteria | 2785 |
| 724 | Ga0496114_0029829 | 3300048917 | Bacteria | 4484 |
| 725 | Ga0496114_0070175 | 3300048917 | Bacteria | 2942 |
| 726 | Ga0496115_0021027 | 3300048918 | Bacteria | 5036 |
| 727 | Ga0496115_0100454 | 3300048918 | Bacteria | 2371 |
| 728 | Ga0496115_0107355 | 3300048918 | Bacteria | 2292 |
| 729 | Ga0496115_0190594 | 3300048918 | Bacteria | 1694 |
| 730 | Ga0496115_0216475 | 3300048918 | Bacteria | 1581 |
| 731 | Ga0496115_0277283 | 3300048918 | Bacteria | 1377 |
| 732 | Ga0496115_0340091 | 3300048918 | Bacteria | 1225 |
| 733 | Ga0496119_0000806 | 3300048922 | Bacteria | 41963 |
| 734 | Ga0496119_0169844 | 3300048922 | Bacteria | 1153 |
| 735 | Ga0496122_0006697 | 3300048925 | Bacteria | 13111 |
| 736 | Ga0496122_0109323 | 3300048925 | Bacteria | 1820 |
| 737 | Ga0496122_0232275 | 3300048925 | Bacteria | 1047 |
| 738 | Ga0496123_0001298 | 3300048926 | Bacteria | 35561 |
| 739 | Ga0496123_0033923 | 3300048926 | Bacteria | 3665 |
| 740 | Ga0496125_0062184 | 3300048928 | Bacteria | 2988 |
| 741 | Ga0496125_0086005 | 3300048928 | Bacteria | 2380 |
| 742 | Ga0496126_0008820 | 3300048929 | Bacteria | 10813 |
| 743 | Ga0496126_0114539 | 3300048929 | Bacteria | 2346 |
| 744 | Ga0501031_0006090 | 3300049568 | Bacteria | 7875 |
| 745 | Ga0501031_0007326 | 3300049568 | Bacteria | 7197 |
| 746 | Ga0501031_0093088 | 3300049568 | Bacteria | 1967 |
| 747 | Ga0501031_0230741 | 3300049568 | Bacteria | 1204 |
| 748 | Ga0501032_0019344 | 3300049569 | Bacteria | 4764 |
| 749 | Ga0501032_0025316 | 3300049569 | Bacteria | 4091 |
| 750 | Ga0501033_0010833 | 3300049570 | Bacteria | 6993 |
| 751 | Ga0501033_0055821 | 3300049570 | Bacteria | 2919 |
| 752 | Ga0501033_0094154 | 3300049570 | Bacteria | 2191 |
| 753 | Ga0501034_0008255 | 3300049571 | Bacteria | 11023 |
| 754 | Ga0501034_0064129 | 3300049571 | Bacteria | 3688 |
| 755 | Ga0501034_0075399 | 3300049571 | Bacteria | 3380 |
| 756 | Ga0501034_0082996 | 3300049571 | Bacteria | 3206 |
| 757 | Ga0501034_0110578 | 3300049571 | Bacteria | 2739 |
| 758 | Ga0501034_0173683 | 3300049571 | Bacteria | 2121 |
| 759 | Ga0501034_0184646 | 3300049571 | Bacteria | 2049 |
| 760 | Ga0501034_0198380 | 3300049571 | Bacteria | 1966 |
| 761 | Ga0501034_0253926 | 3300049571 | Bacteria | 1702 |
| 762 | Ga0501034_0512494 | 3300049571 | Bacteria | 1112 |
| 763 | Ga0501036_0002175 | 3300049572 | Bacteria | 15299 |
| 764 | Ga0501036_0006160 | 3300049572 | Bacteria | 9729 |
| 765 | Ga0501036_0013411 | 3300049572 | Bacteria | 6810 |
| 766 | Ga0501036_0043035 | 3300049572 | Bacteria | 3824 |
| 767 | Ga0501036_0226150 | 3300049572 | Bacteria | 1570 |
| 768 | Ga0501037_0012077 | 3300049573 | Bacteria | 6360 |
| 769 | Ga0501037_0061268 | 3300049573 | Bacteria | 2743 |
| 770 | Ga0501038_0001565 | 3300049574 | Bacteria | 21184 |
| 771 | Ga0501038_0016429 | 3300049574 | Bacteria | 6707 |
| 772 | Ga0501038_0051377 | 3300049574 | Bacteria | 3557 |
| 773 | Ga0501038_0061334 | 3300049574 | Bacteria | 3216 |
| 774 | Ga0501038_0186860 | 3300049574 | Bacteria | 1669 |
| 775 | Ga0501038_0237860 | 3300049574 | Bacteria | 1447 |
| 776 | Ga0501039_0004448 | 3300049575 | Bacteria | 10579 |
| 777 | Ga0501039_0041424 | 3300049575 | Bacteria | 3557 |
| 778 | Ga0501039_0148460 | 3300049575 | Bacteria | 1842 |
| 779 | Ga0501039_0297929 | 3300049575 | Bacteria | 1268 |
| 780 | Ga0501041_0005072 | 3300049577 | Bacteria | 7674 |
| 781 | Ga0501042_0036194 | 3300049578 | Bacteria | 3502 |
| 782 | Ga0501042_0053479 | 3300049578 | Bacteria | 2881 |
| 783 | Ga0501042_0139598 | 3300049578 | Bacteria | 1747 |
| 784 | Ga0501042_0167717 | 3300049578 | Bacteria | 1584 |
| 785 | Ga0501043_0012827 | 3300049579 | Bacteria | 6549 |
| 786 | Ga0501043_0025732 | 3300049579 | Bacteria | 4616 |
| 787 | Ga0501043_0031809 | 3300049579 | Bacteria | 4148 |
| 788 | Ga0501043_0037121 | 3300049579 | Bacteria | 3833 |
| 789 | Ga0501043_0044249 | 3300049579 | Bacteria | 3500 |
| 790 | Ga0501043_0131634 | 3300049579 | Bacteria | 1960 |
| 791 | Ga0501043_0191534 | 3300049579 | Bacteria | 1590 |
| 792 | Ga0501046_0056941 | 3300049580 | Bacteria | 3067 |
| 793 | Ga0501046_0147491 | 3300049580 | Bacteria | 1776 |
| 794 | Ga0501046_0229378 | 3300049580 | Bacteria | 1373 |
| 795 | Ga0501046_0348308 | 3300049580 | Bacteria | 1076 |
| 796 | Ga0501047_0003841 | 3300049581 | Bacteria | 14125 |
| 797 | Ga0501047_0028740 | 3300049581 | Bacteria | 5362 |
| 798 | Ga0501047_0037832 | 3300049581 | Bacteria | 4666 |
| 799 | Ga0501047_0083204 | 3300049581 | Bacteria | 3075 |
| 800 | Ga0501047_0126074 | 3300049581 | Bacteria | 2441 |
| 801 | Ga0501048_0004383 | 3300049582 | Bacteria | 10748 |
| 802 | Ga0501048_0023928 | 3300049582 | Bacteria | 4461 |
| 803 | Ga0501067_0024445 | 3300049583 | Bacteria | 3350 |
| 804 | Ga0501067_0066324 | 3300049583 | Bacteria | 1998 |
| 805 | Ga0501068_0002840 | 3300049584 | Bacteria | 9211 |
| 806 | Ga0501068_0141973 | 3300049584 | Bacteria | 1506 |
| 807 | Ga0501069_0001963 | 3300049585 | Bacteria | 10267 |
| 808 | Ga0501070_0011466 | 3300049586 | Bacteria | 7489 |
| 809 | Ga0501070_0013659 | 3300049586 | Bacteria | 6840 |
| 810 | Ga0501070_0021330 | 3300049586 | Bacteria | 5435 |
| 811 | Ga0501070_0031370 | 3300049586 | Bacteria | 4453 |
| 812 | Ga0501071_0009884 | 3300049587 | Bacteria | 6371 |
| 813 | Ga0501071_0010484 | 3300049587 | Bacteria | 6212 |
| 814 | Ga0501071_0134955 | 3300049587 | Bacteria | 1836 |
| 815 | Ga0501071_0198070 | 3300049587 | Bacteria | 1508 |
| 816 | Ga0501072_0001393 | 3300049588 | Bacteria | 18197 |
| 817 | Ga0501072_0006889 | 3300049588 | Bacteria | 8629 |
| 818 | Ga0501072_0048709 | 3300049588 | Bacteria | 3336 |
| 819 | Ga0501072_0107748 | 3300049588 | Bacteria | 2217 |
| 820 | Ga0501072_0179207 | 3300049588 | Bacteria | 1690 |
| 821 | Ga0501073_0119716 | 3300049589 | Bacteria | 1824 |
| 822 | Ga0501073_0132356 | 3300049589 | Bacteria | 1729 |
| 823 | Ga0501073_0175559 | 3300049589 | Bacteria | 1483 |
| 824 | Ga0501074_0034107 | 3300049590 | Bacteria | 3690 |
| 825 | Ga0501074_0178731 | 3300049590 | Bacteria | 1514 |
| 826 | Ga0501075_0001104 | 3300049591 | Bacteria | 17384 |
| 827 | Ga0501075_0061191 | 3300049591 | Bacteria | 2837 |
| 828 | Ga0501075_0114781 | 3300049591 | Bacteria | 2048 |
| 829 | Ga0501076_0004052 | 3300049592 | Bacteria | 10359 |
| 830 | Ga0501076_0062584 | 3300049592 | Bacteria | 2964 |
| 831 | Ga0501076_0075248 | 3300049592 | Bacteria | 2706 |
| 832 | Ga0501076_0260478 | 3300049592 | Bacteria | 1420 |
| 833 | Ga0501076_0339428 | 3300049592 | Bacteria | 1233 |
| 834 | Ga0501076_0456574 | 3300049592 | Bacteria | 1052 |
| 835 | Ga0501077_0020854 | 3300049593 | Bacteria | 4149 |
| 836 | Ga0501238_004132 | 3300049671 | Bacteria | 1804 |
| 837 | Ga0501079_0003253 | 3300049741 | Bacteria | 11904 |
| 838 | Ga0501079_0036323 | 3300049741 | Bacteria | 3796 |
| 839 | Ga0501079_0263230 | 3300049741 | Bacteria | 1348 |
| 840 | Ga0501079_0398427 | 3300049741 | Bacteria | 1079 |
| 841 | Ga0501080_0095804 | 3300049742 | Bacteria | 2755 |
| 842 | Ga0501080_0102558 | 3300049742 | Bacteria | 2654 |
| 843 | Ga0501080_0257257 | 3300049742 | Bacteria | 1591 |
| 844 | Ga0501080_0759505 | 3300049742 | Bacteria | 852 |
| 845 | Ga0501081_0001170 | 3300049743 | Bacteria | 15892 |
| 846 | Ga0501081_0070925 | 3300049743 | Bacteria | 2428 |
| 847 | Ga0501081_0110950 | 3300049743 | Bacteria | 1946 |
| 848 | Ga0501081_0185146 | 3300049743 | Bacteria | 1507 |
| 849 | Ga0501083_0000817 | 3300049744 | Bacteria | 20380 |
| 850 | Ga0501083_0018751 | 3300049744 | Bacteria | 4818 |
| 851 | Ga0501083_0034375 | 3300049744 | Bacteria | 3467 |
| 852 | Ga0501083_0043563 | 3300049744 | Bacteria | 3040 |
| 853 | Ga0501083_0229720 | 3300049744 | Bacteria | 1208 |
| 854 | Ga0501083_0282335 | 3300049744 | Bacteria | 1080 |
| 855 | Ga0501035_0012798 | 3300049822 | Bacteria | 7749 |
| 856 | Ga0501035_0045489 | 3300049822 | Bacteria | 3949 |
| 857 | Ga0501035_0280771 | 3300049822 | Bacteria | 1407 |
| 858 | Ga0501044_0000509 | 3300049823 | Bacteria | 47320 |
| 859 | Ga0501044_0019980 | 3300049823 | Bacteria | 7152 |
| 860 | Ga0501044_0031516 | 3300049823 | Bacteria | 5580 |
| 861 | Ga0501044_0058340 | 3300049823 | Bacteria | 3958 |
| 862 | Ga0501044_0123557 | 3300049823 | Bacteria | 2587 |
| 863 | Ga0501044_0267384 | 3300049823 | Bacteria | 1646 |
| 864 | Ga0501044_0431705 | 3300049823 | Bacteria | 1226 |
| 865 | Ga0501045_0028996 | 3300049824 | Bacteria | 3996 |
| 866 | Ga0501045_0349566 | 3300049824 | Bacteria | 1100 |
| 867 | nmdc:mga03n38_186506_c1 | 3300050490 | Bacteria | 1066 |
| 868 | nmdc:mga03n38_48450_c1 | 3300050490 | Bacteria | 1885 |
| 869 | nmdc:mga00v17_178781_c1 | 3300050491 | Bacteria | 1369 |
| 870 | nmdc:mga00v17_23359_c1 | 3300050491 | Bacteria | 3576 |
| 871 | nmdc:mga00v17_89581_c1 | 3300050491 | Bacteria | 1931 |
| 872 | nmdc:mga0yw44_1031_c1 | 3300050492 | Bacteria | 10692 |
| 873 | nmdc:mga0yw44_15452_c1 | 3300050492 | Bacteria | 4091 |
| 874 | nmdc:mga0yw44_80427_c1 | 3300050492 | Bacteria | 2041 |
| 875 | nmdc:mga0yw44_97207_c1 | 3300050492 | Bacteria | 1870 |
| 876 | nmdc:mga0k408_12748_c1 | 3300050493 | Bacteria | 4598 |
| 877 | nmdc:mga0k408_139321_c1 | 3300050493 | Bacteria | 1442 |
| 878 | nmdc:mga0k408_41022_c1 | 3300050493 | Bacteria | 2664 |
| 879 | nmdc:mga0k408_53649_c1 | 3300050493 | Bacteria | 2337 |
| 880 | nmdc:mga0k408_73074_c1 | 3300050493 | Bacteria | 2003 |
| 881 | nmdc:mga06z11_11761_c1 | 3300050494 | Bacteria | 3785 |
| 882 | nmdc:mga06z11_125618_c1 | 3300050494 | Bacteria | 1435 |
| 883 | nmdc:mga06z11_36850_c1 | 3300050494 | Bacteria | 2418 |
| 884 | nmdc:mga06z11_3813_c1 | 3300050494 | Bacteria | 5872 |
| 885 | nmdc:mga07m45_75485_c1 | 3300050496 | Bacteria | 1921 |
| 886 | nmdc:mga05p37_119967_c1 | 3300050507 | Bacteria | 3231 |
| 887 | nmdc:mga05p37_158906_c1 | 3300050507 | Bacteria | 2761 |
| 888 | nmdc:mga05p37_30503_c1 | 3300050507 | Bacteria | 6579 |
| 889 | nmdc:mga05p37_52_c1 | 3300050507 | Bacteria | 102932 |
| 890 | nmdc:mga05p37_55172_c1 | 3300050507 | Bacteria | 4889 |
| 891 | nmdc:mga05p37_619897_c1 | 3300050507 | Bacteria | 1217 |
| 892 | nmdc:mga09592_219639_c1 | 3300050508 | Bacteria | 1647 |
| 893 | nmdc:mga09592_356119_c1 | 3300050508 | Bacteria | 1266 |
| 894 | nmdc:mga0qj67_13134_c1 | 3300050509 | Bacteria | 6253 |
| 895 | nmdc:mga0qj67_298910_c1 | 3300050509 | Bacteria | 1304 |
| 896 | nmdc:mga0qj67_3562_c1 | 3300050509 | Bacteria | 11238 |
| 897 | nmdc:mga0qj67_62_c1 | 3300050509 | Bacteria | 79928 |
| 898 | nmdc:mga06r32_169976_c1 | 3300050510 | Bacteria | 2163 |
| 899 | nmdc:mga06r32_188274_c1 | 3300050510 | Bacteria | 2051 |
| 900 | nmdc:mga06r32_248_c1 | 3300050510 | Bacteria | 44402 |
| 901 | nmdc:mga06r32_58944_c1 | 3300050510 | Bacteria | 3691 |
| 902 | nmdc:mga08y16_174418_c1 | 3300050511 | Bacteria | 2232 |
| 903 | nmdc:mga08y16_185_c1 | 3300050511 | Bacteria | 55383 |
| 904 | nmdc:mga08y16_19901_c1 | 3300050511 | Bacteria | 7079 |
| 905 | nmdc:mga08y16_287139_c1 | 3300050511 | Bacteria | 1696 |
| 906 | nmdc:mga08y16_401129_c1 | 3300050511 | Bacteria | 1403 |
| 907 | nmdc:mga08y16_507966_c1 | 3300050511 | Bacteria | 1224 |
| 908 | nmdc:mga0n895_142017_c1 | 3300050512 | Bacteria | 2430 |
| 909 | nmdc:mga0n895_250882_c1 | 3300050512 | Bacteria | 1796 |
| 910 | nmdc:mga0n895_530637_c1 | 3300050512 | Bacteria | 1184 |
| 911 | nmdc:mga0n895_58287_c1 | 3300050512 | Bacteria | 3807 |
| 912 | nmdc:mga0n895_80113_c1 | 3300050512 | Bacteria | 3253 |
| 913 | nmdc:mga0rr50_189449_c1 | 3300050513 | Bacteria | 1685 |
| 914 | nmdc:mga0rr50_33759_c1 | 3300050513 | Bacteria | 3658 |
| 915 | nmdc:mga0rr50_36073_c1 | 3300050513 | Bacteria | 3557 |
| 916 | nmdc:mga0rr50_418387_c1 | 3300050513 | Bacteria | 1133 |
| 917 | nmdc:mga08x19_22_c1 | 3300050514 | Bacteria | 297462 |
| 918 | nmdc:mga0a205_15283_c1 | 3300050515 | Bacteria | 7171 |
| 919 | nmdc:mga0a205_157596_c1 | 3300050515 | Bacteria | 2168 |
| 920 | nmdc:mga0a205_80963_c1 | 3300050515 | Bacteria | 3137 |
| 921 | Ga0495601_0001359 | 3300053077 | Bacteria | 13454 |
| 922 | Ga0495601_0006610 | 3300053077 | Bacteria | 6781 |
| 923 | Ga0495601_0032644 | 3300053077 | Bacteria | 3241 |
| 924 | Ga0495601_0080600 | 3300053077 | Bacteria | 2088 |
| 925 | Ga0495601_0135011 | 3300053077 | Bacteria | 1608 |
| 926 | Ga0495601_0169811 | 3300053077 | Bacteria | 1426 |
| 927 | Ga0495601_0291067 | 3300053077 | Bacteria | 1064 |
| 928 | Ga0495612_0000238 | 3300053078 | Bacteria | 23053 |
| 929 | Ga0495612_0000657 | 3300053078 | Bacteria | 13923 |
| 930 | Ga0495612_0000893 | 3300053078 | Bacteria | 12195 |
| 931 | Ga0495612_0074184 | 3300053078 | Bacteria | 1422 |
| 932 | Ga0495612_0153415 | 3300053078 | Bacteria | 1003 |
| 933 | Ga0495595_0000795 | 3300053084 | Bacteria | 12010 |
| 934 | Ga0495595_0007638 | 3300053084 | Bacteria | 4429 |
| 935 | Ga0495595_0015118 | 3300053084 | Bacteria | 3287 |
| 936 | Ga0495595_0038271 | 3300053084 | Bacteria | 2184 |
| 937 | Ga0495595_0042041 | 3300053084 | Bacteria | 2094 |
| 938 | Ga0495595_0042549 | 3300053084 | Bacteria | 2081 |
| 939 | Ga0495595_0127452 | 3300053084 | Bacteria | 1242 |
| 940 | Ga0495595_0184155 | 3300053084 | Bacteria | 1036 |
| 941 | Ga0495619_0003766 | 3300053085 | Bacteria | 9762 |
| 942 | Ga0495619_0016705 | 3300053085 | Bacteria | 4644 |
| 943 | Ga0495619_0020949 | 3300053085 | Bacteria | 4170 |
| 944 | Ga0495619_0035724 | 3300053085 | Bacteria | 3233 |
| 945 | Ga0495619_0077460 | 3300053085 | Bacteria | 2233 |
| 946 | Ga0495619_0151792 | 3300053085 | Bacteria | 1598 |
| 947 | Ga0495619_0231289 | 3300053085 | Bacteria | 1281 |
| 948 | Ga0500641_0034326 | 3300053096 | Bacteria | 2018 |
| 949 | Ga0500556_0000160 | 3300053104 | Bacteria | 55309 |
| 950 | Ga0500597_030665 | 3300053120 | Bacteria | 2211 |
| 951 | Ga0500652_000056 | 3300053131 | Bacteria | 51871 |
| 952 | Ga0500622_0027584 | 3300053156 | Bacteria | 2994 |
| 953 | Ga0500636_0038640 | 3300053177 | Bacteria | 2823 |
| 954 | Ga0500645_006585 | 3300053730 | Bacteria | 4126 |
| 955 | Ga0501084_0011994 | 3300054114 | Bacteria | 7176 |
| 956 | Ga0501084_0019517 | 3300054114 | Bacteria | 5647 |
| 957 | Ga0501084_0053593 | 3300054114 | Bacteria | 3374 |
| 958 | Ga0501084_0145887 | 3300054114 | Bacteria | 1993 |
| 959 | Ga0501084_0146877 | 3300054114 | Bacteria | 1986 |
| 960 | Ga0501084_0201072 | 3300054114 | Bacteria | 1681 |
| 961 | Ga0501082_0000016 | 3300060353 | Bacteria | 115081 |
| 962 | Ga0501082_0004262 | 3300060353 | Bacteria | 12496 |
| 963 | Ga0501082_0030617 | 3300060353 | Bacteria | 4637 |
| 964 | Ga0501082_0040534 | 3300060353 | Bacteria | 4016 |
| 965 | Ga0501082_0041644 | 3300060353 | Bacteria | 3960 |
| 966 | Ga0501082_0091880 | 3300060353 | Bacteria | 2621 |
| 967 | Ga0466962_0012613 | 3300061719 | Bacteria | 4066 |
| 968 | Ga0530510_0034068 | 3300061734 | Bacteria | 3668 |
| 969 | Ga0530510_0104487 | 3300061734 | Bacteria | 2072 |
| 970 | Ga0530510_0194132 | 3300061734 | Bacteria | 1507 |
| 971 | Ga0530510_0258989 | 3300061734 | Bacteria | 1297 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047471 | Ga0495684_0546352 | Ga0495684_0546352_15_761 | 247 |
| 2 | 3300031344 | Ga0265316_10069276 | Ga0265316_100692762 | 250 |
| 3 | 3300049570 | Ga0501033_0094154 | Ga0501033_0094154_1323_2099 | 252 |
| 4 | 3300049575 | Ga0501039_0148460 | Ga0501039_0148460_960_1736 | 252 |
| 5 | 3300049742 | Ga0501080_0759505 | Ga0501080_0759505_32_808 | 252 |
| 6 | 3300049572 | Ga0501036_0043035 | Ga0501036_0043035_2997_3788 | 256 |
| 7 | 3300046517 | Ga0495630_0014169 | Ga0495630_0014169_5006_5785 | 259 |
| 8 | iso_pu_bacteria | 2508501050 | 2508734185 | 261 |
| 9 | 3300035083 | Ga0373926_0045813 | Ga0373926_0045813_47_838 | 262 |
| 10 | 3300049570 | Ga0501033_0055821 | Ga0501033_0055821_357_1313 | 262 |
| 11 | 3300049571 | Ga0501034_0082996 | Ga0501034_0082996_206_1162 | 262 |
| 12 | 3300049572 | Ga0501036_0006160 | Ga0501036_0006160_5343_6299 | 262 |
| 13 | 3300049573 | Ga0501037_0012077 | Ga0501037_0012077_383_1339 | 262 |
| 14 | 3300049574 | Ga0501038_0001565 | Ga0501038_0001565_15690_16646 | 262 |
| 15 | 3300049575 | Ga0501039_0004448 | Ga0501039_0004448_695_1651 | 262 |
| 16 | 3300049578 | Ga0501042_0053479 | Ga0501042_0053479_1474_2430 | 262 |
| 17 | 3300049579 | Ga0501043_0012827 | Ga0501043_0012827_1584_2540 | 262 |
| 18 | 3300049581 | Ga0501047_0083204 | Ga0501047_0083204_1584_2540 | 262 |
| 19 | 3300049582 | Ga0501048_0004383 | Ga0501048_0004383_510_1466 | 262 |
| 20 | 3300049583 | Ga0501067_0024445 | Ga0501067_0024445_1717_2673 | 262 |
| 21 | 3300049584 | Ga0501068_0002840 | Ga0501068_0002840_447_1403 | 262 |
| 22 | 3300049585 | Ga0501069_0001963 | Ga0501069_0001963_6921_7877 | 262 |
| 23 | 3300049586 | Ga0501070_0013659 | Ga0501070_0013659_5502_6458 | 262 |
| 24 | 3300049587 | Ga0501071_0009884 | Ga0501071_0009884_4570_5526 | 262 |
| 25 | 3300049589 | Ga0501073_0119716 | Ga0501073_0119716_512_1468 | 262 |
| 26 | 3300049592 | Ga0501076_0062584 | Ga0501076_0062584_510_1466 | 262 |
| 27 | 3300049741 | Ga0501079_0036323 | Ga0501079_0036323_2065_3021 | 262 |
| 28 | 3300049744 | Ga0501083_0000817 | Ga0501083_0000817_11675_12631 | 262 |
| 29 | 3300049822 | Ga0501035_0280771 | Ga0501035_0280771_357_1313 | 262 |
| 30 | 3300049823 | Ga0501044_0267384 | Ga0501044_0267384_308_1264 | 262 |
| 31 | 3300054114 | Ga0501084_0053593 | Ga0501084_0053593_2193_3149 | 262 |
| 32 | 3300060353 | Ga0501082_0040534 | Ga0501082_0040534_570_1526 | 262 |
| 33 | 3300049573 | Ga0501037_0061268 | Ga0501037_0061268_14_805 | 263 |
| 34 | 3300035171 | Ga0373946_0223251 | Ga0373946_0223251_50_844 | 264 |
| 35 | 3300035410 | Ga0373924_0155512 | Ga0373924_0155512_41_835 | 264 |
| 36 | 3300035724 | Ga0373933_0328351 | Ga0373933_0328351_35_829 | 264 |
| 37 | 3300037418 | Ga0395900_0329863 | Ga0395900_0329863_678_1472 | 264 |
| 38 | 3300050491 | nmdc:mga00v17_89581_c1 | nmdc:mga00v17_89581_c1_1114_1908 | 264 |
| 39 | 3300035121 | Ga0373960_0089236 | Ga0373960_0089236_37_834 | 265 |
| 40 | 3300046684 | Ga0495669_0233939 | Ga0495669_0233939_30_827 | 265 |
| 41 | 3300046691 | Ga0495670_0244867 | Ga0495670_0244867_14_811 | 265 |
| 42 | 3300050490 | nmdc:mga03n38_186506_c1 | nmdc:mga03n38_186506_c1_226_1023 | 265 |
| 43 | 3300061734 | Ga0530510_0194132 | Ga0530510_0194132_16_813 | 265 |
| 44 | 3300031250 | Ga0265331_10000005 | Ga0265331_10000005352 | 266 |
| 45 | 3300031239 | Ga0265328_10009220 | Ga0265328_100092203 | 267 |
| 46 | 3300031250 | Ga0265331_10010424 | Ga0265331_100104242 | 267 |
| 47 | 3300031251 | Ga0265327_10016866 | Ga0265327_100168663 | 267 |
| 48 | 3300031344 | Ga0265316_10077563 | Ga0265316_100775634 | 267 |
| 49 | 3300049571 | Ga0501034_0173683 | Ga0501034_0173683_523_1470 | 267 |
| 50 | 3300021377 | Ga0213874_10006568 | Ga0213874_100065682 | 274 |
| 51 | 3300031239 | Ga0265328_10000082 | Ga0265328_100000826 | 274 |
| 52 | 3300031242 | Ga0265329_10017381 | Ga0265329_100173813 | 274 |
| 53 | 3300031250 | Ga0265331_10000806 | Ga0265331_100008068 | 274 |
| 54 | 3300031344 | Ga0265316_10018085 | Ga0265316_100180858 | 274 |
| 55 | 3300039450 | Ga0436363_0675916 | Ga0436363_0675916_478_1410 | 274 |
| 56 | 3300037471 | Ga0395905_0308872 | Ga0395905_0308872_273_1172 | 276 |
| 57 | 3300032002 | Ga0307416_100519326 | Ga0307416_1005193262 | 277 |
| 58 | 3300048929 | Ga0496126_0008820 | Ga0496126_0008820_8868_9758 | 278 |
| 59 | iso_pu_bacteria | 2894232714 | 2894238447 | 278 |
| 60 | 3300035695 | Ga0373927_0063590 | Ga0373927_0063590_414_1277 | 280 |
| 61 | 3300049571 | Ga0501034_0008255 | Ga0501034_0008255_2973_3872 | 281 |
| 62 | 3300005548 | Ga0070665_100305640 | Ga0070665_1003056403 | 282 |
| 63 | 3300046454 | Ga0495592_0165203 | Ga0495592_0165203_568_1416 | 282 |
| 64 | 3300005435 | Ga0070714_100017639 | Ga0070714_1000176395 | 283 |
| 65 | 3300006028 | Ga0070717_10023990 | Ga0070717_100239902 | 283 |
| 66 | 3300006163 | Ga0070715_10011779 | Ga0070715_100117794 | 283 |
| 67 | 3300010375 | Ga0105239_10106351 | Ga0105239_101063512 | 283 |
| 68 | 3300025913 | Ga0207695_10004482 | Ga0207695_1000448214 | 283 |
| 69 | 3300025939 | Ga0207665_10022474 | Ga0207665_100224742 | 283 |
| 70 | 3300006871 | Ga0075434_100019972 | Ga0075434_1000199722 | 284 |
| 71 | 3300007076 | Ga0075435_100044761 | Ga0075435_1000447613 | 284 |
| 72 | 3300050512 | nmdc:mga0n895_142017_c1 | nmdc:mga0n895_142017_c1_1368_2273 | 284 |
| 73 | 3300050513 | nmdc:mga0rr50_36073_c1 | nmdc:mga0rr50_36073_c1_1630_2535 | 284 |
| 74 | 3300053078 | Ga0495612_0153415 | Ga0495612_0153415_60_917 | 284 |
| 75 | 3300060353 | Ga0501082_0000016 | Ga0501082_0000016_101575_102519 | 284 |
| 76 | 3300028556 | Ga0265337_1001450 | Ga0265337_10014505 | 285 |
| 77 | 3300049592 | Ga0501076_0456574 | Ga0501076_0456574_185_1042 | 285 |
| 78 | 3300005295 | Ga0065707_10187933 | Ga0065707_101879331 | 287 |
| 79 | 3300005548 | Ga0070665_100350555 | Ga0070665_1003505552 | 287 |
| 80 | 3300014326 | Ga0157380_10313027 | Ga0157380_103130272 | 287 |
| 81 | 3300025904 | Ga0207647_10085701 | Ga0207647_100857012 | 287 |
| 82 | 3300031235 | Ga0265330_10011418 | Ga0265330_100114183 | 287 |
| 83 | 3300031824 | Ga0307413_10056746 | Ga0307413_100567462 | 287 |
| 84 | 3300031903 | Ga0307407_10099690 | Ga0307407_100996901 | 287 |
| 85 | 3300031911 | Ga0307412_10217005 | Ga0307412_102170052 | 287 |
| 86 | 3300031995 | Ga0307409_100058049 | Ga0307409_1000580493 | 287 |
| 87 | 3300032004 | Ga0307414_10005179 | Ga0307414_100051794 | 287 |
| 88 | 3300050511 | nmdc:mga08y16_401129_c1 | nmdc:mga08y16_401129_c1_63_986 | 287 |
| 89 | 3300031731 | Ga0307405_10038411 | Ga0307405_100384114 | 288 |
| 90 | 3300013102 | Ga0157371_10055625 | Ga0157371_100556252 | 289 |
| 91 | 3300013307 | Ga0157372_10616725 | Ga0157372_106167251 | 289 |
| 92 | 3300025909 | Ga0207705_10234333 | Ga0207705_102343331 | 289 |
| 93 | 3300049575 | Ga0501039_0297929 | Ga0501039_0297929_105_1010 | 289 |
| 94 | 3300053085 | Ga0495619_0151792 | Ga0495619_0151792_659_1588 | 289 |
| 95 | 3300005437 | Ga0070710_10149188 | Ga0070710_101491881 | 290 |
| 96 | 3300031240 | Ga0265320_10033635 | Ga0265320_100336354 | 290 |
| 97 | 3300038705 | Ga0237819_05426 | Ga0237819_05426_869_1822 | 290 |
| 98 | iso_pu_bacteria | 3006969106 | 3006972819 | 290 |
| 99 | 3300025284 | Ga0209130_1000024 | Ga0209130_1000024256 | 291 |
| 100 | 3300025302 | Ga0207426_1009016 | Ga0207426_10090162 | 291 |
| 101 | 3300039437 | Ga0436365_0635250 | Ga0436365_0635250_1377_2321 | 291 |
| 102 | 3300005262 | Ga0065165_1000014 | Ga0065165_100001417 | 292 |
| 103 | 3300031344 | Ga0265316_10094735 | Ga0265316_100947351 | 292 |
| 104 | iso_pu_bacteria | 2522572158 | 2523103896 | 292 |
| 105 | iso_pu_bacteria | 2597490356 | 2599106008 | 292 |
| 106 | iso_pu_bacteria | 2846952575 | 2846955799 | 292 |
| 107 | iso_pu_bacteria | 2848858292 | 2848862097 | 292 |
| 108 | 3300007788 | Ga0099795_10034848 | Ga0099795_100348482 | 293 |
| 109 | 3300049568 | Ga0501031_0007326 | Ga0501031_0007326_2636_3535 | 293 |
| 110 | 3300049569 | Ga0501032_0019344 | Ga0501032_0019344_1378_2277 | 293 |
| 111 | 3300049572 | Ga0501036_0002175 | Ga0501036_0002175_4449_5348 | 293 |
| 112 | 3300049574 | Ga0501038_0016429 | Ga0501038_0016429_1795_2694 | 293 |
| 113 | 3300049579 | Ga0501043_0044249 | Ga0501043_0044249_1986_2885 | 293 |
| 114 | 3300049581 | Ga0501047_0037832 | Ga0501047_0037832_1280_2179 | 293 |
| 115 | 3300049586 | Ga0501070_0031370 | Ga0501070_0031370_511_1410 | 293 |
| 116 | 3300049822 | Ga0501035_0045489 | Ga0501035_0045489_882_1781 | 293 |
| 117 | 3300049823 | Ga0501044_0058340 | Ga0501044_0058340_1201_2100 | 293 |
| 118 | 3300049588 | Ga0501072_0001393 | Ga0501072_0001393_15892_16836 | 294 |
| 119 | 3300049588 | Ga0501072_0006889 | Ga0501072_0006889_2891_3775 | 294 |
| 120 | 3300049742 | Ga0501080_0257257 | Ga0501080_0257257_349_1233 | 294 |
| 121 | 3300049744 | Ga0501083_0018751 | Ga0501083_0018751_1916_2800 | 294 |
| 122 | 3300049744 | Ga0501083_0229720 | Ga0501083_0229720_51_995 | 294 |
| 123 | 3300054114 | Ga0501084_0011994 | Ga0501084_0011994_4826_5710 | 294 |
| 124 | 3300054114 | Ga0501084_0145887 | Ga0501084_0145887_631_1575 | 294 |
| 125 | 3300060353 | Ga0501082_0030617 | Ga0501082_0030617_2266_3150 | 294 |
| 126 | 3300060353 | Ga0501082_0041644 | Ga0501082_0041644_2204_3148 | 294 |
| 127 | 3300006844 | Ga0075428_100260860 | Ga0075428_1002608602 | 295 |
| 128 | 3300009147 | Ga0114129_10544150 | Ga0114129_105441501 | 295 |
| 129 | 3300042436 | Ga0439435_0001103 | Ga0439435_0001103_930_1868 | 295 |
| 130 | 3300046557 | Ga0495622_0042825 | Ga0495622_0042825_956_1843 | 295 |
| 131 | 3300048918 | Ga0496115_0277283 | Ga0496115_0277283_458_1345 | 295 |
| 132 | 3300050493 | nmdc:mga0k408_139321_c1 | nmdc:mga0k408_139321_c1_362_1300 | 295 |
| 133 | 3300053096 | Ga0500641_0034326 | Ga0500641_0034326_458_1408 | 295 |
| 134 | 3300009147 | Ga0114129_10065348 | Ga0114129_100653482 | 296 |
| 135 | 3300028800 | Ga0265338_10015220 | Ga0265338_100152208 | 296 |
| 136 | 3300031249 | Ga0265339_10000060 | Ga0265339_1000006056 | 296 |
| 137 | 3300031595 | Ga0265313_10000094 | Ga0265313_1000009452 | 296 |
| 138 | 3300050491 | nmdc:mga00v17_178781_c1 | nmdc:mga00v17_178781_c1_55_966 | 296 |
| 139 | iso_pu_bacteria | 2897803580 | 2897805244 | 296 |
| 140 | iso_pu_bacteria | 2904578770 | 2904580193 | 296 |
| 141 | iso_pu_bacteria | 2919119836 | 2919120134 | 296 |
| 142 | 3300025294 | Ga0209025_1001580 | Ga0209025_10015805 | 297 |
| 143 | 3300048907 | Ga0496104_0000369 | Ga0496104_0000369_11374_12333 | 297 |
| 144 | 3300048908 | Ga0496105_0127425 | Ga0496105_0127425_742_1701 | 297 |
| 145 | 3300048913 | Ga0496110_0402752 | Ga0496110_0402752_198_1157 | 297 |
| 146 | 3300048918 | Ga0496115_0216475 | Ga0496115_0216475_466_1425 | 297 |
| 147 | 3300053085 | Ga0495619_0020949 | Ga0495619_0020949_835_1791 | 297 |
| 148 | 3300031595 | Ga0265313_10000062 | Ga0265313_1000006285 | 298 |
| 149 | 3300048088 | Ga0495602_0034361 | Ga0495602_0034361_273_1193 | 298 |
| 150 | 3300049571 | Ga0501034_0184646 | Ga0501034_0184646_169_1095 | 298 |
| 151 | 3300049744 | Ga0501083_0034375 | Ga0501083_0034375_2076_3002 | 298 |
| 152 | 3300049823 | Ga0501044_0123557 | Ga0501044_0123557_878_1855 | 298 |
| 153 | 3300049824 | Ga0501045_0349566 | Ga0501045_0349566_15_956 | 298 |
| 154 | 3300061734 | Ga0530510_0258989 | Ga0530510_0258989_202_1161 | 298 |
| 155 | 3300005338 | Ga0068868_100054268 | Ga0068868_1000542684 | 299 |
| 156 | 3300005339 | Ga0070660_100062622 | Ga0070660_1000626223 | 299 |
| 157 | 3300005339 | Ga0070660_100269482 | Ga0070660_1002694821 | 299 |
| 158 | 3300005366 | Ga0070659_100020949 | Ga0070659_1000209495 | 299 |
| 159 | 3300005539 | Ga0068853_100028237 | Ga0068853_1000282373 | 299 |
| 160 | 3300005547 | Ga0070693_100138542 | Ga0070693_1001385423 | 299 |
| 161 | 3300005564 | Ga0070664_100032151 | Ga0070664_1000321513 | 299 |
| 162 | 3300005578 | Ga0068854_100035041 | Ga0068854_1000350411 | 299 |
| 163 | 3300005614 | Ga0068856_100017487 | Ga0068856_1000174872 | 299 |
| 164 | 3300005616 | Ga0068852_100019264 | Ga0068852_1000192645 | 299 |
| 165 | 3300005616 | Ga0068852_100194141 | Ga0068852_1001941413 | 299 |
| 166 | 3300009551 | Ga0105238_10026734 | Ga0105238_100267345 | 299 |
| 167 | 3300010375 | Ga0105239_10079246 | Ga0105239_100792465 | 299 |
| 168 | 3300013104 | Ga0157370_10218409 | Ga0157370_102184093 | 299 |
| 169 | 3300013307 | Ga0157372_10056762 | Ga0157372_100567625 | 299 |
| 170 | 3300025321 | Ga0207656_10067678 | Ga0207656_100676781 | 299 |
| 171 | 3300025909 | Ga0207705_10089421 | Ga0207705_100894213 | 299 |
| 172 | 3300025919 | Ga0207657_10023890 | Ga0207657_100238905 | 299 |
| 173 | 3300025919 | Ga0207657_10183571 | Ga0207657_101835712 | 299 |
| 174 | 3300025938 | Ga0207704_10292830 | Ga0207704_102928302 | 299 |
| 175 | 3300025940 | Ga0207691_10073771 | Ga0207691_100737713 | 299 |
| 176 | 3300025945 | Ga0207679_10107222 | Ga0207679_101072223 | 299 |
| 177 | 3300025981 | Ga0207640_10120452 | Ga0207640_101204522 | 299 |
| 178 | 3300026023 | Ga0207677_10083680 | Ga0207677_100836803 | 299 |
| 179 | 3300026041 | Ga0207639_10109120 | Ga0207639_101091203 | 299 |
| 180 | 3300026078 | Ga0207702_10160682 | Ga0207702_101606823 | 299 |
| 181 | 3300026089 | Ga0207648_10014268 | Ga0207648_100142687 | 299 |
| 182 | 3300026121 | Ga0207683_10174021 | Ga0207683_101740212 | 299 |
| 183 | 3300035691 | Ga0373931_0071494 | Ga0373931_0071494_860_1759 | 299 |
| 184 | 3300048922 | Ga0496119_0169844 | Ga0496119_0169844_190_1089 | 299 |
| 185 | 3300048925 | Ga0496122_0109323 | Ga0496122_0109323_767_1669 | 299 |
| 186 | 3300049568 | Ga0501031_0093088 | Ga0501031_0093088_91_1017 | 299 |
| 187 | 3300049578 | Ga0501042_0036194 | Ga0501042_0036194_755_1681 | 299 |
| 188 | 3300049579 | Ga0501043_0037121 | Ga0501043_0037121_140_1078 | 299 |
| 189 | 3300049580 | Ga0501046_0056941 | Ga0501046_0056941_1493_2419 | 299 |
| 190 | 3300049582 | Ga0501048_0023928 | Ga0501048_0023928_500_1426 | 299 |
| 191 | 3300049587 | Ga0501071_0134955 | Ga0501071_0134955_54_980 | 299 |
| 192 | 3300049741 | Ga0501079_0398427 | Ga0501079_0398427_73_999 | 299 |
| 193 | 3300049743 | Ga0501081_0110950 | Ga0501081_0110950_282_1208 | 299 |
| 194 | 3300054114 | Ga0501084_0146877 | Ga0501084_0146877_688_1614 | 299 |
| 195 | 3300060353 | Ga0501082_0091880 | Ga0501082_0091880_343_1269 | 299 |
| 196 | 3300003771 | Ga0055526_1007988 | Ga0055526_10079883 | 300 |
| 197 | 3300003775 | Ga0055524_1000283 | Ga0055524_100028324 | 300 |
| 198 | 3300005434 | Ga0070709_10235803 | Ga0070709_102358031 | 300 |
| 199 | 3300005435 | Ga0070714_100029246 | Ga0070714_1000292465 | 300 |
| 200 | 3300005436 | Ga0070713_100061827 | Ga0070713_1000618274 | 300 |
| 201 | 3300005437 | Ga0070710_10007515 | Ga0070710_100075153 | 300 |
| 202 | 3300006163 | Ga0070715_10005745 | Ga0070715_100057455 | 300 |
| 203 | 3300006173 | Ga0070716_100004357 | Ga0070716_1000043576 | 300 |
| 204 | 3300009147 | Ga0114129_10668071 | Ga0114129_106680711 | 300 |
| 205 | 3300025273 | Ga0209673_1024651 | Ga0209673_10246512 | 300 |
| 206 | 3300025291 | Ga0209675_1001001 | Ga0209675_100100114 | 300 |
| 207 | 3300025295 | Ga0209564_1000015 | Ga0209564_1000015211 | 300 |
| 208 | 3300025299 | Ga0209256_1000294 | Ga0209256_100029483 | 300 |
| 209 | 3300025915 | Ga0207693_10005351 | Ga0207693_100053511 | 300 |
| 210 | 3300025928 | Ga0207700_10043684 | Ga0207700_100436841 | 300 |
| 211 | 3300025939 | Ga0207665_10002162 | Ga0207665_100021629 | 300 |
| 212 | 3300039437 | Ga0436365_1568947 | Ga0436365_1568947_1015_1965 | 300 |
| 213 | 3300048915 | Ga0496112_0494551 | Ga0496112_0494551_97_1059 | 300 |
| 214 | 3300049571 | Ga0501034_0198380 | Ga0501034_0198380_946_1872 | 300 |
| 215 | 3300050492 | nmdc:mga0yw44_80427_c1 | nmdc:mga0yw44_80427_c1_1107_2027 | 300 |
| 216 | 3300050507 | nmdc:mga05p37_619897_c1 | nmdc:mga05p37_619897_c1_96_1058 | 300 |
| 217 | iso_pu_bacteria | 2765235802 | 2765468070 | 300 |
| 218 | iso_pu_bacteria | 2839993093 | 2839993155 | 300 |
| 219 | 3300005618 | Ga0068864_100207110 | Ga0068864_1002071102 | 301 |
| 220 | 3300026095 | Ga0207676_10216632 | Ga0207676_102166322 | 301 |
| 221 | 3300048905 | Ga0496102_0142489 | Ga0496102_0142489_350_1312 | 301 |
| 222 | iso_pu_bacteria | 2919450847 | 2919452165 | 301 |
| 223 | iso_pu_bacteria | 8001845381 | 8001845844 | 301 |
| 224 | 3300006028 | Ga0070717_10016595 | Ga0070717_100165954 | 302 |
| 225 | 3300025905 | Ga0207685_10017806 | Ga0207685_100178062 | 302 |
| 226 | 3300025906 | Ga0207699_10128544 | Ga0207699_101285442 | 302 |
| 227 | 3300031241 | Ga0265325_10001726 | Ga0265325_100017265 | 302 |
| 228 | 3300032126 | Ga0307415_100317307 | Ga0307415_1003173072 | 302 |
| 229 | 3300048922 | Ga0496119_0000806 | Ga0496119_0000806_40885_41850 | 302 |
| 230 | 3300048925 | Ga0496122_0006697 | Ga0496122_0006697_10_975 | 302 |
| 231 | 3300048926 | Ga0496123_0001298 | Ga0496123_0001298_20099_21064 | 302 |
| 232 | 3300048928 | Ga0496125_0086005 | Ga0496125_0086005_413_1360 | 302 |
| 233 | 3300048929 | Ga0496126_0114539 | Ga0496126_0114539_457_1404 | 302 |
| 234 | 3300049572 | Ga0501036_0226150 | Ga0501036_0226150_440_1351 | 302 |
| 235 | 3300049577 | Ga0501041_0005072 | Ga0501041_0005072_5545_6456 | 302 |
| 236 | 3300049578 | Ga0501042_0167717 | Ga0501042_0167717_143_1054 | 302 |
| 237 | 3300049579 | Ga0501043_0025732 | Ga0501043_0025732_3236_4147 | 302 |
| 238 | 3300049580 | Ga0501046_0147491 | Ga0501046_0147491_41_952 | 302 |
| 239 | 3300049589 | Ga0501073_0132356 | Ga0501073_0132356_298_1209 | 302 |
| 240 | 3300049590 | Ga0501074_0034107 | Ga0501074_0034107_601_1512 | 302 |
| 241 | 3300049591 | Ga0501075_0001104 | Ga0501075_0001104_10640_11551 | 302 |
| 242 | 3300049592 | Ga0501076_0004052 | Ga0501076_0004052_6766_7677 | 302 |
| 243 | 3300049592 | Ga0501076_0260478 | Ga0501076_0260478_103_1059 | 302 |
| 244 | 3300049593 | Ga0501077_0020854 | Ga0501077_0020854_1159_2070 | 302 |
| 245 | 3300049741 | Ga0501079_0003253 | Ga0501079_0003253_471_1382 | 302 |
| 246 | 3300049743 | Ga0501081_0001170 | Ga0501081_0001170_1617_2528 | 302 |
| 247 | 3300049824 | Ga0501045_0028996 | Ga0501045_0028996_2459_3370 | 302 |
| 248 | 3300053104 | Ga0500556_0000160 | Ga0500556_0000160_24875_25840 | 302 |
| 249 | 3300053730 | Ga0500645_006585 | Ga0500645_006585_1363_2274 | 302 |
| 250 | 3300054114 | Ga0501084_0019517 | Ga0501084_0019517_3633_4544 | 302 |
| 251 | 3300060353 | Ga0501082_0004262 | Ga0501082_0004262_7967_8878 | 302 |
| 252 | 3300061734 | Ga0530510_0104487 | Ga0530510_0104487_673_1584 | 302 |
| 253 | iso_pu_bacteria | 2508501114 | 2509079120 | 302 |
| 254 | iso_pu_bacteria | 2523231067 | 2523467776 | 302 |
| 255 | iso_pu_bacteria | 2738543031 | 2739349226 | 302 |
| 256 | iso_pu_bacteria | 2773857925 | 2774869260 | 302 |
| 257 | iso_pu_bacteria | 2775506901 | 2776257901 | 302 |
| 258 | iso_pu_bacteria | 2835312727 | 2835317379 | 302 |
| 259 | iso_pu_bacteria | 2882456835 | 2882457366 | 302 |
| 260 | 3300049580 | Ga0501046_0348308 | Ga0501046_0348308_66_1031 | 303 |
| 261 | 3300049589 | Ga0501073_0175559 | Ga0501073_0175559_121_1080 | 303 |
| 262 | 3300049741 | Ga0501079_0263230 | Ga0501079_0263230_304_1263 | 303 |
| 263 | 3300049742 | Ga0501080_0102558 | Ga0501080_0102558_1243_2175 | 303 |
| 264 | 3300049744 | Ga0501083_0043563 | Ga0501083_0043563_2072_3001 | 303 |
| 265 | iso_pu_bacteria | 2671180139 | 2671692230 | 303 |
| 266 | iso_pu_bacteria | 2828305725 | 2828306397 | 303 |
| 267 | iso_pu_bacteria | 2842694124 | 2842697490 | 303 |
| 268 | iso_pu_bacteria | 2917554339 | 2917554503 | 303 |
| 269 | iso_pu_bacteria | 8002060224 | 8002062339 | 303 |
| 270 | 3300020070 | Ga0206356_10344220 | Ga0206356_103442202 | 304 |
| 271 | 3300049578 | Ga0501042_0139598 | Ga0501042_0139598_466_1425 | 304 |
| 272 | 3300049584 | Ga0501068_0141973 | Ga0501068_0141973_118_1077 | 304 |
| 273 | 3300049591 | Ga0501075_0061191 | Ga0501075_0061191_570_1529 | 304 |
| 274 | 3300049592 | Ga0501076_0339428 | Ga0501076_0339428_94_1053 | 304 |
| 275 | 3300005618 | Ga0068864_100037787 | Ga0068864_1000377872 | 305 |
| 276 | 3300013308 | Ga0157375_10524331 | Ga0157375_105243312 | 305 |
| 277 | 3300026095 | Ga0207676_10113020 | Ga0207676_101130203 | 305 |
| 278 | 3300031239 | Ga0265328_10009278 | Ga0265328_100092781 | 305 |
| 279 | 3300048911 | Ga0496108_0420685 | Ga0496108_0420685_17_949 | 305 |
| 280 | 3300049671 | Ga0501238_004132 | Ga0501238_004132_474_1400 | 305 |
| 281 | iso_pu_bacteria | 2513237087 | 2513590524 | 305 |
| 282 | 3300045051 | Ga0451576_0558837 | Ga0451576_0558837_178_1101 | 306 |
| 283 | 3300049744 | Ga0501083_0282335 | Ga0501083_0282335_11_946 | 306 |
| 284 | 3300005435 | Ga0070714_100272207 | Ga0070714_1002722072 | 307 |
| 285 | 3300005536 | Ga0070697_100374000 | Ga0070697_1003740001 | 307 |
| 286 | 3300006175 | Ga0070712_100000882 | Ga0070712_10000088214 | 307 |
| 287 | 3300006175 | Ga0070712_100230069 | Ga0070712_1002300691 | 307 |
| 288 | 3300006846 | Ga0075430_100062646 | Ga0075430_1000626462 | 307 |
| 289 | 3300025915 | Ga0207693_10001021 | Ga0207693_1000102114 | 307 |
| 290 | 3300025915 | Ga0207693_10121812 | Ga0207693_101218122 | 307 |
| 291 | 3300025929 | Ga0207664_10164519 | Ga0207664_101645192 | 307 |
| 292 | 3300035089 | Ga0373944_0000944 | Ga0373944_0000944_5871_6797 | 307 |
| 293 | 3300035113 | Ga0373936_0005000 | Ga0373936_0005000_1084_2010 | 307 |
| 294 | 3300035116 | Ga0373945_0041141 | Ga0373945_0041141_441_1367 | 307 |
| 295 | 3300035170 | Ga0373943_0000444 | Ga0373943_0000444_15420_16346 | 307 |
| 296 | 3300035171 | Ga0373946_0000365 | Ga0373946_0000365_358_1284 | 307 |
| 297 | 3300035725 | Ga0373947_0001394 | Ga0373947_0001394_12605_13531 | 307 |
| 298 | 3300037068 | Ga0373925_0004315 | Ga0373925_0004315_8689_9615 | 307 |
| 299 | 3300046476 | Ga0495662_0097299 | Ga0495662_0097299_197_1123 | 307 |
| 300 | 3300046477 | Ga0495664_0015521 | Ga0495664_0015521_1864_2790 | 307 |
| 301 | 3300046526 | Ga0495666_0009741 | Ga0495666_0009741_1286_2212 | 307 |
| 302 | 3300046531 | Ga0495665_0005950 | Ga0495665_0005950_2478_3404 | 307 |
| 303 | 3300046531 | Ga0495665_0028928 | Ga0495665_0028928_983_1909 | 307 |
| 304 | 3300046533 | Ga0495640_0006778 | Ga0495640_0006778_29_955 | 307 |
| 305 | 3300046543 | Ga0495645_0006252 | Ga0495645_0006252_3473_4399 | 307 |
| 306 | 3300046642 | Ga0495634_0043139 | Ga0495634_0043139_1669_2595 | 307 |
| 307 | 3300046663 | Ga0495635_0005756 | Ga0495635_0005756_4719_5645 | 307 |
| 308 | 3300046681 | Ga0495647_0014368 | Ga0495647_0014368_1011_1937 | 307 |
| 309 | 3300046683 | Ga0495658_0064523 | Ga0495658_0064523_409_1338 | 307 |
| 310 | 3300046690 | Ga0495624_0001159 | Ga0495624_0001159_14888_15814 | 307 |
| 311 | 3300047315 | Ga0495581_0003675 | Ga0495581_0003675_7878_8804 | 307 |
| 312 | 3300047317 | Ga0495604_0119476 | Ga0495604_0119476_448_1374 | 307 |
| 313 | 3300047319 | Ga0495674_0004105 | Ga0495674_0004105_5047_5973 | 307 |
| 314 | 3300047321 | Ga0495676_0012199 | Ga0495676_0012199_664_1590 | 307 |
| 315 | 3300047322 | Ga0495680_0188858 | Ga0495680_0188858_299_1225 | 307 |
| 316 | 3300047471 | Ga0495684_0007486 | Ga0495684_0007486_29_955 | 307 |
| 317 | 3300047673 | Ga0495593_0003777 | Ga0495593_0003777_3485_4411 | 307 |
| 318 | 3300050513 | nmdc:mga0rr50_418387_c1 | nmdc:mga0rr50_418387_c1_104_1054 | 307 |
| 319 | 3300053077 | Ga0495601_0006610 | Ga0495601_0006610_528_1454 | 307 |
| 320 | 3300053078 | Ga0495612_0000893 | Ga0495612_0000893_1515_2441 | 307 |
| 321 | 3300053085 | Ga0495619_0016705 | Ga0495619_0016705_138_1064 | 307 |
| 322 | 3300029957 | Ga0265324_10080010 | Ga0265324_100800101 | 308 |
| 323 | 3300031235 | Ga0265330_10071453 | Ga0265330_100714531 | 308 |
| 324 | 3300031249 | Ga0265339_10073404 | Ga0265339_100734042 | 308 |
| 325 | 3300031344 | Ga0265316_10307722 | Ga0265316_103077221 | 308 |
| 326 | 3300035724 | Ga0373933_0269259 | Ga0373933_0269259_29_958 | 308 |
| 327 | 3300005336 | Ga0070680_100087772 | Ga0070680_1000877721 | 309 |
| 328 | 3300005435 | Ga0070714_100309079 | Ga0070714_1003090791 | 309 |
| 329 | 3300005615 | Ga0070702_100082157 | Ga0070702_1000821573 | 309 |
| 330 | 3300005617 | Ga0068859_100186879 | Ga0068859_1001868792 | 309 |
| 331 | 3300005618 | Ga0068864_100265780 | Ga0068864_1002657801 | 309 |
| 332 | 3300005937 | Ga0081455_10009260 | Ga0081455_100092603 | 309 |
| 333 | 3300006048 | Ga0075363_100131748 | Ga0075363_1001317481 | 309 |
| 334 | 3300006175 | Ga0070712_100015635 | Ga0070712_1000156353 | 309 |
| 335 | 3300006186 | Ga0075369_10021372 | Ga0075369_100213723 | 309 |
| 336 | 3300006846 | Ga0075430_100002427 | Ga0075430_10000242711 | 309 |
| 337 | 3300006914 | Ga0075436_100069432 | Ga0075436_1000694322 | 309 |
| 338 | 3300006931 | Ga0097620_100186881 | Ga0097620_1001868812 | 309 |
| 339 | 3300009094 | Ga0111539_10234105 | Ga0111539_102341052 | 309 |
| 340 | 3300009174 | Ga0105241_10078172 | Ga0105241_100781722 | 309 |
| 341 | 3300013100 | Ga0157373_10078078 | Ga0157373_100780783 | 309 |
| 342 | 3300021358 | Ga0213873_10021273 | Ga0213873_100212732 | 309 |
| 343 | 3300021384 | Ga0213876_10124907 | Ga0213876_101249072 | 309 |
| 344 | 3300025315 | Ga0207697_10138190 | Ga0207697_101381901 | 309 |
| 345 | 3300025906 | Ga0207699_10036471 | Ga0207699_100364714 | 309 |
| 346 | 3300025915 | Ga0207693_10010389 | Ga0207693_100103893 | 309 |
| 347 | 3300025915 | Ga0207693_10063266 | Ga0207693_100632662 | 309 |
| 348 | 3300025916 | Ga0207663_10036958 | Ga0207663_100369582 | 309 |
| 349 | 3300025917 | Ga0207660_10329556 | Ga0207660_103295562 | 309 |
| 350 | 3300025929 | Ga0207664_10041788 | Ga0207664_100417883 | 309 |
| 351 | 3300025940 | Ga0207691_10196142 | Ga0207691_101961422 | 309 |
| 352 | 3300025949 | Ga0207667_10277171 | Ga0207667_102771712 | 309 |
| 353 | 3300026041 | Ga0207639_10101941 | Ga0207639_101019412 | 309 |
| 354 | 3300031239 | Ga0265328_10002876 | Ga0265328_100028764 | 309 |
| 355 | 3300031241 | Ga0265325_10000162 | Ga0265325_1000016231 | 309 |
| 356 | 3300031241 | Ga0265325_10023551 | Ga0265325_100235513 | 309 |
| 357 | 3300031344 | Ga0265316_10195089 | Ga0265316_101950892 | 309 |
| 358 | 3300031595 | Ga0265313_10007672 | Ga0265313_100076722 | 309 |
| 359 | 3300031711 | Ga0265314_10008333 | Ga0265314_100083338 | 309 |
| 360 | 3300035089 | Ga0373944_0014925 | Ga0373944_0014925_158_1087 | 309 |
| 361 | 3300035111 | Ga0373923_0079010 | Ga0373923_0079010_313_1242 | 309 |
| 362 | 3300035118 | Ga0373954_0044090 | Ga0373954_0044090_480_1409 | 309 |
| 363 | 3300035121 | Ga0373960_0047402 | Ga0373960_0047402_85_1017 | 309 |
| 364 | 3300035170 | Ga0373943_0088206 | Ga0373943_0088206_57_986 | 309 |
| 365 | 3300035172 | Ga0373955_0075141 | Ga0373955_0075141_840_1769 | 309 |
| 366 | 3300035691 | Ga0373931_0013544 | Ga0373931_0013544_922_1854 | 309 |
| 367 | 3300035692 | Ga0373935_0349185 | Ga0373935_0349185_50_982 | 309 |
| 368 | 3300036401 | Ga0373937_0031420 | Ga0373937_0031420_2673_3602 | 309 |
| 369 | 3300037068 | Ga0373925_0250100 | Ga0373925_0250100_251_1183 | 309 |
| 370 | 3300037068 | Ga0373925_0295252 | Ga0373925_0295252_308_1240 | 309 |
| 371 | 3300037312 | Ga0395899_0007468 | Ga0395899_0007468_6656_7588 | 309 |
| 372 | 3300037418 | Ga0395900_0005900 | Ga0395900_0005900_6650_7582 | 309 |
| 373 | 3300037418 | Ga0395900_0087539 | Ga0395900_0087539_107_1039 | 309 |
| 374 | 3300037418 | Ga0395900_0110828 | Ga0395900_0110828_18_950 | 309 |
| 375 | 3300037466 | Ga0395898_0002812 | Ga0395898_0002812_7522_8454 | 309 |
| 376 | 3300037466 | Ga0395898_0009212 | Ga0395898_0009212_1273_2205 | 309 |
| 377 | 3300038443 | Ga0395901_0013723 | Ga0395901_0013723_1293_2225 | 309 |
| 378 | 3300038443 | Ga0395901_0080302 | Ga0395901_0080302_279_1211 | 309 |
| 379 | 3300038443 | Ga0395901_0355573 | Ga0395901_0355573_216_1148 | 309 |
| 380 | 3300039437 | Ga0436365_0344984 | Ga0436365_0344984_12429_13364 | 309 |
| 381 | 3300039450 | Ga0436363_0335613 | Ga0436363_0335613_334_1269 | 309 |
| 382 | 3300039453 | Ga0436362_0983170 | Ga0436362_0983170_168_1103 | 309 |
| 383 | 3300044694 | Ga0466963_0004838 | Ga0466963_0004838_5195_6127 | 309 |
| 384 | 3300044719 | Ga0466971_0059504 | Ga0466971_0059504_241_1173 | 309 |
| 385 | 3300044842 | Ga0466957_0046112 | Ga0466957_0046112_66_998 | 309 |
| 386 | 3300045836 | Ga0466958_0207560 | Ga0466958_0207560_28_960 | 309 |
| 387 | 3300045976 | Ga0466967_0000600 | Ga0466967_0000600_361_1293 | 309 |
| 388 | 3300045976 | Ga0466967_0605673 | Ga0466967_0605673_112_1044 | 309 |
| 389 | 3300046462 | Ga0495651_0003936 | Ga0495651_0003936_4065_4994 | 309 |
| 390 | 3300046463 | Ga0495653_0016165 | Ga0495653_0016165_1412_2341 | 309 |
| 391 | 3300046516 | Ga0495628_0008857 | Ga0495628_0008857_2266_3195 | 309 |
| 392 | 3300046517 | Ga0495630_0051618 | Ga0495630_0051618_1731_2663 | 309 |
| 393 | 3300046529 | Ga0495652_0002263 | Ga0495652_0002263_1699_2628 | 309 |
| 394 | 3300046535 | Ga0495586_0166346 | Ga0495586_0166346_177_1109 | 309 |
| 395 | 3300046536 | Ga0495587_0006801 | Ga0495587_0006801_3669_4598 | 309 |
| 396 | 3300046543 | Ga0495645_0013793 | Ga0495645_0013793_197_1126 | 309 |
| 397 | 3300046559 | Ga0495667_0003673 | Ga0495667_0003673_7460_8389 | 309 |
| 398 | 3300046663 | Ga0495635_0062865 | Ga0495635_0062865_71_1000 | 309 |
| 399 | 3300046678 | Ga0495599_0001552 | Ga0495599_0001552_10497_11426 | 309 |
| 400 | 3300046681 | Ga0495647_0047949 | Ga0495647_0047949_503_1435 | 309 |
| 401 | 3300046683 | Ga0495658_0008108 | Ga0495658_0008108_4080_5012 | 309 |
| 402 | 3300046809 | Ga0495600_0005624 | Ga0495600_0005624_5490_6419 | 309 |
| 403 | 3300047317 | Ga0495604_0060160 | Ga0495604_0060160_154_1083 | 309 |
| 404 | 3300047444 | Ga0495675_0017849 | Ga0495675_0017849_2020_2949 | 309 |
| 405 | 3300048088 | Ga0495602_0005586 | Ga0495602_0005586_2841_3770 | 309 |
| 406 | 3300048903 | Ga0496100_0003561 | Ga0496100_0003561_1483_2433 | 309 |
| 407 | 3300048903 | Ga0496100_0020821 | Ga0496100_0020821_2157_3089 | 309 |
| 408 | 3300048904 | Ga0496101_0002312 | Ga0496101_0002312_469_1419 | 309 |
| 409 | 3300048905 | Ga0496102_0011352 | Ga0496102_0011352_4863_5813 | 309 |
| 410 | 3300048906 | Ga0496103_0181616 | Ga0496103_0181616_67_1017 | 309 |
| 411 | 3300048907 | Ga0496104_0003051 | Ga0496104_0003051_10215_11165 | 309 |
| 412 | 3300048907 | Ga0496104_0029302 | Ga0496104_0029302_4095_5045 | 309 |
| 413 | 3300048907 | Ga0496104_0041805 | Ga0496104_0041805_2737_3669 | 309 |
| 414 | 3300048909 | Ga0496106_0004523 | Ga0496106_0004523_1157_2107 | 309 |
| 415 | 3300048910 | Ga0496107_0001981 | Ga0496107_0001981_1627_2577 | 309 |
| 416 | 3300048911 | Ga0496108_0008671 | Ga0496108_0008671_1238_2188 | 309 |
| 417 | 3300048911 | Ga0496108_0109164 | Ga0496108_0109164_479_1411 | 309 |
| 418 | 3300048911 | Ga0496108_0263427 | Ga0496108_0263427_258_1190 | 309 |
| 419 | 3300048912 | Ga0496109_0108961 | Ga0496109_0108961_1429_2379 | 309 |
| 420 | 3300048912 | Ga0496109_0260989 | Ga0496109_0260989_648_1580 | 309 |
| 421 | 3300048913 | Ga0496110_0002763 | Ga0496110_0002763_2035_2985 | 309 |
| 422 | 3300048913 | Ga0496110_0004859 | Ga0496110_0004859_3826_4776 | 309 |
| 423 | 3300048914 | Ga0496111_0022767 | Ga0496111_0022767_1750_2700 | 309 |
| 424 | 3300048915 | Ga0496112_0006926 | Ga0496112_0006926_7823_8773 | 309 |
| 425 | 3300048915 | Ga0496112_0060283 | Ga0496112_0060283_832_1782 | 309 |
| 426 | 3300048916 | Ga0496113_0007716 | Ga0496113_0007716_4720_5670 | 309 |
| 427 | 3300048917 | Ga0496114_0070175 | Ga0496114_0070175_1393_2325 | 309 |
| 428 | 3300048918 | Ga0496115_0021027 | Ga0496115_0021027_1087_2037 | 309 |
| 429 | 3300048918 | Ga0496115_0107355 | Ga0496115_0107355_118_1050 | 309 |
| 430 | 3300049568 | Ga0501031_0230741 | Ga0501031_0230741_260_1192 | 309 |
| 431 | 3300049571 | Ga0501034_0253926 | Ga0501034_0253926_677_1609 | 309 |
| 432 | 3300049583 | Ga0501067_0066324 | Ga0501067_0066324_930_1880 | 309 |
| 433 | 3300049587 | Ga0501071_0198070 | Ga0501071_0198070_385_1317 | 309 |
| 434 | 3300050492 | nmdc:mga0yw44_97207_c1 | nmdc:mga0yw44_97207_c1_617_1549 | 309 |
| 435 | 3300050494 | nmdc:mga06z11_36850_c1 | nmdc:mga06z11_36850_c1_342_1277 | 309 |
| 436 | 3300050496 | nmdc:mga07m45_75485_c1 | nmdc:mga07m45_75485_c1_126_1061 | 309 |
| 437 | 3300050509 | nmdc:mga0qj67_62_c1 | nmdc:mga0qj67_62_c1_42085_43017 | 309 |
| 438 | 3300050510 | nmdc:mga06r32_169976_c1 | nmdc:mga06r32_169976_c1_13_945 | 309 |
| 439 | 3300050511 | nmdc:mga08y16_174418_c1 | nmdc:mga08y16_174418_c1_101_1033 | 309 |
| 440 | 3300050512 | nmdc:mga0n895_58287_c1 | nmdc:mga0n895_58287_c1_1225_2157 | 309 |
| 441 | 3300050515 | nmdc:mga0a205_15283_c1 | nmdc:mga0a205_15283_c1_3504_4436 | 309 |
| 442 | 3300053077 | Ga0495601_0001359 | Ga0495601_0001359_5480_6409 | 309 |
| 443 | 3300053078 | Ga0495612_0000238 | Ga0495612_0000238_4902_5831 | 309 |
| 444 | 3300053084 | Ga0495595_0000795 | Ga0495595_0000795_4653_5582 | 309 |
| 445 | 3300053084 | Ga0495595_0042549 | Ga0495595_0042549_505_1437 | 309 |
| 446 | 3300053085 | Ga0495619_0003766 | Ga0495619_0003766_4127_5056 | 309 |
| 447 | 3300053120 | Ga0500597_030665 | Ga0500597_030665_980_1915 | 309 |
| 448 | 3300061719 | Ga0466962_0012613 | Ga0466962_0012613_2977_3909 | 309 |
| 449 | iso_pu_bacteria | 2818991467 | 2819719939 | 309 |
| 450 | iso_pu_bacteria | 2917699015 | 2917704148 | 309 |
| 451 | 3300005331 | Ga0070670_100015801 | Ga0070670_1000158013 | 310 |
| 452 | 3300005344 | Ga0070661_100206365 | Ga0070661_1002063651 | 310 |
| 453 | 3300005354 | Ga0070675_100089330 | Ga0070675_1000893302 | 310 |
| 454 | 3300005355 | Ga0070671_100000776 | Ga0070671_1000007768 | 310 |
| 455 | 3300005364 | Ga0070673_100005013 | Ga0070673_1000050135 | 310 |
| 456 | 3300005435 | Ga0070714_100033778 | Ga0070714_1000337784 | 310 |
| 457 | 3300005437 | Ga0070710_10136370 | Ga0070710_101363702 | 310 |
| 458 | 3300005439 | Ga0070711_100067116 | Ga0070711_1000671162 | 310 |
| 459 | 3300005466 | Ga0070685_10142373 | Ga0070685_101423732 | 310 |
| 460 | 3300005530 | Ga0070679_100082513 | Ga0070679_1000825133 | 310 |
| 461 | 3300005548 | Ga0070665_100018913 | Ga0070665_1000189134 | 310 |
| 462 | 3300005614 | Ga0068856_100500857 | Ga0068856_1005008571 | 310 |
| 463 | 3300005618 | Ga0068864_100511957 | Ga0068864_1005119572 | 310 |
| 464 | 3300006175 | Ga0070712_100067116 | Ga0070712_1000671163 | 310 |
| 465 | 3300006844 | Ga0075428_100002387 | Ga0075428_10000238719 | 310 |
| 466 | 3300006846 | Ga0075430_100004956 | Ga0075430_1000049561 | 310 |
| 467 | 3300006847 | Ga0075431_100000881 | Ga0075431_1000008815 | 310 |
| 468 | 3300006880 | Ga0075429_100002150 | Ga0075429_10000215011 | 310 |
| 469 | 3300009094 | Ga0111539_10000144 | Ga0111539_1000014463 | 310 |
| 470 | 3300009098 | Ga0105245_10245169 | Ga0105245_102451692 | 310 |
| 471 | 3300009147 | Ga0114129_10000542 | Ga0114129_1000054225 | 310 |
| 472 | 3300014325 | Ga0163163_10124862 | Ga0163163_101248622 | 310 |
| 473 | 3300025916 | Ga0207663_10108500 | Ga0207663_101085001 | 310 |
| 474 | 3300025925 | Ga0207650_10041512 | Ga0207650_100415123 | 310 |
| 475 | 3300025926 | Ga0207659_10024779 | Ga0207659_100247793 | 310 |
| 476 | 3300025928 | Ga0207700_10194075 | Ga0207700_101940751 | 310 |
| 477 | 3300025929 | Ga0207664_10131445 | Ga0207664_101314452 | 310 |
| 478 | 3300025932 | Ga0207690_10195149 | Ga0207690_101951492 | 310 |
| 479 | 3300025932 | Ga0207690_10354798 | Ga0207690_103547981 | 310 |
| 480 | 3300025939 | Ga0207665_10064667 | Ga0207665_100646673 | 310 |
| 481 | 3300025960 | Ga0207651_10005773 | Ga0207651_100057735 | 310 |
| 482 | 3300025972 | Ga0207668_10289548 | Ga0207668_102895482 | 310 |
| 483 | 3300027907 | Ga0207428_10036366 | Ga0207428_100363663 | 310 |
| 484 | 3300028023 | Ga0265357_1002069 | Ga0265357_10020691 | 310 |
| 485 | 3300030763 | Ga0265763_1000930 | Ga0265763_10009302 | 310 |
| 486 | 3300031090 | Ga0265760_10020706 | Ga0265760_100207062 | 310 |
| 487 | 3300035086 | Ga0373934_0099054 | Ga0373934_0099054_119_1054 | 310 |
| 488 | 3300035118 | Ga0373954_0024856 | Ga0373954_0024856_583_1518 | 310 |
| 489 | 3300035119 | Ga0373956_0014953 | Ga0373956_0014953_1937_2872 | 310 |
| 490 | 3300035119 | Ga0373956_0049755 | Ga0373956_0049755_595_1530 | 310 |
| 491 | 3300035172 | Ga0373955_0018513 | Ga0373955_0018513_2299_3234 | 310 |
| 492 | 3300035692 | Ga0373935_0033031 | Ga0373935_0033031_321_1256 | 310 |
| 493 | 3300035695 | Ga0373927_0029481 | Ga0373927_0029481_2348_3283 | 310 |
| 494 | 3300035724 | Ga0373933_0007659 | Ga0373933_0007659_2593_3528 | 310 |
| 495 | 3300035725 | Ga0373947_0076635 | Ga0373947_0076635_427_1362 | 310 |
| 496 | 3300036401 | Ga0373937_0007150 | Ga0373937_0007150_6847_7782 | 310 |
| 497 | 3300037068 | Ga0373925_0042730 | Ga0373925_0042730_98_1033 | 310 |
| 498 | 3300039437 | Ga0436365_1514696 | Ga0436365_1514696_882_1817 | 310 |
| 499 | 3300046454 | Ga0495592_0009274 | Ga0495592_0009274_2465_3400 | 310 |
| 500 | 3300046462 | Ga0495651_0146388 | Ga0495651_0146388_232_1167 | 310 |
| 501 | 3300046463 | Ga0495653_0001546 | Ga0495653_0001546_2860_3795 | 310 |
| 502 | 3300046463 | Ga0495653_0101288 | Ga0495653_0101288_738_1673 | 310 |
| 503 | 3300046472 | Ga0495580_0212472 | Ga0495580_0212472_316_1251 | 310 |
| 504 | 3300046477 | Ga0495664_0074735 | Ga0495664_0074735_816_1751 | 310 |
| 505 | 3300046511 | Ga0495608_0002461 | Ga0495608_0002461_3494_4429 | 310 |
| 506 | 3300046516 | Ga0495628_0051189 | Ga0495628_0051189_1995_2930 | 310 |
| 507 | 3300046516 | Ga0495628_0113205 | Ga0495628_0113205_261_1196 | 310 |
| 508 | 3300046529 | Ga0495652_0002387 | Ga0495652_0002387_4601_5536 | 310 |
| 509 | 3300046529 | Ga0495652_0049159 | Ga0495652_0049159_243_1178 | 310 |
| 510 | 3300046533 | Ga0495640_0002268 | Ga0495640_0002268_370_1305 | 310 |
| 511 | 3300046536 | Ga0495587_0000974 | Ga0495587_0000974_14257_15192 | 310 |
| 512 | 3300046543 | Ga0495645_0005094 | Ga0495645_0005094_535_1470 | 310 |
| 513 | 3300046559 | Ga0495667_0002526 | Ga0495667_0002526_7782_8717 | 310 |
| 514 | 3300046642 | Ga0495634_0001554 | Ga0495634_0001554_5060_5995 | 310 |
| 515 | 3300046663 | Ga0495635_0001424 | Ga0495635_0001424_13244_14179 | 310 |
| 516 | 3300046678 | Ga0495599_0002551 | Ga0495599_0002551_3277_4212 | 310 |
| 517 | 3300046679 | Ga0495623_0044148 | Ga0495623_0044148_226_1161 | 310 |
| 518 | 3300046679 | Ga0495623_0101310 | Ga0495623_0101310_459_1394 | 310 |
| 519 | 3300046680 | Ga0495646_0007710 | Ga0495646_0007710_793_1728 | 310 |
| 520 | 3300046683 | Ga0495658_0256598 | Ga0495658_0256598_83_1018 | 310 |
| 521 | 3300046689 | Ga0495613_0113254 | Ga0495613_0113254_787_1722 | 310 |
| 522 | 3300046690 | Ga0495624_0059969 | Ga0495624_0059969_1199_2134 | 310 |
| 523 | 3300046809 | Ga0495600_0021678 | Ga0495600_0021678_2967_3902 | 310 |
| 524 | 3300046809 | Ga0495600_0097430 | Ga0495600_0097430_418_1353 | 310 |
| 525 | 3300047315 | Ga0495581_0024208 | Ga0495581_0024208_710_1645 | 310 |
| 526 | 3300047317 | Ga0495604_0028339 | Ga0495604_0028339_1842_2777 | 310 |
| 527 | 3300047319 | Ga0495674_0001794 | Ga0495674_0001794_1985_2920 | 310 |
| 528 | 3300047321 | Ga0495676_0347744 | Ga0495676_0347744_13_948 | 310 |
| 529 | 3300047322 | Ga0495680_0003134 | Ga0495680_0003134_1203_2138 | 310 |
| 530 | 3300047322 | Ga0495680_0033332 | Ga0495680_0033332_948_1883 | 310 |
| 531 | 3300047444 | Ga0495675_0006989 | Ga0495675_0006989_2734_3669 | 310 |
| 532 | 3300047471 | Ga0495684_0122218 | Ga0495684_0122218_871_1806 | 310 |
| 533 | 3300048907 | Ga0496104_0129397 | Ga0496104_0129397_1357_2292 | 310 |
| 534 | 3300048909 | Ga0496106_0199358 | Ga0496106_0199358_217_1152 | 310 |
| 535 | 3300048913 | Ga0496110_0444293 | Ga0496110_0444293_137_1072 | 310 |
| 536 | 3300048915 | Ga0496112_0212104 | Ga0496112_0212104_693_1628 | 310 |
| 537 | 3300048916 | Ga0496113_0063776 | Ga0496113_0063776_1418_2353 | 310 |
| 538 | 3300048918 | Ga0496115_0340091 | Ga0496115_0340091_131_1066 | 310 |
| 539 | 3300049574 | Ga0501038_0186860 | Ga0501038_0186860_430_1368 | 310 |
| 540 | 3300049579 | Ga0501043_0191534 | Ga0501043_0191534_405_1343 | 310 |
| 541 | 3300049581 | Ga0501047_0003841 | Ga0501047_0003841_5329_6267 | 310 |
| 542 | 3300049586 | Ga0501070_0011466 | Ga0501070_0011466_1762_2700 | 310 |
| 543 | 3300049590 | Ga0501074_0178731 | Ga0501074_0178731_354_1292 | 310 |
| 544 | 3300049742 | Ga0501080_0095804 | Ga0501080_0095804_1716_2654 | 310 |
| 545 | 3300049823 | Ga0501044_0019980 | Ga0501044_0019980_5388_6326 | 310 |
| 546 | 3300050507 | nmdc:mga05p37_52_c1 | nmdc:mga05p37_52_c1_22370_23305 | 310 |
| 547 | 3300050509 | nmdc:mga0qj67_3562_c1 | nmdc:mga0qj67_3562_c1_9975_10910 | 310 |
| 548 | 3300050510 | nmdc:mga06r32_248_c1 | nmdc:mga06r32_248_c1_10972_11907 | 310 |
| 549 | 3300050511 | nmdc:mga08y16_185_c1 | nmdc:mga08y16_185_c1_27647_28582 | 310 |
| 550 | 3300053077 | Ga0495601_0080600 | Ga0495601_0080600_590_1525 | 310 |
| 551 | 3300053078 | Ga0495612_0000657 | Ga0495612_0000657_2547_3482 | 310 |
| 552 | 3300053084 | Ga0495595_0015118 | Ga0495595_0015118_10_945 | 310 |
| 553 | 3300053084 | Ga0495595_0127452 | Ga0495595_0127452_75_1010 | 310 |
| 554 | iso_pu_bacteria | 2643221736 | 2644744181 | 310 |
| 555 | iso_pu_bacteria | 2851182111 | 2851186011 | 310 |
| 556 | 3300005471 | Ga0070698_100068873 | Ga0070698_1000688732 | 311 |
| 557 | 3300005981 | Ga0081538_10006793 | Ga0081538_100067932 | 311 |
| 558 | 3300006048 | Ga0075363_100014937 | Ga0075363_1000149374 | 311 |
| 559 | 3300006051 | Ga0075364_10006943 | Ga0075364_100069432 | 311 |
| 560 | 3300006177 | Ga0075362_10000531 | Ga0075362_100005313 | 311 |
| 561 | 3300006195 | Ga0075366_10005359 | Ga0075366_100053597 | 311 |
| 562 | 3300010159 | Ga0099796_10002797 | Ga0099796_100027974 | 311 |
| 563 | 3300021361 | Ga0213872_10102814 | Ga0213872_101028142 | 311 |
| 564 | 3300025928 | Ga0207700_10384309 | Ga0207700_103843091 | 311 |
| 565 | 3300035113 | Ga0373936_0058991 | Ga0373936_0058991_491_1429 | 311 |
| 566 | 3300035116 | Ga0373945_0119307 | Ga0373945_0119307_92_1033 | 311 |
| 567 | 3300035170 | Ga0373943_0038446 | Ga0373943_0038446_874_1812 | 311 |
| 568 | 3300035695 | Ga0373927_0024839 | Ga0373927_0024839_2011_2949 | 311 |
| 569 | 3300035695 | Ga0373927_0083964 | Ga0373927_0083964_1025_1963 | 311 |
| 570 | 3300035725 | Ga0373947_0078149 | Ga0373947_0078149_985_2022 | 311 |
| 571 | 3300037853 | Ga0436364_0503784 | Ga0436364_0503784_312_1253 | 311 |
| 572 | 3300039450 | Ga0436363_0461760 | Ga0436363_0461760_1212_2153 | 311 |
| 573 | 3300046514 | Ga0495618_0118213 | Ga0495618_0118213_275_1312 | 311 |
| 574 | 3300046516 | Ga0495628_0138418 | Ga0495628_0138418_860_1801 | 311 |
| 575 | 3300046533 | Ga0495640_0134623 | Ga0495640_0134623_25_966 | 311 |
| 576 | 3300046678 | Ga0495599_0128260 | Ga0495599_0128260_329_1270 | 311 |
| 577 | 3300047322 | Ga0495680_0210983 | Ga0495680_0210983_323_1264 | 311 |
| 578 | 3300047471 | Ga0495684_0067676 | Ga0495684_0067676_1492_2433 | 311 |
| 579 | 3300048907 | Ga0496104_0256893 | Ga0496104_0256893_40_981 | 311 |
| 580 | 3300048911 | Ga0496108_0085789 | Ga0496108_0085789_1534_2475 | 311 |
| 581 | 3300048912 | Ga0496109_0082119 | Ga0496109_0082119_1639_2580 | 311 |
| 582 | 3300050490 | nmdc:mga03n38_48450_c1 | nmdc:mga03n38_48450_c1_418_1359 | 311 |
| 583 | 3300050491 | nmdc:mga00v17_23359_c1 | nmdc:mga00v17_23359_c1_883_1824 | 311 |
| 584 | 3300050493 | nmdc:mga0k408_12748_c1 | nmdc:mga0k408_12748_c1_419_1360 | 311 |
| 585 | 3300053078 | Ga0495612_0074184 | Ga0495612_0074184_30_971 | 311 |
| 586 | 3300053084 | Ga0495595_0042041 | Ga0495595_0042041_729_1670 | 311 |
| 587 | 3300053085 | Ga0495619_0077460 | Ga0495619_0077460_599_1540 | 311 |
| 588 | 3300003203 | JGI25406J46586_10028084 | JGI25406J46586_100280841 | 312 |
| 589 | 3300003578 | Ga0006562J51391_1044411 | Ga0006562J51391_10444112 | 312 |
| 590 | 3300003578 | Ga0006562J51391_1044412 | Ga0006562J51391_10444122 | 312 |
| 591 | 3300003659 | JGI25404J52841_10006833 | JGI25404J52841_100068332 | 312 |
| 592 | 3300003771 | Ga0055526_1000554 | Ga0055526_100055429 | 312 |
| 593 | 3300003771 | Ga0055526_1004638 | Ga0055526_10046383 | 312 |
| 594 | 3300005331 | Ga0070670_100152008 | Ga0070670_1001520082 | 312 |
| 595 | 3300005333 | Ga0070677_10067371 | Ga0070677_100673712 | 312 |
| 596 | 3300005340 | Ga0070689_100072734 | Ga0070689_1000727342 | 312 |
| 597 | 3300005353 | Ga0070669_100066683 | Ga0070669_1000666832 | 312 |
| 598 | 3300005354 | Ga0070675_100053603 | Ga0070675_1000536032 | 312 |
| 599 | 3300005356 | Ga0070674_100084072 | Ga0070674_1000840721 | 312 |
| 600 | 3300005365 | Ga0070688_100064312 | Ga0070688_1000643122 | 312 |
| 601 | 3300005367 | Ga0070667_100154760 | Ga0070667_1001547602 | 312 |
| 602 | 3300005435 | Ga0070714_100229399 | Ga0070714_1002293992 | 312 |
| 603 | 3300005436 | Ga0070713_100178332 | Ga0070713_1001783322 | 312 |
| 604 | 3300005436 | Ga0070713_100342449 | Ga0070713_1003424492 | 312 |
| 605 | 3300005458 | Ga0070681_10342099 | Ga0070681_103420991 | 312 |
| 606 | 3300005543 | Ga0070672_100018088 | Ga0070672_1000180882 | 312 |
| 607 | 3300005548 | Ga0070665_100314505 | Ga0070665_1003145052 | 312 |
| 608 | 3300005617 | Ga0068859_100357955 | Ga0068859_1003579552 | 312 |
| 609 | 3300005618 | Ga0068864_100028321 | Ga0068864_1000283212 | 312 |
| 610 | 3300005841 | Ga0068863_100424690 | Ga0068863_1004246901 | 312 |
| 611 | 3300005981 | Ga0081538_10031584 | Ga0081538_100315844 | 312 |
| 612 | 3300005983 | Ga0081540_1000108 | Ga0081540_100010843 | 312 |
| 613 | 3300005985 | Ga0081539_10002916 | Ga0081539_1000291618 | 312 |
| 614 | 3300006177 | Ga0075362_10053515 | Ga0075362_100535151 | 312 |
| 615 | 3300006178 | Ga0075367_10051569 | Ga0075367_100515693 | 312 |
| 616 | 3300006195 | Ga0075366_10032009 | Ga0075366_100320093 | 312 |
| 617 | 3300006931 | Ga0097620_100357939 | Ga0097620_1003579392 | 312 |
| 618 | 3300009098 | Ga0105245_10579770 | Ga0105245_105797701 | 312 |
| 619 | 3300009147 | Ga0114129_10093762 | Ga0114129_100937623 | 312 |
| 620 | 3300009148 | Ga0105243_10055697 | Ga0105243_100556972 | 312 |
| 621 | 3300014326 | Ga0157380_10135776 | Ga0157380_101357763 | 312 |
| 622 | 3300014969 | Ga0157376_10725703 | Ga0157376_107257031 | 312 |
| 623 | 3300025294 | Ga0209025_1000008 | Ga0209025_1000008159 | 312 |
| 624 | 3300025295 | Ga0209564_1000031 | Ga0209564_1000031339 | 312 |
| 625 | 3300025893 | Ga0207682_10000236 | Ga0207682_1000023621 | 312 |
| 626 | 3300025912 | Ga0207707_10249614 | Ga0207707_102496142 | 312 |
| 627 | 3300025918 | Ga0207662_10029165 | Ga0207662_100291652 | 312 |
| 628 | 3300025921 | Ga0207652_10382817 | Ga0207652_103828172 | 312 |
| 629 | 3300025931 | Ga0207644_10072623 | Ga0207644_100726232 | 312 |
| 630 | 3300025940 | Ga0207691_10014531 | Ga0207691_100145315 | 312 |
| 631 | 3300025942 | Ga0207689_10032070 | Ga0207689_100320704 | 312 |
| 632 | 3300025960 | Ga0207651_10187064 | Ga0207651_101870642 | 312 |
| 633 | 3300026041 | Ga0207639_10344912 | Ga0207639_103449122 | 312 |
| 634 | 3300026089 | Ga0207648_10017205 | Ga0207648_100172052 | 312 |
| 635 | 3300026095 | Ga0207676_10014792 | Ga0207676_100147924 | 312 |
| 636 | 3300026116 | Ga0207674_10216695 | Ga0207674_102166952 | 312 |
| 637 | 3300026118 | Ga0207675_100066985 | Ga0207675_1000669853 | 312 |
| 638 | 3300026121 | Ga0207683_10007521 | Ga0207683_100075215 | 312 |
| 639 | 3300028379 | Ga0268266_10259631 | Ga0268266_102596312 | 312 |
| 640 | 3300035117 | Ga0373953_0044878 | Ga0373953_0044878_228_1172 | 312 |
| 641 | 3300035118 | Ga0373954_0073733 | Ga0373954_0073733_459_1403 | 312 |
| 642 | 3300035119 | Ga0373956_0066003 | Ga0373956_0066003_630_1574 | 312 |
| 643 | 3300035120 | Ga0373957_0125471 | Ga0373957_0125471_48_992 | 312 |
| 644 | 3300036401 | Ga0373937_0007474 | Ga0373937_0007474_237_1181 | 312 |
| 645 | 3300046474 | Ga0495605_0014539 | Ga0495605_0014539_953_1897 | 312 |
| 646 | 3300046517 | Ga0495630_0274915 | Ga0495630_0274915_100_1044 | 312 |
| 647 | 3300047317 | Ga0495604_0263699 | Ga0495604_0263699_111_1055 | 312 |
| 648 | 3300047319 | Ga0495674_0049828 | Ga0495674_0049828_69_1013 | 312 |
| 649 | 3300048925 | Ga0496122_0232275 | Ga0496122_0232275_56_1003 | 312 |
| 650 | 3300048926 | Ga0496123_0033923 | Ga0496123_0033923_1471_2418 | 312 |
| 651 | 3300048928 | Ga0496125_0062184 | Ga0496125_0062184_1480_2427 | 312 |
| 652 | 3300049570 | Ga0501033_0010833 | Ga0501033_0010833_2347_3342 | 312 |
| 653 | 3300049571 | Ga0501034_0110578 | Ga0501034_0110578_279_1274 | 312 |
| 654 | 3300049574 | Ga0501038_0237860 | Ga0501038_0237860_107_1102 | 312 |
| 655 | 3300049579 | Ga0501043_0131634 | Ga0501043_0131634_912_1907 | 312 |
| 656 | 3300049581 | Ga0501047_0028740 | Ga0501047_0028740_819_1814 | 312 |
| 657 | 3300049823 | Ga0501044_0031516 | Ga0501044_0031516_816_1811 | 312 |
| 658 | 3300050493 | nmdc:mga0k408_41022_c1 | nmdc:mga0k408_41022_c1_503_1444 | 312 |
| 659 | 3300050507 | nmdc:mga05p37_55172_c1 | nmdc:mga05p37_55172_c1_2507_3496 | 312 |
| 660 | 3300050508 | nmdc:mga09592_356119_c1 | nmdc:mga09592_356119_c1_91_1050 | 312 |
| 661 | 3300053077 | Ga0495601_0169811 | Ga0495601_0169811_131_1075 | 312 |
| 662 | 3300005981 | Ga0081538_10053170 | Ga0081538_100531702 | 313 |
| 663 | 3300006042 | Ga0075368_10008782 | Ga0075368_100087823 | 313 |
| 664 | 3300013104 | Ga0157370_10114947 | Ga0157370_101149472 | 313 |
| 665 | 3300031665 | Ga0316575_10047580 | Ga0316575_100475802 | 313 |
| 666 | 3300031727 | Ga0316576_10014553 | Ga0316576_100145535 | 313 |
| 667 | 3300032133 | Ga0316583_10001130 | Ga0316583_100011305 | 313 |
| 668 | 3300035398 | Ga0316574_0000639 | Ga0316574_0000639_10901_11857 | 313 |
| 669 | 3300036712 | Ga0316584_0020630 | Ga0316584_0020630_3772_4728 | 313 |
| 670 | 3300046522 | Ga0495643_0019528 | Ga0495643_0019528_246_1196 | 313 |
| 671 | 3300050492 | nmdc:mga0yw44_15452_c1 | nmdc:mga0yw44_15452_c1_586_1536 | 313 |
| 672 | 3300050494 | nmdc:mga06z11_11761_c1 | nmdc:mga06z11_11761_c1_959_1909 | 313 |
| 673 | 3300053131 | Ga0500652_000056 | Ga0500652_000056_35523_36473 | 313 |
| 674 | 3300053156 | Ga0500622_0027584 | Ga0500622_0027584_1284_2234 | 313 |
| 675 | 3300053177 | Ga0500636_0038640 | Ga0500636_0038640_341_1291 | 313 |
| 676 | iso_pu_bacteria | 2643221733 | 2644732324 | 313 |
| 677 | 3300031090 | Ga0265760_10020197 | Ga0265760_100201972 | 314 |
| 678 | 3300044842 | Ga0466957_0023514 | Ga0466957_0023514_1502_2449 | 314 |
| 679 | 3300045049 | Ga0466959_0027099 | Ga0466959_0027099_240_1187 | 314 |
| 680 | 3300045836 | Ga0466958_0075461 | Ga0466958_0075461_1102_2049 | 314 |
| 681 | 3300005545 | Ga0070695_100051014 | Ga0070695_1000510143 | 316 |
| 682 | 3300005983 | Ga0081540_1007873 | Ga0081540_10078733 | 316 |
| 683 | 3300007076 | Ga0075435_100237431 | Ga0075435_1002374312 | 316 |
| 684 | 3300041408 | Ga0439453_0003007 | Ga0439453_0003007_669_1622 | 316 |
| 685 | 3300050512 | nmdc:mga0n895_250882_c1 | nmdc:mga0n895_250882_c1_161_1117 | 316 |
| 686 | 3300050513 | nmdc:mga0rr50_189449_c1 | nmdc:mga0rr50_189449_c1_343_1338 | 316 |
| 687 | 3300050514 | nmdc:mga08x19_22_c1 | nmdc:mga08x19_22_c1_394_1389 | 316 |
| 688 | 3300005328 | Ga0070676_10059345 | Ga0070676_100593453 | 317 |
| 689 | 3300005330 | Ga0070690_100229382 | Ga0070690_1002293822 | 317 |
| 690 | 3300005336 | Ga0070680_100038585 | Ga0070680_1000385853 | 317 |
| 691 | 3300005340 | Ga0070689_100019555 | Ga0070689_1000195555 | 317 |
| 692 | 3300005354 | Ga0070675_100040621 | Ga0070675_1000406215 | 317 |
| 693 | 3300005355 | Ga0070671_100149828 | Ga0070671_1001498282 | 317 |
| 694 | 3300005365 | Ga0070688_100036231 | Ga0070688_1000362314 | 317 |
| 695 | 3300005458 | Ga0070681_10018284 | Ga0070681_100182847 | 317 |
| 696 | 3300005458 | Ga0070681_10374909 | Ga0070681_103749092 | 317 |
| 697 | 3300005458 | Ga0070681_10458554 | Ga0070681_104585541 | 317 |
| 698 | 3300005530 | Ga0070679_100053825 | Ga0070679_1000538253 | 317 |
| 699 | 3300005543 | Ga0070672_100160616 | Ga0070672_1001606162 | 317 |
| 700 | 3300005617 | Ga0068859_100132355 | Ga0068859_1001323553 | 317 |
| 701 | 3300005843 | Ga0068860_100123800 | Ga0068860_1001238002 | 317 |
| 702 | 3300006178 | Ga0075367_10120882 | Ga0075367_101208822 | 317 |
| 703 | 3300006195 | Ga0075366_10022896 | Ga0075366_100228963 | 317 |
| 704 | 3300006237 | Ga0097621_100324730 | Ga0097621_1003247302 | 317 |
| 705 | 3300006881 | Ga0068865_100327642 | Ga0068865_1003276421 | 317 |
| 706 | 3300006931 | Ga0097620_100132350 | Ga0097620_1001323503 | 317 |
| 707 | 3300007076 | Ga0075435_100005906 | Ga0075435_1000059064 | 317 |
| 708 | 3300009094 | Ga0111539_10022547 | Ga0111539_100225475 | 317 |
| 709 | 3300009177 | Ga0105248_10002898 | Ga0105248_100028989 | 317 |
| 710 | 3300013308 | Ga0157375_10144334 | Ga0157375_101443342 | 317 |
| 711 | 3300014325 | Ga0163163_10010340 | Ga0163163_100103408 | 317 |
| 712 | 3300014497 | Ga0182008_10025417 | Ga0182008_100254174 | 317 |
| 713 | 3300025901 | Ga0207688_10024290 | Ga0207688_100242905 | 317 |
| 714 | 3300025912 | Ga0207707_10075933 | Ga0207707_100759332 | 317 |
| 715 | 3300025917 | Ga0207660_10003986 | Ga0207660_1000398610 | 317 |
| 716 | 3300025921 | Ga0207652_10039220 | Ga0207652_100392206 | 317 |
| 717 | 3300025926 | Ga0207659_10044866 | Ga0207659_100448663 | 317 |
| 718 | 3300025935 | Ga0207709_10316393 | Ga0207709_103163931 | 317 |
| 719 | 3300025936 | Ga0207670_10001838 | Ga0207670_100018385 | 317 |
| 720 | 3300025939 | Ga0207665_10070566 | Ga0207665_100705661 | 317 |
| 721 | 3300025940 | Ga0207691_10060991 | Ga0207691_100609913 | 317 |
| 722 | 3300025941 | Ga0207711_10064116 | Ga0207711_100641164 | 317 |
| 723 | 3300026023 | Ga0207677_10061026 | Ga0207677_100610263 | 317 |
| 724 | 3300026089 | Ga0207648_10324214 | Ga0207648_103242141 | 317 |
| 725 | 3300026118 | Ga0207675_100463081 | Ga0207675_1004630812 | 317 |
| 726 | 3300027907 | Ga0207428_10146992 | Ga0207428_101469922 | 317 |
| 727 | 3300031241 | Ga0265325_10005177 | Ga0265325_100051773 | 317 |
| 728 | 3300031241 | Ga0265325_10064001 | Ga0265325_100640012 | 317 |
| 729 | 3300034820 | Ga0373959_0008928 | Ga0373959_0008928_491_1447 | 317 |
| 730 | 3300035112 | Ga0373932_0047861 | Ga0373932_0047861_284_1240 | 317 |
| 731 | 3300035121 | Ga0373960_0025163 | Ga0373960_0025163_623_1579 | 317 |
| 732 | 3300035121 | Ga0373960_0063683 | Ga0373960_0063683_38_994 | 317 |
| 733 | 3300035172 | Ga0373955_0112793 | Ga0373955_0112793_280_1236 | 317 |
| 734 | 3300035241 | Ga0373961_0006333 | Ga0373961_0006333_165_1121 | 317 |
| 735 | 3300035241 | Ga0373961_0050987 | Ga0373961_0050987_203_1159 | 317 |
| 736 | 3300035242 | Ga0373962_0002857 | Ga0373962_0002857_2535_3491 | 317 |
| 737 | 3300035691 | Ga0373931_0002195 | Ga0373931_0002195_5827_6783 | 317 |
| 738 | 3300035691 | Ga0373931_0002855 | Ga0373931_0002855_5574_6530 | 317 |
| 739 | 3300035691 | Ga0373931_0080160 | Ga0373931_0080160_467_1423 | 317 |
| 740 | 3300035692 | Ga0373935_0013611 | Ga0373935_0013611_2258_3214 | 317 |
| 741 | 3300035692 | Ga0373935_0121150 | Ga0373935_0121150_753_1709 | 317 |
| 742 | 3300035725 | Ga0373947_0211134 | Ga0373947_0211134_254_1210 | 317 |
| 743 | 3300037068 | Ga0373925_0091344 | Ga0373925_0091344_858_1814 | 317 |
| 744 | 3300046454 | Ga0495592_0075476 | Ga0495592_0075476_231_1187 | 317 |
| 745 | 3300047317 | Ga0495604_0227216 | Ga0495604_0227216_135_1091 | 317 |
| 746 | 3300047322 | Ga0495680_0099299 | Ga0495680_0099299_978_1934 | 317 |
| 747 | 3300048903 | Ga0496100_0007392 | Ga0496100_0007392_3151_4107 | 317 |
| 748 | 3300048904 | Ga0496101_0001698 | Ga0496101_0001698_5516_6472 | 317 |
| 749 | 3300048905 | Ga0496102_0006852 | Ga0496102_0006852_1473_2429 | 317 |
| 750 | 3300048906 | Ga0496103_0135250 | Ga0496103_0135250_371_1327 | 317 |
| 751 | 3300048907 | Ga0496104_0196091 | Ga0496104_0196091_437_1393 | 317 |
| 752 | 3300048909 | Ga0496106_0016334 | Ga0496106_0016334_3098_4054 | 317 |
| 753 | 3300048909 | Ga0496106_0258551 | Ga0496106_0258551_238_1194 | 317 |
| 754 | 3300048911 | Ga0496108_0007574 | Ga0496108_0007574_5589_6545 | 317 |
| 755 | 3300048912 | Ga0496109_0038830 | Ga0496109_0038830_1392_2348 | 317 |
| 756 | 3300048913 | Ga0496110_0003430 | Ga0496110_0003430_7998_8954 | 317 |
| 757 | 3300048914 | Ga0496111_0041160 | Ga0496111_0041160_916_1872 | 317 |
| 758 | 3300048915 | Ga0496112_0113340 | Ga0496112_0113340_715_1671 | 317 |
| 759 | 3300048915 | Ga0496112_0263309 | Ga0496112_0263309_136_1092 | 317 |
| 760 | 3300048917 | Ga0496114_0029829 | Ga0496114_0029829_1750_2706 | 317 |
| 761 | 3300048918 | Ga0496115_0190594 | Ga0496115_0190594_568_1524 | 317 |
| 762 | 3300049568 | Ga0501031_0006090 | Ga0501031_0006090_3903_4859 | 317 |
| 763 | 3300049569 | Ga0501032_0025316 | Ga0501032_0025316_854_1810 | 317 |
| 764 | 3300049571 | Ga0501034_0064129 | Ga0501034_0064129_1084_2040 | 317 |
| 765 | 3300049571 | Ga0501034_0075399 | Ga0501034_0075399_1250_2206 | 317 |
| 766 | 3300049571 | Ga0501034_0512494 | Ga0501034_0512494_129_1085 | 317 |
| 767 | 3300049572 | Ga0501036_0013411 | Ga0501036_0013411_3017_3973 | 317 |
| 768 | 3300049574 | Ga0501038_0051377 | Ga0501038_0051377_1925_2881 | 317 |
| 769 | 3300049574 | Ga0501038_0061334 | Ga0501038_0061334_1127_2083 | 317 |
| 770 | 3300049575 | Ga0501039_0041424 | Ga0501039_0041424_645_1601 | 317 |
| 771 | 3300049579 | Ga0501043_0031809 | Ga0501043_0031809_994_1950 | 317 |
| 772 | 3300049581 | Ga0501047_0126074 | Ga0501047_0126074_443_1399 | 317 |
| 773 | 3300049586 | Ga0501070_0021330 | Ga0501070_0021330_2986_3942 | 317 |
| 774 | 3300049588 | Ga0501072_0107748 | Ga0501072_0107748_698_1654 | 317 |
| 775 | 3300049822 | Ga0501035_0012798 | Ga0501035_0012798_3877_4833 | 317 |
| 776 | 3300049823 | Ga0501044_0000509 | Ga0501044_0000509_17434_18390 | 317 |
| 777 | 3300049823 | Ga0501044_0431705 | Ga0501044_0431705_185_1141 | 317 |
| 778 | 3300050493 | nmdc:mga0k408_53649_c1 | nmdc:mga0k408_53649_c1_1122_2078 | 317 |
| 779 | 3300050493 | nmdc:mga0k408_73074_c1 | nmdc:mga0k408_73074_c1_213_1169 | 317 |
| 780 | 3300050494 | nmdc:mga06z11_3813_c1 | nmdc:mga06z11_3813_c1_2489_3445 | 317 |
| 781 | 3300050511 | nmdc:mga08y16_19901_c1 | nmdc:mga08y16_19901_c1_5710_6687 | 317 |
| 782 | 3300050513 | nmdc:mga0rr50_33759_c1 | nmdc:mga0rr50_33759_c1_2169_3146 | 317 |
| 783 | 3300053084 | Ga0495595_0038271 | Ga0495595_0038271_70_1026 | 317 |
| 784 | 3300053085 | Ga0495619_0231289 | Ga0495619_0231289_250_1206 | 317 |
| 785 | 3300005458 | Ga0070681_10110314 | Ga0070681_101103143 | 318 |
| 786 | 3300005530 | Ga0070679_100151087 | Ga0070679_1001510872 | 318 |
| 787 | 3300036401 | Ga0373937_0125580 | Ga0373937_0125580_1121_2110 | 318 |
| 788 | 3300049587 | Ga0501071_0010484 | Ga0501071_0010484_2063_3025 | 318 |
| 789 | 3300049588 | Ga0501072_0048709 | Ga0501072_0048709_2021_2983 | 318 |
| 790 | 3300049592 | Ga0501076_0075248 | Ga0501076_0075248_671_1633 | 318 |
| 791 | 3300049743 | Ga0501081_0070925 | Ga0501081_0070925_424_1386 | 318 |
| 792 | 3300050511 | nmdc:mga08y16_507966_c1 | nmdc:mga08y16_507966_c1_194_1183 | 318 |
| 793 | 3300061734 | Ga0530510_0034068 | Ga0530510_0034068_351_1313 | 318 |
| 794 | 3300001977 | JGI24746J21847_1002311 | JGI24746J21847_10023114 | 319 |
| 795 | 3300002244 | JGI24742J22300_10001731 | JGI24742J22300_100017312 | 319 |
| 796 | 3300002459 | JGI24751J29686_10012415 | JGI24751J29686_100124152 | 319 |
| 797 | 3300005328 | Ga0070676_10079333 | Ga0070676_100793333 | 319 |
| 798 | 3300005335 | Ga0070666_10017740 | Ga0070666_100177403 | 319 |
| 799 | 3300005337 | Ga0070682_100016862 | Ga0070682_1000168624 | 319 |
| 800 | 3300005364 | Ga0070673_100010439 | Ga0070673_1000104391 | 319 |
| 801 | 3300005365 | Ga0070688_100009732 | Ga0070688_1000097325 | 319 |
| 802 | 3300005366 | Ga0070659_100032106 | Ga0070659_1000321063 | 319 |
| 803 | 3300005367 | Ga0070667_100111510 | Ga0070667_1001115102 | 319 |
| 804 | 3300005436 | Ga0070713_100307697 | Ga0070713_1003076972 | 319 |
| 805 | 3300005439 | Ga0070711_100026936 | Ga0070711_1000269362 | 319 |
| 806 | 3300005439 | Ga0070711_100035081 | Ga0070711_1000350815 | 319 |
| 807 | 3300005445 | Ga0070708_100015368 | Ga0070708_1000153686 | 319 |
| 808 | 3300005455 | Ga0070663_100009309 | Ga0070663_1000093091 | 319 |
| 809 | 3300005468 | Ga0070707_100080461 | Ga0070707_1000804613 | 319 |
| 810 | 3300005468 | Ga0070707_100246552 | Ga0070707_1002465521 | 319 |
| 811 | 3300005471 | Ga0070698_100370916 | Ga0070698_1003709161 | 319 |
| 812 | 3300005518 | Ga0070699_100001669 | Ga0070699_1000016697 | 319 |
| 813 | 3300005518 | Ga0070699_100231298 | Ga0070699_1002312982 | 319 |
| 814 | 3300005530 | Ga0070679_100019369 | Ga0070679_1000193691 | 319 |
| 815 | 3300005543 | Ga0070672_100002368 | Ga0070672_1000023688 | 319 |
| 816 | 3300005548 | Ga0070665_100236209 | Ga0070665_1002362093 | 319 |
| 817 | 3300005549 | Ga0070704_100046280 | Ga0070704_1000462802 | 319 |
| 818 | 3300005549 | Ga0070704_100174268 | Ga0070704_1001742682 | 319 |
| 819 | 3300005563 | Ga0068855_100542362 | Ga0068855_1005423621 | 319 |
| 820 | 3300005617 | Ga0068859_100148383 | Ga0068859_1001483832 | 319 |
| 821 | 3300005618 | Ga0068864_100065734 | Ga0068864_1000657342 | 319 |
| 822 | 3300005719 | Ga0068861_100252540 | Ga0068861_1002525402 | 319 |
| 823 | 3300005840 | Ga0068870_10000511 | Ga0068870_100005119 | 319 |
| 824 | 3300005842 | Ga0068858_100092912 | Ga0068858_1000929123 | 319 |
| 825 | 3300005843 | Ga0068860_100005647 | Ga0068860_1000056477 | 319 |
| 826 | 3300005844 | Ga0068862_100023093 | Ga0068862_1000230931 | 319 |
| 827 | 3300005937 | Ga0081455_10000393 | Ga0081455_1000039329 | 319 |
| 828 | 3300005937 | Ga0081455_10009827 | Ga0081455_100098275 | 319 |
| 829 | 3300006028 | Ga0070717_10344410 | Ga0070717_103444101 | 319 |
| 830 | 3300006038 | Ga0075365_10050728 | Ga0075365_100507284 | 319 |
| 831 | 3300006175 | Ga0070712_100000770 | Ga0070712_10000077016 | 319 |
| 832 | 3300006175 | Ga0070712_100082986 | Ga0070712_1000829863 | 319 |
| 833 | 3300006358 | Ga0068871_100052246 | Ga0068871_1000522464 | 319 |
| 834 | 3300006844 | Ga0075428_100018721 | Ga0075428_1000187216 | 319 |
| 835 | 3300006846 | Ga0075430_100002327 | Ga0075430_1000023278 | 319 |
| 836 | 3300006847 | Ga0075431_100016707 | Ga0075431_1000167078 | 319 |
| 837 | 3300006847 | Ga0075431_100137754 | Ga0075431_1001377542 | 319 |
| 838 | 3300006852 | Ga0075433_10070886 | Ga0075433_100708861 | 319 |
| 839 | 3300006852 | Ga0075433_10138908 | Ga0075433_101389082 | 319 |
| 840 | 3300006871 | Ga0075434_100071051 | Ga0075434_1000710511 | 319 |
| 841 | 3300006881 | Ga0068865_100234807 | Ga0068865_1002348072 | 319 |
| 842 | 3300006931 | Ga0097620_100148390 | Ga0097620_1001483903 | 319 |
| 843 | 3300007076 | Ga0075435_100240108 | Ga0075435_1002401082 | 319 |
| 844 | 3300007076 | Ga0075435_100364745 | Ga0075435_1003647451 | 319 |
| 845 | 3300009092 | Ga0105250_10019437 | Ga0105250_100194373 | 319 |
| 846 | 3300009094 | Ga0111539_10135467 | Ga0111539_101354673 | 319 |
| 847 | 3300009094 | Ga0111539_10263619 | Ga0111539_102636193 | 319 |
| 848 | 3300009147 | Ga0114129_10013541 | Ga0114129_100135416 | 319 |
| 849 | 3300009147 | Ga0114129_10123555 | Ga0114129_101235552 | 319 |
| 850 | 3300009147 | Ga0114129_10756344 | Ga0114129_107563441 | 319 |
| 851 | 3300009147 | Ga0114129_10843961 | Ga0114129_108439611 | 319 |
| 852 | 3300009177 | Ga0105248_10148570 | Ga0105248_101485702 | 319 |
| 853 | 3300009545 | Ga0105237_10096445 | Ga0105237_100964453 | 319 |
| 854 | 3300009553 | Ga0105249_10061178 | Ga0105249_100611781 | 319 |
| 855 | 3300013102 | Ga0157371_10121373 | Ga0157371_101213733 | 319 |
| 856 | 3300013296 | Ga0157374_10106058 | Ga0157374_101060582 | 319 |
| 857 | 3300013297 | Ga0157378_10126593 | Ga0157378_101265931 | 319 |
| 858 | 3300014325 | Ga0163163_10076230 | Ga0163163_100762305 | 319 |
| 859 | 3300014326 | Ga0157380_10023243 | Ga0157380_100232432 | 319 |
| 860 | 3300014745 | Ga0157377_10003949 | Ga0157377_100039491 | 319 |
| 861 | 3300014968 | Ga0157379_10009156 | Ga0157379_100091564 | 319 |
| 862 | 3300017792 | Ga0163161_10100381 | Ga0163161_101003814 | 319 |
| 863 | 3300025885 | Ga0207653_10007174 | Ga0207653_100071741 | 319 |
| 864 | 3300025893 | Ga0207682_10005063 | Ga0207682_100050634 | 319 |
| 865 | 3300025899 | Ga0207642_10009702 | Ga0207642_100097023 | 319 |
| 866 | 3300025901 | Ga0207688_10003976 | Ga0207688_100039767 | 319 |
| 867 | 3300025904 | Ga0207647_10015177 | Ga0207647_100151772 | 319 |
| 868 | 3300025907 | Ga0207645_10003639 | Ga0207645_100036396 | 319 |
| 869 | 3300025908 | Ga0207643_10003115 | Ga0207643_100031158 | 319 |
| 870 | 3300025914 | Ga0207671_10197014 | Ga0207671_101970142 | 319 |
| 871 | 3300025915 | Ga0207693_10001559 | Ga0207693_100015592 | 319 |
| 872 | 3300025915 | Ga0207693_10114569 | Ga0207693_101145692 | 319 |
| 873 | 3300025916 | Ga0207663_10024975 | Ga0207663_100249751 | 319 |
| 874 | 3300025916 | Ga0207663_10030171 | Ga0207663_100301712 | 319 |
| 875 | 3300025919 | Ga0207657_10012193 | Ga0207657_100121936 | 319 |
| 876 | 3300025920 | Ga0207649_10087027 | Ga0207649_100870272 | 319 |
| 877 | 3300025921 | Ga0207652_10010934 | Ga0207652_100109343 | 319 |
| 878 | 3300025922 | Ga0207646_10057546 | Ga0207646_100575465 | 319 |
| 879 | 3300025922 | Ga0207646_10067738 | Ga0207646_100677383 | 319 |
| 880 | 3300025925 | Ga0207650_10032327 | Ga0207650_100323273 | 319 |
| 881 | 3300025926 | Ga0207659_10132119 | Ga0207659_101321191 | 319 |
| 882 | 3300025928 | Ga0207700_10228104 | Ga0207700_102281042 | 319 |
| 883 | 3300025932 | Ga0207690_10038360 | Ga0207690_100383602 | 319 |
| 884 | 3300025933 | Ga0207706_10001795 | Ga0207706_100017956 | 319 |
| 885 | 3300025935 | Ga0207709_10076406 | Ga0207709_100764062 | 319 |
| 886 | 3300025938 | Ga0207704_10012217 | Ga0207704_100122172 | 319 |
| 887 | 3300025940 | Ga0207691_10000439 | Ga0207691_1000043920 | 319 |
| 888 | 3300025941 | Ga0207711_10038507 | Ga0207711_100385073 | 319 |
| 889 | 3300025942 | Ga0207689_10015672 | Ga0207689_100156726 | 319 |
| 890 | 3300025944 | Ga0207661_10048993 | Ga0207661_100489933 | 319 |
| 891 | 3300025960 | Ga0207651_10204425 | Ga0207651_102044252 | 319 |
| 892 | 3300025960 | Ga0207651_10299281 | Ga0207651_102992812 | 319 |
| 893 | 3300026023 | Ga0207677_10028542 | Ga0207677_100285425 | 319 |
| 894 | 3300026035 | Ga0207703_10002169 | Ga0207703_100021699 | 319 |
| 895 | 3300026067 | Ga0207678_10005411 | Ga0207678_100054119 | 319 |
| 896 | 3300026075 | Ga0207708_10006130 | Ga0207708_100061307 | 319 |
| 897 | 3300026088 | Ga0207641_10253446 | Ga0207641_102534461 | 319 |
| 898 | 3300026089 | Ga0207648_10001430 | Ga0207648_1000143023 | 319 |
| 899 | 3300026095 | Ga0207676_10018517 | Ga0207676_100185174 | 319 |
| 900 | 3300026116 | Ga0207674_10026467 | Ga0207674_100264672 | 319 |
| 901 | 3300026118 | Ga0207675_100003488 | Ga0207675_1000034888 | 319 |
| 902 | 3300028380 | Ga0268265_10014784 | Ga0268265_100147841 | 319 |
| 903 | 3300035117 | Ga0373953_0003585 | Ga0373953_0003585_748_1734 | 319 |
| 904 | 3300035119 | Ga0373956_0065882 | Ga0373956_0065882_40_1026 | 319 |
| 905 | 3300035120 | Ga0373957_0014429 | Ga0373957_0014429_1566_2552 | 319 |
| 906 | 3300035170 | Ga0373943_0054726 | Ga0373943_0054726_154_1113 | 319 |
| 907 | 3300035691 | Ga0373931_0089492 | Ga0373931_0089492_54_1013 | 319 |
| 908 | 3300035695 | Ga0373927_0005292 | Ga0373927_0005292_4903_5862 | 319 |
| 909 | 3300035725 | Ga0373947_0011575 | Ga0373947_0011575_2480_3439 | 319 |
| 910 | 3300037068 | Ga0373925_0141590 | Ga0373925_0141590_410_1372 | 319 |
| 911 | 3300038443 | Ga0395901_0131267 | Ga0395901_0131267_1084_2076 | 319 |
| 912 | 3300039447 | Ga0436361_0166397 | Ga0436361_0166397_25707_26669 | 319 |
| 913 | 3300046455 | Ga0495603_0033614 | Ga0495603_0033614_2036_2995 | 319 |
| 914 | 3300046459 | Ga0495629_0065960 | Ga0495629_0065960_25_984 | 319 |
| 915 | 3300046461 | Ga0495641_0015315 | Ga0495641_0015315_2101_3060 | 319 |
| 916 | 3300046462 | Ga0495651_0070751 | Ga0495651_0070751_651_1637 | 319 |
| 917 | 3300046472 | Ga0495580_0048530 | Ga0495580_0048530_171_1130 | 319 |
| 918 | 3300046473 | Ga0495582_0015745 | Ga0495582_0015745_2956_3918 | 319 |
| 919 | 3300046475 | Ga0495639_0003876 | Ga0495639_0003876_2619_3578 | 319 |
| 920 | 3300046491 | Ga0495584_0022721 | Ga0495584_0022721_1410_2369 | 319 |
| 921 | 3300046492 | Ga0495585_0003847 | Ga0495585_0003847_3972_4931 | 319 |
| 922 | 3300046492 | Ga0495585_0067832 | Ga0495585_0067832_131_1090 | 319 |
| 923 | 3300046511 | Ga0495608_0098663 | Ga0495608_0098663_301_1287 | 319 |
| 924 | 3300046517 | Ga0495630_0063975 | Ga0495630_0063975_1493_2452 | 319 |
| 925 | 3300046533 | Ga0495640_0100265 | Ga0495640_0100265_734_1693 | 319 |
| 926 | 3300046536 | Ga0495587_0010772 | Ga0495587_0010772_1555_2541 | 319 |
| 927 | 3300046537 | Ga0495598_0000959 | Ga0495598_0000959_4283_5242 | 319 |
| 928 | 3300046539 | Ga0495621_0022218 | Ga0495621_0022218_286_1245 | 319 |
| 929 | 3300046558 | Ga0495633_0020617 | Ga0495633_0020617_1497_2456 | 319 |
| 930 | 3300046615 | Ga0495656_0026622 | Ga0495656_0026622_884_1843 | 319 |
| 931 | 3300046663 | Ga0495635_0078455 | Ga0495635_0078455_981_1967 | 319 |
| 932 | 3300046663 | Ga0495635_0269245 | Ga0495635_0269245_20_979 | 319 |
| 933 | 3300046664 | Ga0495659_0002398 | Ga0495659_0002398_3981_4940 | 319 |
| 934 | 3300046665 | Ga0495661_0063393 | Ga0495661_0063393_147_1106 | 319 |
| 935 | 3300046674 | Ga0495588_0014648 | Ga0495588_0014648_1308_2270 | 319 |
| 936 | 3300046679 | Ga0495623_0143865 | Ga0495623_0143865_371_1357 | 319 |
| 937 | 3300046681 | Ga0495647_0009007 | Ga0495647_0009007_1539_2498 | 319 |
| 938 | 3300046683 | Ga0495658_0010116 | Ga0495658_0010116_992_1951 | 319 |
| 939 | 3300046684 | Ga0495669_0076514 | Ga0495669_0076514_77_1036 | 319 |
| 940 | 3300046689 | Ga0495613_0110861 | Ga0495613_0110861_855_1817 | 319 |
| 941 | 3300046689 | Ga0495613_0133310 | Ga0495613_0133310_197_1156 | 319 |
| 942 | 3300046690 | Ga0495624_0056823 | Ga0495624_0056823_122_1081 | 319 |
| 943 | 3300046810 | Ga0495660_0168427 | Ga0495660_0168427_75_1034 | 319 |
| 944 | 3300047317 | Ga0495604_0035557 | Ga0495604_0035557_2884_3870 | 319 |
| 945 | 3300047318 | Ga0495636_0130497 | Ga0495636_0130497_74_1033 | 319 |
| 946 | 3300047322 | Ga0495680_0044275 | Ga0495680_0044275_285_1271 | 319 |
| 947 | 3300047444 | Ga0495675_0106974 | Ga0495675_0106974_27_1013 | 319 |
| 948 | 3300047445 | Ga0495677_0081526 | Ga0495677_0081526_53_1012 | 319 |
| 949 | 3300047471 | Ga0495684_0171952 | Ga0495684_0171952_126_1085 | 319 |
| 950 | 3300048088 | Ga0495602_0057794 | Ga0495602_0057794_2233_3219 | 319 |
| 951 | 3300048904 | Ga0496101_0011605 | Ga0496101_0011605_3277_4236 | 319 |
| 952 | 3300048904 | Ga0496101_0061483 | Ga0496101_0061483_361_1320 | 319 |
| 953 | 3300048905 | Ga0496102_0069972 | Ga0496102_0069972_1261_2220 | 319 |
| 954 | 3300048906 | Ga0496103_0004686 | Ga0496103_0004686_7242_8201 | 319 |
| 955 | 3300048906 | Ga0496103_0040482 | Ga0496103_0040482_124_1083 | 319 |
| 956 | 3300048907 | Ga0496104_0001214 | Ga0496104_0001214_13709_14668 | 319 |
| 957 | 3300048907 | Ga0496104_0017246 | Ga0496104_0017246_3236_4195 | 319 |
| 958 | 3300048907 | Ga0496104_0302856 | Ga0496104_0302856_526_1485 | 319 |
| 959 | 3300048908 | Ga0496105_0009664 | Ga0496105_0009664_526_1485 | 319 |
| 960 | 3300048908 | Ga0496105_0037536 | Ga0496105_0037536_921_1880 | 319 |
| 961 | 3300048909 | Ga0496106_0003679 | Ga0496106_0003679_10397_11356 | 319 |
| 962 | 3300048910 | Ga0496107_0030776 | Ga0496107_0030776_1947_2906 | 319 |
| 963 | 3300048911 | Ga0496108_0002287 | Ga0496108_0002287_13223_14182 | 319 |
| 964 | 3300048912 | Ga0496109_0000561 | Ga0496109_0000561_18199_19158 | 319 |
| 965 | 3300048912 | Ga0496109_0040998 | Ga0496109_0040998_27_986 | 319 |
| 966 | 3300048913 | Ga0496110_0007744 | Ga0496110_0007744_997_1959 | 319 |
| 967 | 3300048913 | Ga0496110_0014211 | Ga0496110_0014211_2618_3577 | 319 |
| 968 | 3300048913 | Ga0496110_0038338 | Ga0496110_0038338_1993_2952 | 319 |
| 969 | 3300048914 | Ga0496111_0013509 | Ga0496111_0013509_3654_4613 | 319 |
| 970 | 3300048914 | Ga0496111_0024178 | Ga0496111_0024178_3303_4265 | 319 |
| 971 | 3300048914 | Ga0496111_0064980 | Ga0496111_0064980_171_1130 | 319 |
| 972 | 3300048915 | Ga0496112_0000702 | Ga0496112_0000702_10450_11409 | 319 |
| 973 | 3300048915 | Ga0496112_0090573 | Ga0496112_0090573_1993_2952 | 319 |
| 974 | 3300048915 | Ga0496112_0280330 | Ga0496112_0280330_522_1481 | 319 |
| 975 | 3300048916 | Ga0496113_0001074 | Ga0496113_0001074_1190_2149 | 319 |
| 976 | 3300048916 | Ga0496113_0025205 | Ga0496113_0025205_69_1028 | 319 |
| 977 | 3300048918 | Ga0496115_0100454 | Ga0496115_0100454_966_1925 | 319 |
| 978 | 3300049580 | Ga0501046_0229378 | Ga0501046_0229378_272_1231 | 319 |
| 979 | 3300049588 | Ga0501072_0179207 | Ga0501072_0179207_278_1237 | 319 |
| 980 | 3300049591 | Ga0501075_0114781 | Ga0501075_0114781_443_1402 | 319 |
| 981 | 3300049743 | Ga0501081_0185146 | Ga0501081_0185146_52_1011 | 319 |
| 982 | 3300050492 | nmdc:mga0yw44_1031_c1 | nmdc:mga0yw44_1031_c1_699_1658 | 319 |
| 983 | 3300050494 | nmdc:mga06z11_125618_c1 | nmdc:mga06z11_125618_c1_341_1300 | 319 |
| 984 | 3300050507 | nmdc:mga05p37_119967_c1 | nmdc:mga05p37_119967_c1_292_1284 | 319 |
| 985 | 3300050507 | nmdc:mga05p37_158906_c1 | nmdc:mga05p37_158906_c1_28_987 | 319 |
| 986 | 3300050507 | nmdc:mga05p37_30503_c1 | nmdc:mga05p37_30503_c1_1429_2388 | 319 |
| 987 | 3300050508 | nmdc:mga09592_219639_c1 | nmdc:mga09592_219639_c1_565_1524 | 319 |
| 988 | 3300050509 | nmdc:mga0qj67_13134_c1 | nmdc:mga0qj67_13134_c1_5125_6084 | 319 |
| 989 | 3300050509 | nmdc:mga0qj67_298910_c1 | nmdc:mga0qj67_298910_c1_264_1223 | 319 |
| 990 | 3300050510 | nmdc:mga06r32_188274_c1 | nmdc:mga06r32_188274_c1_122_1114 | 319 |
| 991 | 3300050510 | nmdc:mga06r32_58944_c1 | nmdc:mga06r32_58944_c1_2193_3152 | 319 |
| 992 | 3300050511 | nmdc:mga08y16_287139_c1 | nmdc:mga08y16_287139_c1_252_1211 | 319 |
| 993 | 3300050512 | nmdc:mga0n895_530637_c1 | nmdc:mga0n895_530637_c1_19_981 | 319 |
| 994 | 3300050512 | nmdc:mga0n895_80113_c1 | nmdc:mga0n895_80113_c1_1939_2898 | 319 |
| 995 | 3300050515 | nmdc:mga0a205_157596_c1 | nmdc:mga0a205_157596_c1_39_998 | 319 |
| 996 | 3300050515 | nmdc:mga0a205_80963_c1 | nmdc:mga0a205_80963_c1_2064_3026 | 319 |
| 997 | 3300053077 | Ga0495601_0032644 | Ga0495601_0032644_2020_3006 | 319 |
| 998 | 3300053077 | Ga0495601_0135011 | Ga0495601_0135011_204_1163 | 319 |
| 999 | 3300053077 | Ga0495601_0291067 | Ga0495601_0291067_81_1040 | 319 |
| 1000 | 3300053084 | Ga0495595_0007638 | Ga0495595_0007638_358_1344 | 319 |
| 1001 | 3300053084 | Ga0495595_0184155 | Ga0495595_0184155_45_1004 | 319 |
| 1002 | 3300053085 | Ga0495619_0035724 | Ga0495619_0035724_138_1097 | 319 |
| 1003 | 3300054114 | Ga0501084_0201072 | Ga0501084_0201072_456_1415 | 319 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3m0g-assembly1.cif.gz_B | crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus | 0.972 | 17 | 317 |
| 3m0g-assembly1.cif.gz_A | crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus | 0.9708 | 17 | 315 |
| 4llt-assembly1.cif.gz_B | crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with two ipp and calcium bound in active site | 0.9702 | 16 | 319 |
| 2h8o-assembly1.cif.gz_A-2 | the 1.6a crystal structure of the geranyltransferase from agrobacterium tumefaciens | 0.9674 | 13 | 315 |
| 3m0g-assembly1.cif.gz_B | crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus | 0.9649 | 17 | 317 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2h8oA00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9674 | 13 | 315 | 1.10.600.10 |
| 3m0gA00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9635 | 17 | 315 | 1.10.600.10 |
| 4kkmB00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9567 | 15 | 314 | 1.10.600.10 |
| 2h8oA00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.954 | 13 | 315 | 1.10.600.10 |
| 3m0gA00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9525 | 17 | 315 | 1.10.600.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7FL91-F1-model_v4 | Geranylgeranyl pyrophosphate synthase | 0.9957 | 15 | 174 |
GO:0004659
GO:0008299 |
| AF-A0A212QL17-F1-model_v4 | deleted | 0.9939 | 17 | 319 |
|
| AF-Q93CJ0-F1-model_v4 | Farnesyl diphosphate synthase (Polyprenyl synthetase) | 0.9908 | 17 | 319 |
GO:0004659
GO:0005737 GO:0008299 |
| AF-A0A1G7Q3W3-F1-model_v4 | Farnesyl-diphosphate synthase | 0.9896 | 13 | 319 |
GO:0004659
GO:0005737 GO:0008299 |
| AF-A0A0R3MJS7-F1-model_v4 | Geranylgeranyl pyrophosphate synthase | 0.9885 | 13 | 319 |
GO:0004659
GO:0005737 GO:0008299 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar