F487816

General Info

Members Datasets Scaffolds Average Seq Length
998 287 1996 81

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100004979|Ga0075436_10000497911
Length 84
Sequence MGMNLFRSEEHARRWPQFNPASEVGLGFIRLEDLVAFFGTDSRRHMLHADYLSTWYPKRAAERRTVLERAGKTTPFWMGTPGTP

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
210 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
211 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
215 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
220 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1
Rhizosphere 99
Stem 0
Stem Tuber 0
Unclassified 19.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100004979 3300006914 Bacteria 9129
2 Ga0065707_10018464 3300005295 Bacteria 1443
3 Ga0065707_10168097 3300005295 Bacteria 1503
4 Ga0065707_10681800 3300005295 Bacteria 637
5 Ga0070676_10000793 3300005328 Bacteria 15592
6 Ga0070676_10011848 3300005328 Bacteria 4749
7 Ga0070683_100024363 3300005329 Bacteria 5420
8 Ga0070690_100143054 3300005330 Bacteria 1625
9 Ga0070690_100273362 3300005330 Bacteria 1203
10 Ga0070690_101463981 3300005330 Bacteria 551
11 Ga0070670_100013632 3300005331 Bacteria 6966
12 Ga0070677_10636440 3300005333 Unclassified 594
13 Ga0068869_100002053 3300005334 Bacteria 12100
14 Ga0068869_100046070 3300005334 Bacteria 3143
15 Ga0068869_100148103 3300005334 Bacteria 1818
16 Ga0068869_100292000 3300005334 Bacteria 1314
17 Ga0068869_100566758 3300005334 Bacteria 956
18 Ga0070666_10075368 3300005335 Bacteria 2300
19 Ga0070680_100003802 3300005336 Bacteria 11292
20 Ga0070680_100017250 3300005336 Bacteria 5689
21 Ga0070680_100072817 3300005336 Bacteria 2825
22 Ga0070680_100839616 3300005336 Unclassified 792
23 Ga0070682_100001673 3300005337 Bacteria 12340
24 Ga0068868_100007767 3300005338 Bacteria 7656
25 Ga0068868_101998946 3300005338 Bacteria 550
26 Ga0070660_100020417 3300005339 Bacteria 4867
27 Ga0070689_100586798 3300005340 Unclassified 964
28 Ga0070689_100886112 3300005340 Bacteria 789
29 Ga0070689_101272014 3300005340 Bacteria 662
30 Ga0070689_101666567 3300005340 Unclassified 580
31 Ga0070691_10004693 3300005341 Bacteria 6217
32 Ga0070691_10024899 3300005341 Bacteria 2785
33 Ga0070691_10183286 3300005341 Bacteria 1091
34 Ga0070687_100460605 3300005343 Bacteria 848
35 Ga0070687_100531517 3300005343 Bacteria 797
36 Ga0070661_100006150 3300005344 Bacteria 8272
37 Ga0070692_10006918 3300005345 Bacteria 4960
38 Ga0070692_10021252 3300005345 Bacteria 3155
39 Ga0070692_10060721 3300005345 Bacteria 1991
40 Ga0070692_10114186 3300005345 Bacteria 1498
41 Ga0070668_100203687 3300005347 Bacteria 1625
42 Ga0070668_100383308 3300005347 Bacteria 1197
43 Ga0070668_100452472 3300005347 Bacteria 1104
44 Ga0070668_100997024 3300005347 Bacteria 753
45 Ga0070669_100013243 3300005353 Bacteria 5862
46 Ga0070669_100411974 3300005353 Bacteria 1108
47 Ga0070669_100427366 3300005353 Unclassified 1088
48 Ga0070669_100849398 3300005353 Bacteria 778
49 Ga0070669_100921864 3300005353 Bacteria 747
50 Ga0070669_101107730 3300005353 Bacteria 682
51 Ga0070675_100250854 3300005354 Bacteria 1549
52 Ga0070671_100287020 3300005355 Bacteria 1400
53 Ga0070673_100134425 3300005364 Bacteria 2080
54 Ga0070673_101230205 3300005364 Bacteria 702
55 Ga0070688_100065577 3300005365 Bacteria 2308
56 Ga0070688_100348094 3300005365 Unclassified 1084
57 Ga0070659_100005631 3300005366 Bacteria 9007
58 Ga0070659_100970452 3300005366 Bacteria 745
59 Ga0070667_100756359 3300005367 Bacteria 901
60 Ga0070667_101008252 3300005367 Bacteria 777
61 Ga0070703_10007181 3300005406 Bacteria 3127
62 Ga0070703_10359551 3300005406 Unclassified 624
63 Ga0070703_10456648 3300005406 Bacteria 567
64 Ga0070703_10519007 3300005406 Unclassified 539
65 Ga0070709_10557074 3300005434 Bacteria 878
66 Ga0070710_10223032 3300005437 Bacteria 1200
67 Ga0070701_10006578 3300005438 Bacteria 4899
68 Ga0070701_10022540 3300005438 Bacteria 3020
69 Ga0070701_10290740 3300005438 Bacteria 1001
70 Ga0070711_100215406 3300005439 Bacteria 1490
71 Ga0070711_100658233 3300005439 Bacteria 879
72 Ga0070705_100001541 3300005440 Bacteria 12106
73 Ga0070705_100007899 3300005440 Bacteria 5256
74 Ga0070705_100062121 3300005440 Bacteria 2223
75 Ga0070705_100199374 3300005440 Bacteria 1371
76 Ga0070705_100225343 3300005440 Bacteria 1301
77 Ga0070705_100284831 3300005440 Bacteria 1177
78 Ga0070705_100313208 3300005440 Unclassified 1130
79 Ga0070705_100620837 3300005440 Bacteria 839
80 Ga0070700_100052430 3300005441 Bacteria 2544
81 Ga0070700_100549883 3300005441 Unclassified 897
82 Ga0070700_100605753 3300005441 Bacteria 859
83 Ga0070700_100711653 3300005441 Bacteria 800
84 Ga0070694_100002862 3300005444 Bacteria 10250
85 Ga0070694_100004074 3300005444 Bacteria 8763
86 Ga0070694_100021189 3300005444 Bacteria 4150
87 Ga0070694_100022916 3300005444 Bacteria 4008
88 Ga0070694_100023248 3300005444 Bacteria 3984
89 Ga0070694_100075106 3300005444 Bacteria 2337
90 Ga0070694_100097527 3300005444 Bacteria 2074
91 Ga0070694_100270263 3300005444 Bacteria 1293
92 Ga0070694_100541527 3300005444 Bacteria 931
93 Ga0070694_101793027 3300005444 Bacteria 523
94 Ga0070708_100066258 3300005445 Bacteria 3241
95 Ga0070708_100188658 3300005445 Bacteria 1928
96 Ga0070708_100269001 3300005445 Bacteria 1603
97 Ga0070708_100291129 3300005445 Bacteria 1537
98 Ga0070708_100329895 3300005445 Unclassified 1437
99 Ga0070708_100448341 3300005445 Bacteria 1217
100 Ga0070708_100493976 3300005445 Unclassified 1154
101 Ga0070708_100736065 3300005445 Unclassified 927
102 Ga0070708_101468536 3300005445 Bacteria 635
103 Ga0070708_101871418 3300005445 Unclassified 556
104 Ga0070663_100001620 3300005455 Bacteria 12414
105 Ga0070663_100730061 3300005455 Bacteria 844
106 Ga0070662_100004269 3300005457 Bacteria 9017
107 Ga0070662_100059752 3300005457 Bacteria 2778
108 Ga0070662_100297191 3300005457 Bacteria 1311
109 Ga0070681_10150940 3300005458 Bacteria 2250
110 Ga0070681_10622436 3300005458 Bacteria 994
111 Ga0070681_12018583 3300005458 Unclassified 505
112 Ga0068867_100023047 3300005459 Bacteria 4455
113 Ga0068867_100039866 3300005459 Bacteria 3426
114 Ga0068867_100096419 3300005459 Unclassified 2252
115 Ga0068867_100241416 3300005459 Bacteria 1465
116 Ga0068867_100321122 3300005459 Bacteria 1283
117 Ga0068867_100340277 3300005459 Unclassified 1249
118 Ga0070706_100003379 3300005467 Bacteria 15734
119 Ga0070706_100066029 3300005467 Bacteria 3346
120 Ga0070706_100174594 3300005467 Bacteria 2006
121 Ga0070706_100316621 3300005467 Bacteria 1455
122 Ga0070706_100688034 3300005467 Unclassified 949
123 Ga0070706_101179808 3300005467 Unclassified 704
124 Ga0070707_100031417 3300005468 Bacteria 5059
125 Ga0070707_100051180 3300005468 Bacteria 3959
126 Ga0070707_100377247 3300005468 Unclassified 1378
127 Ga0070707_100719776 3300005468 Bacteria 961
128 Ga0070707_100972928 3300005468 Unclassified 814
129 Ga0070707_101020868 3300005468 Bacteria 792
130 Ga0070707_101337588 3300005468 Bacteria 683
131 Ga0070707_101366479 3300005468 Bacteria 675
132 Ga0070698_100003851 3300005471 Bacteria 16502
133 Ga0070698_100005788 3300005471 Bacteria 13523
134 Ga0070698_100050420 3300005471 Unclassified 4244
135 Ga0070698_100733840 3300005471 Bacteria 930
136 Ga0070698_101226431 3300005471 Bacteria 699
137 Ga0070698_101280917 3300005471 Bacteria 683
138 Ga0070699_100007462 3300005518 Bacteria 9515
139 Ga0070699_100056661 3300005518 Bacteria 3394
140 Ga0070699_100115982 3300005518 Bacteria 2353
141 Ga0070699_100177567 3300005518 Unclassified 1889
142 Ga0070699_100294477 3300005518 Bacteria 1455
143 Ga0070699_100580032 3300005518 Unclassified 1022
144 Ga0070699_101130446 3300005518 Unclassified 719
145 Ga0070679_100007343 3300005530 Bacteria 10297
146 Ga0070684_100002889 3300005535 Bacteria 12766
147 Ga0070697_100009746 3300005536 Bacteria 7492
148 Ga0070697_100014889 3300005536 Bacteria 6104
149 Ga0070697_100016680 3300005536 Bacteria 5778
150 Ga0070697_100219727 3300005536 Bacteria 1619
151 Ga0070697_100224848 3300005536 Bacteria 1600
152 Ga0070697_100335275 3300005536 Bacteria 1304
153 Ga0070697_100385714 3300005536 Bacteria 1214
154 Ga0070697_100401166 3300005536 Bacteria 1190
155 Ga0070697_100481704 3300005536 Unclassified 1083
156 Ga0070697_101280725 3300005536 Bacteria 654
157 Ga0068853_100368381 3300005539 Bacteria 1340
158 Ga0068853_101194819 3300005539 Unclassified 734
159 Ga0068853_102041701 3300005539 Unclassified 556
160 Ga0070672_100064841 3300005543 Bacteria 2887
161 Ga0070672_100154190 3300005543 Bacteria 1902
162 Ga0070672_100816324 3300005543 Unclassified 821
163 Ga0070672_102046474 3300005543 Unclassified 516
164 Ga0070686_100181419 3300005544 Bacteria 1496
165 Ga0070686_100727658 3300005544 Unclassified 794
166 Ga0070695_100000636 3300005545 Bacteria 18606
167 Ga0070695_100006753 3300005545 Bacteria 6791
168 Ga0070695_100019059 3300005545 Bacteria 4172
169 Ga0070695_100031455 3300005545 Bacteria 3311
170 Ga0070695_100084900 3300005545 Bacteria 2101
171 Ga0070695_100091832 3300005545 Bacteria 2029
172 Ga0070695_100174411 3300005545 Unclassified 1519
173 Ga0070695_100219262 3300005545 Bacteria 1370
174 Ga0070695_100808392 3300005545 Unclassified 752
175 Ga0070695_101049617 3300005545 Bacteria 665
176 Ga0070696_100002733 3300005546 Bacteria 11715
177 Ga0070696_100005376 3300005546 Bacteria 8543
178 Ga0070696_100025546 3300005546 Bacteria 4017
179 Ga0070696_100037595 3300005546 Bacteria 3340
180 Ga0070696_100155485 3300005546 Unclassified 1681
181 Ga0070696_100164907 3300005546 Bacteria 1634
182 Ga0070696_100288119 3300005546 Bacteria 1254
183 Ga0070696_100891055 3300005546 Bacteria 737
184 Ga0070696_100996643 3300005546 Bacteria 700
185 Ga0070693_100000439 3300005547 Bacteria 18760
186 Ga0070693_100386557 3300005547 Unclassified 967
187 Ga0070704_100011325 3300005549 Bacteria 5464
188 Ga0070704_100048472 3300005549 Bacteria 2974
189 Ga0070704_100048719 3300005549 Bacteria 2967
190 Ga0070704_100059354 3300005549 Bacteria 2729
191 Ga0070704_100075936 3300005549 Bacteria 2456
192 Ga0070704_100100911 3300005549 Bacteria 2174
193 Ga0070704_100380929 3300005549 Unclassified 1198
194 Ga0070704_100601332 3300005549 Bacteria 967
195 Ga0070704_101787197 3300005549 Bacteria 569
196 Ga0068855_100008335 3300005563 Bacteria 12530
197 Ga0070664_100011490 3300005564 Bacteria 7186
198 Ga0068857_100267344 3300005577 Bacteria 1571
199 Ga0068857_100488478 3300005577 Bacteria 1154
200 Ga0068857_102090316 3300005577 Unclassified 556
201 Ga0068854_100018950 3300005578 Bacteria 4627
202 Ga0068854_100343728 3300005578 Unclassified 1219
203 Ga0068854_100424414 3300005578 Bacteria 1105
204 Ga0068856_100003850 3300005614 Bacteria 15057
205 Ga0068856_101838473 3300005614 Unclassified 617
206 Ga0070702_100112288 3300005615 Bacteria 1692
207 Ga0070702_100163562 3300005615 Bacteria 1441
208 Ga0070702_100731516 3300005615 Bacteria 758
209 Ga0068859_100010219 3300005617 Bacteria 9445
210 Ga0068859_100204139 3300005617 Bacteria 2061
211 Ga0068859_100285229 3300005617 Bacteria 1744
212 Ga0068859_100503607 3300005617 Bacteria 1306
213 Ga0068859_100942276 3300005617 Bacteria 947
214 Ga0068864_100767891 3300005618 Bacteria 945
215 Ga0068864_100828646 3300005618 Bacteria 910
216 Ga0068866_10215582 3300005718 Bacteria 1155
217 Ga0068866_10594996 3300005718 Bacteria 746
218 Ga0068861_100048642 3300005719 Bacteria 3207
219 Ga0068861_100418985 3300005719 Bacteria 1193
220 Ga0068861_100599157 3300005719 Bacteria 1011
221 Ga0068870_10000417 3300005840 Bacteria 16024
222 Ga0068870_10018242 3300005840 Bacteria 3385
223 Ga0068863_100076909 3300005841 Bacteria 3157
224 Ga0068863_100581124 3300005841 Unclassified 1108
225 Ga0068863_100627446 3300005841 Unclassified 1065
226 Ga0068863_100672467 3300005841 Bacteria 1028
227 Ga0068858_100411661 3300005842 Unclassified 1300
228 Ga0068858_100495844 3300005842 Bacteria 1180
229 Ga0068860_100061390 3300005843 Bacteria 3571
230 Ga0068860_100175519 3300005843 Bacteria 2071
231 Ga0068860_100180609 3300005843 Bacteria 2039
232 Ga0068860_100316099 3300005843 Bacteria 1532
233 Ga0068860_100966986 3300005843 Unclassified 869
234 Ga0068860_101033635 3300005843 Bacteria 840
235 Ga0068860_101543640 3300005843 Bacteria 686
236 Ga0068860_102346500 3300005843 Bacteria 554
237 Ga0068862_100002631 3300005844 Bacteria 15813
238 Ga0068862_100026579 3300005844 Bacteria 4865
239 Ga0068862_100039230 3300005844 Bacteria 4021
240 Ga0068862_100264184 3300005844 Bacteria 1572
241 Ga0068862_102383587 3300005844 Bacteria 541
242 Ga0068862_102440934 3300005844 Unclassified 534
243 Ga0081455_10000080 3300005937 Bacteria 104190
244 Ga0081455_10136106 3300005937 Bacteria 1914
245 Ga0081540_1085026 3300005983 Bacteria 1410
246 Ga0075432_10007150 3300006058 Bacteria 3801
247 Ga0075432_10374393 3300006058 Unclassified 609
248 Ga0070715_10067314 3300006163 Bacteria 1590
249 Ga0070716_100010320 3300006173 Bacteria 4680
250 Ga0070712_100004295 3300006175 Bacteria 8777
251 Ga0070712_100266456 3300006175 Bacteria 1375
252 Ga0068871_100976505 3300006358 Bacteria 788
253 Ga0068871_102319683 3300006358 Bacteria 512
254 Ga0075428_100002385 3300006844 Bacteria 20397
255 Ga0075428_100028397 3300006844 Bacteria 6188
256 Ga0075428_100079541 3300006844 Bacteria 3578
257 Ga0075428_100305245 3300006844 Bacteria 1711
258 Ga0075430_100000034 3300006846 Bacteria 70046
259 Ga0075430_100432343 3300006846 Bacteria 1086
260 Ga0075430_100485045 3300006846 Unclassified 1020
261 Ga0075430_100935764 3300006846 Bacteria 714
262 Ga0075431_100000281 3300006847 Bacteria 39748
263 Ga0075431_100001229 3300006847 Bacteria 23220
264 Ga0075431_100182386 3300006847 Bacteria 2154
265 Ga0075431_100238987 3300006847 Bacteria 1848
266 Ga0075431_100244153 3300006847 Bacteria 1826
267 Ga0075431_100477694 3300006847 Bacteria 1239
268 Ga0075431_100514343 3300006847 Bacteria 1187
269 Ga0075431_100726219 3300006847 Unclassified 970
270 Ga0075433_10003389 3300006852 Bacteria 12309
271 Ga0075433_10006568 3300006852 Bacteria 9207
272 Ga0075433_10025226 3300006852 Bacteria 5024
273 Ga0075433_10102441 3300006852 Bacteria 2535
274 Ga0075433_10125025 3300006852 Bacteria 2284
275 Ga0075433_10142443 3300006852 Bacteria 2131
276 Ga0075433_10218568 3300006852 Bacteria 1693
277 Ga0075433_10352338 3300006852 Unclassified 1301
278 Ga0075433_10437488 3300006852 Unclassified 1153
279 Ga0075433_10559576 3300006852 Unclassified 1005
280 Ga0075433_11123815 3300006852 Unclassified 683
281 Ga0075434_100003335 3300006871 Bacteria 14367
282 Ga0075434_100007549 3300006871 Bacteria 10075
283 Ga0075434_100020422 3300006871 Bacteria 6426
284 Ga0075434_100028009 3300006871 Bacteria 5532
285 Ga0075434_100061172 3300006871 Bacteria 3746
286 Ga0075434_100227097 3300006871 Bacteria 1886
287 Ga0075434_100749511 3300006871 Unclassified 993
288 Ga0075434_101278941 3300006871 Bacteria 745
289 Ga0075429_100010800 3300006880 Bacteria 7897
290 Ga0075429_100077083 3300006880 Bacteria 2904
291 Ga0075429_100179469 3300006880 Bacteria 1856
292 Ga0075429_100236675 3300006880 Bacteria 1599
293 Ga0075429_100258520 3300006880 Bacteria 1524
294 Ga0075429_100993150 3300006880 Unclassified 734
295 Ga0075429_101953515 3300006880 Bacteria 508
296 Ga0068865_100127012 3300006881 Bacteria 1905
297 Ga0068865_100456999 3300006881 Unclassified 1057
298 Ga0068865_100743278 3300006881 Bacteria 842
299 Ga0068865_100756975 3300006881 Unclassified 835
300 Ga0068865_100989786 3300006881 Unclassified 736
301 Ga0075436_100016366 3300006914 Bacteria 5075
302 Ga0075436_100060978 3300006914 Bacteria 2606
303 Ga0075436_100102030 3300006914 Bacteria 1998
304 Ga0075436_100335639 3300006914 Bacteria 1087
305 Ga0075436_100359619 3300006914 Bacteria 1050
306 Ga0075436_100398917 3300006914 Bacteria 996
307 Ga0075436_101155983 3300006914 Bacteria 583
308 Ga0097620_100010219 3300006931 Bacteria 9445
309 Ga0097620_100204154 3300006931 Bacteria 2061
310 Ga0097620_100285246 3300006931 Bacteria 1744
311 Ga0097620_100503679 3300006931 Bacteria 1306
312 Ga0097620_100942244 3300006931 Bacteria 947
313 Ga0075435_100001787 3300007076 Bacteria 13994
314 Ga0075435_100129929 3300007076 Bacteria 2107
315 Ga0075435_100142468 3300007076 Bacteria 2012
316 Ga0075435_100157559 3300007076 Bacteria 1911
317 Ga0075435_100305645 3300007076 Bacteria 1361
318 Ga0075435_100500402 3300007076 Bacteria 1051
319 Ga0075435_100517655 3300007076 Bacteria 1032
320 Ga0075435_100553318 3300007076 Unclassified 996
321 Ga0075435_100568475 3300007076 Bacteria 982
322 Ga0075435_100652530 3300007076 Bacteria 913
323 Ga0075435_100659455 3300007076 Bacteria 908
324 Ga0075435_101707524 3300007076 Bacteria 552
325 Ga0099794_10001322 3300007265 Bacteria 8600
326 Ga0099794_10725773 3300007265 Unclassified 530
327 Ga0099795_10094208 3300007788 Bacteria 1165
328 Ga0105240_11842803 3300009093 Bacteria 630
329 Ga0111539_10002043 3300009094 Bacteria 26984
330 Ga0111539_10007553 3300009094 Bacteria 13898
331 Ga0111539_10063471 3300009094 Bacteria 4371
332 Ga0111539_10105391 3300009094 Unclassified 3308
333 Ga0111539_10143511 3300009094 Bacteria 2795
334 Ga0111539_10594860 3300009094 Bacteria 1288
335 Ga0105245_10129731 3300009098 Bacteria 2364
336 Ga0105245_10764380 3300009098 Bacteria 1003
337 Ga0105245_11625589 3300009098 Bacteria 698
338 Ga0105245_12460150 3300009098 Unclassified 574
339 Ga0105247_10111079 3300009101 Bacteria 1765
340 Ga0114129_10019248 3300009147 Bacteria 9725
341 Ga0114129_10098016 3300009147 Bacteria 4058
342 Ga0114129_10107946 3300009147 Bacteria 3844
343 Ga0114129_10113267 3300009147 Bacteria 3741
344 Ga0114129_10163744 3300009147 Unclassified 3036
345 Ga0114129_10210148 3300009147 Bacteria 2631
346 Ga0114129_10259987 3300009147 Bacteria 2327
347 Ga0114129_10509609 3300009147 Unclassified 1570
348 Ga0114129_10724596 3300009147 Bacteria 1276
349 Ga0114129_10840108 3300009147 Unclassified 1168
350 Ga0114129_10979580 3300009147 Unclassified 1066
351 Ga0114129_10997814 3300009147 Bacteria 1055
352 Ga0114129_12074175 3300009147 Bacteria 686
353 Ga0114129_12788953 3300009147 Unclassified 581
354 Ga0105243_10019273 3300009148 Bacteria 5171
355 Ga0105243_10036389 3300009148 Bacteria 3821
356 Ga0105243_10146336 3300009148 Bacteria 2022
357 Ga0105243_10152728 3300009148 Bacteria 1982
358 Ga0105243_10469462 3300009148 Bacteria 1185
359 Ga0105243_10866382 3300009148 Bacteria 896
360 Ga0105243_12170848 3300009148 Unclassified 592
361 Ga0105243_12301227 3300009148 Unclassified 576
362 Ga0105241_10029731 3300009174 Bacteria 4078
363 Ga0105241_10129563 3300009174 Bacteria 2041
364 Ga0105241_11014929 3300009174 Bacteria 777
365 Ga0105242_10052026 3300009176 Bacteria 3340
366 Ga0105242_10660637 3300009176 Unclassified 1018
367 Ga0105242_11478205 3300009176 Bacteria 709
368 Ga0105242_11849719 3300009176 Unclassified 643
369 Ga0105242_12221524 3300009176 Unclassified 594
370 Ga0105248_10162520 3300009177 Bacteria 2518
371 Ga0105248_10387115 3300009177 Bacteria 1574
372 Ga0105248_10492848 3300009177 Bacteria 1381
373 Ga0105248_11703850 3300009177 Unclassified 715
374 Ga0105248_11737615 3300009177 Unclassified 707
375 Ga0105237_10966700 3300009545 Bacteria 858
376 Ga0105238_11650293 3300009551 Bacteria 671
377 Ga0105249_10046874 3300009553 Bacteria 3935
378 Ga0105249_10047904 3300009553 Bacteria 3896
379 Ga0105249_10056174 3300009553 Bacteria 3604
380 Ga0105249_10440935 3300009553 Unclassified 1339
381 Ga0105249_10507620 3300009553 Bacteria 1252
382 Ga0105249_10674804 3300009553 Unclassified 1092
383 Ga0105249_11298016 3300009553 Bacteria 799
384 Ga0105249_11653635 3300009553 Bacteria 713
385 Ga0105239_10319220 3300010375 Bacteria 1751
386 Ga0105239_10400917 3300010375 Bacteria 1552
387 Ga0105246_10515536 3300011119 Bacteria 1018
388 Ga0105246_10658602 3300011119 Bacteria 912
389 Ga0157373_10002202 3300013100 Bacteria 14755
390 Ga0157371_10084346 3300013102 Bacteria 2250
391 Ga0157371_10465807 3300013102 Bacteria 930
392 Ga0157369_10489347 3300013105 Bacteria 1273
393 Ga0157378_10186919 3300013297 Unclassified 1952
394 Ga0157378_10916902 3300013297 Unclassified 907
395 Ga0163162_10011523 3300013306 Bacteria 8623
396 Ga0163162_10183251 3300013306 Bacteria 2220
397 Ga0163162_10285271 3300013306 Bacteria 1783
398 Ga0163162_10341099 3300013306 Bacteria 1631
399 Ga0163162_11280483 3300013306 Bacteria 833
400 Ga0163162_12887375 3300013306 Bacteria 553
401 Ga0157372_10270982 3300013307 Bacteria 1973
402 Ga0157372_10416241 3300013307 Bacteria 1566
403 Ga0157372_11061630 3300013307 Bacteria 937
404 Ga0157375_10040315 3300013308 Bacteria 4501
405 Ga0157375_10203944 3300013308 Bacteria 2134
406 Ga0157375_10261659 3300013308 Bacteria 1892
407 Ga0157375_11177707 3300013308 Unclassified 899
408 Ga0157375_12573118 3300013308 Bacteria 608
409 Ga0157375_13445003 3300013308 Bacteria 527
410 Ga0163163_10465118 3300014325 Bacteria 1325
411 Ga0163163_10492901 3300014325 Bacteria 1287
412 Ga0157380_10253441 3300014326 Bacteria 1594
413 Ga0157380_10881158 3300014326 Bacteria 919
414 Ga0157379_11223050 3300014968 Bacteria 723
415 Ga0157376_10920025 3300014969 Unclassified 893
416 Ga0182007_10082489 3300015262 Bacteria 1055
417 Ga0163161_11165954 3300017792 Bacteria 665
418 Ga0206356_10843478 3300020070 Bacteria 1219
419 Ga0206353_11382503 3300020082 Bacteria 1001
420 Ga0207653_10014697 3300025885 Bacteria 2456
421 Ga0207642_10287831 3300025899 Bacteria 948
422 Ga0207642_10324822 3300025899 Bacteria 900
423 Ga0207642_10599156 3300025899 Bacteria 686
424 Ga0207710_10230974 3300025900 Bacteria 921
425 Ga0207688_10168436 3300025901 Bacteria 1302
426 Ga0207680_10127492 3300025903 Bacteria 1673
427 Ga0207680_10901640 3300025903 Unclassified 634
428 Ga0207685_10250224 3300025905 Bacteria 857
429 Ga0207685_10452435 3300025905 Bacteria 668
430 Ga0207699_10162197 3300025906 Unclassified 1489
431 Ga0207699_10405971 3300025906 Bacteria 971
432 Ga0207645_10000290 3300025907 Bacteria 42058
433 Ga0207645_10012920 3300025907 Bacteria 5651
434 Ga0207643_10000482 3300025908 Bacteria 25722
435 Ga0207643_10056577 3300025908 Bacteria 2231
436 Ga0207684_10003244 3300025910 Bacteria 15956
437 Ga0207684_10016346 3300025910 Bacteria 6372
438 Ga0207684_10068836 3300025910 Bacteria 3008
439 Ga0207684_10129580 3300025910 Bacteria 2165
440 Ga0207684_10140646 3300025910 Bacteria 2074
441 Ga0207684_10363472 3300025910 Bacteria 1245
442 Ga0207684_10484074 3300025910 Bacteria 1061
443 Ga0207654_10087613 3300025911 Bacteria 1890
444 Ga0207654_10219482 3300025911 Bacteria 1260
445 Ga0207707_10001856 3300025912 Bacteria 19311
446 Ga0207707_10322375 3300025912 Bacteria 1334
447 Ga0207695_10709250 3300025913 Bacteria 886
448 Ga0207671_10587060 3300025914 Bacteria 888
449 Ga0207693_10006750 3300025915 Bacteria 9477
450 Ga0207693_10263706 3300025915 Bacteria 1350
451 Ga0207663_10953733 3300025916 Bacteria 687
452 Ga0207660_10062776 3300025917 Bacteria 2677
453 Ga0207660_10131202 3300025917 Unclassified 1907
454 Ga0207660_10167967 3300025917 Unclassified 1697
455 Ga0207662_10159328 3300025918 Bacteria 1441
456 Ga0207662_10751096 3300025918 Bacteria 686
457 Ga0207657_10000158 3300025919 Bacteria 69402
458 Ga0207649_10002003 3300025920 Bacteria 11591
459 Ga0207652_10001521 3300025921 Bacteria 20469
460 Ga0207646_10012309 3300025922 Bacteria 8227
461 Ga0207646_10025576 3300025922 Bacteria 5399
462 Ga0207646_10027397 3300025922 Bacteria 5197
463 Ga0207646_10047754 3300025922 Bacteria 3839
464 Ga0207646_10091326 3300025922 Bacteria 2725
465 Ga0207646_10115375 3300025922 Bacteria 2412
466 Ga0207646_10325897 3300025922 Bacteria 1388
467 Ga0207646_10965033 3300025922 Bacteria 754
468 Ga0207646_11092117 3300025922 Unclassified 702
469 Ga0207681_10019121 3300025923 Bacteria 4325
470 Ga0207681_10046441 3300025923 Bacteria 2921
471 Ga0207681_10083087 3300025923 Bacteria 2266
472 Ga0207681_10289268 3300025923 Bacteria 1293
473 Ga0207681_10368379 3300025923 Bacteria 1154
474 Ga0207681_10682530 3300025923 Unclassified 853
475 Ga0207681_11398423 3300025923 Unclassified 587
476 Ga0207694_11133471 3300025924 Bacteria 662
477 Ga0207650_10183357 3300025925 Bacteria 1669
478 Ga0207687_10201920 3300025927 Bacteria 1554
479 Ga0207690_10001543 3300025932 Bacteria 14416
480 Ga0207706_10008540 3300025933 Bacteria 9437
481 Ga0207706_10047416 3300025933 Bacteria 3801
482 Ga0207706_10056083 3300025933 Bacteria 3474
483 Ga0207706_10107633 3300025933 Bacteria 2453
484 Ga0207706_10231880 3300025933 Bacteria 1615
485 Ga0207686_10063374 3300025934 Bacteria 2350
486 Ga0207686_11634024 3300025934 Bacteria 532
487 Ga0207709_10036676 3300025935 Bacteria 2907
488 Ga0207709_10197233 3300025935 Unclassified 1435
489 Ga0207709_10338185 3300025935 Bacteria 1132
490 Ga0207709_10506267 3300025935 Bacteria 943
491 Ga0207709_10652900 3300025935 Unclassified 838
492 Ga0207709_11003721 3300025935 Unclassified 682
493 Ga0207709_11633781 3300025935 Bacteria 535
494 Ga0207709_11657806 3300025935 Unclassified 531
495 Ga0207670_10135468 3300025936 Unclassified 1810
496 Ga0207670_10217984 3300025936 Bacteria 1459
497 Ga0207670_10500331 3300025936 Bacteria 987
498 Ga0207670_11204795 3300025936 Unclassified 641
499 Ga0207704_10264995 3300025938 Unclassified 1297
500 Ga0207704_10512251 3300025938 Bacteria 969
501 Ga0207704_10612011 3300025938 Bacteria 893
502 Ga0207665_10001514 3300025939 Bacteria 15638
503 Ga0207665_10478242 3300025939 Bacteria 959
504 Ga0207691_10015161 3300025940 Bacteria 7334
505 Ga0207691_11478136 3300025940 Unclassified 556
506 Ga0207711_10211408 3300025941 Bacteria 1772
507 Ga0207711_10458241 3300025941 Bacteria 1187
508 Ga0207711_11613652 3300025941 Unclassified 592
509 Ga0207689_10000425 3300025942 Bacteria 39512
510 Ga0207689_10040379 3300025942 Bacteria 3862
511 Ga0207689_10134723 3300025942 Bacteria 2034
512 Ga0207689_10207500 3300025942 Bacteria 1618
513 Ga0207661_10030238 3300025944 Bacteria 4170
514 Ga0207679_10003606 3300025945 Bacteria 9604
515 Ga0207667_10003229 3300025949 Bacteria 20130
516 Ga0207712_10013031 3300025961 Bacteria 5326
517 Ga0207712_10032621 3300025961 Bacteria 3515
518 Ga0207712_10118425 3300025961 Bacteria 1999
519 Ga0207712_10238180 3300025961 Bacteria 1465
520 Ga0207712_10583522 3300025961 Bacteria 965
521 Ga0207712_11828666 3300025961 Unclassified 544
522 Ga0207668_10257348 3300025972 Bacteria 1421
523 Ga0207668_10447670 3300025972 Unclassified 1101
524 Ga0207668_10705574 3300025972 Unclassified 887
525 Ga0207640_10043658 3300025981 Bacteria 2866
526 Ga0207640_10167588 3300025981 Bacteria 1633
527 Ga0207640_10665128 3300025981 Unclassified 889
528 Ga0207658_10318974 3300025986 Bacteria 1345
529 Ga0207677_10241075 3300026023 Bacteria 1463
530 Ga0207703_10287440 3300026035 Bacteria 1495
531 Ga0207639_10068980 3300026041 Bacteria 2757
532 Ga0207639_11704655 3300026041 Unclassified 590
533 Ga0207678_10001467 3300026067 Bacteria 21633
534 Ga0207678_10844559 3300026067 Bacteria 809
535 Ga0207708_10021275 3300026075 Bacteria 4890
536 Ga0207708_10372955 3300026075 Bacteria 1175
537 Ga0207708_11369990 3300026075 Bacteria 620
538 Ga0207702_10082235 3300026078 Bacteria 2799
539 Ga0207641_10331604 3300026088 Bacteria 1445
540 Ga0207641_10545245 3300026088 Bacteria 1130
541 Ga0207641_11018249 3300026088 Unclassified 825
542 Ga0207641_12100681 3300026088 Unclassified 566
543 Ga0207648_10001313 3300026089 Bacteria 27657
544 Ga0207648_10065151 3300026089 Bacteria 3176
545 Ga0207648_10068928 3300026089 Bacteria 3082
546 Ga0207648_10081994 3300026089 Bacteria 2813
547 Ga0207648_10501739 3300026089 Unclassified 1110
548 Ga0207648_11513698 3300026089 Unclassified 631
549 Ga0207676_10268284 3300026095 Bacteria 1544
550 Ga0207674_10004140 3300026116 Bacteria 17546
551 Ga0207674_10014924 3300026116 Bacteria 8561
552 Ga0207674_10077913 3300026116 Bacteria 3320
553 Ga0207674_10291874 3300026116 Bacteria 1579
554 Ga0207674_11345588 3300026116 Unclassified 684
555 Ga0207675_100131809 3300026118 Bacteria 2370
556 Ga0207675_100135053 3300026118 Bacteria 2340
557 Ga0207675_100478487 3300026118 Bacteria 1237
558 Ga0207675_100566268 3300026118 Bacteria 1137
559 Ga0207675_102269485 3300026118 Unclassified 557
560 Ga0207698_10732659 3300026142 Bacteria 986
561 Ga0209984_1046439 3300027424 Bacteria 631
562 Ga0210000_1009484 3300027462 Bacteria 1433
563 Ga0209968_1021447 3300027526 Bacteria 1049
564 Ga0209999_1001223 3300027543 Bacteria 4414
565 Ga0209970_1001329 3300027614 Bacteria 4338
566 Ga0210002_1016838 3300027617 Bacteria 1159
567 Ga0209983_1003515 3300027665 Bacteria 3339
568 Ga0209588_1008766 3300027671 Bacteria 3007
569 Ga0209971_1000005 3300027682 Bacteria 108671
570 Ga0209971_1074177 3300027682 Unclassified 827
571 Ga0209966_1000010 3300027695 Bacteria 86172
572 Ga0209966_1106188 3300027695 Bacteria 637
573 Ga0209998_10000023 3300027717 Bacteria 65076
574 Ga0209998_10044277 3300027717 Bacteria 1017
575 Ga0209974_10000464 3300027876 Bacteria 13490
576 Ga0207428_10000276 3300027907 Bacteria 69031
577 Ga0207428_10002151 3300027907 Bacteria 19792
578 Ga0207428_10023978 3300027907 Bacteria 5124
579 Ga0207428_10341066 3300027907 Bacteria 1104
580 Ga0268265_10020825 3300028380 Bacteria 4583
581 Ga0268265_10145731 3300028380 Bacteria 1989
582 Ga0268265_10192885 3300028380 Bacteria 1761
583 Ga0268265_10195095 3300028380 Bacteria 1752
584 Ga0268265_10643007 3300028380 Bacteria 1019
585 Ga0268265_10684843 3300028380 Bacteria 989
586 Ga0268265_12068926 3300028380 Bacteria 576
587 Ga0268264_10165774 3300028381 Bacteria 1994
588 Ga0268264_10694506 3300028381 Bacteria 1010
589 Ga0268264_10874747 3300028381 Bacteria 901
590 Ga0268264_10887363 3300028381 Unclassified 894
591 Ga0268264_10912977 3300028381 Unclassified 882
592 Ga0268264_11818733 3300028381 Bacteria 619
593 Ga0268264_12256103 3300028381 Unclassified 552
594 Ga0307408_100034196 3300031548 Bacteria 3558
595 Ga0307408_100039290 3300031548 Bacteria 3344
596 Ga0307410_10247620 3300031852 Bacteria 1384
597 Ga0307406_10368250 3300031901 Bacteria 1129
598 Ga0307406_10961810 3300031901 Bacteria 730
599 Ga0307407_10438973 3300031903 Bacteria 945
600 Ga0307407_10555046 3300031903 Bacteria 850
601 Ga0307409_100155967 3300031995 Bacteria 1989
602 Ga0307409_100212376 3300031995 Bacteria 1740
603 Ga0307416_100004866 3300032002 Bacteria 8176
604 Ga0307416_101613871 3300032002 Bacteria 754
605 Ga0307416_101707280 3300032002 Bacteria 734
606 Ga0307416_103390582 3300032002 Unclassified 533
607 Ga0307414_11173060 3300032004 Bacteria 711
608 Ga0307411_10142688 3300032005 Bacteria 1768
609 Ga0307411_10282796 3300032005 Unclassified 1321
610 Ga0307415_101690692 3300032126 Bacteria 610
611 Ga0373930_0043049 3300034816 Unclassified 968
612 Ga0373948_0014616 3300034817 Bacteria 1432
613 Ga0373938_0257310 3300034957 Bacteria 501
614 Ga0373940_0021007 3300035088 Bacteria 1664
615 Ga0373940_0223696 3300035088 Bacteria 626
616 Ga0373949_0048902 3300035090 Bacteria 1060
617 Ga0373949_0130161 3300035090 Unclassified 713
618 Ga0373951_0042731 3300035091 Bacteria 1097
619 Ga0373952_0030493 3300035092 Bacteria 1194
620 Ga0373932_0021309 3300035112 Bacteria 1710
621 Ga0373932_0029771 3300035112 Bacteria 1509
622 Ga0373932_0081463 3300035112 Bacteria 1023
623 Ga0373932_0137002 3300035112 Bacteria 829
624 Ga0373939_0022504 3300035114 Bacteria 1738
625 Ga0373939_0027201 3300035114 Bacteria 1618
626 Ga0373941_0058453 3300035115 Unclassified 1248
627 Ga0373941_0218976 3300035115 Bacteria 731
628 Ga0373941_0224164 3300035115 Bacteria 724
629 Ga0373960_0048327 3300035121 Bacteria 1255
630 Ga0373942_0176282 3300035207 Bacteria 698
631 Ga0373962_0030135 3300035242 Bacteria 1483
632 Ga0373962_0070683 3300035242 Bacteria 1042
633 Ga0373962_0227493 3300035242 Unclassified 640
634 Ga0373931_0092538 3300035691 Bacteria 1687
635 Ga0373931_0406906 3300035691 Bacteria 862
636 Ga0373931_1024420 3300035691 Bacteria 559
637 Ga0242420_048752 3300038996 Bacteria 824
638 Ga0439437_036521 3300042000 Unclassified 629
639 Ga0439441_013035 3300042001 Bacteria 1436
640 Ga0439441_085998 3300042001 Unclassified 690
641 Ga0439448_0000678 3300042005 Bacteria 8135
642 Ga0439448_0069255 3300042005 Bacteria 1174
643 Ga0439455_0052959 3300042012 Bacteria 1063
644 Ga0439463_076189 3300042016 Bacteria 861
645 Ga0450890_035150 3300042127 Bacteria 726
646 Ga0439458_0017593 3300042157 Bacteria 1634
647 Ga0439435_0063560 3300042436 Unclassified 1080
648 Ga0439444_0103208 3300042437 Bacteria 648
649 Ga0439444_0124819 3300042437 Bacteria 604
650 Ga0439459_0001810 3300042438 Bacteria 3214
651 Ga0439464_0010970 3300042439 Bacteria 2395
652 Ga0439460_0000314 3300042461 Bacteria 10206
653 Ga0439460_0037069 3300042461 Bacteria 1417
654 Ga0451577_0020330 3300042876 Bacteria 6094
655 Ga0451577_0061662 3300042876 Bacteria 3344
656 Ga0451577_0087844 3300042876 Bacteria 2774
657 Ga0451577_0248786 3300042876 Bacteria 1609
658 Ga0451577_2019548 3300042876 Unclassified 504
659 Ga0453683_0239845 3300044673 Bacteria 1155
660 Ga0453683_0432087 3300044673 Unclassified 850
661 Ga0453683_0987531 3300044673 Unclassified 559
662 Ga0453684_0018602 3300044712 Bacteria 10651
663 Ga0453684_0090401 3300044712 Bacteria 3783
664 Ga0453684_0158659 3300044712 Bacteria 2678
665 Ga0453684_1929691 3300044712 Bacteria 597
666 Ga0451576_0020221 3300045051 Bacteria 7250
667 Ga0451576_0025380 3300045051 Bacteria 6383
668 Ga0451576_0093511 3300045051 Bacteria 3126
669 Ga0451576_0391163 3300045051 Bacteria 1457
670 Ga0451576_0451537 3300045051 Bacteria 1349
671 Ga0451576_0465771 3300045051 Bacteria 1327
672 Ga0451576_0646223 3300045051 Bacteria 1111
673 Ga0451576_2558835 3300045051 Unclassified 521
674 Ga0495580_0056808 3300046472 Bacteria 2756
675 Ga0495580_0072895 3300046472 Bacteria 2397
676 Ga0495580_0225730 3300046472 Bacteria 1286
677 Ga0495580_0650327 3300046472 Unclassified 693
678 Ga0495584_0103348 3300046491 Bacteria 1441
679 Ga0495663_0228469 3300046525 Unclassified 656
680 Ga0495642_0020490 3300046528 Bacteria 2597
681 Ga0495642_0149261 3300046528 Bacteria 1011
682 Ga0495598_0466204 3300046537 Bacteria 502
683 Ga0495656_0244633 3300046615 Unclassified 904
684 Ga0495656_0759330 3300046615 Unclassified 523
685 Ga0495611_0292872 3300046648 Unclassified 751
686 Ga0495659_0269911 3300046664 Unclassified 713
687 Ga0495659_0277261 3300046664 Bacteria 704
688 Ga0495659_0415543 3300046664 Unclassified 582
689 Ga0495669_0047771 3300046684 Bacteria 1913
690 Ga0495670_0740956 3300046691 Unclassified 536
691 Ga0495677_0103177 3300047445 Bacteria 1081
692 Ga0496100_0917477 3300048903 Bacteria 688
693 Ga0496102_0007307 3300048905 Bacteria 9429
694 Ga0496102_0160505 3300048905 Bacteria 2114
695 Ga0496102_0943613 3300048905 Unclassified 784
696 Ga0496103_0151051 3300048906 Bacteria 1488
697 Ga0496107_0085910 3300048910 Bacteria 2296
698 Ga0496108_1364326 3300048911 Unclassified 594
699 Ga0496109_0542496 3300048912 Bacteria 1097
700 Ga0496112_0218919 3300048915 Bacteria 1860
701 Ga0496113_0415113 3300048916 Bacteria 1081
702 Ga0501031_0141600 3300049568 Bacteria 1572
703 Ga0501031_0357848 3300049568 Bacteria 945
704 Ga0501031_0483460 3300049568 Unclassified 799
705 Ga0501032_0222261 3300049569 Bacteria 1229
706 Ga0501032_0597294 3300049569 Unclassified 702
707 Ga0501033_0062130 3300049570 Bacteria 2751
708 Ga0501033_0117179 3300049570 Bacteria 1935
709 Ga0501033_0215878 3300049570 Bacteria 1367
710 Ga0501033_0262998 3300049570 Bacteria 1221
711 Ga0501033_0556286 3300049570 Bacteria 790
712 Ga0501036_0109022 3300049572 Bacteria 2340
713 Ga0501036_0144176 3300049572 Bacteria 2009
714 Ga0501036_0357405 3300049572 Bacteria 1220
715 Ga0501036_0393893 3300049572 Bacteria 1156
716 Ga0501036_0542706 3300049572 Unclassified 966
717 Ga0501036_1365613 3300049572 Bacteria 575
718 Ga0501037_0549703 3300049573 Bacteria 779
719 Ga0501037_0925831 3300049573 Bacteria 570
720 Ga0501038_0080163 3300049574 Bacteria 2752
721 Ga0501038_0184818 3300049574 Bacteria 1680
722 Ga0501038_0469060 3300049574 Bacteria 966
723 Ga0501038_1266005 3300049574 Bacteria 534
724 Ga0501039_0155566 3300049575 Bacteria 1796
725 Ga0501039_0345818 3300049575 Bacteria 1169
726 Ga0501039_0599174 3300049575 Unclassified 864
727 Ga0501039_0621844 3300049575 Unclassified 846
728 Ga0501039_0716878 3300049575 Bacteria 782
729 Ga0501039_1028893 3300049575 Bacteria 639
730 Ga0501040_0026323 3300049576 Bacteria 3912
731 Ga0501040_0032784 3300049576 Bacteria 3516
732 Ga0501040_0075516 3300049576 Bacteria 2329
733 Ga0501040_0076278 3300049576 Bacteria 2318
734 Ga0501040_0101684 3300049576 Bacteria 2005
735 Ga0501040_0275028 3300049576 Bacteria 1203
736 Ga0501040_0310002 3300049576 Unclassified 1128
737 Ga0501040_0315227 3300049576 Bacteria 1118
738 Ga0501040_0315239 3300049576 Bacteria 1118
739 Ga0501040_0341784 3300049576 Unclassified 1072
740 Ga0501040_0381910 3300049576 Unclassified 1011
741 Ga0501040_0824700 3300049576 Bacteria 671
742 Ga0501041_0011242 3300049577 Bacteria 5289
743 Ga0501041_0054206 3300049577 Bacteria 2446
744 Ga0501041_0072652 3300049577 Bacteria 2114
745 Ga0501041_0159947 3300049577 Bacteria 1408
746 Ga0501041_0246972 3300049577 Bacteria 1122
747 Ga0501041_0427341 3300049577 Bacteria 840
748 Ga0501041_0831028 3300049577 Bacteria 593
749 Ga0501042_0005993 3300049578 Bacteria 7868
750 Ga0501042_0057825 3300049578 Bacteria 2767
751 Ga0501042_0097136 3300049578 Bacteria 2117
752 Ga0501042_0133860 3300049578 Bacteria 1787
753 Ga0501042_0351755 3300049578 Bacteria 1066
754 Ga0501042_0372617 3300049578 Unclassified 1033
755 Ga0501042_0653855 3300049578 Unclassified 764
756 Ga0501042_1149333 3300049578 Unclassified 566
757 Ga0501042_1331274 3300049578 Bacteria 524
758 Ga0501043_0225769 3300049579 Bacteria 1448
759 Ga0501043_0257406 3300049579 Bacteria 1343
760 Ga0501043_1301758 3300049579 Unclassified 507
761 Ga0501046_0001215 3300049580 Bacteria 24954
762 Ga0501046_0050939 3300049580 Bacteria 3269
763 Ga0501046_0098183 3300049580 Bacteria 2249
764 Ga0501046_0230206 3300049580 Bacteria 1370
765 Ga0501047_1257069 3300049581 Unclassified 554
766 Ga0501048_0003092 3300049582 Bacteria 12693
767 Ga0501048_0065312 3300049582 Bacteria 2573
768 Ga0501048_0344138 3300049582 Bacteria 1063
769 Ga0501048_0392588 3300049582 Bacteria 991
770 Ga0501048_0557232 3300049582 Bacteria 822
771 Ga0501048_1012765 3300049582 Unclassified 597
772 Ga0501048_1159250 3300049582 Bacteria 556
773 Ga0501048_1167279 3300049582 Unclassified 554
774 Ga0501067_0058067 3300049583 Bacteria 2143
775 Ga0501067_0647908 3300049583 Bacteria 593
776 Ga0501068_0261581 3300049584 Bacteria 1104
777 Ga0501068_0273894 3300049584 Unclassified 1078
778 Ga0501068_0300299 3300049584 Bacteria 1028
779 Ga0501068_0543911 3300049584 Unclassified 755
780 Ga0501068_0568448 3300049584 Unclassified 738
781 Ga0501068_0942018 3300049584 Unclassified 569
782 Ga0501069_0353518 3300049585 Bacteria 866
783 Ga0501069_0842948 3300049585 Bacteria 556
784 Ga0501070_0752103 3300049586 Unclassified 768
785 Ga0501070_1217236 3300049586 Bacteria 577
786 Ga0501071_0078047 3300049587 Bacteria 2420
787 Ga0501071_0139077 3300049587 Bacteria 1808
788 Ga0501071_0280335 3300049587 Bacteria 1261
789 Ga0501071_0302233 3300049587 Bacteria 1213
790 Ga0501071_0341413 3300049587 Bacteria 1139
791 Ga0501071_0362427 3300049587 Bacteria 1104
792 Ga0501071_0854497 3300049587 Unclassified 702
793 Ga0501071_0882038 3300049587 Bacteria 690
794 Ga0501072_0012951 3300049588 Bacteria 6381
795 Ga0501072_0014845 3300049588 Bacteria 5971
796 Ga0501072_0043264 3300049588 Bacteria 3539
797 Ga0501072_0115943 3300049588 Bacteria 2133
798 Ga0501072_0338933 3300049588 Bacteria 1194
799 Ga0501072_0342590 3300049588 Bacteria 1187
800 Ga0501072_0473286 3300049588 Unclassified 992
801 Ga0501072_0585236 3300049588 Bacteria 880
802 Ga0501072_1374471 3300049588 Unclassified 546
803 Ga0501074_0003061 3300049590 Bacteria 11789
804 Ga0501074_0127291 3300049590 Bacteria 1823
805 Ga0501074_0131214 3300049590 Bacteria 1792
806 Ga0501074_0532630 3300049590 Unclassified 832
807 Ga0501074_0943503 3300049590 Unclassified 607
808 Ga0501074_1222069 3300049590 Unclassified 527
809 Ga0501075_0099859 3300049591 Bacteria 2204
810 Ga0501075_0209333 3300049591 Bacteria 1487
811 Ga0501075_0209743 3300049591 Bacteria 1486
812 Ga0501075_0215542 3300049591 Bacteria 1464
813 Ga0501075_0230422 3300049591 Bacteria 1413
814 Ga0501075_0347940 3300049591 Unclassified 1129
815 Ga0501075_0377033 3300049591 Unclassified 1081
816 Ga0501075_0665142 3300049591 Bacteria 794
817 Ga0501076_0019298 3300049592 Bacteria 5210
818 Ga0501076_0052056 3300049592 Bacteria 3242
819 Ga0501076_0059592 3300049592 Bacteria 3037
820 Ga0501076_0085124 3300049592 Bacteria 2540
821 Ga0501076_0161390 3300049592 Bacteria 1826
822 Ga0501076_0179017 3300049592 Bacteria 1728
823 Ga0501076_0188647 3300049592 Unclassified 1682
824 Ga0501076_0222472 3300049592 Bacteria 1542
825 Ga0501076_0230653 3300049592 Bacteria 1513
826 Ga0501076_0267343 3300049592 Bacteria 1400
827 Ga0501076_0300220 3300049592 Bacteria 1316
828 Ga0501076_0401878 3300049592 Bacteria 1126
829 Ga0501076_1485364 3300049592 Bacteria 556
830 Ga0501077_0057986 3300049593 Bacteria 2458
831 Ga0501077_0109311 3300049593 Bacteria 1752
832 Ga0501077_0347533 3300049593 Unclassified 946
833 Ga0501077_0383841 3300049593 Bacteria 897
834 Ga0501077_0392313 3300049593 Bacteria 887
835 Ga0501077_0440374 3300049593 Unclassified 834
836 Ga0501079_0001522 3300049741 Bacteria 16405
837 Ga0501079_0005080 3300049741 Bacteria 9774
838 Ga0501079_0041460 3300049741 Bacteria 3554
839 Ga0501079_0043307 3300049741 Bacteria 3474
840 Ga0501079_0339295 3300049741 Bacteria 1177
841 Ga0501079_0359262 3300049741 Bacteria 1141
842 Ga0501079_0446567 3300049741 Unclassified 1015
843 Ga0501079_0454325 3300049741 Bacteria 1006
844 Ga0501079_0525263 3300049741 Unclassified 931
845 Ga0501079_0579936 3300049741 Bacteria 882
846 Ga0501079_1146555 3300049741 Bacteria 612
847 Ga0501079_1540682 3300049741 Unclassified 523
848 Ga0501080_0013705 3300049742 Bacteria 7466
849 Ga0501080_0033217 3300049742 Bacteria 4816
850 Ga0501080_0243041 3300049742 Bacteria 1643
851 Ga0501080_0772581 3300049742 Unclassified 844
852 Ga0501080_0801028 3300049742 Unclassified 826
853 Ga0501080_0831347 3300049742 Bacteria 808
854 Ga0501080_0973846 3300049742 Bacteria 737
855 Ga0501080_1169721 3300049742 Bacteria 662
856 Ga0501081_0002787 3300049743 Bacteria 11084
857 Ga0501081_0007340 3300049743 Bacteria 7155
858 Ga0501081_0010136 3300049743 Bacteria 6149
859 Ga0501081_0078980 3300049743 Bacteria 2301
860 Ga0501081_0405674 3300049743 Bacteria 1009
861 Ga0501081_0663628 3300049743 Unclassified 782
862 Ga0501081_0678566 3300049743 Bacteria 773
863 Ga0501081_0892016 3300049743 Bacteria 670
864 Ga0501081_0946282 3300049743 Bacteria 650
865 Ga0501081_1210761 3300049743 Unclassified 572
866 Ga0501083_0022373 3300049744 Bacteria 4388
867 Ga0501083_0064121 3300049744 Bacteria 2449
868 Ga0501083_0086745 3300049744 Bacteria 2070
869 Ga0501083_1104771 3300049744 Bacteria 516
870 Ga0501035_0042434 3300049822 Bacteria 4103
871 Ga0501035_0095058 3300049822 Bacteria 2620
872 Ga0501035_0585371 3300049822 Unclassified 911
873 Ga0501035_0889487 3300049822 Unclassified 706
874 Ga0501045_0029253 3300049824 Bacteria 3981
875 Ga0501045_0124625 3300049824 Bacteria 1913
876 Ga0501045_0172975 3300049824 Bacteria 1608
877 Ga0501045_0352284 3300049824 Bacteria 1096
878 Ga0501045_0417446 3300049824 Unclassified 998
879 Ga0501045_0450596 3300049824 Bacteria 957
880 Ga0501045_1011422 3300049824 Bacteria 609
881 Ga0501045_1202087 3300049824 Bacteria 553
882 nmdc:mga05p37_137048_c1 3300050507 Unclassified 3000
883 nmdc:mga05p37_1863345_c1 3300050507 Unclassified 577
884 nmdc:mga05p37_31017_c1 3300050507 Bacteria 6528
885 nmdc:mga05p37_373856_c1 3300050507 Bacteria 1672
886 nmdc:mga05p37_38013_c1 3300050507 Bacteria 5903
887 nmdc:mga05p37_403502_c1 3300050507 Bacteria 1596
888 nmdc:mga05p37_427775_c1 3300050507 Bacteria 1539
889 nmdc:mga05p37_441663_c1 3300050507 Bacteria 1509
890 nmdc:mga05p37_477307_c1 3300050507 Unclassified 1437
891 nmdc:mga05p37_53621_c1 3300050507 Bacteria 4959
892 nmdc:mga05p37_55198_c1 3300050507 Bacteria 4887
893 nmdc:mga05p37_56888_c1 3300050507 Bacteria 4816
894 nmdc:mga05p37_71433_c1 3300050507 Bacteria 4270
895 nmdc:mga05p37_749931_c1 3300050507 Bacteria 1076
896 nmdc:mga05p37_819084_c2 3300050507 Bacteria 688
897 nmdc:mga05p37_924934_c1 3300050507 Bacteria 937
898 nmdc:mga09592_1232_c1 3300050508 Bacteria 20495
899 nmdc:mga09592_241146_c1 3300050508 Bacteria 1566
900 nmdc:mga09592_250046_c1 3300050508 Unclassified 1537
901 nmdc:mga09592_32265_c1 3300050508 Bacteria 4367
902 nmdc:mga09592_33628_c1 3300050508 Bacteria 4281
903 nmdc:mga09592_424839_c1 3300050508 Bacteria 1148
904 nmdc:mga09592_841579_c1 3300050508 Bacteria 774
905 nmdc:mga09592_856878_c1 3300050508 Unclassified 766
906 nmdc:mga0qj67_52361_c1 3300050509 Bacteria 3231
907 nmdc:mga0qj67_5451_c1 3300050509 Bacteria 9294
908 nmdc:mga0qj67_67370_c1 3300050509 Bacteria 2852
909 nmdc:mga0qj67_86545_c1 3300050509 Bacteria 2514
910 nmdc:mga06r32_1104463_c1 3300050510 Bacteria 742
911 nmdc:mga06r32_147119_c1 3300050510 Bacteria 2333
912 nmdc:mga06r32_2190_c1 3300050510 Bacteria 17506
913 nmdc:mga06r32_22649_c1 3300050510 Bacteria 5810
914 nmdc:mga06r32_379982_c1 3300050510 Unclassified 1395
915 nmdc:mga06r32_383652_c1 3300050510 Bacteria 1388
916 nmdc:mga06r32_544795_c1 3300050510 Bacteria 1135
917 nmdc:mga06r32_84656_c1 3300050510 Bacteria 3091
918 nmdc:mga06r32_865045_c1 3300050510 Unclassified 862
919 nmdc:mga08y16_113120_c1 3300050511 Bacteria 2826
920 nmdc:mga08y16_1530346_c1 3300050511 Bacteria 627
921 nmdc:mga08y16_34111_c1 3300050511 Bacteria 5346
922 nmdc:mga08y16_703196_c1 3300050511 Unclassified 1010
923 nmdc:mga08y16_82960_c1 3300050511 Unclassified 3341
924 nmdc:mga08y16_93993_c1 3300050511 Bacteria 3124
925 nmdc:mga0n895_10097_c1 3300050512 Bacteria 8312
926 nmdc:mga0n895_1053473_c1 3300050512 Bacteria 792
927 nmdc:mga0n895_15398_c1 3300050512 Bacteria 6971
928 nmdc:mga0n895_2245147_c1 3300050512 Unclassified 501
929 nmdc:mga0n895_263814_c1 3300050512 Bacteria 1748
930 nmdc:mga0n895_292208_c1 3300050512 Bacteria 1652
931 nmdc:mga0n895_33008_c1 3300050512 Bacteria 4972
932 nmdc:mga0n895_40993_c1 3300050512 Bacteria 4500
933 nmdc:mga0n895_538100_c1 3300050512 Bacteria 1175
934 nmdc:mga0n895_551601_c1 3300050512 Bacteria 1158
935 nmdc:mga0n895_559006_c1 3300050512 Bacteria 1149
936 nmdc:mga0n895_63951_c1 3300050512 Bacteria 3639
937 nmdc:mga0n895_72925_c1 3300050512 Bacteria 3408
938 nmdc:mga0n895_772592_c1 3300050512 Bacteria 953
939 nmdc:mga0n895_899752_c1 3300050512 Bacteria 871
940 nmdc:mga0rr50_1331313_c1 3300050513 Bacteria 609
941 nmdc:mga0rr50_226351_c1 3300050513 Bacteria 1546
942 nmdc:mga0rr50_279909_c1 3300050513 Bacteria 1392
943 nmdc:mga0rr50_32975_c1 3300050513 Bacteria 3696
944 nmdc:mga0rr50_34163_c1 3300050513 Bacteria 3640
945 nmdc:mga0rr50_34819_c1 3300050513 Bacteria 3610
946 nmdc:mga0rr50_405061_c1 3300050513 Bacteria 1153
947 nmdc:mga0rr50_476179_c1 3300050513 Bacteria 1060
948 nmdc:mga0rr50_505669_c1 3300050513 Unclassified 1028
949 nmdc:mga0rr50_65554_c1 3300050513 Unclassified 2751
950 nmdc:mga0rr50_76015_c1 3300050513 Bacteria 2577
951 nmdc:mga08x19_1040396_c1 3300050514 Bacteria 581
952 nmdc:mga08x19_13439_c1 3300050514 Bacteria 4951
953 nmdc:mga08x19_219595_c1 3300050514 Bacteria 1306
954 nmdc:mga08x19_24360_c1 3300050514 Unclassified 3760
955 nmdc:mga08x19_307010_c1 3300050514 Bacteria 1103
956 nmdc:mga08x19_312030_c1 3300050514 Bacteria 1093
957 nmdc:mga08x19_64213_c1 3300050514 Unclassified 2383
958 nmdc:mga08x19_96553_c1 3300050514 Bacteria 1341
959 nmdc:mga0a205_1030699_c1 3300050515 Bacteria 670
960 nmdc:mga0a205_142361_c1 3300050515 Bacteria 2298
961 nmdc:mga0a205_148426_c1 3300050515 Bacteria 2245
962 nmdc:mga0a205_18346_c1 3300050515 Bacteria 6576
963 nmdc:mga0a205_21467_c1 3300050515 Bacteria 6108
964 nmdc:mga0a205_278342_c1 3300050515 Unclassified 1549
965 nmdc:mga0a205_354695_c1 3300050515 Bacteria 1334
966 nmdc:mga0a205_445739_c1 3300050515 Bacteria 1155
967 nmdc:mga0a205_48154_c1 3300050515 Bacteria 4114
968 nmdc:mga0a205_57051_c1 3300050515 Bacteria 3771
969 nmdc:mga0a205_8519_c1 3300050515 Bacteria 9325
970 Ga0501084_0007636 3300054114 Bacteria 8918
971 Ga0501084_0011856 3300054114 Bacteria 7215
972 Ga0501084_0120564 3300054114 Bacteria 2205
973 Ga0501084_0336863 3300054114 Bacteria 1274
974 Ga0501084_0376331 3300054114 Bacteria 1200
975 Ga0501084_0688237 3300054114 Unclassified 862
976 Ga0501084_0764067 3300054114 Unclassified 814
977 Ga0501084_1258828 3300054114 Unclassified 620
978 Ga0501084_1385526 3300054114 Bacteria 589
979 Ga0501084_1562494 3300054114 Bacteria 552
980 Ga0590074_053250 3300059423 Bacteria 743
981 Ga0501082_0001952 3300060353 Bacteria 18158
982 Ga0501082_0258293 3300060353 Bacteria 1515
983 Ga0501082_0290814 3300060353 Bacteria 1423
984 Ga0501082_0325296 3300060353 Bacteria 1340
985 Ga0501082_0361033 3300060353 Bacteria 1267
986 Ga0501082_0459179 3300060353 Bacteria 1113
987 Ga0501082_0564064 3300060353 Unclassified 996
988 Ga0501082_0681622 3300060353 Unclassified 900
989 Ga0501082_0737062 3300060353 Unclassified 862
990 Ga0501082_0827430 3300060353 Unclassified 810
991 Ga0530510_0014411 3300061734 Bacteria 5574
992 Ga0530510_0032918 3300061734 Bacteria 3731
993 Ga0530510_0104733 3300061734 Bacteria 2070
994 Ga0530510_0108372 3300061734 Bacteria 2033
995 Ga0530510_0109391 3300061734 Bacteria 2024
996 Ga0530510_0214673 3300061734 Bacteria 1429
997 Ga0530510_0330224 3300061734 Bacteria 1144
998 Ga0530510_0353123 3300061734 Bacteria 1104
999 Ga0075436_100004979
1000 Ga0065707_10018464
1001 Ga0065707_10168097
1002 Ga0065707_10681800
1003 Ga0070676_10000793
1004 Ga0070676_10011848
1005 Ga0070683_100024363
1006 Ga0070690_100143054
1007 Ga0070690_100273362
1008 Ga0070690_101463981
1009 Ga0070670_100013632
1010 Ga0070677_10636440
1011 Ga0068869_100002053
1012 Ga0068869_100046070
1013 Ga0068869_100148103
1014 Ga0068869_100292000
1015 Ga0068869_100566758
1016 Ga0070666_10075368
1017 Ga0070680_100003802
1018 Ga0070680_100017250
1019 Ga0070680_100072817
1020 Ga0070680_100839616
1021 Ga0070682_100001673
1022 Ga0068868_100007767
1023 Ga0068868_101998946
1024 Ga0070660_100020417
1025 Ga0070689_100586798
1026 Ga0070689_100886112
1027 Ga0070689_101272014
1028 Ga0070689_101666567
1029 Ga0070691_10004693
1030 Ga0070691_10024899
1031 Ga0070691_10183286
1032 Ga0070687_100460605
1033 Ga0070687_100531517
1034 Ga0070661_100006150
1035 Ga0070692_10006918
1036 Ga0070692_10021252
1037 Ga0070692_10060721
1038 Ga0070692_10114186
1039 Ga0070668_100203687
1040 Ga0070668_100383308
1041 Ga0070668_100452472
1042 Ga0070668_100997024
1043 Ga0070669_100013243
1044 Ga0070669_100411974
1045 Ga0070669_100427366
1046 Ga0070669_100849398
1047 Ga0070669_100921864
1048 Ga0070669_101107730
1049 Ga0070675_100250854
1050 Ga0070671_100287020
1051 Ga0070673_100134425
1052 Ga0070673_101230205
1053 Ga0070688_100065577
1054 Ga0070688_100348094
1055 Ga0070659_100005631
1056 Ga0070659_100970452
1057 Ga0070667_100756359
1058 Ga0070667_101008252
1059 Ga0070703_10007181
1060 Ga0070703_10359551
1061 Ga0070703_10456648
1062 Ga0070703_10519007
1063 Ga0070709_10557074
1064 Ga0070710_10223032
1065 Ga0070701_10006578
1066 Ga0070701_10022540
1067 Ga0070701_10290740
1068 Ga0070711_100215406
1069 Ga0070711_100658233
1070 Ga0070705_100001541
1071 Ga0070705_100007899
1072 Ga0070705_100062121
1073 Ga0070705_100199374
1074 Ga0070705_100225343
1075 Ga0070705_100284831
1076 Ga0070705_100313208
1077 Ga0070705_100620837
1078 Ga0070700_100052430
1079 Ga0070700_100549883
1080 Ga0070700_100605753
1081 Ga0070700_100711653
1082 Ga0070694_100002862
1083 Ga0070694_100004074
1084 Ga0070694_100021189
1085 Ga0070694_100022916
1086 Ga0070694_100023248
1087 Ga0070694_100075106
1088 Ga0070694_100097527
1089 Ga0070694_100270263
1090 Ga0070694_100541527
1091 Ga0070694_101793027
1092 Ga0070708_100066258
1093 Ga0070708_100188658
1094 Ga0070708_100269001
1095 Ga0070708_100291129
1096 Ga0070708_100329895
1097 Ga0070708_100448341
1098 Ga0070708_100493976
1099 Ga0070708_100736065
1100 Ga0070708_101468536
1101 Ga0070708_101871418
1102 Ga0070663_100001620
1103 Ga0070663_100730061
1104 Ga0070662_100004269
1105 Ga0070662_100059752
1106 Ga0070662_100297191
1107 Ga0070681_10150940
1108 Ga0070681_10622436
1109 Ga0070681_12018583
1110 Ga0068867_100023047
1111 Ga0068867_100039866
1112 Ga0068867_100096419
1113 Ga0068867_100241416
1114 Ga0068867_100321122
1115 Ga0068867_100340277
1116 Ga0070706_100003379
1117 Ga0070706_100066029
1118 Ga0070706_100174594
1119 Ga0070706_100316621
1120 Ga0070706_100688034
1121 Ga0070706_101179808
1122 Ga0070707_100031417
1123 Ga0070707_100051180
1124 Ga0070707_100377247
1125 Ga0070707_100719776
1126 Ga0070707_100972928
1127 Ga0070707_101020868
1128 Ga0070707_101337588
1129 Ga0070707_101366479
1130 Ga0070698_100003851
1131 Ga0070698_100005788
1132 Ga0070698_100050420
1133 Ga0070698_100733840
1134 Ga0070698_101226431
1135 Ga0070698_101280917
1136 Ga0070699_100007462
1137 Ga0070699_100056661
1138 Ga0070699_100115982
1139 Ga0070699_100177567
1140 Ga0070699_100294477
1141 Ga0070699_100580032
1142 Ga0070699_101130446
1143 Ga0070679_100007343
1144 Ga0070684_100002889
1145 Ga0070697_100009746
1146 Ga0070697_100014889
1147 Ga0070697_100016680
1148 Ga0070697_100219727
1149 Ga0070697_100224848
1150 Ga0070697_100335275
1151 Ga0070697_100385714
1152 Ga0070697_100401166
1153 Ga0070697_100481704
1154 Ga0070697_101280725
1155 Ga0068853_100368381
1156 Ga0068853_101194819
1157 Ga0068853_102041701
1158 Ga0070672_100064841
1159 Ga0070672_100154190
1160 Ga0070672_100816324
1161 Ga0070672_102046474
1162 Ga0070686_100181419
1163 Ga0070686_100727658
1164 Ga0070695_100000636
1165 Ga0070695_100006753
1166 Ga0070695_100019059
1167 Ga0070695_100031455
1168 Ga0070695_100084900
1169 Ga0070695_100091832
1170 Ga0070695_100174411
1171 Ga0070695_100219262
1172 Ga0070695_100808392
1173 Ga0070695_101049617
1174 Ga0070696_100002733
1175 Ga0070696_100005376
1176 Ga0070696_100025546
1177 Ga0070696_100037595
1178 Ga0070696_100155485
1179 Ga0070696_100164907
1180 Ga0070696_100288119
1181 Ga0070696_100891055
1182 Ga0070696_100996643
1183 Ga0070693_100000439
1184 Ga0070693_100386557
1185 Ga0070704_100011325
1186 Ga0070704_100048472
1187 Ga0070704_100048719
1188 Ga0070704_100059354
1189 Ga0070704_100075936
1190 Ga0070704_100100911
1191 Ga0070704_100380929
1192 Ga0070704_100601332
1193 Ga0070704_101787197
1194 Ga0068855_100008335
1195 Ga0070664_100011490
1196 Ga0068857_100267344
1197 Ga0068857_100488478
1198 Ga0068857_102090316
1199 Ga0068854_100018950
1200 Ga0068854_100343728
1201 Ga0068854_100424414
1202 Ga0068856_100003850
1203 Ga0068856_101838473
1204 Ga0070702_100112288
1205 Ga0070702_100163562
1206 Ga0070702_100731516
1207 Ga0068859_100010219
1208 Ga0068859_100204139
1209 Ga0068859_100285229
1210 Ga0068859_100503607
1211 Ga0068859_100942276
1212 Ga0068864_100767891
1213 Ga0068864_100828646
1214 Ga0068866_10215582
1215 Ga0068866_10594996
1216 Ga0068861_100048642
1217 Ga0068861_100418985
1218 Ga0068861_100599157
1219 Ga0068870_10000417
1220 Ga0068870_10018242
1221 Ga0068863_100076909
1222 Ga0068863_100581124
1223 Ga0068863_100627446
1224 Ga0068863_100672467
1225 Ga0068858_100411661
1226 Ga0068858_100495844
1227 Ga0068860_100061390
1228 Ga0068860_100175519
1229 Ga0068860_100180609
1230 Ga0068860_100316099
1231 Ga0068860_100966986
1232 Ga0068860_101033635
1233 Ga0068860_101543640
1234 Ga0068860_102346500
1235 Ga0068862_100002631
1236 Ga0068862_100026579
1237 Ga0068862_100039230
1238 Ga0068862_100264184
1239 Ga0068862_102383587
1240 Ga0068862_102440934
1241 Ga0081455_10000080
1242 Ga0081455_10136106
1243 Ga0081540_1085026
1244 Ga0075432_10007150
1245 Ga0075432_10374393
1246 Ga0070715_10067314
1247 Ga0070716_100010320
1248 Ga0070712_100004295
1249 Ga0070712_100266456
1250 Ga0068871_100976505
1251 Ga0068871_102319683
1252 Ga0075428_100002385
1253 Ga0075428_100028397
1254 Ga0075428_100079541
1255 Ga0075428_100305245
1256 Ga0075430_100000034
1257 Ga0075430_100432343
1258 Ga0075430_100485045
1259 Ga0075430_100935764
1260 Ga0075431_100000281
1261 Ga0075431_100001229
1262 Ga0075431_100182386
1263 Ga0075431_100238987
1264 Ga0075431_100244153
1265 Ga0075431_100477694
1266 Ga0075431_100514343
1267 Ga0075431_100726219
1268 Ga0075433_10003389
1269 Ga0075433_10006568
1270 Ga0075433_10025226
1271 Ga0075433_10102441
1272 Ga0075433_10125025
1273 Ga0075433_10142443
1274 Ga0075433_10218568
1275 Ga0075433_10352338
1276 Ga0075433_10437488
1277 Ga0075433_10559576
1278 Ga0075433_11123815
1279 Ga0075434_100003335
1280 Ga0075434_100007549
1281 Ga0075434_100020422
1282 Ga0075434_100028009
1283 Ga0075434_100061172
1284 Ga0075434_100227097
1285 Ga0075434_100749511
1286 Ga0075434_101278941
1287 Ga0075429_100010800
1288 Ga0075429_100077083
1289 Ga0075429_100179469
1290 Ga0075429_100236675
1291 Ga0075429_100258520
1292 Ga0075429_100993150
1293 Ga0075429_101953515
1294 Ga0068865_100127012
1295 Ga0068865_100456999
1296 Ga0068865_100743278
1297 Ga0068865_100756975
1298 Ga0068865_100989786
1299 Ga0075436_100016366
1300 Ga0075436_100060978
1301 Ga0075436_100102030
1302 Ga0075436_100335639
1303 Ga0075436_100359619
1304 Ga0075436_100398917
1305 Ga0075436_101155983
1306 Ga0097620_100010219
1307 Ga0097620_100204154
1308 Ga0097620_100285246
1309 Ga0097620_100503679
1310 Ga0097620_100942244
1311 Ga0075435_100001787
1312 Ga0075435_100129929
1313 Ga0075435_100142468
1314 Ga0075435_100157559
1315 Ga0075435_100305645
1316 Ga0075435_100500402
1317 Ga0075435_100517655
1318 Ga0075435_100553318
1319 Ga0075435_100568475
1320 Ga0075435_100652530
1321 Ga0075435_100659455
1322 Ga0075435_101707524
1323 Ga0099794_10001322
1324 Ga0099794_10725773
1325 Ga0099795_10094208
1326 Ga0105240_11842803
1327 Ga0111539_10002043
1328 Ga0111539_10007553
1329 Ga0111539_10063471
1330 Ga0111539_10105391
1331 Ga0111539_10143511
1332 Ga0111539_10594860
1333 Ga0105245_10129731
1334 Ga0105245_10764380
1335 Ga0105245_11625589
1336 Ga0105245_12460150
1337 Ga0105247_10111079
1338 Ga0114129_10019248
1339 Ga0114129_10098016
1340 Ga0114129_10107946
1341 Ga0114129_10113267
1342 Ga0114129_10163744
1343 Ga0114129_10210148
1344 Ga0114129_10259987
1345 Ga0114129_10509609
1346 Ga0114129_10724596
1347 Ga0114129_10840108
1348 Ga0114129_10979580
1349 Ga0114129_10997814
1350 Ga0114129_12074175
1351 Ga0114129_12788953
1352 Ga0105243_10019273
1353 Ga0105243_10036389
1354 Ga0105243_10146336
1355 Ga0105243_10152728
1356 Ga0105243_10469462
1357 Ga0105243_10866382
1358 Ga0105243_12170848
1359 Ga0105243_12301227
1360 Ga0105241_10029731
1361 Ga0105241_10129563
1362 Ga0105241_11014929
1363 Ga0105242_10052026
1364 Ga0105242_10660637
1365 Ga0105242_11478205
1366 Ga0105242_11849719
1367 Ga0105242_12221524
1368 Ga0105248_10162520
1369 Ga0105248_10387115
1370 Ga0105248_10492848
1371 Ga0105248_11703850
1372 Ga0105248_11737615
1373 Ga0105237_10966700
1374 Ga0105238_11650293
1375 Ga0105249_10046874
1376 Ga0105249_10047904
1377 Ga0105249_10056174
1378 Ga0105249_10440935
1379 Ga0105249_10507620
1380 Ga0105249_10674804
1381 Ga0105249_11298016
1382 Ga0105249_11653635
1383 Ga0105239_10319220
1384 Ga0105239_10400917
1385 Ga0105246_10515536
1386 Ga0105246_10658602
1387 Ga0157373_10002202
1388 Ga0157371_10084346
1389 Ga0157371_10465807
1390 Ga0157369_10489347
1391 Ga0157378_10186919
1392 Ga0157378_10916902
1393 Ga0163162_10011523
1394 Ga0163162_10183251
1395 Ga0163162_10285271
1396 Ga0163162_10341099
1397 Ga0163162_11280483
1398 Ga0163162_12887375
1399 Ga0157372_10270982
1400 Ga0157372_10416241
1401 Ga0157372_11061630
1402 Ga0157375_10040315
1403 Ga0157375_10203944
1404 Ga0157375_10261659
1405 Ga0157375_11177707
1406 Ga0157375_12573118
1407 Ga0157375_13445003
1408 Ga0163163_10465118
1409 Ga0163163_10492901
1410 Ga0157380_10253441
1411 Ga0157380_10881158
1412 Ga0157379_11223050
1413 Ga0157376_10920025
1414 Ga0182007_10082489
1415 Ga0163161_11165954
1416 Ga0206356_10843478
1417 Ga0206353_11382503
1418 Ga0207653_10014697
1419 Ga0207642_10287831
1420 Ga0207642_10324822
1421 Ga0207642_10599156
1422 Ga0207710_10230974
1423 Ga0207688_10168436
1424 Ga0207680_10127492
1425 Ga0207680_10901640
1426 Ga0207685_10250224
1427 Ga0207685_10452435
1428 Ga0207699_10162197
1429 Ga0207699_10405971
1430 Ga0207645_10000290
1431 Ga0207645_10012920
1432 Ga0207643_10000482
1433 Ga0207643_10056577
1434 Ga0207684_10003244
1435 Ga0207684_10016346
1436 Ga0207684_10068836
1437 Ga0207684_10129580
1438 Ga0207684_10140646
1439 Ga0207684_10363472
1440 Ga0207684_10484074
1441 Ga0207654_10087613
1442 Ga0207654_10219482
1443 Ga0207707_10001856
1444 Ga0207707_10322375
1445 Ga0207695_10709250
1446 Ga0207671_10587060
1447 Ga0207693_10006750
1448 Ga0207693_10263706
1449 Ga0207663_10953733
1450 Ga0207660_10062776
1451 Ga0207660_10131202
1452 Ga0207660_10167967
1453 Ga0207662_10159328
1454 Ga0207662_10751096
1455 Ga0207657_10000158
1456 Ga0207649_10002003
1457 Ga0207652_10001521
1458 Ga0207646_10012309
1459 Ga0207646_10025576
1460 Ga0207646_10027397
1461 Ga0207646_10047754
1462 Ga0207646_10091326
1463 Ga0207646_10115375
1464 Ga0207646_10325897
1465 Ga0207646_10965033
1466 Ga0207646_11092117
1467 Ga0207681_10019121
1468 Ga0207681_10046441
1469 Ga0207681_10083087
1470 Ga0207681_10289268
1471 Ga0207681_10368379
1472 Ga0207681_10682530
1473 Ga0207681_11398423
1474 Ga0207694_11133471
1475 Ga0207650_10183357
1476 Ga0207687_10201920
1477 Ga0207690_10001543
1478 Ga0207706_10008540
1479 Ga0207706_10047416
1480 Ga0207706_10056083
1481 Ga0207706_10107633
1482 Ga0207706_10231880
1483 Ga0207686_10063374
1484 Ga0207686_11634024
1485 Ga0207709_10036676
1486 Ga0207709_10197233
1487 Ga0207709_10338185
1488 Ga0207709_10506267
1489 Ga0207709_10652900
1490 Ga0207709_11003721
1491 Ga0207709_11633781
1492 Ga0207709_11657806
1493 Ga0207670_10135468
1494 Ga0207670_10217984
1495 Ga0207670_10500331
1496 Ga0207670_11204795
1497 Ga0207704_10264995
1498 Ga0207704_10512251
1499 Ga0207704_10612011
1500 Ga0207665_10001514
1501 Ga0207665_10478242
1502 Ga0207691_10015161
1503 Ga0207691_11478136
1504 Ga0207711_10211408
1505 Ga0207711_10458241
1506 Ga0207711_11613652
1507 Ga0207689_10000425
1508 Ga0207689_10040379
1509 Ga0207689_10134723
1510 Ga0207689_10207500
1511 Ga0207661_10030238
1512 Ga0207679_10003606
1513 Ga0207667_10003229
1514 Ga0207712_10013031
1515 Ga0207712_10032621
1516 Ga0207712_10118425
1517 Ga0207712_10238180
1518 Ga0207712_10583522
1519 Ga0207712_11828666
1520 Ga0207668_10257348
1521 Ga0207668_10447670
1522 Ga0207668_10705574
1523 Ga0207640_10043658
1524 Ga0207640_10167588
1525 Ga0207640_10665128
1526 Ga0207658_10318974
1527 Ga0207677_10241075
1528 Ga0207703_10287440
1529 Ga0207639_10068980
1530 Ga0207639_11704655
1531 Ga0207678_10001467
1532 Ga0207678_10844559
1533 Ga0207708_10021275
1534 Ga0207708_10372955
1535 Ga0207708_11369990
1536 Ga0207702_10082235
1537 Ga0207641_10331604
1538 Ga0207641_10545245
1539 Ga0207641_11018249
1540 Ga0207641_12100681
1541 Ga0207648_10001313
1542 Ga0207648_10065151
1543 Ga0207648_10068928
1544 Ga0207648_10081994
1545 Ga0207648_10501739
1546 Ga0207648_11513698
1547 Ga0207676_10268284
1548 Ga0207674_10004140
1549 Ga0207674_10014924
1550 Ga0207674_10077913
1551 Ga0207674_10291874
1552 Ga0207674_11345588
1553 Ga0207675_100131809
1554 Ga0207675_100135053
1555 Ga0207675_100478487
1556 Ga0207675_100566268
1557 Ga0207675_102269485
1558 Ga0207698_10732659
1559 Ga0209984_1046439
1560 Ga0210000_1009484
1561 Ga0209968_1021447
1562 Ga0209999_1001223
1563 Ga0209970_1001329
1564 Ga0210002_1016838
1565 Ga0209983_1003515
1566 Ga0209588_1008766
1567 Ga0209971_1000005
1568 Ga0209971_1074177
1569 Ga0209966_1000010
1570 Ga0209966_1106188
1571 Ga0209998_10000023
1572 Ga0209998_10044277
1573 Ga0209974_10000464
1574 Ga0207428_10000276
1575 Ga0207428_10002151
1576 Ga0207428_10023978
1577 Ga0207428_10341066
1578 Ga0268265_10020825
1579 Ga0268265_10145731
1580 Ga0268265_10192885
1581 Ga0268265_10195095
1582 Ga0268265_10643007
1583 Ga0268265_10684843
1584 Ga0268265_12068926
1585 Ga0268264_10165774
1586 Ga0268264_10694506
1587 Ga0268264_10874747
1588 Ga0268264_10887363
1589 Ga0268264_10912977
1590 Ga0268264_11818733
1591 Ga0268264_12256103
1592 Ga0307408_100034196
1593 Ga0307408_100039290
1594 Ga0307410_10247620
1595 Ga0307406_10368250
1596 Ga0307406_10961810
1597 Ga0307407_10438973
1598 Ga0307407_10555046
1599 Ga0307409_100155967
1600 Ga0307409_100212376
1601 Ga0307416_100004866
1602 Ga0307416_101613871
1603 Ga0307416_101707280
1604 Ga0307416_103390582
1605 Ga0307414_11173060
1606 Ga0307411_10142688
1607 Ga0307411_10282796
1608 Ga0307415_101690692
1609 Ga0373930_0043049
1610 Ga0373948_0014616
1611 Ga0373938_0257310
1612 Ga0373940_0021007
1613 Ga0373940_0223696
1614 Ga0373949_0048902
1615 Ga0373949_0130161
1616 Ga0373951_0042731
1617 Ga0373952_0030493
1618 Ga0373932_0021309
1619 Ga0373932_0029771
1620 Ga0373932_0081463
1621 Ga0373932_0137002
1622 Ga0373939_0022504
1623 Ga0373939_0027201
1624 Ga0373941_0058453
1625 Ga0373941_0218976
1626 Ga0373941_0224164
1627 Ga0373960_0048327
1628 Ga0373942_0176282
1629 Ga0373962_0030135
1630 Ga0373962_0070683
1631 Ga0373962_0227493
1632 Ga0373931_0092538
1633 Ga0373931_0406906
1634 Ga0373931_1024420
1635 Ga0242420_048752
1636 Ga0439437_036521
1637 Ga0439441_013035
1638 Ga0439441_085998
1639 Ga0439448_0000678
1640 Ga0439448_0069255
1641 Ga0439455_0052959
1642 Ga0439463_076189
1643 Ga0450890_035150
1644 Ga0439458_0017593
1645 Ga0439435_0063560
1646 Ga0439444_0103208
1647 Ga0439444_0124819
1648 Ga0439459_0001810
1649 Ga0439464_0010970
1650 Ga0439460_0000314
1651 Ga0439460_0037069
1652 Ga0451577_0020330
1653 Ga0451577_0061662
1654 Ga0451577_0087844
1655 Ga0451577_0248786
1656 Ga0451577_2019548
1657 Ga0453683_0239845
1658 Ga0453683_0432087
1659 Ga0453683_0987531
1660 Ga0453684_0018602
1661 Ga0453684_0090401
1662 Ga0453684_0158659
1663 Ga0453684_1929691
1664 Ga0451576_0020221
1665 Ga0451576_0025380
1666 Ga0451576_0093511
1667 Ga0451576_0391163
1668 Ga0451576_0451537
1669 Ga0451576_0465771
1670 Ga0451576_0646223
1671 Ga0451576_2558835
1672 Ga0495580_0056808
1673 Ga0495580_0072895
1674 Ga0495580_0225730
1675 Ga0495580_0650327
1676 Ga0495584_0103348
1677 Ga0495663_0228469
1678 Ga0495642_0020490
1679 Ga0495642_0149261
1680 Ga0495598_0466204
1681 Ga0495656_0244633
1682 Ga0495656_0759330
1683 Ga0495611_0292872
1684 Ga0495659_0269911
1685 Ga0495659_0277261
1686 Ga0495659_0415543
1687 Ga0495669_0047771
1688 Ga0495670_0740956
1689 Ga0495677_0103177
1690 Ga0496100_0917477
1691 Ga0496102_0007307
1692 Ga0496102_0160505
1693 Ga0496102_0943613
1694 Ga0496103_0151051
1695 Ga0496107_0085910
1696 Ga0496108_1364326
1697 Ga0496109_0542496
1698 Ga0496112_0218919
1699 Ga0496113_0415113
1700 Ga0501031_0141600
1701 Ga0501031_0357848
1702 Ga0501031_0483460
1703 Ga0501032_0222261
1704 Ga0501032_0597294
1705 Ga0501033_0062130
1706 Ga0501033_0117179
1707 Ga0501033_0215878
1708 Ga0501033_0262998
1709 Ga0501033_0556286
1710 Ga0501036_0109022
1711 Ga0501036_0144176
1712 Ga0501036_0357405
1713 Ga0501036_0393893
1714 Ga0501036_0542706
1715 Ga0501036_1365613
1716 Ga0501037_0549703
1717 Ga0501037_0925831
1718 Ga0501038_0080163
1719 Ga0501038_0184818
1720 Ga0501038_0469060
1721 Ga0501038_1266005
1722 Ga0501039_0155566
1723 Ga0501039_0345818
1724 Ga0501039_0599174
1725 Ga0501039_0621844
1726 Ga0501039_0716878
1727 Ga0501039_1028893
1728 Ga0501040_0026323
1729 Ga0501040_0032784
1730 Ga0501040_0075516
1731 Ga0501040_0076278
1732 Ga0501040_0101684
1733 Ga0501040_0275028
1734 Ga0501040_0310002
1735 Ga0501040_0315227
1736 Ga0501040_0315239
1737 Ga0501040_0341784
1738 Ga0501040_0381910
1739 Ga0501040_0824700
1740 Ga0501041_0011242
1741 Ga0501041_0054206
1742 Ga0501041_0072652
1743 Ga0501041_0159947
1744 Ga0501041_0246972
1745 Ga0501041_0427341
1746 Ga0501041_0831028
1747 Ga0501042_0005993
1748 Ga0501042_0057825
1749 Ga0501042_0097136
1750 Ga0501042_0133860
1751 Ga0501042_0351755
1752 Ga0501042_0372617
1753 Ga0501042_0653855
1754 Ga0501042_1149333
1755 Ga0501042_1331274
1756 Ga0501043_0225769
1757 Ga0501043_0257406
1758 Ga0501043_1301758
1759 Ga0501046_0001215
1760 Ga0501046_0050939
1761 Ga0501046_0098183
1762 Ga0501046_0230206
1763 Ga0501047_1257069
1764 Ga0501048_0003092
1765 Ga0501048_0065312
1766 Ga0501048_0344138
1767 Ga0501048_0392588
1768 Ga0501048_0557232
1769 Ga0501048_1012765
1770 Ga0501048_1159250
1771 Ga0501048_1167279
1772 Ga0501067_0058067
1773 Ga0501067_0647908
1774 Ga0501068_0261581
1775 Ga0501068_0273894
1776 Ga0501068_0300299
1777 Ga0501068_0543911
1778 Ga0501068_0568448
1779 Ga0501068_0942018
1780 Ga0501069_0353518
1781 Ga0501069_0842948
1782 Ga0501070_0752103
1783 Ga0501070_1217236
1784 Ga0501071_0078047
1785 Ga0501071_0139077
1786 Ga0501071_0280335
1787 Ga0501071_0302233
1788 Ga0501071_0341413
1789 Ga0501071_0362427
1790 Ga0501071_0854497
1791 Ga0501071_0882038
1792 Ga0501072_0012951
1793 Ga0501072_0014845
1794 Ga0501072_0043264
1795 Ga0501072_0115943
1796 Ga0501072_0338933
1797 Ga0501072_0342590
1798 Ga0501072_0473286
1799 Ga0501072_0585236
1800 Ga0501072_1374471
1801 Ga0501074_0003061
1802 Ga0501074_0127291
1803 Ga0501074_0131214
1804 Ga0501074_0532630
1805 Ga0501074_0943503
1806 Ga0501074_1222069
1807 Ga0501075_0099859
1808 Ga0501075_0209333
1809 Ga0501075_0209743
1810 Ga0501075_0215542
1811 Ga0501075_0230422
1812 Ga0501075_0347940
1813 Ga0501075_0377033
1814 Ga0501075_0665142
1815 Ga0501076_0019298
1816 Ga0501076_0052056
1817 Ga0501076_0059592
1818 Ga0501076_0085124
1819 Ga0501076_0161390
1820 Ga0501076_0179017
1821 Ga0501076_0188647
1822 Ga0501076_0222472
1823 Ga0501076_0230653
1824 Ga0501076_0267343
1825 Ga0501076_0300220
1826 Ga0501076_0401878
1827 Ga0501076_1485364
1828 Ga0501077_0057986
1829 Ga0501077_0109311
1830 Ga0501077_0347533
1831 Ga0501077_0383841
1832 Ga0501077_0392313
1833 Ga0501077_0440374
1834 Ga0501079_0001522
1835 Ga0501079_0005080
1836 Ga0501079_0041460
1837 Ga0501079_0043307
1838 Ga0501079_0339295
1839 Ga0501079_0359262
1840 Ga0501079_0446567
1841 Ga0501079_0454325
1842 Ga0501079_0525263
1843 Ga0501079_0579936
1844 Ga0501079_1146555
1845 Ga0501079_1540682
1846 Ga0501080_0013705
1847 Ga0501080_0033217
1848 Ga0501080_0243041
1849 Ga0501080_0772581
1850 Ga0501080_0801028
1851 Ga0501080_0831347
1852 Ga0501080_0973846
1853 Ga0501080_1169721
1854 Ga0501081_0002787
1855 Ga0501081_0007340
1856 Ga0501081_0010136
1857 Ga0501081_0078980
1858 Ga0501081_0405674
1859 Ga0501081_0663628
1860 Ga0501081_0678566
1861 Ga0501081_0892016
1862 Ga0501081_0946282
1863 Ga0501081_1210761
1864 Ga0501083_0022373
1865 Ga0501083_0064121
1866 Ga0501083_0086745
1867 Ga0501083_1104771
1868 Ga0501035_0042434
1869 Ga0501035_0095058
1870 Ga0501035_0585371
1871 Ga0501035_0889487
1872 Ga0501045_0029253
1873 Ga0501045_0124625
1874 Ga0501045_0172975
1875 Ga0501045_0352284
1876 Ga0501045_0417446
1877 Ga0501045_0450596
1878 Ga0501045_1011422
1879 Ga0501045_1202087
1880 nmdc:mga05p37_137048_c1
1881 nmdc:mga05p37_1863345_c1
1882 nmdc:mga05p37_31017_c1
1883 nmdc:mga05p37_373856_c1
1884 nmdc:mga05p37_38013_c1
1885 nmdc:mga05p37_403502_c1
1886 nmdc:mga05p37_427775_c1
1887 nmdc:mga05p37_441663_c1
1888 nmdc:mga05p37_477307_c1
1889 nmdc:mga05p37_53621_c1
1890 nmdc:mga05p37_55198_c1
1891 nmdc:mga05p37_56888_c1
1892 nmdc:mga05p37_71433_c1
1893 nmdc:mga05p37_749931_c1
1894 nmdc:mga05p37_819084_c2
1895 nmdc:mga05p37_924934_c1
1896 nmdc:mga09592_1232_c1
1897 nmdc:mga09592_241146_c1
1898 nmdc:mga09592_250046_c1
1899 nmdc:mga09592_32265_c1
1900 nmdc:mga09592_33628_c1
1901 nmdc:mga09592_424839_c1
1902 nmdc:mga09592_841579_c1
1903 nmdc:mga09592_856878_c1
1904 nmdc:mga0qj67_52361_c1
1905 nmdc:mga0qj67_5451_c1
1906 nmdc:mga0qj67_67370_c1
1907 nmdc:mga0qj67_86545_c1
1908 nmdc:mga06r32_1104463_c1
1909 nmdc:mga06r32_147119_c1
1910 nmdc:mga06r32_2190_c1
1911 nmdc:mga06r32_22649_c1
1912 nmdc:mga06r32_379982_c1
1913 nmdc:mga06r32_383652_c1
1914 nmdc:mga06r32_544795_c1
1915 nmdc:mga06r32_84656_c1
1916 nmdc:mga06r32_865045_c1
1917 nmdc:mga08y16_113120_c1
1918 nmdc:mga08y16_1530346_c1
1919 nmdc:mga08y16_34111_c1
1920 nmdc:mga08y16_703196_c1
1921 nmdc:mga08y16_82960_c1
1922 nmdc:mga08y16_93993_c1
1923 nmdc:mga0n895_10097_c1
1924 nmdc:mga0n895_1053473_c1
1925 nmdc:mga0n895_15398_c1
1926 nmdc:mga0n895_2245147_c1
1927 nmdc:mga0n895_263814_c1
1928 nmdc:mga0n895_292208_c1
1929 nmdc:mga0n895_33008_c1
1930 nmdc:mga0n895_40993_c1
1931 nmdc:mga0n895_538100_c1
1932 nmdc:mga0n895_551601_c1
1933 nmdc:mga0n895_559006_c1
1934 nmdc:mga0n895_63951_c1
1935 nmdc:mga0n895_72925_c1
1936 nmdc:mga0n895_772592_c1
1937 nmdc:mga0n895_899752_c1
1938 nmdc:mga0rr50_1331313_c1
1939 nmdc:mga0rr50_226351_c1
1940 nmdc:mga0rr50_279909_c1
1941 nmdc:mga0rr50_32975_c1
1942 nmdc:mga0rr50_34163_c1
1943 nmdc:mga0rr50_34819_c1
1944 nmdc:mga0rr50_405061_c1
1945 nmdc:mga0rr50_476179_c1
1946 nmdc:mga0rr50_505669_c1
1947 nmdc:mga0rr50_65554_c1
1948 nmdc:mga0rr50_76015_c1
1949 nmdc:mga08x19_1040396_c1
1950 nmdc:mga08x19_13439_c1
1951 nmdc:mga08x19_219595_c1
1952 nmdc:mga08x19_24360_c1
1953 nmdc:mga08x19_307010_c1
1954 nmdc:mga08x19_312030_c1
1955 nmdc:mga08x19_64213_c1
1956 nmdc:mga08x19_96553_c1
1957 nmdc:mga0a205_1030699_c1
1958 nmdc:mga0a205_142361_c1
1959 nmdc:mga0a205_148426_c1
1960 nmdc:mga0a205_18346_c1
1961 nmdc:mga0a205_21467_c1
1962 nmdc:mga0a205_278342_c1
1963 nmdc:mga0a205_354695_c1
1964 nmdc:mga0a205_445739_c1
1965 nmdc:mga0a205_48154_c1
1966 nmdc:mga0a205_57051_c1
1967 nmdc:mga0a205_8519_c1
1968 Ga0501084_0007636
1969 Ga0501084_0011856
1970 Ga0501084_0120564
1971 Ga0501084_0336863
1972 Ga0501084_0376331
1973 Ga0501084_0688237
1974 Ga0501084_0764067
1975 Ga0501084_1258828
1976 Ga0501084_1385526
1977 Ga0501084_1562494
1978 Ga0590074_053250
1979 Ga0501082_0001952
1980 Ga0501082_0258293
1981 Ga0501082_0290814
1982 Ga0501082_0325296
1983 Ga0501082_0361033
1984 Ga0501082_0459179
1985 Ga0501082_0564064
1986 Ga0501082_0681622
1987 Ga0501082_0737062
1988 Ga0501082_0827430
1989 Ga0530510_0014411
1990 Ga0530510_0032918
1991 Ga0530510_0104733
1992 Ga0530510_0108372
1993 Ga0530510_0109391
1994 Ga0530510_0214673
1995 Ga0530510_0330224
1996 Ga0530510_0353123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_A0A0P0W1V1_41_103_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.4081 25 70 1.10.10.60
af_A0A1D6GKP0_46_107_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.3994 25 70 1.10.10.60
af_Q9M9X9_703_769_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3735 23 69 1.25.40.10
af_A0A0P0W1V1_41_103_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.3241 25 70 1.10.10.60
af_A0A1D6GKP0_46_107_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.3202 25 70 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2V6ZW53-F1-model_v4 NIPSNAP domain-containing protein 0.5783 1 79
AF-A0A2V6ZW53-F1-model_v4 NIPSNAP domain-containing protein 0.5612 1 79
AF-A0A1F7LQ64-F1-model_v4 Uncharacterized protein 0.5463 1 78
AF-A0A2D9LMA8-F1-model_v4 Uncharacterized protein 0.5356 1 73
AF-A0A1F7LQ64-F1-model_v4 Uncharacterized protein 0.5352 1 78

Map