F487797

General Info

Members Datasets Scaffolds Average Seq Length
997 443 997 189

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10937966|Ga0157372_109379662
Length 229
Sequence MEIKAPTPQIPPAVWTEFKDLQEWEKLHQERPEGDKHSALFESLTEGIQHFPGGFALTTVADAFFNWARKSSVWPVTFGLACCAIEMMATGAGRYDLARFGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMVEPKWVLSMGVCASSGGMFNNYAIVQGVDHVVPVDIYLPGCPPRPEMLINALLALHEEIQAMPLGVNRRRAAEAAERAAMEAVPTSKMKGLLR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005870 Rhizosphere microbial communities from Harvard Forest, USA - 4Rhizosphere_NRpos metaG Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027200 Rhizosphere microbial communities from Harvard Forest, USA - 4Rhizosphere_NRpos metaG (SPAdes) Metagenome Rhizosphere
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
166 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
167 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
206 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
207 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
208 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
209 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
210 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
211 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
223 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
224 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
225 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
226 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
227 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
228 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
229 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
230 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
233 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
279 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
282 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
316 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
317 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
318 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
327 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
331 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
355 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
356 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
392 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
393 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
394 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
395 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
396 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
401 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
402 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
403 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
404 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
405 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
408 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
411 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
412 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
413 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
414 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
417 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
418 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
419 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
420 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
421 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
422 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
423 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
424 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
425 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
426 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
427 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
428 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
429 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
430 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
431 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
432 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
433 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
434 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
435 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 2.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 0.1
Rhizoplane 3.61
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10017517 3300001989 Bacteria 2584
2 JGI24737J22298_10005199 3300001990 Bacteria 4505
3 JGI24735J21928_10027305 3300002067 Bacteria 1711
4 JGI25406J46586_10095938 3300003203 Bacteria 889
5 JGI25160J50197_1007524 3300003354 Bacteria 4251
6 JGI25160J50197_1027486 3300003354 Bacteria 1547
7 Ga0006562J51391_1028667 3300003578 Bacteria 1109
8 Ga0070658_10092336 3300005327 Bacteria 2496
9 Ga0070683_100156880 3300005329 Bacteria 2159
10 Ga0070683_101336697 3300005329 Bacteria 689
11 Ga0068869_100160319 3300005334 Bacteria 1751
12 Ga0068868_100317088 3300005338 Bacteria 1327
13 Ga0070691_10223067 3300005341 Bacteria 1000
14 Ga0070675_100252848 3300005354 Bacteria 1543
15 Ga0070671_100593449 3300005355 Bacteria 957
16 Ga0070714_100005638 3300005435 Bacteria 9577
17 Ga0070714_100259945 3300005435 Bacteria 1607
18 Ga0070713_100082501 3300005436 Bacteria 2745
19 Ga0070710_10064545 3300005437 Bacteria 2095
20 Ga0070711_100285287 3300005439 Bacteria 1308
21 Ga0070708_100079381 3300005445 Bacteria 2969
22 Ga0070708_100238153 3300005445 Bacteria 1709
23 Ga0070708_100371712 3300005445 Bacteria 1348
24 Ga0070708_100389335 3300005445 Bacteria 1314
25 Ga0070681_10257637 3300005458 Bacteria 1656
26 Ga0070685_10070335 3300005466 Bacteria 2072
27 Ga0070685_10476889 3300005466 Bacteria 879
28 Ga0070706_100021841 3300005467 Bacteria 5894
29 Ga0070706_100022401 3300005467 Bacteria 5816
30 Ga0070706_100028028 3300005467 Bacteria 5182
31 Ga0070707_100060119 3300005468 Bacteria 3644
32 Ga0070707_100085925 3300005468 Bacteria 3041
33 Ga0070707_100092350 3300005468 Bacteria 2931
34 Ga0070707_100096257 3300005468 Bacteria 2867
35 Ga0070698_100000073 3300005471 Bacteria 75512
36 Ga0070698_100007866 3300005471 Bacteria 11541
37 Ga0070698_100240442 3300005471 Bacteria 1744
38 Ga0070698_100268482 3300005471 Bacteria 1638
39 Ga0070698_100288985 3300005471 Bacteria 1571
40 Ga0070679_100078515 3300005530 Bacteria 3290
41 Ga0070679_100234828 3300005530 Bacteria 1793
42 Ga0070684_100129401 3300005535 Bacteria 2276
43 Ga0070684_100318038 3300005535 Bacteria 1430
44 Ga0070697_100068869 3300005536 Bacteria 2898
45 Ga0068853_100049777 3300005539 Bacteria 3602
46 Ga0070693_100098803 3300005547 Bacteria 1774
47 Ga0070665_100040161 3300005548 Bacteria 4704
48 Ga0070665_100127648 3300005548 Bacteria 2546
49 Ga0068855_100063115 3300005563 Bacteria 4324
50 Ga0068857_100081703 3300005577 Bacteria 2886
51 Ga0068854_100050967 3300005578 Bacteria 2964
52 Ga0068854_100694586 3300005578 Bacteria 878
53 Ga0068856_100022041 3300005614 Bacteria 6195
54 Ga0068856_100065456 3300005614 Bacteria 3592
55 Ga0068852_100029725 3300005616 Bacteria 4491
56 Ga0068852_100471772 3300005616 Bacteria 1246
57 Ga0068864_100117330 3300005618 Bacteria 2376
58 Ga0068864_100684381 3300005618 Bacteria 1001
59 Ga0068863_100107785 3300005841 Bacteria 2651
60 Ga0068860_100109475 3300005843 Bacteria 2640
61 Ga0068862_100245460 3300005844 Bacteria 1630
62 Ga0058723_100038 3300005870 Bacteria 764
63 Ga0081455_10009867 3300005937 Bacteria 9770
64 Ga0081455_10044055 3300005937 Bacteria 3897
65 Ga0081540_1003156 3300005983 Bacteria 13157
66 Ga0081540_1057177 3300005983 Bacteria 1888
67 Ga0081539_10003492 3300005985 Bacteria 19204
68 Ga0081539_10004406 3300005985 Bacteria 15592
69 Ga0081539_10010250 3300005985 Bacteria 7655
70 Ga0081539_10023002 3300005985 Bacteria 4097
71 Ga0081539_10067109 3300005985 Bacteria 1941
72 Ga0070717_10006986 3300006028 Bacteria 8350
73 Ga0075365_10174846 3300006038 Bacteria 1499
74 Ga0075368_10005635 3300006042 Bacteria 4321
75 Ga0075368_10147976 3300006042 Bacteria 980
76 Ga0075363_100041969 3300006048 Bacteria 2415
77 Ga0070716_100065567 3300006173 Bacteria 2115
78 Ga0075367_10027504 3300006178 Bacteria 3236
79 Ga0075367_10087241 3300006178 Bacteria 1895
80 Ga0097621_100143458 3300006237 Bacteria 2042
81 Ga0075370_10011734 3300006353 Bacteria 4613
82 Ga0075370_10148971 3300006353 Bacteria 1371
83 Ga0075370_10320096 3300006353 Bacteria 924
84 Ga0075430_100189014 3300006846 Bacteria 1712
85 Ga0075434_100229942 3300006871 Bacteria 1874
86 Ga0075436_100009981 3300006914 Bacteria 6496
87 Ga0075436_100549664 3300006914 Bacteria 847
88 Ga0099826_10142629 3300006948 Bacteria 1381
89 Ga0075435_100351775 3300007076 Bacteria 1263
90 Ga0105251_10012881 3300009011 Bacteria 4706
91 Ga0105244_10171727 3300009036 Bacteria 1031
92 Ga0105250_10024088 3300009092 Bacteria 2453
93 Ga0105240_10015715 3300009093 Bacteria 10272
94 Ga0105240_10645361 3300009093 Bacteria 1161
95 Ga0105245_10261800 3300009098 Bacteria 1683
96 Ga0114129_10091266 3300009147 Bacteria 4221
97 Ga0105243_10000636 3300009148 Bacteria 34702
98 Ga0105243_10020026 3300009148 Bacteria 5073
99 Ga0105241_10077421 3300009174 Bacteria 2596
100 Ga0105248_10075304 3300009177 Bacteria 3793
101 Ga0105248_10212959 3300009177 Bacteria 2177
102 Ga0105237_10004407 3300009545 Bacteria 16312
103 Ga0105237_10227257 3300009545 Bacteria 1867
104 Ga0105238_10000200 3300009551 Bacteria 66219
105 Ga0105238_10368954 3300009551 Bacteria 1426
106 Ga0105249_10262215 3300009553 Bacteria 1718
107 Ga0105239_10032749 3300010375 Bacteria 5711
108 Ga0105239_10048362 3300010375 Bacteria 4664
109 Ga0105239_10227329 3300010375 Bacteria 2093
110 Ga0105239_11010342 3300010375 Bacteria 956
111 Ga0105246_10861047 3300011119 Bacteria 809
112 Ga0157343_1005239 3300012488 Bacteria 834
113 Ga0157373_10885815 3300013100 Bacteria 662
114 Ga0157369_10059844 3300013105 Bacteria 4108
115 Ga0157369_10364564 3300013105 Bacteria 1500
116 Ga0157374_10097920 3300013296 Bacteria 2807
117 Ga0157374_10175319 3300013296 Bacteria 2093
118 Ga0163162_10194077 3300013306 Bacteria 2159
119 Ga0163162_10891135 3300013306 Bacteria 1003
120 Ga0157372_10535298 3300013307 Bacteria 1365
121 Ga0157372_10937966 3300013307 Bacteria 1003
122 Ga0157375_10136007 3300013308 Bacteria 2581
123 Ga0157375_10161489 3300013308 Bacteria 2383
124 Ga0157375_10183074 3300013308 Bacteria 2247
125 Ga0163163_10013354 3300014325 Bacteria 7517
126 Ga0163163_10525102 3300014325 Bacteria 1246
127 Ga0157380_10145681 3300014326 Bacteria 2041
128 Ga0182008_10011765 3300014497 Bacteria 4643
129 Ga0157379_10187206 3300014968 Bacteria 1871
130 Ga0157379_10471539 3300014968 Bacteria 1161
131 Ga0157376_10003944 3300014969 Bacteria 10264
132 Ga0157376_10150356 3300014969 Bacteria 2099
133 Ga0182007_10001899 3300015262 Bacteria 10894
134 Ga0182005_1007289 3300015265 Bacteria 3323
135 Ga0206355_1363819 3300020076 Bacteria 857
136 Ga0206350_11072649 3300020080 Bacteria 1458
137 Ga0154015_1559063 3300020610 Bacteria 862
138 Ga0224712_10000465 3300022467 Bacteria 8140
139 Ga0224712_10003509 3300022467 Bacteria 4088
140 Ga0224712_10157609 3300022467 Bacteria 1010
141 Ga0209758_1005072 3300025297 Bacteria 10434
142 Ga0207426_1004723 3300025302 Bacteria 6516
143 Ga0207426_1005819 3300025302 Bacteria 5516
144 Ga0207426_1014205 3300025302 Bacteria 2922
145 Ga0207656_10071654 3300025321 Bacteria 1541
146 Ga0207696_1021304 3300025711 Bacteria 2078
147 Ga0207655_1086590 3300025728 Bacteria 1114
148 Ga0207713_1060066 3300025735 Bacteria 1455
149 Ga0207692_10002379 3300025898 Bacteria 7222
150 Ga0207692_10195304 3300025898 Bacteria 1187
151 Ga0207642_10080716 3300025899 Bacteria 1578
152 Ga0207680_10131885 3300025903 Bacteria 1648
153 Ga0207680_10543619 3300025903 Bacteria 829
154 Ga0207647_10000384 3300025904 Bacteria 35996
155 Ga0207647_10009432 3300025904 Bacteria 6934
156 Ga0207647_10128796 3300025904 Bacteria 1488
157 Ga0207685_10048624 3300025905 Bacteria 1626
158 Ga0207699_10002064 3300025906 Bacteria 9489
159 Ga0207699_10014455 3300025906 Bacteria 4070
160 Ga0207705_10219756 3300025909 Bacteria 1443
161 Ga0207684_10040407 3300025910 Bacteria 3954
162 Ga0207684_10052520 3300025910 Bacteria 3458
163 Ga0207684_10074704 3300025910 Bacteria 2880
164 Ga0207684_10172630 3300025910 Bacteria 1863
165 Ga0207684_10540319 3300025910 Bacteria 997
166 Ga0207707_10158691 3300025912 Bacteria 1978
167 Ga0207695_10000449 3300025913 Bacteria 89856
168 Ga0207671_10000052 3300025914 Bacteria 188462
169 Ga0207671_10495799 3300025914 Bacteria 974
170 Ga0207663_10001812 3300025916 Bacteria 10093
171 Ga0207663_10144374 3300025916 Bacteria 1662
172 Ga0207646_10015555 3300025922 Bacteria 7181
173 Ga0207646_10028005 3300025922 Bacteria 5134
174 Ga0207646_10087778 3300025922 Bacteria 2783
175 Ga0207646_10110238 3300025922 Bacteria 2470
176 Ga0207646_10288670 3300025922 Bacteria 1482
177 Ga0207694_10000079 3300025924 Bacteria 111767
178 Ga0207650_11180467 3300025925 Bacteria 652
179 Ga0207659_10833060 3300025926 Bacteria 793
180 Ga0207687_10100335 3300025927 Bacteria 2129
181 Ga0207687_10122885 3300025927 Bacteria 1944
182 Ga0207687_10888245 3300025927 Bacteria 762
183 Ga0207700_10008575 3300025928 Bacteria 6342
184 Ga0207700_10014777 3300025928 Bacteria 5126
185 Ga0207700_10260657 3300025928 Bacteria 1484
186 Ga0207664_10000341 3300025929 Bacteria 34367
187 Ga0207664_10031264 3300025929 Bacteria 4071
188 Ga0207664_10296281 3300025929 Bacteria 1422
189 Ga0207686_10980883 3300025934 Bacteria 685
190 Ga0207709_10005302 3300025935 Bacteria 7335
191 Ga0207709_10069295 3300025935 Bacteria 2232
192 Ga0207665_10002727 3300025939 Bacteria 11848
193 Ga0207665_10019025 3300025939 Bacteria 4511
194 Ga0207665_10090596 3300025939 Bacteria 2119
195 Ga0207665_10292424 3300025939 Bacteria 1215
196 Ga0207691_10136399 3300025940 Bacteria 2164
197 Ga0207711_10097161 3300025941 Bacteria 2600
198 Ga0207711_10139384 3300025941 Bacteria 2181
199 Ga0207711_10167793 3300025941 Bacteria 1990
200 Ga0207689_10038451 3300025942 Bacteria 3963
201 Ga0207661_10381463 3300025944 Bacteria 1276
202 Ga0207661_11393665 3300025944 Bacteria 643
203 Ga0207679_10118739 3300025945 Bacteria 2101
204 Ga0207679_10707649 3300025945 Bacteria 914
205 Ga0207667_10008068 3300025949 Bacteria 12548
206 Ga0207667_10354176 3300025949 Bacteria 1497
207 Ga0207667_10533626 3300025949 Bacteria 1188
208 Ga0207668_10003383 3300025972 Bacteria 9352
209 Ga0207668_11173018 3300025972 Bacteria 690
210 Ga0207640_10042792 3300025981 Bacteria 2890
211 Ga0207640_10162953 3300025981 Bacteria 1652
212 Ga0207677_10035072 3300026023 Bacteria 3254
213 Ga0207703_10014834 3300026035 Bacteria 6081
214 Ga0207639_10173213 3300026041 Bacteria 1830
215 Ga0207639_10228406 3300026041 Bacteria 1612
216 Ga0207702_10151815 3300026078 Bacteria 2108
217 Ga0207702_10185703 3300026078 Bacteria 1917
218 Ga0207702_10256002 3300026078 Bacteria 1646
219 Ga0207698_10023885 3300026142 Bacteria 4280
220 Ga0208976_10089 3300027200 Bacteria 764
221 Ga0209371_1031617 3300027312 Bacteria 1146
222 Ga0209813_10005060 3300027866 Bacteria 3187
223 Ga0268266_10015277 3300028379 Bacteria 6591
224 Ga0268265_10057465 3300028380 Bacteria 2965
225 Ga0265334_10000874 3300028573 Bacteria 15103
226 Ga0265336_10002275 3300028666 Bacteria 8033
227 Ga0307517_10002400 3300028786 Bacteria 30069
228 Ga0307517_10006298 3300028786 Bacteria 17623
229 Ga0307517_10086569 3300028786 Bacteria 2613
230 Ga0307517_10213521 3300028786 Bacteria 1184
231 Ga0307515_10000038 3300028794 Bacteria 331376
232 Ga0307515_10001177 3300028794 Bacteria 59836
233 Ga0307515_10033888 3300028794 Bacteria 8389
234 Ga0307515_10086084 3300028794 Bacteria 4011
235 Ga0307515_10104037 3300028794 Bacteria 3397
236 Ga0307515_10210976 3300028794 Bacteria 1786
237 Ga0265338_10001380 3300028800 Bacteria 39522
238 Ga0268256_1013505 3300030500 Bacteria 2468
239 Ga0307511_10002042 3300030521 Bacteria 21169
240 Ga0307511_10109100 3300030521 Bacteria 1772
241 Ga0307512_10005436 3300030522 Bacteria 13305
242 Ga0307512_10006290 3300030522 Bacteria 12063
243 Ga0307512_10027696 3300030522 Bacteria 4980
244 Ga0265327_10000021 3300031251 Bacteria 417788
245 Ga0307513_10007971 3300031456 Bacteria 13620
246 Ga0307513_10023232 3300031456 Bacteria 7249
247 Ga0307513_10045604 3300031456 Bacteria 4789
248 Ga0307513_10228372 3300031456 Bacteria 1675
249 Ga0307509_10015278 3300031507 Bacteria 8971
250 Ga0307509_10069495 3300031507 Bacteria 3681
251 Ga0307509_10163227 3300031507 Bacteria 2121
252 Ga0307509_10316032 3300031507 Bacteria 1301
253 Ga0307408_100017582 3300031548 Bacteria 4787
254 Ga0307508_10000506 3300031616 Bacteria 46624
255 Ga0307508_10001775 3300031616 Bacteria 23968
256 Ga0307508_10014629 3300031616 Bacteria 7158
257 Ga0307508_10030734 3300031616 Bacteria 4854
258 Ga0307508_10064626 3300031616 Bacteria 3226
259 Ga0307508_10201044 3300031616 Bacteria 1593
260 Ga0307508_10303466 3300031616 Bacteria 1189
261 Ga0307514_10006847 3300031649 Bacteria 9870
262 Ga0307514_10037111 3300031649 Bacteria 3868
263 Ga0307514_10181625 3300031649 Bacteria 1355
264 Ga0316579_10002060 3300031691 Bacteria 7532
265 Ga0316576_10002103 3300031727 Bacteria 11207
266 Ga0316576_10004023 3300031727 Bacteria 8750
267 Ga0316576_10017633 3300031727 Bacteria 4856
268 Ga0307516_10002871 3300031730 Bacteria 22675
269 Ga0307516_10010111 3300031730 Bacteria 10429
270 Ga0307516_10017451 3300031730 Bacteria 7484
271 Ga0307516_10021308 3300031730 Bacteria 6674
272 Ga0307516_10119211 3300031730 Bacteria 2432
273 Ga0307516_10168803 3300031730 Bacteria 1930
274 Ga0307516_10641736 3300031730 Bacteria 716
275 Ga0307405_10041322 3300031731 Bacteria 2798
276 Ga0307405_10106693 3300031731 Bacteria 1889
277 Ga0307405_10161691 3300031731 Bacteria 1587
278 Ga0316577_10011667 3300031733 Bacteria 4766
279 Ga0307413_10072273 3300031824 Bacteria 2177
280 Ga0307413_10318605 3300031824 Bacteria 1187
281 Ga0307518_10054920 3300031838 Bacteria 2894
282 Ga0307410_10015291 3300031852 Bacteria 4547
283 Ga0326468_10000710 3300031889 Bacteria 3368
284 Ga0307406_10004254 3300031901 Bacteria 7791
285 Ga0307406_10060114 3300031901 Bacteria 2449
286 Ga0307407_10003337 3300031903 Bacteria 6563
287 Ga0307412_10749474 3300031911 Bacteria 843
288 Ga0307409_100000406 3300031995 Bacteria 18400
289 Ga0307409_100025042 3300031995 Bacteria 4176
290 Ga0307409_100342503 3300031995 Bacteria 1407
291 Ga0307416_100005536 3300032002 Bacteria 7769
292 Ga0307416_100006145 3300032002 Bacteria 7484
293 Ga0307416_101172627 3300032002 Bacteria 873
294 Ga0307414_10776620 3300032004 Bacteria 872
295 Ga0307411_10581905 3300032005 Bacteria 960
296 Ga0307415_100000422 3300032126 Bacteria 18141
297 Ga0307415_100049687 3300032126 Bacteria 2837
298 Ga0307415_100129203 3300032126 Bacteria 1909
299 Ga0307415_100393824 3300032126 Bacteria 1180
300 Ga0316585_10006376 3300032137 Bacteria 3373
301 Ga0316585_10013650 3300032137 Bacteria 2419
302 Ga0316585_10198398 3300032137 Bacteria 663
303 Ga0316580_10001258 3300032139 Bacteria 6532
304 Ga0316580_10093244 3300032139 Bacteria 921
305 Ga0316593_10005924 3300032168 Bacteria 3265
306 Ga0307507_10046747 3300033179 Bacteria 4238
307 Ga0307507_10107969 3300033179 Bacteria 2291
308 Ga0307507_10134600 3300033179 Bacteria 1920
309 Ga0307507_10256224 3300033179 Bacteria 1123
310 Ga0307510_10055624 3300033180 Bacteria 4131
311 Ga0307510_10141040 3300033180 Bacteria 2053
312 Ga0307510_10287223 3300033180 Bacteria 1112
313 Ga0307510_10294043 3300033180 Bacteria 1089
314 Ga0316592_1001020 3300033524 Bacteria 4341
315 Ga0316588_1020277 3300033528 Bacteria 1504
316 Ga0316596_1006584 3300033541 Bacteria 2707
317 Ga0373926_0015043 3300035083 Bacteria 2635
318 Ga0373926_0144764 3300035083 Bacteria 903
319 Ga0373934_0000145 3300035086 Bacteria 25938
320 Ga0373934_0055947 3300035086 Bacteria 1568
321 Ga0373944_0018737 3300035089 Bacteria 1979
322 Ga0373949_0139700 3300035090 Bacteria 693
323 Ga0373951_0000115 3300035091 Bacteria 30473
324 Ga0373923_0036634 3300035111 Bacteria 2003
325 Ga0373932_0036450 3300035112 Bacteria 1397
326 Ga0373932_0046447 3300035112 Bacteria 1273
327 Ga0373953_0000082 3300035117 Bacteria 22843
328 Ga0373956_0025341 3300035119 Bacteria 2562
329 Ga0373957_0000047 3300035120 Bacteria 31450
330 Ga0373957_0003440 3300035120 Bacteria 4680
331 Ga0373955_0000020 3300035172 Bacteria 63100
332 Ga0373955_0029205 3300035172 Bacteria 2865
333 Ga0373942_0000196 3300035207 Bacteria 15484
334 Ga0316574_0002467 3300035398 Bacteria 9293
335 Ga0316574_0003441 3300035398 Bacteria 8157
336 Ga0316574_0012516 3300035398 Bacteria 4854
337 Ga0316574_0202237 3300035398 Bacteria 1276
338 Ga0316574_0249145 3300035398 Bacteria 1135
339 Ga0316574_0449297 3300035398 Bacteria 808
340 Ga0373924_0001863 3300035410 Bacteria 6982
341 Ga0373924_0054868 3300035410 Bacteria 1657
342 Ga0373931_0067227 3300035691 Bacteria 1947
343 Ga0373935_0001783 3300035692 Bacteria 12111
344 Ga0373935_0231311 3300035692 Bacteria 1287
345 Ga0373935_0404336 3300035692 Bacteria 981
346 Ga0373933_0000192 3300035724 Bacteria 40573
347 Ga0373947_0000009 3300035725 Bacteria 172751
348 Ga0373937_0000067 3300036401 Bacteria 94291
349 Ga0373937_0079660 3300036401 Bacteria 3027
350 Ga0310112_023850 3300036458 Bacteria 851
351 Ga0316582_0009552 3300036647 Bacteria 5269
352 Ga0316582_0283237 3300036647 Bacteria 1138
353 Ga0316582_0310176 3300036647 Bacteria 1084
354 Ga0316584_0006927 3300036712 Bacteria 7705
355 Ga0316584_0015007 3300036712 Bacteria 5532
356 Ga0316584_0204214 3300036712 Bacteria 1457
357 Ga0395899_0145964 3300037312 Bacteria 1680
358 Ga0395900_0080690 3300037418 Bacteria 3343
359 Ga0395900_0525259 3300037418 Bacteria 1131
360 Ga0395898_0035335 3300037466 Bacteria 4971
361 Ga0395898_0151508 3300037466 Bacteria 2218
362 Ga0395898_0716200 3300037466 Bacteria 942
363 Ga0395898_0813423 3300037466 Bacteria 874
364 Ga0395905_0040914 3300037471 Bacteria 4348
365 Ga0395905_0082226 3300037471 Bacteria 3018
366 Ga0395905_0439594 3300037471 Bacteria 1202
367 Ga0316581_0008926 3300037588 Bacteria 2742
368 Ga0436364_0696641 3300037853 Bacteria 19004
369 Ga0395901_0003772 3300038443 Bacteria 15271
370 Ga0395901_0025204 3300038443 Bacteria 6106
371 Ga0395901_0978121 3300038443 Bacteria 823
372 Ga0400488_07225 3300038741 Bacteria 3313
373 Ga0436363_0357854 3300039450 Bacteria 1031
374 Ga0436362_0777364 3300039453 Bacteria 1098
375 Ga0436362_1118715 3300039453 Bacteria 1331
376 Ga0439436_0000647 3300041404 Bacteria 9264
377 Ga0439439_0050921 3300041406 Bacteria 1085
378 Ga0451793_0775163 3300041452 Bacteria 1195
379 Ga0451795_0216371 3300041456 Bacteria 932
380 Ga0451798_0034298 3300041458 Bacteria 1504
381 Ga0451804_0745524 3300041463 Bacteria 780
382 Ga0451804_0888423 3300041463 Bacteria 1039
383 Ga0451835_1095149 3300041492 Bacteria 2265
384 Ga0451841_0657617 3300041498 Bacteria 1034
385 Ga0451845_0110932 3300041501 Bacteria 1148
386 Ga0451853_0476250 3300041512 Bacteria 4496
387 Ga0439431_0082966 3300041997 Bacteria 866
388 Ga0439433_0000925 3300041999 Bacteria 5873
389 Ga0439448_0068586 3300042005 Bacteria 1179
390 Ga0439449_0007208 3300042007 Bacteria 4230
391 Ga0439449_0061763 3300042007 Bacteria 1382
392 Ga0439449_0114589 3300042007 Bacteria 999
393 Ga0439454_012870 3300042011 Bacteria 1140
394 Ga0439455_0007065 3300042012 Bacteria 2360
395 Ga0439457_001642 3300042014 Bacteria 6667
396 Ga0439462_0015964 3300042015 Bacteria 1937
397 Ga0450914_010590 3300042118 Bacteria 894
398 Ga0450894_000878 3300042131 Bacteria 4808
399 Ga0450895_000300 3300042132 Bacteria 2602
400 Ga0450900_025880 3300042136 Bacteria 837
401 Ga0450902_010824 3300042137 Bacteria 1444
402 Ga0450903_000042 3300042138 Bacteria 24733
403 Ga0450903_021470 3300042138 Bacteria 997
404 Ga0450906_003999 3300042145 Bacteria 3118
405 Ga0450907_010517 3300042146 Bacteria 1535
406 Ga0439458_0002401 3300042157 Bacteria 4574
407 Ga0450908_011788 3300042184 Bacteria 1594
408 Ga0450901_020097 3300042533 Bacteria 714
409 Ga0451577_0111144 3300042876 Bacteria 2452
410 Ga0466969_0001418 3300044656 Bacteria 12922
411 Ga0466969_0003205 3300044656 Bacteria 8713
412 Ga0466969_0004397 3300044656 Bacteria 7494
413 Ga0466969_0391709 3300044656 Bacteria 630
414 Ga0466972_0024378 3300044658 Bacteria 3002
415 Ga0466972_0029293 3300044658 Bacteria 2710
416 Ga0466972_0151363 3300044658 Bacteria 1091
417 Ga0466972_0202942 3300044658 Bacteria 929
418 Ga0466965_0077522 3300044683 Bacteria 1678
419 Ga0466965_0118188 3300044683 Bacteria 1367
420 Ga0466965_0234623 3300044683 Bacteria 981
421 Ga0466966_0002225 3300044684 Bacteria 12619
422 Ga0466966_0005406 3300044684 Bacteria 8394
423 Ga0466966_0005466 3300044684 Bacteria 8354
424 Ga0466966_0025916 3300044684 Bacteria 3830
425 Ga0466966_0265793 3300044684 Bacteria 1032
426 Ga0466961_0005647 3300044693 Bacteria 7909
427 Ga0466961_0010029 3300044693 Bacteria 6034
428 Ga0466961_0030018 3300044693 Bacteria 3493
429 Ga0466961_0034304 3300044693 Bacteria 3258
430 Ga0466961_0165088 3300044693 Bacteria 1379
431 Ga0466963_0001853 3300044694 Bacteria 11530
432 Ga0466963_0006392 3300044694 Bacteria 6969
433 Ga0466963_0177807 3300044694 Bacteria 1485
434 Ga0466963_0185911 3300044694 Bacteria 1451
435 Ga0466964_0058623 3300044706 Bacteria 1597
436 Ga0466971_0001269 3300044719 Bacteria 10524
437 Ga0466971_0074212 3300044719 Bacteria 1546
438 Ga0466968_0068045 3300044735 Bacteria 1545
439 Ga0466970_0005211 3300044765 Bacteria 6433
440 Ga0466970_0009711 3300044765 Bacteria 4868
441 Ga0466970_0011518 3300044765 Bacteria 4508
442 Ga0466970_0231915 3300044765 Bacteria 1032
443 Ga0466957_0005140 3300044842 Bacteria 7314
444 Ga0466957_0064142 3300044842 Bacteria 2259
445 Ga0466957_0654104 3300044842 Bacteria 739
446 Ga0466957_0770045 3300044842 Bacteria 682
447 Ga0466960_0152786 3300044901 Bacteria 1234
448 Ga0466959_0012115 3300045049 Bacteria 6223
449 Ga0466959_0019353 3300045049 Bacteria 5006
450 Ga0466959_0032027 3300045049 Bacteria 3890
451 Ga0466959_0366316 3300045049 Bacteria 982
452 Ga0466959_0380902 3300045049 Bacteria 960
453 Ga0466958_0018495 3300045836 Bacteria 4044
454 Ga0466958_0027371 3300045836 Bacteria 3375
455 Ga0466958_0068692 3300045836 Bacteria 2166
456 Ga0466958_0202720 3300045836 Bacteria 1263
457 Ga0466958_0605152 3300045836 Bacteria 713
458 Ga0466958_0619135 3300045836 Bacteria 704
459 Ga0466967_0049198 3300045976 Bacteria 3685
460 Ga0466967_0160826 3300045976 Bacteria 2107
461 Ga0466967_0601572 3300045976 Bacteria 1085
462 Ga0466967_1805276 3300045976 Bacteria 609
463 Ga0495617_008519 3300046452 Bacteria 3533
464 Ga0495627_046111 3300046453 Bacteria 1326
465 Ga0495592_0000069 3300046454 Bacteria 94288
466 Ga0495592_0086598 3300046454 Bacteria 2255
467 Ga0495592_0113597 3300046454 Bacteria 1913
468 Ga0495592_0139010 3300046454 Bacteria 1691
469 Ga0495603_0014289 3300046455 Bacteria 4803
470 Ga0495603_0049787 3300046455 Bacteria 2493
471 Ga0495603_0106842 3300046455 Bacteria 1633
472 Ga0495603_0107917 3300046455 Bacteria 1624
473 Ga0495603_0125423 3300046455 Bacteria 1496
474 Ga0495603_0172744 3300046455 Bacteria 1251
475 Ga0495590_0074454 3300046457 Bacteria 1194
476 Ga0495629_0004039 3300046459 Bacteria 11030
477 Ga0495629_0037840 3300046459 Bacteria 3400
478 Ga0495629_0099559 3300046459 Bacteria 2028
479 Ga0495629_0218347 3300046459 Bacteria 1315
480 Ga0495629_0221652 3300046459 Bacteria 1304
481 Ga0495629_0245836 3300046459 Bacteria 1231
482 Ga0495638_0056942 3300046460 Bacteria 2425
483 Ga0495638_0254522 3300046460 Bacteria 966
484 Ga0495638_0376605 3300046460 Bacteria 742
485 Ga0495638_0415067 3300046460 Bacteria 695
486 Ga0495641_0031258 3300046461 Bacteria 2545
487 Ga0495641_0056976 3300046461 Bacteria 1770
488 Ga0495641_0222014 3300046461 Bacteria 848
489 Ga0495651_0000016 3300046462 Bacteria 125612
490 Ga0495651_0000877 3300046462 Bacteria 23370
491 Ga0495651_0002270 3300046462 Bacteria 14836
492 Ga0495651_0024622 3300046462 Bacteria 4681
493 Ga0495651_0064795 3300046462 Bacteria 2792
494 Ga0495651_0267752 3300046462 Bacteria 1160
495 Ga0495653_0000381 3300046463 Bacteria 35673
496 Ga0495653_0022314 3300046463 Bacteria 5123
497 Ga0495653_0147679 3300046463 Bacteria 1646
498 Ga0495580_0105648 3300046472 Bacteria 1956
499 Ga0495582_0103106 3300046473 Bacteria 1598
500 Ga0495582_0112376 3300046473 Bacteria 1530
501 Ga0495582_0287040 3300046473 Bacteria 945
502 Ga0495605_0028928 3300046474 Bacteria 2856
503 Ga0495605_0159786 3300046474 Bacteria 1001
504 Ga0495605_0211553 3300046474 Bacteria 841
505 Ga0495662_0002591 3300046476 Bacteria 9136
506 Ga0495662_0017622 3300046476 Bacteria 3457
507 Ga0495662_0062385 3300046476 Bacteria 1800
508 Ga0495662_0181358 3300046476 Bacteria 1037
509 Ga0495664_0011037 3300046477 Bacteria 5082
510 Ga0495664_0047922 3300046477 Bacteria 2536
511 Ga0495664_0358600 3300046477 Bacteria 877
512 Ga0495584_0096326 3300046491 Bacteria 1494
513 Ga0495585_0007060 3300046492 Bacteria 6907
514 Ga0495585_0017360 3300046492 Bacteria 4157
515 Ga0495585_0029333 3300046492 Bacteria 3132
516 Ga0495585_0111505 3300046492 Bacteria 1454
517 Ga0495585_0165981 3300046492 Bacteria 1143
518 Ga0495594_0000534 3300046499 Bacteria 19485
519 Ga0495594_0001342 3300046499 Bacteria 12775
520 Ga0495594_0025045 3300046499 Bacteria 3206
521 Ga0495594_0066921 3300046499 Bacteria 1993
522 Ga0495594_0080354 3300046499 Bacteria 1820
523 Ga0495594_0122822 3300046499 Bacteria 1468
524 Ga0495594_0201958 3300046499 Bacteria 1133
525 Ga0495596_0059337 3300046500 Bacteria 1491
526 Ga0495607_0027985 3300046501 Bacteria 3480
527 Ga0495607_0098590 3300046501 Bacteria 1569
528 Ga0495607_0111703 3300046501 Bacteria 1448
529 Ga0495607_0171270 3300046501 Bacteria 1096
530 Ga0495583_0014310 3300046506 Bacteria 4383
531 Ga0495608_0000051 3300046511 Bacteria 94719
532 Ga0495610_0032653 3300046512 Bacteria 2701
533 Ga0495616_0004473 3300046513 Bacteria 8801
534 Ga0495618_0071355 3300046514 Bacteria 2209
535 Ga0495618_0073416 3300046514 Bacteria 2178
536 Ga0495620_0210712 3300046515 Bacteria 745
537 Ga0495620_0210714 3300046515 Bacteria 745
538 Ga0495628_0000126 3300046516 Bacteria 63839
539 Ga0495628_0021083 3300046516 Bacteria 5366
540 Ga0495628_0047595 3300046516 Bacteria 3401
541 Ga0495628_0232483 3300046516 Bacteria 1381
542 Ga0495630_0083686 3300046517 Bacteria 2409
543 Ga0495630_0222633 3300046517 Bacteria 1440
544 Ga0495630_0271273 3300046517 Bacteria 1296
545 Ga0495630_0286596 3300046517 Bacteria 1258
546 Ga0495631_0003096 3300046518 Bacteria 9166
547 Ga0495631_0062705 3300046518 Bacteria 1610
548 Ga0495631_0251352 3300046518 Bacteria 753
549 Ga0495632_0013008 3300046519 Bacteria 4770
550 Ga0495637_0009037 3300046520 Bacteria 4869
551 Ga0495643_0003319 3300046522 Bacteria 11874
552 Ga0495643_0011979 3300046522 Bacteria 5248
553 Ga0495648_0052190 3300046524 Bacteria 2485
554 Ga0495666_0042778 3300046526 Bacteria 2189
555 Ga0495666_0071248 3300046526 Bacteria 1652
556 Ga0495642_0098842 3300046528 Bacteria 1240
557 Ga0495642_0151219 3300046528 Bacteria 1004
558 Ga0495652_0000654 3300046529 Bacteria 40137
559 Ga0495652_0000831 3300046529 Bacteria 35576
560 Ga0495652_0006834 3300046529 Bacteria 10573
561 Ga0495652_0018073 3300046529 Bacteria 6290
562 Ga0495654_0055777 3300046530 Bacteria 1912
563 Ga0495665_0007973 3300046531 Bacteria 5743
564 Ga0495640_0018021 3300046533 Bacteria 5249
565 Ga0495640_0032738 3300046533 Bacteria 3699
566 Ga0495586_0067920 3300046535 Bacteria 1944
567 Ga0495586_0186455 3300046535 Bacteria 1174
568 Ga0495587_0000058 3300046536 Bacteria 94307
569 Ga0495587_0000907 3300046536 Bacteria 19603
570 Ga0495587_0003288 3300046536 Bacteria 10788
571 Ga0495609_0007988 3300046538 Bacteria 5225
572 Ga0495597_0026389 3300046542 Bacteria 2668
573 Ga0495645_0004398 3300046543 Bacteria 9628
574 Ga0495645_0044976 3300046543 Bacteria 3220
575 Ga0495645_0277480 3300046543 Bacteria 1103
576 Ga0495622_0009980 3300046557 Bacteria 4392
577 Ga0495622_0010925 3300046557 Bacteria 4188
578 Ga0495622_0011920 3300046557 Bacteria 4021
579 Ga0495622_0018300 3300046557 Bacteria 3263
580 Ga0495622_0215186 3300046557 Bacteria 852
581 Ga0495633_0033673 3300046558 Bacteria 2469
582 Ga0495633_0034749 3300046558 Bacteria 2423
583 Ga0495633_0250474 3300046558 Bacteria 808
584 Ga0495667_0000062 3300046559 Bacteria 94307
585 Ga0495667_0055394 3300046559 Bacteria 2608
586 Ga0495667_0073354 3300046559 Bacteria 2229
587 Ga0495667_0182850 3300046559 Bacteria 1345
588 Ga0495667_0294036 3300046559 Bacteria 1030
589 Ga0495656_0042986 3300046615 Bacteria 1895
590 Ga0495656_0171800 3300046615 Bacteria 1060
591 Ga0495668_0000123 3300046616 Bacteria 115173
592 Ga0495668_0419641 3300046616 Bacteria 735
593 Ga0495634_0012335 3300046642 Bacteria 6192
594 Ga0495634_0085861 3300046642 Bacteria 2050
595 Ga0495634_0223669 3300046642 Bacteria 1161
596 Ga0495611_0020510 3300046648 Bacteria 2845
597 Ga0495611_0172956 3300046648 Bacteria 1009
598 Ga0495625_0005807 3300046660 Bacteria 11145
599 Ga0495625_0315112 3300046660 Bacteria 997
600 Ga0495625_0393212 3300046660 Bacteria 867
601 Ga0495635_0005875 3300046663 Bacteria 8556
602 Ga0495635_0016061 3300046663 Bacteria 5228
603 Ga0495635_0044394 3300046663 Bacteria 3067
604 Ga0495635_0138722 3300046663 Bacteria 1656
605 Ga0495635_0228830 3300046663 Bacteria 1256
606 Ga0495635_0327665 3300046663 Bacteria 1024
607 Ga0495661_0020242 3300046665 Bacteria 4348
608 Ga0495588_0001306 3300046674 Bacteria 10661
609 Ga0495588_0002549 3300046674 Bacteria 7786
610 Ga0495588_0033182 3300046674 Bacteria 2606
611 Ga0495588_0044870 3300046674 Bacteria 2265
612 Ga0495588_0493970 3300046674 Bacteria 642
613 Ga0495657_0000065 3300046675 Bacteria 94307
614 Ga0495657_0003629 3300046675 Bacteria 12539
615 Ga0495657_0085383 3300046675 Bacteria 2034
616 Ga0495657_0153142 3300046675 Bacteria 1430
617 Ga0495657_0258619 3300046675 Bacteria 1047
618 Ga0495657_0280552 3300046675 Bacteria 997
619 Ga0495599_0000045 3300046678 Bacteria 86086
620 Ga0495599_0043568 3300046678 Bacteria 2816
621 Ga0495599_0089876 3300046678 Bacteria 1917
622 Ga0495623_0000051 3300046679 Bacteria 72814
623 Ga0495623_0026038 3300046679 Bacteria 3767
624 Ga0495623_0086019 3300046679 Bacteria 1938
625 Ga0495623_0108105 3300046679 Bacteria 1688
626 Ga0495623_0137046 3300046679 Bacteria 1460
627 Ga0495646_0000855 3300046680 Bacteria 17256
628 Ga0495646_0006164 3300046680 Bacteria 7603
629 Ga0495646_0036344 3300046680 Bacteria 3051
630 Ga0495646_0193007 3300046680 Bacteria 1112
631 Ga0495658_0043519 3300046683 Bacteria 2512
632 Ga0495658_0073541 3300046683 Bacteria 1990
633 Ga0495669_0016530 3300046684 Bacteria 3161
634 Ga0495613_0003081 3300046689 Bacteria 12453
635 Ga0495613_0052882 3300046689 Bacteria 2990
636 Ga0495613_0150761 3300046689 Bacteria 1658
637 Ga0495613_0511424 3300046689 Bacteria 807
638 Ga0495613_0608431 3300046689 Bacteria 726
639 Ga0495624_0058266 3300046690 Bacteria 2426
640 Ga0495624_0385078 3300046690 Bacteria 842
641 Ga0495670_0006366 3300046691 Bacteria 5797
642 Ga0495670_0139922 3300046691 Bacteria 1265
643 Ga0495670_0172250 3300046691 Bacteria 1140
644 Ga0495671_0027068 3300046692 Bacteria 2964
645 Ga0495671_0101110 3300046692 Bacteria 1409
646 Ga0495671_0140874 3300046692 Bacteria 1175
647 Ga0495671_0238204 3300046692 Bacteria 879
648 Ga0495649_0108145 3300046694 Bacteria 1475
649 Ga0495649_0153422 3300046694 Bacteria 1209
650 Ga0495649_0220882 3300046694 Bacteria 980
651 Ga0495589_0052255 3300046794 Bacteria 2019
652 Ga0495589_0081760 3300046794 Bacteria 1571
653 Ga0495589_0100668 3300046794 Bacteria 1398
654 Ga0495589_0149558 3300046794 Bacteria 1115
655 Ga0495589_0309960 3300046794 Bacteria 730
656 Ga0495600_0001072 3300046809 Bacteria 14861
657 Ga0495600_0005303 3300046809 Bacteria 7767
658 Ga0495600_0005439 3300046809 Bacteria 7677
659 Ga0495600_0082971 3300046809 Bacteria 2092
660 Ga0495600_0306200 3300046809 Bacteria 1001
661 Ga0495660_0289822 3300046810 Bacteria 745
662 Ga0495660_0289843 3300046810 Bacteria 745
663 Ga0495581_0084198 3300047315 Bacteria 1843
664 Ga0495581_0111016 3300047315 Bacteria 1595
665 Ga0495604_0000233 3300047317 Bacteria 49951
666 Ga0495604_0001536 3300047317 Bacteria 19010
667 Ga0495604_0010118 3300047317 Bacteria 7472
668 Ga0495604_0248821 3300047317 Bacteria 1212
669 Ga0495636_0005810 3300047318 Bacteria 4838
670 Ga0495636_0037681 3300047318 Bacteria 1997
671 Ga0495636_0047587 3300047318 Bacteria 1791
672 Ga0495636_0086946 3300047318 Bacteria 1352
673 Ga0495636_0127086 3300047318 Bacteria 1132
674 Ga0495636_0170319 3300047318 Bacteria 984
675 Ga0495674_0215164 3300047319 Bacteria 1590
676 Ga0495674_0436576 3300047319 Bacteria 1053
677 Ga0495672_0019354 3300047320 Bacteria 4493
678 Ga0495676_0013343 3300047321 Bacteria 7380
679 Ga0495676_0026725 3300047321 Bacteria 4962
680 Ga0495676_0028819 3300047321 Bacteria 4736
681 Ga0495676_0066809 3300047321 Bacteria 2784
682 Ga0495676_0101081 3300047321 Bacteria 2134
683 Ga0495676_0111304 3300047321 Bacteria 2008
684 Ga0495680_0000678 3300047322 Bacteria 38049
685 Ga0495680_0044111 3300047322 Bacteria 3527
686 Ga0495680_0084935 3300047322 Bacteria 2384
687 Ga0495680_0577371 3300047322 Bacteria 754
688 Ga0495683_0069931 3300047323 Bacteria 1724
689 Ga0495683_0153368 3300047323 Bacteria 1070
690 Ga0495683_0154877 3300047323 Bacteria 1063
691 Ga0495683_0185626 3300047323 Bacteria 947
692 Ga0495687_001147 3300047443 Bacteria 25643
693 Ga0495687_003306 3300047443 Bacteria 11824
694 Ga0495687_134956 3300047443 Bacteria 867
695 Ga0495675_0000325 3300047444 Bacteria 33817
696 Ga0495675_0000675 3300047444 Bacteria 21516
697 Ga0495675_0007918 3300047444 Bacteria 6566
698 Ga0495675_0077417 3300047444 Bacteria 2095
699 Ga0495675_0295609 3300047444 Bacteria 963
700 Ga0495679_057193 3300047446 Bacteria 1154
701 Ga0495685_000486 3300047447 Bacteria 12295
702 Ga0495685_020602 3300047447 Bacteria 2266
703 Ga0495685_034258 3300047447 Bacteria 1744
704 Ga0495685_034731 3300047447 Bacteria 1732
705 Ga0495685_092198 3300047447 Bacteria 1003
706 Ga0495685_169910 3300047447 Bacteria 704
707 Ga0495681_0000590 3300047470 Bacteria 27737
708 Ga0495681_0004760 3300047470 Bacteria 9198
709 Ga0495684_0065573 3300047471 Bacteria 2760
710 Ga0495684_0186585 3300047471 Bacteria 1535
711 Ga0495686_0087868 3300047472 Bacteria 1890
712 Ga0495686_0159404 3300047472 Bacteria 1319
713 Ga0495686_0345750 3300047472 Bacteria 810
714 Ga0495593_0037244 3300047673 Bacteria 2632
715 Ga0495593_0105733 3300047673 Bacteria 1440
716 Ga0495593_0106955 3300047673 Bacteria 1430
717 Ga0495593_0226146 3300047673 Bacteria 938
718 Ga0495602_0000079 3300048088 Bacteria 94307
719 Ga0495602_0168435 3300048088 Bacteria 1702
720 Ga0495602_0246286 3300048088 Bacteria 1334
721 Ga0495602_0567654 3300048088 Bacteria 784
722 Ga0495614_0000331 3300048089 Bacteria 18729
723 Ga0495614_0002125 3300048089 Bacteria 8769
724 Ga0495614_0174306 3300048089 Bacteria 966
725 Ga0495614_0255350 3300048089 Bacteria 803
726 Ga0495614_0501839 3300048089 Bacteria 577
727 Ga0495626_0007219 3300048091 Bacteria 6208
728 Ga0496101_0224705 3300048904 Bacteria 1458
729 Ga0496102_0119267 3300048905 Bacteria 2463
730 Ga0496102_0219017 3300048905 Bacteria 1794
731 Ga0496104_0009222 3300048907 Bacteria 8771
732 Ga0496104_0131038 3300048907 Bacteria 2408
733 Ga0496105_0012096 3300048908 Bacteria 6835
734 Ga0496105_0412330 3300048908 Bacteria 1071
735 Ga0496105_0846831 3300048908 Bacteria 692
736 Ga0496107_0072025 3300048910 Bacteria 2512
737 Ga0496107_0853082 3300048910 Bacteria 665
738 Ga0496108_0000959 3300048911 Bacteria 22428
739 Ga0496108_0042183 3300048911 Bacteria 3809
740 Ga0496108_0061256 3300048911 Bacteria 3166
741 Ga0496109_0139325 3300048912 Bacteria 2268
742 Ga0496109_0147279 3300048912 Bacteria 2203
743 Ga0496109_0293706 3300048912 Bacteria 1532
744 Ga0496110_0014056 3300048913 Bacteria 6636
745 Ga0496110_0087314 3300048913 Bacteria 2786
746 Ga0496110_0180538 3300048913 Bacteria 1916
747 Ga0496110_0242064 3300048913 Bacteria 1641
748 Ga0496111_0091211 3300048914 Bacteria 2233
749 Ga0496111_0185530 3300048914 Bacteria 1546
750 Ga0496111_0463243 3300048914 Bacteria 935
751 Ga0496112_0009854 3300048915 Bacteria 8632
752 Ga0496112_0364853 3300048915 Bacteria 1386
753 Ga0496113_0298415 3300048916 Bacteria 1290
754 Ga0496114_0008124 3300048917 Bacteria 8316
755 Ga0496114_0078991 3300048917 Bacteria 2776
756 Ga0496114_0158091 3300048917 Bacteria 1969
757 Ga0496115_0248285 3300048918 Bacteria 1466
758 Ga0496115_0413098 3300048918 Bacteria 1094
759 Ga0496124_0429297 3300048927 Bacteria 908
760 Ga0496126_0046187 3300048929 Bacteria 3997
761 Ga0501310_000014 3300049130 Bacteria 16976
762 Ga0495678_022611 3300049459 Bacteria 2746
763 Ga0495682_0023182 3300049460 Bacteria 2318
764 Ga0501031_0003124 3300049568 Bacteria 10615
765 Ga0501031_0003254 3300049568 Bacteria 10440
766 Ga0501031_0122493 3300049568 Bacteria 1699
767 Ga0501031_0125833 3300049568 Bacteria 1674
768 Ga0501031_0197093 3300049568 Bacteria 1314
769 Ga0501031_0246077 3300049568 Bacteria 1162
770 Ga0501032_0000686 3300049569 Bacteria 27531
771 Ga0501032_0001522 3300049569 Bacteria 18477
772 Ga0501032_0007044 3300049569 Bacteria 8247
773 Ga0501032_0051495 3300049569 Bacteria 2776
774 Ga0501032_0060063 3300049569 Bacteria 2550
775 Ga0501032_0069873 3300049569 Bacteria 2343
776 Ga0501032_0191272 3300049569 Bacteria 1337
777 Ga0501033_0003959 3300049570 Bacteria 12010
778 Ga0501033_0009007 3300049570 Bacteria 7700
779 Ga0501033_0011728 3300049570 Bacteria 6702
780 Ga0501033_0017170 3300049570 Bacteria 5469
781 Ga0501033_0037585 3300049570 Bacteria 3623
782 Ga0501033_0054186 3300049570 Bacteria 2968
783 Ga0501033_0078686 3300049570 Bacteria 2419
784 Ga0501033_0099712 3300049570 Bacteria 2120
785 Ga0501033_0849378 3300049570 Bacteria 615
786 Ga0501034_0000700 3300049571 Bacteria 50894
787 Ga0501034_0000987 3300049571 Bacteria 40823
788 Ga0501034_0033852 3300049571 Bacteria 5180
789 Ga0501034_0037777 3300049571 Bacteria 4890
790 Ga0501034_0110839 3300049571 Bacteria 2735
791 Ga0501034_0112723 3300049571 Bacteria 2709
792 Ga0501034_0234177 3300049571 Bacteria 1784
793 Ga0501034_0263121 3300049571 Bacteria 1667
794 Ga0501034_0440620 3300049571 Bacteria 1221
795 Ga0501036_0001560 3300049572 Bacteria 17694
796 Ga0501036_0003653 3300049572 Bacteria 12306
797 Ga0501036_0014281 3300049572 Bacteria 6608
798 Ga0501036_0030414 3300049572 Bacteria 4561
799 Ga0501036_0045495 3300049572 Bacteria 3718
800 Ga0501036_0046338 3300049572 Bacteria 3681
801 Ga0501036_0091993 3300049572 Bacteria 2562
802 Ga0501037_0001087 3300049573 Bacteria 20162
803 Ga0501037_0025618 3300049573 Bacteria 4357
804 Ga0501037_0061963 3300049573 Bacteria 2727
805 Ga0501037_0080775 3300049573 Bacteria 2358
806 Ga0501037_0221921 3300049573 Bacteria 1329
807 Ga0501038_0001100 3300049574 Bacteria 24469
808 Ga0501038_0001242 3300049574 Bacteria 23113
809 Ga0501038_0006803 3300049574 Bacteria 10561
810 Ga0501038_0088005 3300049574 Bacteria 2607
811 Ga0501038_0141596 3300049574 Bacteria 1967
812 Ga0501038_0174750 3300049574 Bacteria 1736
813 Ga0501039_0004281 3300049575 Bacteria 10759
814 Ga0501039_0014667 3300049575 Bacteria 5995
815 Ga0501039_0017205 3300049575 Bacteria 5545
816 Ga0501039_0021995 3300049575 Bacteria 4893
817 Ga0501039_0219304 3300049575 Bacteria 1495
818 Ga0501040_0001045 3300049576 Bacteria 17510
819 Ga0501041_0012339 3300049577 Bacteria 5062
820 Ga0501042_0002602 3300049578 Bacteria 11093
821 Ga0501042_0016301 3300049578 Bacteria 5100
822 Ga0501042_0093193 3300049578 Bacteria 2163
823 Ga0501042_0216865 3300049578 Bacteria 1380
824 Ga0501042_0333062 3300049578 Bacteria 1097
825 Ga0501043_0000814 3300049579 Bacteria 27743
826 Ga0501043_0000867 3300049579 Bacteria 26805
827 Ga0501043_0029105 3300049579 Bacteria 4338
828 Ga0501043_0033018 3300049579 Bacteria 4070
829 Ga0501043_0035627 3300049579 Bacteria 3914
830 Ga0501043_0044064 3300049579 Bacteria 3507
831 Ga0501043_0060168 3300049579 Bacteria 2981
832 Ga0501043_0193409 3300049579 Bacteria 1581
833 Ga0501043_0592663 3300049579 Bacteria 819
834 Ga0501046_0000707 3300049580 Bacteria 32240
835 Ga0501046_0004881 3300049580 Bacteria 12082
836 Ga0501046_0006561 3300049580 Bacteria 10288
837 Ga0501046_0038654 3300049580 Bacteria 3827
838 Ga0501046_0145295 3300049580 Bacteria 1792
839 Ga0501046_0212742 3300049580 Bacteria 1434
840 Ga0501047_0000112 3300049581 Bacteria 98939
841 Ga0501047_0000544 3300049581 Bacteria 40681
842 Ga0501047_0001995 3300049581 Bacteria 19595
843 Ga0501047_0023263 3300049581 Bacteria 5950
844 Ga0501047_0031600 3300049581 Bacteria 5107
845 Ga0501047_0052789 3300049581 Bacteria 3929
846 Ga0501047_0065503 3300049581 Bacteria 3502
847 Ga0501047_0204643 3300049581 Bacteria 1833
848 Ga0501047_0385953 3300049581 Bacteria 1234
849 Ga0501047_0621977 3300049581 Bacteria 900
850 Ga0501048_0002418 3300049582 Bacteria 14247
851 Ga0501048_0010533 3300049582 Bacteria 6899
852 Ga0501048_0015892 3300049582 Bacteria 5553
853 Ga0501048_0144532 3300049582 Bacteria 1682
854 Ga0501048_0227416 3300049582 Bacteria 1324
855 Ga0501067_0001531 3300049583 Bacteria 12597
856 Ga0501067_0228774 3300049583 Bacteria 1035
857 Ga0501067_0313677 3300049583 Bacteria 873
858 Ga0501068_0000652 3300049584 Bacteria 17789
859 Ga0501068_0136793 3300049584 Bacteria 1534
860 Ga0501069_0001987 3300049585 Bacteria 10227
861 Ga0501069_0475695 3300049585 Bacteria 744
862 Ga0501070_0005364 3300049586 Bacteria 10933
863 Ga0501070_0007413 3300049586 Bacteria 9317
864 Ga0501070_0008447 3300049586 Bacteria 8696
865 Ga0501070_0028520 3300049586 Bacteria 4683
866 Ga0501070_0054517 3300049586 Bacteria 3315
867 Ga0501070_0238670 3300049586 Bacteria 1488
868 Ga0501070_0297577 3300049586 Bacteria 1315
869 Ga0501071_0003645 3300049587 Bacteria 9658
870 Ga0501072_0008562 3300049588 Bacteria 7758
871 Ga0501072_0425724 3300049588 Bacteria 1052
872 Ga0501073_0014251 3300049589 Bacteria 5772
873 Ga0501073_0022877 3300049589 Bacteria 4496
874 Ga0501073_0066008 3300049589 Bacteria 2523
875 Ga0501073_0259648 3300049589 Bacteria 1199
876 Ga0501073_0307588 3300049589 Bacteria 1093
877 Ga0501074_0002273 3300049590 Bacteria 13362
878 Ga0501074_0012622 3300049590 Bacteria 6144
879 Ga0501074_0039993 3300049590 Bacteria 3395
880 Ga0501074_0132439 3300049590 Bacteria 1783
881 Ga0501076_0036062 3300049592 Bacteria 3873
882 Ga0501077_0017485 3300049593 Bacteria 4527
883 Ga0501251_047748 3300049681 Bacteria 669
884 Ga0501079_0002562 3300049741 Bacteria 13200
885 Ga0501079_0094040 3300049741 Bacteria 2323
886 Ga0501079_0100791 3300049741 Bacteria 2239
887 Ga0501080_0023738 3300049742 Bacteria 5682
888 Ga0501080_0081705 3300049742 Bacteria 3001
889 Ga0501083_0010392 3300049744 Bacteria 6553
890 Ga0501083_0019557 3300049744 Bacteria 4716
891 Ga0501282_002622 3300049778 Bacteria 1947
892 Ga0501035_0000870 3300049822 Bacteria 32141
893 Ga0501035_0004451 3300049822 Bacteria 13296
894 Ga0501035_0015420 3300049822 Bacteria 7050
895 Ga0501035_0047700 3300049822 Bacteria 3843
896 Ga0501035_0059386 3300049822 Bacteria 3405
897 Ga0501035_0067815 3300049822 Bacteria 3164
898 Ga0501035_0132440 3300049822 Bacteria 2172
899 Ga0501035_0147643 3300049822 Bacteria 2041
900 Ga0501035_0316416 3300049822 Bacteria 1312
901 Ga0501044_0002317 3300049823 Bacteria 21701
902 Ga0501044_0010614 3300049823 Bacteria 9992
903 Ga0501044_0011995 3300049823 Bacteria 9389
904 Ga0501044_0020341 3300049823 Bacteria 7085
905 Ga0501044_0021399 3300049823 Bacteria 6900
906 Ga0501044_0228012 3300049823 Bacteria 1811
907 Ga0501044_0274536 3300049823 Bacteria 1620
908 Ga0501044_0324586 3300049823 Bacteria 1463
909 Ga0501044_0338707 3300049823 Bacteria 1425
910 Ga0501044_0495460 3300049823 Bacteria 1123
911 Ga0501045_0014319 3300049824 Bacteria 5619
912 Ga0501045_0077506 3300049824 Bacteria 2449
913 Ga0501045_0105868 3300049824 Bacteria 2084
914 Ga0501045_0171368 3300049824 Bacteria 1616
915 Ga0501045_0468240 3300049824 Bacteria 936
916 nmdc:mga03n38_269825_c1 3300050490 Bacteria 905
917 nmdc:mga03n38_50584_c1 3300050490 Bacteria 1853
918 nmdc:mga00v17_171753_c1 3300050491 Bacteria 1398
919 nmdc:mga0yw44_668391_c1 3300050492 Bacteria 706
920 nmdc:mga0yw44_739629_c1 3300050492 Bacteria 668
921 nmdc:mga06z11_222551_c1 3300050494 Bacteria 1103
922 nmdc:mga06z11_242299_c1 3300050494 Bacteria 1059
923 nmdc:mga06z11_9099_c1 3300050494 Bacteria 4173
924 nmdc:mga04h51_7954_c1 3300050495 Bacteria 2821
925 nmdc:mga07m45_61521_c1 3300050496 Bacteria 2127
926 nmdc:mga07m45_84894_c1 3300050496 Bacteria 1810
927 nmdc:mga05p37_856356_c1 3300050507 Bacteria 986
928 nmdc:mga09592_220966_c1 3300050508 Bacteria 1641
929 nmdc:mga08y16_1490131_c1 3300050511 Bacteria 637
930 Ga0495601_0019263 3300053077 Bacteria 4161
931 Ga0495601_0024467 3300053077 Bacteria 3719
932 Ga0495601_0062260 3300053077 Bacteria 2369
933 Ga0495612_0000768 3300053078 Bacteria 13075
934 Ga0495612_0005175 3300053078 Bacteria 5388
935 Ga0495612_0063444 3300053078 Bacteria 1532
936 Ga0495655_0018188 3300053083 Bacteria 1541
937 Ga0495595_0006106 3300053084 Bacteria 4895
938 Ga0495619_0113133 3300053085 Bacteria 1856
939 Ga0495619_0416383 3300053085 Bacteria 927
940 Ga0500578_0008090 3300053086 Bacteria 6887
941 Ga0500578_0089502 3300053086 Bacteria 1954
942 Ga0500578_0115495 3300053086 Bacteria 1690
943 Ga0500644_0380410 3300053088 Bacteria 613
944 Ga0500583_0023379 3300053092 Bacteria 2604
945 Ga0500651_0013535 3300053093 Bacteria 4973
946 Ga0500651_0288322 3300053093 Bacteria 945
947 Ga0500566_0086219 3300053094 Bacteria 1741
948 Ga0500566_0145746 3300053094 Bacteria 1251
949 Ga0500640_000199 3300053095 Bacteria 12879
950 Ga0500641_0052684 3300053096 Bacteria 1677
951 Ga0500641_0343873 3300053096 Bacteria 601
952 Ga0500650_0016510 3300053098 Bacteria 3170
953 Ga0500650_0176274 3300053098 Bacteria 981
954 Ga0500654_049480 3300053099 Bacteria 2281
955 Ga0500660_029746 3300053100 Bacteria 2856
956 Ga0500553_091291 3300053101 Bacteria 1339
957 Ga0500560_002560 3300053107 Bacteria 3501
958 Ga0500560_034312 3300053107 Bacteria 1555
959 Ga0500562_106921 3300053108 Bacteria 762
960 Ga0500569_000546 3300053109 Bacteria 6301
961 Ga0500569_007858 3300053109 Bacteria 2415
962 Ga0500591_141766 3300053115 Bacteria 947
963 Ga0500594_0006500 3300053118 Bacteria 2629
964 Ga0500594_0017387 3300053118 Bacteria 1761
965 Ga0500628_002653 3300053129 Bacteria 2950
966 Ga0500628_056958 3300053129 Bacteria 944
967 Ga0500652_000612 3300053131 Bacteria 12304
968 Ga0500652_025122 3300053131 Bacteria 2279
969 Ga0500658_0003635 3300053134 Bacteria 5819
970 Ga0500561_0000617 3300053137 Bacteria 5682
971 Ga0500573_0033390 3300053140 Bacteria 2970
972 Ga0500573_0096693 3300053140 Bacteria 1664
973 Ga0500573_0203833 3300053140 Bacteria 1048
974 Ga0500577_0092516 3300053142 Bacteria 1224
975 Ga0500579_028293 3300053143 Bacteria 3606
976 Ga0500588_0010244 3300053146 Bacteria 2257
977 Ga0500600_0003949 3300053149 Bacteria 8643
978 Ga0500600_0048636 3300053149 Bacteria 2414
979 Ga0500600_0126663 3300053149 Bacteria 1307
980 Ga0500620_020076 3300053155 Bacteria 1976
981 Ga0500624_041737 3300053157 Bacteria 826
982 Ga0500633_0000470 3300053160 Bacteria 6396
983 Ga0500634_0010585 3300053161 Bacteria 4717
984 Ga0500656_000324 3300053732 Bacteria 3371
985 Ga0500587_002977 3300053739 Bacteria 2397
986 Ga0501084_0001814 3300054114 Bacteria 17044
987 Ga0587082_094927 3300059504 Bacteria 642
988 Ga0587083_0034247 3300059505 Bacteria 1029
989 Ga0587101_074392 3300059623 Bacteria 632
990 Ga0587072_072482 3300059643 Bacteria 730
991 Ga0587107_056688 3300059652 Bacteria 680
992 Ga0587071_102484 3300060344 Bacteria 664
993 Ga0587111_0043853 3300060346 Bacteria 964
994 Ga0501082_0009754 3300060353 Bacteria 8272
995 Ga0501082_0009930 3300060353 Bacteria 8207
996 Ga0466962_0001065 3300061719 Bacteria 12616
997 Ga0466962_0059802 3300061719 Bacteria 1819

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100238153 Ga0070708_1002381532 175
2 3300025910 Ga0207684_10540319 Ga0207684_105403192 175
3 3300005467 Ga0070706_100022401 Ga0070706_1000224015 176
4 3300005471 Ga0070698_100000073 Ga0070698_10000007360 176
5 3300006028 Ga0070717_10006986 Ga0070717_100069869 176
6 3300025910 Ga0207684_10040407 Ga0207684_100404075 176
7 3300039453 Ga0436362_1118715 Ga0436362_1118715_753_1313 176
8 3300005468 Ga0070707_100096257 Ga0070707_1000962572 179
9 3300006914 Ga0075436_100009981 Ga0075436_1000099815 179
10 3300025922 Ga0207646_10015555 Ga0207646_100155552 179
11 3300025939 Ga0207665_10292424 Ga0207665_102924242 179
12 3300035112 Ga0373932_0036450 Ga0373932_0036450_698_1264 179
13 3300044656 Ga0466969_0391709 Ga0466969_0391709_45_599 179
14 3300044842 Ga0466957_0770045 Ga0466957_0770045_105_659 179
15 3300059623 Ga0587101_074392 Ga0587101_074392_21_581 179
16 3300005467 Ga0070706_100028028 Ga0070706_1000280283 180
17 3300010375 Ga0105239_10227329 Ga0105239_102273293 180
18 3300025910 Ga0207684_10052520 Ga0207684_100525204 180
19 3300046684 Ga0495669_0016530 Ga0495669_0016530_495_1076 180
20 3300005341 Ga0070691_10223067 Ga0070691_102230672 181
21 3300005354 Ga0070675_100252848 Ga0070675_1002528482 181
22 3300005355 Ga0070671_100593449 Ga0070671_1005934492 181
23 3300005435 Ga0070714_100005638 Ga0070714_1000056383 181
24 3300005435 Ga0070714_100259945 Ga0070714_1002599452 181
25 3300005436 Ga0070713_100082501 Ga0070713_1000825012 181
26 3300005437 Ga0070710_10064545 Ga0070710_100645453 181
27 3300005439 Ga0070711_100285287 Ga0070711_1002852872 181
28 3300005445 Ga0070708_100079381 Ga0070708_1000793813 181
29 3300005445 Ga0070708_100371712 Ga0070708_1003717122 181
30 3300005445 Ga0070708_100389335 Ga0070708_1003893351 181
31 3300005466 Ga0070685_10070335 Ga0070685_100703352 181
32 3300005467 Ga0070706_100021841 Ga0070706_1000218413 181
33 3300005468 Ga0070707_100060119 Ga0070707_1000601193 181
34 3300005468 Ga0070707_100085925 Ga0070707_1000859252 181
35 3300005468 Ga0070707_100092350 Ga0070707_1000923502 181
36 3300005471 Ga0070698_100007866 Ga0070698_1000078664 181
37 3300005471 Ga0070698_100240442 Ga0070698_1002404422 181
38 3300005471 Ga0070698_100288985 Ga0070698_1002889852 181
39 3300005530 Ga0070679_100234828 Ga0070679_1002348283 181
40 3300005535 Ga0070684_100129401 Ga0070684_1001294012 181
41 3300005536 Ga0070697_100068869 Ga0070697_1000688692 181
42 3300005548 Ga0070665_100127648 Ga0070665_1001276483 181
43 3300005577 Ga0068857_100081703 Ga0068857_1000817032 181
44 3300005618 Ga0068864_100117330 Ga0068864_1001173303 181
45 3300005841 Ga0068863_100107785 Ga0068863_1001077853 181
46 3300005843 Ga0068860_100109475 Ga0068860_1001094753 181
47 3300005844 Ga0068862_100245460 Ga0068862_1002454602 181
48 3300005937 Ga0081455_10044055 Ga0081455_100440554 181
49 3300005983 Ga0081540_1057177 Ga0081540_10571772 181
50 3300005985 Ga0081539_10003492 Ga0081539_1000349214 181
51 3300005985 Ga0081539_10004406 Ga0081539_100044066 181
52 3300005985 Ga0081539_10010250 Ga0081539_100102503 181
53 3300006173 Ga0070716_100065567 Ga0070716_1000655673 181
54 3300006237 Ga0097621_100143458 Ga0097621_1001434582 181
55 3300006871 Ga0075434_100229942 Ga0075434_1002299422 181
56 3300006914 Ga0075436_100549664 Ga0075436_1005496642 181
57 3300007076 Ga0075435_100351775 Ga0075435_1003517751 181
58 3300009098 Ga0105245_10261800 Ga0105245_102618002 181
59 3300009174 Ga0105241_10077421 Ga0105241_100774212 181
60 3300009177 Ga0105248_10075304 Ga0105248_100753042 181
61 3300009545 Ga0105237_10227257 Ga0105237_102272573 181
62 3300010375 Ga0105239_10032749 Ga0105239_100327493 181
63 3300013296 Ga0157374_10175319 Ga0157374_101753193 181
64 3300013306 Ga0163162_10194077 Ga0163162_101940773 181
65 3300013307 Ga0157372_10535298 Ga0157372_105352983 181
66 3300014325 Ga0163163_10013354 Ga0163163_100133547 181
67 3300014325 Ga0163163_10525102 Ga0163163_105251022 181
68 3300014968 Ga0157379_10471539 Ga0157379_104715392 181
69 3300014969 Ga0157376_10003944 Ga0157376_100039443 181
70 3300014969 Ga0157376_10150356 Ga0157376_101503562 181
71 3300020080 Ga0206350_11072649 Ga0206350_110726493 181
72 3300022467 Ga0224712_10000465 Ga0224712_100004656 181
73 3300022467 Ga0224712_10003509 Ga0224712_100035093 181
74 3300022467 Ga0224712_10157609 Ga0224712_101576092 181
75 3300025898 Ga0207692_10002379 Ga0207692_100023795 181
76 3300025898 Ga0207692_10195304 Ga0207692_101953042 181
77 3300025903 Ga0207680_10131885 Ga0207680_101318852 181
78 3300025905 Ga0207685_10048624 Ga0207685_100486243 181
79 3300025906 Ga0207699_10002064 Ga0207699_100020648 181
80 3300025906 Ga0207699_10014455 Ga0207699_100144552 181
81 3300025910 Ga0207684_10074704 Ga0207684_100747043 181
82 3300025914 Ga0207671_10495799 Ga0207671_104957992 181
83 3300025916 Ga0207663_10001812 Ga0207663_100018128 181
84 3300025916 Ga0207663_10144374 Ga0207663_101443742 181
85 3300025922 Ga0207646_10028005 Ga0207646_100280053 181
86 3300025922 Ga0207646_10087778 Ga0207646_100877783 181
87 3300025922 Ga0207646_10110238 Ga0207646_101102383 181
88 3300025922 Ga0207646_10288670 Ga0207646_102886702 181
89 3300025926 Ga0207659_10833060 Ga0207659_108330601 181
90 3300025927 Ga0207687_10122885 Ga0207687_101228852 181
91 3300025928 Ga0207700_10008575 Ga0207700_100085755 181
92 3300025928 Ga0207700_10014777 Ga0207700_100147775 181
93 3300025928 Ga0207700_10260657 Ga0207700_102606572 181
94 3300025929 Ga0207664_10000341 Ga0207664_1000034127 181
95 3300025929 Ga0207664_10031264 Ga0207664_100312643 181
96 3300025929 Ga0207664_10296281 Ga0207664_102962812 181
97 3300025939 Ga0207665_10002727 Ga0207665_1000272711 181
98 3300025939 Ga0207665_10019025 Ga0207665_100190253 181
99 3300025939 Ga0207665_10090596 Ga0207665_100905963 181
100 3300025941 Ga0207711_10097161 Ga0207711_100971613 181
101 3300025941 Ga0207711_10167793 Ga0207711_101677932 181
102 3300025945 Ga0207679_10118739 Ga0207679_101187392 181
103 3300025945 Ga0207679_10707649 Ga0207679_107076492 181
104 3300025949 Ga0207667_10354176 Ga0207667_103541763 181
105 3300025972 Ga0207668_10003383 Ga0207668_100033836 181
106 3300026023 Ga0207677_10035072 Ga0207677_100350724 181
107 3300026035 Ga0207703_10014834 Ga0207703_100148343 181
108 3300026041 Ga0207639_10228406 Ga0207639_102284063 181
109 3300026078 Ga0207702_10185703 Ga0207702_101857033 181
110 3300028380 Ga0268265_10057465 Ga0268265_100574653 181
111 3300028666 Ga0265336_10002275 Ga0265336_100022753 181
112 3300028786 Ga0307517_10086569 Ga0307517_100865693 181
113 3300028786 Ga0307517_10213521 Ga0307517_102135212 181
114 3300028794 Ga0307515_10000038 Ga0307515_10000038133 181
115 3300028794 Ga0307515_10033888 Ga0307515_100338885 181
116 3300028794 Ga0307515_10086084 Ga0307515_100860844 181
117 3300028800 Ga0265338_10001380 Ga0265338_100013809 181
118 3300030522 Ga0307512_10006290 Ga0307512_1000629010 181
119 3300031456 Ga0307513_10007971 Ga0307513_100079717 181
120 3300031507 Ga0307509_10015278 Ga0307509_100152783 181
121 3300031548 Ga0307408_100017582 Ga0307408_1000175823 181
122 3300031616 Ga0307508_10000506 Ga0307508_1000050637 181
123 3300031616 Ga0307508_10030734 Ga0307508_100307343 181
124 3300031616 Ga0307508_10201044 Ga0307508_102010442 181
125 3300031730 Ga0307516_10002871 Ga0307516_100028718 181
126 3300031730 Ga0307516_10017451 Ga0307516_100174512 181
127 3300031730 Ga0307516_10021308 Ga0307516_100213083 181
128 3300031730 Ga0307516_10641736 Ga0307516_106417361 181
129 3300031731 Ga0307405_10041322 Ga0307405_100413223 181
130 3300031731 Ga0307405_10106693 Ga0307405_101066932 181
131 3300031731 Ga0307405_10161691 Ga0307405_101616914 181
132 3300031824 Ga0307413_10072273 Ga0307413_100722733 181
133 3300031824 Ga0307413_10318605 Ga0307413_103186052 181
134 3300031852 Ga0307410_10015291 Ga0307410_100152915 181
135 3300031889 Ga0326468_10000710 Ga0326468_100007103 181
136 3300031901 Ga0307406_10004254 Ga0307406_100042546 181
137 3300031901 Ga0307406_10060114 Ga0307406_100601143 181
138 3300031903 Ga0307407_10003337 Ga0307407_100033374 181
139 3300031995 Ga0307409_100000406 Ga0307409_1000004065 181
140 3300031995 Ga0307409_100025042 Ga0307409_1000250425 181
141 3300031995 Ga0307409_100342503 Ga0307409_1003425032 181
142 3300032002 Ga0307416_100005536 Ga0307416_1000055365 181
143 3300032126 Ga0307415_100000422 Ga0307415_1000004228 181
144 3300032126 Ga0307415_100049687 Ga0307415_1000496874 181
145 3300032126 Ga0307415_100129203 Ga0307415_1001292032 181
146 3300032126 Ga0307415_100393824 Ga0307415_1003938242 181
147 3300033179 Ga0307507_10107969 Ga0307507_101079693 181
148 3300035083 Ga0373926_0015043 Ga0373926_0015043_1017_1583 181
149 3300035083 Ga0373926_0144764 Ga0373926_0144764_247_807 181
150 3300035086 Ga0373934_0000145 Ga0373934_0000145_417_1028 181
151 3300035086 Ga0373934_0055947 Ga0373934_0055947_925_1491 181
152 3300035089 Ga0373944_0018737 Ga0373944_0018737_427_993 181
153 3300035090 Ga0373949_0139700 Ga0373949_0139700_38_604 181
154 3300035091 Ga0373951_0000115 Ga0373951_0000115_12993_13664 181
155 3300035111 Ga0373923_0036634 Ga0373923_0036634_1363_1929 181
156 3300035112 Ga0373932_0046447 Ga0373932_0046447_186_857 181
157 3300035117 Ga0373953_0000082 Ga0373953_0000082_242_853 181
158 3300035119 Ga0373956_0025341 Ga0373956_0025341_565_1131 181
159 3300035120 Ga0373957_0000047 Ga0373957_0000047_385_996 181
160 3300035120 Ga0373957_0003440 Ga0373957_0003440_2347_2913 181
161 3300035172 Ga0373955_0000020 Ga0373955_0000020_24042_24653 181
162 3300035172 Ga0373955_0029205 Ga0373955_0029205_1270_1836 181
163 3300035207 Ga0373942_0000196 Ga0373942_0000196_2850_3521 181
164 3300035410 Ga0373924_0001863 Ga0373924_0001863_3131_3742 181
165 3300035410 Ga0373924_0054868 Ga0373924_0054868_952_1518 181
166 3300035691 Ga0373931_0067227 Ga0373931_0067227_142_708 181
167 3300035692 Ga0373935_0001783 Ga0373935_0001783_3367_3927 181
168 3300035692 Ga0373935_0231311 Ga0373935_0231311_600_1193 181
169 3300035724 Ga0373933_0000192 Ga0373933_0000192_4549_5160 181
170 3300035725 Ga0373947_0000009 Ga0373947_0000009_133361_133921 181
171 3300036401 Ga0373937_0000067 Ga0373937_0000067_58679_59290 181
172 3300036401 Ga0373937_0079660 Ga0373937_0079660_1599_2165 181
173 3300037418 Ga0395900_0080690 Ga0395900_0080690_2060_2728 181
174 3300037466 Ga0395898_0035335 Ga0395898_0035335_422_1090 181
175 3300037471 Ga0395905_0082226 Ga0395905_0082226_455_1123 181
176 3300038443 Ga0395901_0003772 Ga0395901_0003772_12725_13393 181
177 3300042118 Ga0450914_010590 Ga0450914_010590_102_773 181
178 3300044694 Ga0466963_0177807 Ga0466963_0177807_774_1340 181
179 3300046454 Ga0495592_0000069 Ga0495592_0000069_34999_35610 181
180 3300046454 Ga0495592_0113597 Ga0495592_0113597_636_1202 181
181 3300046455 Ga0495603_0125423 Ga0495603_0125423_681_1247 181
182 3300046459 Ga0495629_0245836 Ga0495629_0245836_568_1134 181
183 3300046461 Ga0495641_0056976 Ga0495641_0056976_222_788 181
184 3300046462 Ga0495651_0000016 Ga0495651_0000016_58695_59306 181
185 3300046462 Ga0495651_0024622 Ga0495651_0024622_3185_3751 181
186 3300046463 Ga0495653_0000381 Ga0495653_0000381_9443_10054 181
187 3300046463 Ga0495653_0022314 Ga0495653_0022314_1488_2054 181
188 3300046472 Ga0495580_0105648 Ga0495580_0105648_1313_1879 181
189 3300046473 Ga0495582_0287040 Ga0495582_0287040_59_625 181
190 3300046476 Ga0495662_0062385 Ga0495662_0062385_548_1114 181
191 3300046477 Ga0495664_0047922 Ga0495664_0047922_1440_2006 181
192 3300046511 Ga0495608_0000051 Ga0495608_0000051_35414_36025 181
193 3300046514 Ga0495618_0071355 Ga0495618_0071355_1572_2138 181
194 3300046516 Ga0495628_0000126 Ga0495628_0000126_58695_59306 181
195 3300046516 Ga0495628_0232483 Ga0495628_0232483_351_917 181
196 3300046517 Ga0495630_0083686 Ga0495630_0083686_967_1554 181
197 3300046517 Ga0495630_0222633 Ga0495630_0222633_294_860 181
198 3300046526 Ga0495666_0071248 Ga0495666_0071248_136_702 181
199 3300046529 Ga0495652_0000831 Ga0495652_0000831_13566_14177 181
200 3300046529 Ga0495652_0018073 Ga0495652_0018073_5122_5688 181
201 3300046531 Ga0495665_0007973 Ga0495665_0007973_899_1465 181
202 3300046533 Ga0495640_0032738 Ga0495640_0032738_2605_3171 181
203 3300046535 Ga0495586_0186455 Ga0495586_0186455_571_1137 181
204 3300046536 Ga0495587_0000058 Ga0495587_0000058_58695_59306 181
205 3300046536 Ga0495587_0000907 Ga0495587_0000907_7362_7928 181
206 3300046559 Ga0495667_0000062 Ga0495667_0000062_35002_35613 181
207 3300046559 Ga0495667_0073354 Ga0495667_0073354_712_1278 181
208 3300046642 Ga0495634_0085861 Ga0495634_0085861_773_1339 181
209 3300046663 Ga0495635_0138722 Ga0495635_0138722_414_980 181
210 3300046674 Ga0495588_0044870 Ga0495588_0044870_942_1508 181
211 3300046675 Ga0495657_0000065 Ga0495657_0000065_58695_59306 181
212 3300046675 Ga0495657_0085383 Ga0495657_0085383_453_1019 181
213 3300046678 Ga0495599_0000045 Ga0495599_0000045_37259_37870 181
214 3300046678 Ga0495599_0043568 Ga0495599_0043568_1085_1651 181
215 3300046679 Ga0495623_0000051 Ga0495623_0000051_37390_38001 181
216 3300046679 Ga0495623_0026038 Ga0495623_0026038_812_1378 181
217 3300046680 Ga0495646_0006164 Ga0495646_0006164_239_850 181
218 3300046680 Ga0495646_0036344 Ga0495646_0036344_1166_1732 181
219 3300046689 Ga0495613_0052882 Ga0495613_0052882_353_919 181
220 3300046690 Ga0495624_0058266 Ga0495624_0058266_574_1140 181
221 3300046694 Ga0495649_0220882 Ga0495649_0220882_248_919 181
222 3300046809 Ga0495600_0005303 Ga0495600_0005303_2832_3443 181
223 3300046809 Ga0495600_0005439 Ga0495600_0005439_4194_4760 181
224 3300047317 Ga0495604_0000233 Ga0495604_0000233_12526_13137 181
225 3300047319 Ga0495674_0215164 Ga0495674_0215164_931_1497 181
226 3300047321 Ga0495676_0066809 Ga0495676_0066809_129_695 181
227 3300047321 Ga0495676_0101081 Ga0495676_0101081_1305_1859 181
228 3300047322 Ga0495680_0000678 Ga0495680_0000678_2437_3048 181
229 3300047322 Ga0495680_0044111 Ga0495680_0044111_1200_1766 181
230 3300047444 Ga0495675_0000325 Ga0495675_0000325_19758_20369 181
231 3300047444 Ga0495675_0077417 Ga0495675_0077417_985_1551 181
232 3300047471 Ga0495684_0065573 Ga0495684_0065573_1127_1693 181
233 3300048088 Ga0495602_0000079 Ga0495602_0000079_58695_59306 181
234 3300048088 Ga0495602_0168435 Ga0495602_0168435_339_905 181
235 3300048905 Ga0496102_0119267 Ga0496102_0119267_1232_1798 181
236 3300048907 Ga0496104_0009222 Ga0496104_0009222_742_1308 181
237 3300048908 Ga0496105_0012096 Ga0496105_0012096_5889_6455 181
238 3300048911 Ga0496108_0000959 Ga0496108_0000959_3067_3633 181
239 3300048913 Ga0496110_0180538 Ga0496110_0180538_1039_1605 181
240 3300048914 Ga0496111_0185530 Ga0496111_0185530_864_1430 181
241 3300048915 Ga0496112_0364853 Ga0496112_0364853_376_942 181
242 3300048918 Ga0496115_0413098 Ga0496115_0413098_127_720 181
243 3300049571 Ga0501034_0263121 Ga0501034_0263121_714_1274 181
244 3300049572 Ga0501036_0003653 Ga0501036_0003653_7308_7868 181
245 3300049574 Ga0501038_0006803 Ga0501038_0006803_829_1389 181
246 3300049574 Ga0501038_0141596 Ga0501038_0141596_1303_1863 181
247 3300049578 Ga0501042_0016301 Ga0501042_0016301_1241_1801 181
248 3300049579 Ga0501043_0000814 Ga0501043_0000814_21243_21803 181
249 3300049581 Ga0501047_0001995 Ga0501047_0001995_15634_16194 181
250 3300049582 Ga0501048_0015892 Ga0501048_0015892_1152_1712 181
251 3300049590 Ga0501074_0012622 Ga0501074_0012622_3171_3731 181
252 3300049823 Ga0501044_0021399 Ga0501044_0021399_2161_2721 181
253 3300049824 Ga0501045_0468240 Ga0501045_0468240_19_579 181
254 3300050507 nmdc:mga05p37_856356_c1 nmdc:mga05p37_856356_c1_290_961 181
255 3300053077 Ga0495601_0062260 Ga0495601_0062260_773_1339 181
256 3300053078 Ga0495612_0063444 Ga0495612_0063444_820_1386 181
257 3300053084 Ga0495595_0006106 Ga0495595_0006106_3830_4441 181
258 3300053086 Ga0500578_0089502 Ga0500578_0089502_312_980 181
259 3300053093 Ga0500651_0013535 Ga0500651_0013535_1951_2619 181
260 3300053096 Ga0500641_0052684 Ga0500641_0052684_682_1350 181
261 3300053098 Ga0500650_0016510 Ga0500650_0016510_477_1145 181
262 3300053108 Ga0500562_106921 Ga0500562_106921_67_735 181
263 3300053109 Ga0500569_007858 Ga0500569_007858_1011_1679 181
264 3300053118 Ga0500594_0006500 Ga0500594_0006500_649_1317 181
265 3300053131 Ga0500652_025122 Ga0500652_025122_482_1150 181
266 3300053142 Ga0500577_0092516 Ga0500577_0092516_77_748 181
267 3300053149 Ga0500600_0048636 Ga0500600_0048636_1181_1852 181
268 3300060346 Ga0587111_0043853 Ga0587111_0043853_352_918 181
269 3300006038 Ga0075365_10174846 Ga0075365_101748463 182
270 3300009093 Ga0105240_10645361 Ga0105240_106453612 182
271 3300036458 Ga0310112_023850 Ga0310112_023850_14_583 182
272 3300041456 Ga0451795_0216371 Ga0451795_0216371_311_865 182
273 3300044684 Ga0466966_0005406 Ga0466966_0005406_5049_5603 182
274 3300044693 Ga0466961_0005647 Ga0466961_0005647_3479_4033 182
275 3300044719 Ga0466971_0074212 Ga0466971_0074212_963_1517 182
276 3300045836 Ga0466958_0027371 Ga0466958_0027371_1324_1878 182
277 3300050492 nmdc:mga0yw44_668391_c1 nmdc:mga0yw44_668391_c1_75_629 182
278 3300050492 nmdc:mga0yw44_739629_c1 nmdc:mga0yw44_739629_c1_76_630 182
279 3300059643 Ga0587072_072482 Ga0587072_072482_94_663 182
280 3300050511 nmdc:mga08y16_1490131_c1 nmdc:mga08y16_1490131_c1_37_597 183
281 3300001989 JGI24739J22299_10017517 JGI24739J22299_100175172 184
282 3300001990 JGI24737J22298_10005199 JGI24737J22298_100051993 184
283 3300002067 JGI24735J21928_10027305 JGI24735J21928_100273052 184
284 3300003203 JGI25406J46586_10095938 JGI25406J46586_100959382 184
285 3300003354 JGI25160J50197_1007524 JGI25160J50197_10075242 184
286 3300003354 JGI25160J50197_1027486 JGI25160J50197_10274862 184
287 3300003578 Ga0006562J51391_1028667 Ga0006562J51391_10286672 184
288 3300005327 Ga0070658_10092336 Ga0070658_100923363 184
289 3300005329 Ga0070683_100156880 Ga0070683_1001568802 184
290 3300005329 Ga0070683_101336697 Ga0070683_1013366971 184
291 3300005334 Ga0068869_100160319 Ga0068869_1001603191 184
292 3300005338 Ga0068868_100317088 Ga0068868_1003170882 184
293 3300005458 Ga0070681_10257637 Ga0070681_102576372 184
294 3300005466 Ga0070685_10476889 Ga0070685_104768891 184
295 3300005471 Ga0070698_100268482 Ga0070698_1002684822 184
296 3300005530 Ga0070679_100078515 Ga0070679_1000785153 184
297 3300005535 Ga0070684_100318038 Ga0070684_1003180382 184
298 3300005539 Ga0068853_100049777 Ga0068853_1000497772 184
299 3300005547 Ga0070693_100098803 Ga0070693_1000988033 184
300 3300005548 Ga0070665_100040161 Ga0070665_1000401612 184
301 3300005563 Ga0068855_100063115 Ga0068855_1000631152 184
302 3300005578 Ga0068854_100050967 Ga0068854_1000509672 184
303 3300005578 Ga0068854_100694586 Ga0068854_1006945862 184
304 3300005614 Ga0068856_100022041 Ga0068856_1000220412 184
305 3300005614 Ga0068856_100065456 Ga0068856_1000654563 184
306 3300005616 Ga0068852_100029725 Ga0068852_1000297255 184
307 3300005616 Ga0068852_100471772 Ga0068852_1004717722 184
308 3300005618 Ga0068864_100684381 Ga0068864_1006843812 184
309 3300005870 Ga0058723_100038 Ga0058723_1000381 184
310 3300005937 Ga0081455_10009867 Ga0081455_100098676 184
311 3300005983 Ga0081540_1003156 Ga0081540_100315610 184
312 3300005985 Ga0081539_10023002 Ga0081539_100230023 184
313 3300005985 Ga0081539_10067109 Ga0081539_100671092 184
314 3300006042 Ga0075368_10005635 Ga0075368_100056352 184
315 3300006042 Ga0075368_10147976 Ga0075368_101479761 184
316 3300006048 Ga0075363_100041969 Ga0075363_1000419693 184
317 3300006178 Ga0075367_10027504 Ga0075367_100275044 184
318 3300006178 Ga0075367_10087241 Ga0075367_100872413 184
319 3300006353 Ga0075370_10011734 Ga0075370_100117344 184
320 3300006353 Ga0075370_10148971 Ga0075370_101489713 184
321 3300006353 Ga0075370_10320096 Ga0075370_103200961 184
322 3300006846 Ga0075430_100189014 Ga0075430_1001890142 184
323 3300006948 Ga0099826_10142629 Ga0099826_101426292 184
324 3300009011 Ga0105251_10012881 Ga0105251_100128812 184
325 3300009036 Ga0105244_10171727 Ga0105244_101717272 184
326 3300009092 Ga0105250_10024088 Ga0105250_100240882 184
327 3300009093 Ga0105240_10015715 Ga0105240_100157158 184
328 3300009147 Ga0114129_10091266 Ga0114129_100912665 184
329 3300009148 Ga0105243_10000636 Ga0105243_1000063627 184
330 3300009148 Ga0105243_10020026 Ga0105243_100200262 184
331 3300009177 Ga0105248_10212959 Ga0105248_102129592 184
332 3300009545 Ga0105237_10004407 Ga0105237_100044075 184
333 3300009551 Ga0105238_10000200 Ga0105238_1000020022 184
334 3300009551 Ga0105238_10368954 Ga0105238_103689542 184
335 3300009553 Ga0105249_10262215 Ga0105249_102622151 184
336 3300010375 Ga0105239_10048362 Ga0105239_100483625 184
337 3300010375 Ga0105239_11010342 Ga0105239_110103422 184
338 3300011119 Ga0105246_10861047 Ga0105246_108610472 184
339 3300012488 Ga0157343_1005239 Ga0157343_10052392 184
340 3300013100 Ga0157373_10885815 Ga0157373_108858152 184
341 3300013105 Ga0157369_10059844 Ga0157369_100598441 184
342 3300013105 Ga0157369_10364564 Ga0157369_103645641 184
343 3300013296 Ga0157374_10097920 Ga0157374_100979204 184
344 3300013306 Ga0163162_10891135 Ga0163162_108911352 184
345 3300013307 Ga0157372_10937966 Ga0157372_109379662 184
346 3300013308 Ga0157375_10136007 Ga0157375_101360073 184
347 3300013308 Ga0157375_10161489 Ga0157375_101614892 184
348 3300013308 Ga0157375_10183074 Ga0157375_101830743 184
349 3300014326 Ga0157380_10145681 Ga0157380_101456813 184
350 3300014497 Ga0182008_10011765 Ga0182008_100117654 184
351 3300014968 Ga0157379_10187206 Ga0157379_101872062 184
352 3300015262 Ga0182007_10001899 Ga0182007_1000189913 184
353 3300015265 Ga0182005_1007289 Ga0182005_10072893 184
354 3300020076 Ga0206355_1363819 Ga0206355_13638192 184
355 3300020610 Ga0154015_1559063 Ga0154015_15590632 184
356 3300025297 Ga0209758_1005072 Ga0209758_10050729 184
357 3300025302 Ga0207426_1004723 Ga0207426_10047235 184
358 3300025302 Ga0207426_1005819 Ga0207426_10058194 184
359 3300025302 Ga0207426_1014205 Ga0207426_10142052 184
360 3300025321 Ga0207656_10071654 Ga0207656_100716542 184
361 3300025711 Ga0207696_1021304 Ga0207696_10213043 184
362 3300025728 Ga0207655_1086590 Ga0207655_10865901 184
363 3300025735 Ga0207713_1060066 Ga0207713_10600662 184
364 3300025899 Ga0207642_10080716 Ga0207642_100807161 184
365 3300025903 Ga0207680_10543619 Ga0207680_105436192 184
366 3300025904 Ga0207647_10000384 Ga0207647_100003844 184
367 3300025904 Ga0207647_10009432 Ga0207647_100094323 184
368 3300025904 Ga0207647_10128796 Ga0207647_101287962 184
369 3300025909 Ga0207705_10219756 Ga0207705_102197562 184
370 3300025910 Ga0207684_10172630 Ga0207684_101726303 184
371 3300025912 Ga0207707_10158691 Ga0207707_101586912 184
372 3300025913 Ga0207695_10000449 Ga0207695_1000044959 184
373 3300025914 Ga0207671_10000052 Ga0207671_10000052114 184
374 3300025924 Ga0207694_10000079 Ga0207694_1000007921 184
375 3300025925 Ga0207650_11180467 Ga0207650_111804671 184
376 3300025927 Ga0207687_10100335 Ga0207687_101003353 184
377 3300025927 Ga0207687_10888245 Ga0207687_108882452 184
378 3300025934 Ga0207686_10980883 Ga0207686_109808831 184
379 3300025935 Ga0207709_10005302 Ga0207709_100053025 184
380 3300025935 Ga0207709_10069295 Ga0207709_100692953 184
381 3300025940 Ga0207691_10136399 Ga0207691_101363992 184
382 3300025941 Ga0207711_10139384 Ga0207711_101393843 184
383 3300025942 Ga0207689_10038451 Ga0207689_100384514 184
384 3300025944 Ga0207661_10381463 Ga0207661_103814632 184
385 3300025944 Ga0207661_11393665 Ga0207661_113936651 184
386 3300025949 Ga0207667_10008068 Ga0207667_1000806811 184
387 3300025949 Ga0207667_10533626 Ga0207667_105336262 184
388 3300025972 Ga0207668_11173018 Ga0207668_111730181 184
389 3300025981 Ga0207640_10042792 Ga0207640_100427922 184
390 3300025981 Ga0207640_10162953 Ga0207640_101629533 184
391 3300026041 Ga0207639_10173213 Ga0207639_101732132 184
392 3300026078 Ga0207702_10151815 Ga0207702_101518151 184
393 3300026078 Ga0207702_10256002 Ga0207702_102560022 184
394 3300026142 Ga0207698_10023885 Ga0207698_100238852 184
395 3300027200 Ga0208976_10089 Ga0208976_100891 184
396 3300027312 Ga0209371_1031617 Ga0209371_10316172 184
397 3300027866 Ga0209813_10005060 Ga0209813_100050602 184
398 3300028379 Ga0268266_10015277 Ga0268266_100152776 184
399 3300028573 Ga0265334_10000874 Ga0265334_1000087413 184
400 3300028786 Ga0307517_10002400 Ga0307517_100024006 184
401 3300028786 Ga0307517_10006298 Ga0307517_1000629812 184
402 3300028794 Ga0307515_10001177 Ga0307515_1000117736 184
403 3300028794 Ga0307515_10104037 Ga0307515_101040372 184
404 3300028794 Ga0307515_10210976 Ga0307515_102109762 184
405 3300030500 Ga0268256_1013505 Ga0268256_10135052 184
406 3300030521 Ga0307511_10002042 Ga0307511_1000204214 184
407 3300030521 Ga0307511_10109100 Ga0307511_101091001 184
408 3300030522 Ga0307512_10005436 Ga0307512_100054368 184
409 3300030522 Ga0307512_10027696 Ga0307512_100276963 184
410 3300031251 Ga0265327_10000021 Ga0265327_10000021122 184
411 3300031456 Ga0307513_10023232 Ga0307513_100232326 184
412 3300031456 Ga0307513_10045604 Ga0307513_100456042 184
413 3300031456 Ga0307513_10228372 Ga0307513_102283722 184
414 3300031507 Ga0307509_10069495 Ga0307509_100694954 184
415 3300031507 Ga0307509_10163227 Ga0307509_101632273 184
416 3300031507 Ga0307509_10316032 Ga0307509_103160322 184
417 3300031616 Ga0307508_10001775 Ga0307508_1000177514 184
418 3300031616 Ga0307508_10014629 Ga0307508_100146293 184
419 3300031616 Ga0307508_10064626 Ga0307508_100646264 184
420 3300031616 Ga0307508_10303466 Ga0307508_103034662 184
421 3300031649 Ga0307514_10006847 Ga0307514_100068478 184
422 3300031649 Ga0307514_10037111 Ga0307514_100371115 184
423 3300031649 Ga0307514_10181625 Ga0307514_101816252 184
424 3300031691 Ga0316579_10002060 Ga0316579_100020604 184
425 3300031727 Ga0316576_10002103 Ga0316576_100021039 184
426 3300031727 Ga0316576_10004023 Ga0316576_100040236 184
427 3300031727 Ga0316576_10017633 Ga0316576_100176335 184
428 3300031730 Ga0307516_10010111 Ga0307516_100101114 184
429 3300031730 Ga0307516_10119211 Ga0307516_101192113 184
430 3300031730 Ga0307516_10168803 Ga0307516_101688033 184
431 3300031733 Ga0316577_10011667 Ga0316577_100116674 184
432 3300031838 Ga0307518_10054920 Ga0307518_100549203 184
433 3300031911 Ga0307412_10749474 Ga0307412_107494742 184
434 3300032002 Ga0307416_100006145 Ga0307416_1000061452 184
435 3300032002 Ga0307416_101172627 Ga0307416_1011726272 184
436 3300032004 Ga0307414_10776620 Ga0307414_107766202 184
437 3300032005 Ga0307411_10581905 Ga0307411_105819052 184
438 3300032137 Ga0316585_10006376 Ga0316585_100063763 184
439 3300032137 Ga0316585_10013650 Ga0316585_100136502 184
440 3300032137 Ga0316585_10198398 Ga0316585_101983981 184
441 3300032139 Ga0316580_10001258 Ga0316580_100012585 184
442 3300032139 Ga0316580_10093244 Ga0316580_100932442 184
443 3300032168 Ga0316593_10005924 Ga0316593_100059244 184
444 3300033179 Ga0307507_10046747 Ga0307507_100467473 184
445 3300033179 Ga0307507_10134600 Ga0307507_101346003 184
446 3300033179 Ga0307507_10256224 Ga0307507_102562242 184
447 3300033180 Ga0307510_10055624 Ga0307510_100556245 184
448 3300033180 Ga0307510_10141040 Ga0307510_101410402 184
449 3300033180 Ga0307510_10287223 Ga0307510_102872232 184
450 3300033180 Ga0307510_10294043 Ga0307510_102940432 184
451 3300033524 Ga0316592_1001020 Ga0316592_10010203 184
452 3300033528 Ga0316588_1020277 Ga0316588_10202773 184
453 3300033541 Ga0316596_1006584 Ga0316596_10065843 184
454 3300035398 Ga0316574_0002467 Ga0316574_0002467_7405_8004 184
455 3300035398 Ga0316574_0003441 Ga0316574_0003441_3816_4370 184
456 3300035398 Ga0316574_0012516 Ga0316574_0012516_1751_2305 184
457 3300035398 Ga0316574_0202237 Ga0316574_0202237_16_570 184
458 3300035398 Ga0316574_0249145 Ga0316574_0249145_348_902 184
459 3300035398 Ga0316574_0449297 Ga0316574_0449297_198_752 184
460 3300035692 Ga0373935_0404336 Ga0373935_0404336_58_825 184
461 3300036647 Ga0316582_0009552 Ga0316582_0009552_1980_2579 184
462 3300036647 Ga0316582_0283237 Ga0316582_0283237_469_1023 184
463 3300036647 Ga0316582_0310176 Ga0316582_0310176_475_1029 184
464 3300036712 Ga0316584_0006927 Ga0316584_0006927_1751_2305 184
465 3300036712 Ga0316584_0015007 Ga0316584_0015007_3298_3897 184
466 3300036712 Ga0316584_0204214 Ga0316584_0204214_675_1229 184
467 3300037312 Ga0395899_0145964 Ga0395899_0145964_981_1535 184
468 3300037418 Ga0395900_0525259 Ga0395900_0525259_361_915 184
469 3300037466 Ga0395898_0151508 Ga0395898_0151508_1414_1968 184
470 3300037466 Ga0395898_0716200 Ga0395898_0716200_208_762 184
471 3300037466 Ga0395898_0813423 Ga0395898_0813423_193_747 184
472 3300037471 Ga0395905_0040914 Ga0395905_0040914_1144_1698 184
473 3300037471 Ga0395905_0439594 Ga0395905_0439594_212_766 184
474 3300037588 Ga0316581_0008926 Ga0316581_0008926_311_865 184
475 3300037853 Ga0436364_0696641 Ga0436364_0696641_174_728 184
476 3300038443 Ga0395901_0025204 Ga0395901_0025204_5411_5965 184
477 3300038443 Ga0395901_0978121 Ga0395901_0978121_143_697 184
478 3300038741 Ga0400488_07225 Ga0400488_07225_192_746 184
479 3300039450 Ga0436363_0357854 Ga0436363_0357854_176_730 184
480 3300039453 Ga0436362_0777364 Ga0436362_0777364_347_901 184
481 3300041404 Ga0439436_0000647 Ga0439436_0000647_5175_5729 184
482 3300041406 Ga0439439_0050921 Ga0439439_0050921_488_1042 184
483 3300041452 Ga0451793_0775163 Ga0451793_0775163_112_672 184
484 3300041458 Ga0451798_0034298 Ga0451798_0034298_861_1415 184
485 3300041463 Ga0451804_0745524 Ga0451804_0745524_126_680 184
486 3300041463 Ga0451804_0888423 Ga0451804_0888423_16_570 184
487 3300041492 Ga0451835_1095149 Ga0451835_1095149_571_1125 184
488 3300041498 Ga0451841_0657617 Ga0451841_0657617_454_1008 184
489 3300041501 Ga0451845_0110932 Ga0451845_0110932_421_975 184
490 3300041512 Ga0451853_0476250 Ga0451853_0476250_3133_3687 184
491 3300041997 Ga0439431_0082966 Ga0439431_0082966_178_732 184
492 3300041999 Ga0439433_0000925 Ga0439433_0000925_5294_5848 184
493 3300042005 Ga0439448_0068586 Ga0439448_0068586_119_673 184
494 3300042007 Ga0439449_0007208 Ga0439449_0007208_2375_2929 184
495 3300042007 Ga0439449_0061763 Ga0439449_0061763_150_704 184
496 3300042007 Ga0439449_0114589 Ga0439449_0114589_252_806 184
497 3300042011 Ga0439454_012870 Ga0439454_012870_522_1076 184
498 3300042012 Ga0439455_0007065 Ga0439455_0007065_912_1466 184
499 3300042014 Ga0439457_001642 Ga0439457_001642_5381_5935 184
500 3300042015 Ga0439462_0015964 Ga0439462_0015964_1217_1771 184
501 3300042131 Ga0450894_000878 Ga0450894_000878_2215_2769 184
502 3300042132 Ga0450895_000300 Ga0450895_000300_707_1261 184
503 3300042136 Ga0450900_025880 Ga0450900_025880_138_692 184
504 3300042137 Ga0450902_010824 Ga0450902_010824_411_965 184
505 3300042138 Ga0450903_000042 Ga0450903_000042_20102_20656 184
506 3300042138 Ga0450903_021470 Ga0450903_021470_354_908 184
507 3300042145 Ga0450906_003999 Ga0450906_003999_427_981 184
508 3300042146 Ga0450907_010517 Ga0450907_010517_810_1364 184
509 3300042157 Ga0439458_0002401 Ga0439458_0002401_761_1315 184
510 3300042184 Ga0450908_011788 Ga0450908_011788_750_1304 184
511 3300042533 Ga0450901_020097 Ga0450901_020097_123_677 184
512 3300042876 Ga0451577_0111144 Ga0451577_0111144_1868_2434 184
513 3300044656 Ga0466969_0001418 Ga0466969_0001418_5184_5738 184
514 3300044656 Ga0466969_0003205 Ga0466969_0003205_7077_7631 184
515 3300044656 Ga0466969_0004397 Ga0466969_0004397_1894_2448 184
516 3300044658 Ga0466972_0024378 Ga0466972_0024378_987_1541 184
517 3300044658 Ga0466972_0029293 Ga0466972_0029293_344_898 184
518 3300044658 Ga0466972_0151363 Ga0466972_0151363_322_876 184
519 3300044658 Ga0466972_0202942 Ga0466972_0202942_360_914 184
520 3300044683 Ga0466965_0077522 Ga0466965_0077522_111_665 184
521 3300044683 Ga0466965_0118188 Ga0466965_0118188_15_569 184
522 3300044683 Ga0466965_0234623 Ga0466965_0234623_109_663 184
523 3300044684 Ga0466966_0002225 Ga0466966_0002225_11650_12204 184
524 3300044684 Ga0466966_0005466 Ga0466966_0005466_2247_2801 184
525 3300044684 Ga0466966_0025916 Ga0466966_0025916_2620_3174 184
526 3300044684 Ga0466966_0265793 Ga0466966_0265793_415_969 184
527 3300044693 Ga0466961_0010029 Ga0466961_0010029_1946_2500 184
528 3300044693 Ga0466961_0030018 Ga0466961_0030018_2779_3333 184
529 3300044693 Ga0466961_0034304 Ga0466961_0034304_685_1239 184
530 3300044693 Ga0466961_0165088 Ga0466961_0165088_692_1246 184
531 3300044694 Ga0466963_0001853 Ga0466963_0001853_9270_9824 184
532 3300044694 Ga0466963_0006392 Ga0466963_0006392_3690_4244 184
533 3300044694 Ga0466963_0185911 Ga0466963_0185911_637_1191 184
534 3300044706 Ga0466964_0058623 Ga0466964_0058623_995_1549 184
535 3300044719 Ga0466971_0001269 Ga0466971_0001269_1848_2402 184
536 3300044735 Ga0466968_0068045 Ga0466968_0068045_44_598 184
537 3300044765 Ga0466970_0005211 Ga0466970_0005211_958_1512 184
538 3300044765 Ga0466970_0009711 Ga0466970_0009711_2197_2751 184
539 3300044765 Ga0466970_0011518 Ga0466970_0011518_1600_2154 184
540 3300044765 Ga0466970_0231915 Ga0466970_0231915_451_1005 184
541 3300044842 Ga0466957_0005140 Ga0466957_0005140_434_988 184
542 3300044842 Ga0466957_0064142 Ga0466957_0064142_362_916 184
543 3300044842 Ga0466957_0654104 Ga0466957_0654104_87_641 184
544 3300044901 Ga0466960_0152786 Ga0466960_0152786_663_1217 184
545 3300045049 Ga0466959_0012115 Ga0466959_0012115_5140_5694 184
546 3300045049 Ga0466959_0019353 Ga0466959_0019353_4043_4597 184
547 3300045049 Ga0466959_0032027 Ga0466959_0032027_2195_2749 184
548 3300045049 Ga0466959_0366316 Ga0466959_0366316_251_805 184
549 3300045049 Ga0466959_0380902 Ga0466959_0380902_395_949 184
550 3300045836 Ga0466958_0018495 Ga0466958_0018495_1819_2373 184
551 3300045836 Ga0466958_0068692 Ga0466958_0068692_977_1531 184
552 3300045836 Ga0466958_0202720 Ga0466958_0202720_15_569 184
553 3300045836 Ga0466958_0605152 Ga0466958_0605152_100_654 184
554 3300045836 Ga0466958_0619135 Ga0466958_0619135_31_585 184
555 3300045976 Ga0466967_0049198 Ga0466967_0049198_1103_1657 184
556 3300045976 Ga0466967_0160826 Ga0466967_0160826_132_686 184
557 3300045976 Ga0466967_0601572 Ga0466967_0601572_346_900 184
558 3300045976 Ga0466967_1805276 Ga0466967_1805276_40_594 184
559 3300046452 Ga0495617_008519 Ga0495617_008519_1916_2470 184
560 3300046453 Ga0495627_046111 Ga0495627_046111_590_1144 184
561 3300046454 Ga0495592_0086598 Ga0495592_0086598_1459_2013 184
562 3300046454 Ga0495592_0139010 Ga0495592_0139010_252_806 184
563 3300046455 Ga0495603_0014289 Ga0495603_0014289_204_758 184
564 3300046455 Ga0495603_0049787 Ga0495603_0049787_92_646 184
565 3300046455 Ga0495603_0106842 Ga0495603_0106842_504_1058 184
566 3300046455 Ga0495603_0107917 Ga0495603_0107917_954_1508 184
567 3300046455 Ga0495603_0172744 Ga0495603_0172744_119_673 184
568 3300046457 Ga0495590_0074454 Ga0495590_0074454_528_1082 184
569 3300046459 Ga0495629_0004039 Ga0495629_0004039_3535_4089 184
570 3300046459 Ga0495629_0037840 Ga0495629_0037840_951_1505 184
571 3300046459 Ga0495629_0099559 Ga0495629_0099559_319_873 184
572 3300046459 Ga0495629_0218347 Ga0495629_0218347_102_656 184
573 3300046459 Ga0495629_0221652 Ga0495629_0221652_659_1213 184
574 3300046460 Ga0495638_0056942 Ga0495638_0056942_131_685 184
575 3300046460 Ga0495638_0254522 Ga0495638_0254522_131_685 184
576 3300046460 Ga0495638_0376605 Ga0495638_0376605_133_687 184
577 3300046460 Ga0495638_0415067 Ga0495638_0415067_87_641 184
578 3300046461 Ga0495641_0031258 Ga0495641_0031258_1684_2238 184
579 3300046461 Ga0495641_0222014 Ga0495641_0222014_177_731 184
580 3300046462 Ga0495651_0000877 Ga0495651_0000877_12342_12896 184
581 3300046462 Ga0495651_0002270 Ga0495651_0002270_3702_4256 184
582 3300046462 Ga0495651_0064795 Ga0495651_0064795_2108_2662 184
583 3300046462 Ga0495651_0267752 Ga0495651_0267752_147_701 184
584 3300046463 Ga0495653_0147679 Ga0495653_0147679_620_1174 184
585 3300046473 Ga0495582_0103106 Ga0495582_0103106_76_630 184
586 3300046473 Ga0495582_0112376 Ga0495582_0112376_591_1145 184
587 3300046474 Ga0495605_0028928 Ga0495605_0028928_436_990 184
588 3300046474 Ga0495605_0159786 Ga0495605_0159786_121_675 184
589 3300046474 Ga0495605_0211553 Ga0495605_0211553_131_685 184
590 3300046476 Ga0495662_0002591 Ga0495662_0002591_8480_9034 184
591 3300046476 Ga0495662_0017622 Ga0495662_0017622_2753_3307 184
592 3300046476 Ga0495662_0181358 Ga0495662_0181358_57_611 184
593 3300046477 Ga0495664_0011037 Ga0495664_0011037_4402_4956 184
594 3300046477 Ga0495664_0358600 Ga0495664_0358600_81_635 184
595 3300046491 Ga0495584_0096326 Ga0495584_0096326_606_1160 184
596 3300046492 Ga0495585_0007060 Ga0495585_0007060_3239_3793 184
597 3300046492 Ga0495585_0017360 Ga0495585_0017360_811_1365 184
598 3300046492 Ga0495585_0029333 Ga0495585_0029333_1863_2417 184
599 3300046492 Ga0495585_0111505 Ga0495585_0111505_121_675 184
600 3300046492 Ga0495585_0165981 Ga0495585_0165981_474_1028 184
601 3300046499 Ga0495594_0000534 Ga0495594_0000534_9729_10283 184
602 3300046499 Ga0495594_0001342 Ga0495594_0001342_7098_7652 184
603 3300046499 Ga0495594_0025045 Ga0495594_0025045_2618_3172 184
604 3300046499 Ga0495594_0066921 Ga0495594_0066921_947_1501 184
605 3300046499 Ga0495594_0080354 Ga0495594_0080354_1184_1738 184
606 3300046499 Ga0495594_0122822 Ga0495594_0122822_256_810 184
607 3300046499 Ga0495594_0201958 Ga0495594_0201958_401_955 184
608 3300046500 Ga0495596_0059337 Ga0495596_0059337_113_667 184
609 3300046501 Ga0495607_0027985 Ga0495607_0027985_134_688 184
610 3300046501 Ga0495607_0098590 Ga0495607_0098590_786_1340 184
611 3300046501 Ga0495607_0111703 Ga0495607_0111703_133_687 184
612 3300046501 Ga0495607_0171270 Ga0495607_0171270_423_977 184
613 3300046506 Ga0495583_0014310 Ga0495583_0014310_2765_3319 184
614 3300046512 Ga0495610_0032653 Ga0495610_0032653_1778_2332 184
615 3300046513 Ga0495616_0004473 Ga0495616_0004473_3951_4505 184
616 3300046514 Ga0495618_0073416 Ga0495618_0073416_302_895 184
617 3300046515 Ga0495620_0210712 Ga0495620_0210712_135_689 184
618 3300046515 Ga0495620_0210714 Ga0495620_0210714_57_611 184
619 3300046516 Ga0495628_0021083 Ga0495628_0021083_975_1529 184
620 3300046516 Ga0495628_0047595 Ga0495628_0047595_1255_1809 184
621 3300046517 Ga0495630_0271273 Ga0495630_0271273_103_657 184
622 3300046517 Ga0495630_0286596 Ga0495630_0286596_204_758 184
623 3300046518 Ga0495631_0003096 Ga0495631_0003096_2171_2725 184
624 3300046518 Ga0495631_0062705 Ga0495631_0062705_30_584 184
625 3300046518 Ga0495631_0251352 Ga0495631_0251352_86_640 184
626 3300046519 Ga0495632_0013008 Ga0495632_0013008_2057_2611 184
627 3300046520 Ga0495637_0009037 Ga0495637_0009037_224_778 184
628 3300046522 Ga0495643_0003319 Ga0495643_0003319_4694_5248 184
629 3300046522 Ga0495643_0011979 Ga0495643_0011979_2477_3031 184
630 3300046524 Ga0495648_0052190 Ga0495648_0052190_135_689 184
631 3300046526 Ga0495666_0042778 Ga0495666_0042778_243_797 184
632 3300046528 Ga0495642_0098842 Ga0495642_0098842_267_821 184
633 3300046528 Ga0495642_0151219 Ga0495642_0151219_94_648 184
634 3300046529 Ga0495652_0000654 Ga0495652_0000654_29609_30163 184
635 3300046529 Ga0495652_0006834 Ga0495652_0006834_6545_7099 184
636 3300046530 Ga0495654_0055777 Ga0495654_0055777_487_1041 184
637 3300046533 Ga0495640_0018021 Ga0495640_0018021_1007_1561 184
638 3300046535 Ga0495586_0067920 Ga0495586_0067920_946_1500 184
639 3300046536 Ga0495587_0003288 Ga0495587_0003288_4803_5357 184
640 3300046538 Ga0495609_0007988 Ga0495609_0007988_279_833 184
641 3300046542 Ga0495597_0026389 Ga0495597_0026389_135_689 184
642 3300046543 Ga0495645_0004398 Ga0495645_0004398_2401_2955 184
643 3300046543 Ga0495645_0044976 Ga0495645_0044976_920_1474 184
644 3300046543 Ga0495645_0277480 Ga0495645_0277480_475_1068 184
645 3300046557 Ga0495622_0009980 Ga0495622_0009980_1664_2218 184
646 3300046557 Ga0495622_0010925 Ga0495622_0010925_317_871 184
647 3300046557 Ga0495622_0011920 Ga0495622_0011920_3404_3958 184
648 3300046557 Ga0495622_0018300 Ga0495622_0018300_578_1132 184
649 3300046557 Ga0495622_0215186 Ga0495622_0215186_168_722 184
650 3300046558 Ga0495633_0033673 Ga0495633_0033673_1057_1611 184
651 3300046558 Ga0495633_0034749 Ga0495633_0034749_630_1184 184
652 3300046558 Ga0495633_0250474 Ga0495633_0250474_94_648 184
653 3300046559 Ga0495667_0055394 Ga0495667_0055394_785_1339 184
654 3300046559 Ga0495667_0182850 Ga0495667_0182850_443_997 184
655 3300046559 Ga0495667_0294036 Ga0495667_0294036_57_626 184
656 3300046615 Ga0495656_0042986 Ga0495656_0042986_621_1175 184
657 3300046615 Ga0495656_0171800 Ga0495656_0171800_482_1036 184
658 3300046616 Ga0495668_0000123 Ga0495668_0000123_51470_52024 184
659 3300046616 Ga0495668_0419641 Ga0495668_0419641_47_601 184
660 3300046642 Ga0495634_0012335 Ga0495634_0012335_793_1347 184
661 3300046642 Ga0495634_0223669 Ga0495634_0223669_190_759 184
662 3300046648 Ga0495611_0020510 Ga0495611_0020510_347_901 184
663 3300046648 Ga0495611_0172956 Ga0495611_0172956_324_878 184
664 3300046660 Ga0495625_0005807 Ga0495625_0005807_10461_11015 184
665 3300046660 Ga0495625_0315112 Ga0495625_0315112_133_687 184
666 3300046660 Ga0495625_0393212 Ga0495625_0393212_131_685 184
667 3300046663 Ga0495635_0005875 Ga0495635_0005875_25_579 184
668 3300046663 Ga0495635_0016061 Ga0495635_0016061_125_679 184
669 3300046663 Ga0495635_0044394 Ga0495635_0044394_1088_1642 184
670 3300046663 Ga0495635_0228830 Ga0495635_0228830_515_1069 184
671 3300046663 Ga0495635_0327665 Ga0495635_0327665_204_854 184
672 3300046665 Ga0495661_0020242 Ga0495661_0020242_431_985 184
673 3300046674 Ga0495588_0001306 Ga0495588_0001306_10028_10582 184
674 3300046674 Ga0495588_0002549 Ga0495588_0002549_1793_2347 184
675 3300046674 Ga0495588_0033182 Ga0495588_0033182_309_863 184
676 3300046674 Ga0495588_0493970 Ga0495588_0493970_48_602 184
677 3300046675 Ga0495657_0003629 Ga0495657_0003629_11855_12409 184
678 3300046675 Ga0495657_0153142 Ga0495657_0153142_57_611 184
679 3300046675 Ga0495657_0258619 Ga0495657_0258619_437_991 184
680 3300046675 Ga0495657_0280552 Ga0495657_0280552_420_974 184
681 3300046678 Ga0495599_0089876 Ga0495599_0089876_1305_1859 184
682 3300046679 Ga0495623_0086019 Ga0495623_0086019_466_1020 184
683 3300046679 Ga0495623_0108105 Ga0495623_0108105_1031_1585 184
684 3300046679 Ga0495623_0137046 Ga0495623_0137046_14_568 184
685 3300046680 Ga0495646_0000855 Ga0495646_0000855_4780_5334 184
686 3300046680 Ga0495646_0193007 Ga0495646_0193007_103_657 184
687 3300046683 Ga0495658_0043519 Ga0495658_0043519_1803_2357 184
688 3300046683 Ga0495658_0073541 Ga0495658_0073541_459_1013 184
689 3300046689 Ga0495613_0003081 Ga0495613_0003081_6489_7043 184
690 3300046689 Ga0495613_0150761 Ga0495613_0150761_950_1504 184
691 3300046689 Ga0495613_0511424 Ga0495613_0511424_116_670 184
692 3300046689 Ga0495613_0608431 Ga0495613_0608431_57_611 184
693 3300046690 Ga0495624_0385078 Ga0495624_0385078_34_588 184
694 3300046691 Ga0495670_0006366 Ga0495670_0006366_2653_3207 184
695 3300046691 Ga0495670_0139922 Ga0495670_0139922_556_1110 184
696 3300046691 Ga0495670_0172250 Ga0495670_0172250_141_695 184
697 3300046692 Ga0495671_0027068 Ga0495671_0027068_2280_2834 184
698 3300046692 Ga0495671_0101110 Ga0495671_0101110_36_590 184
699 3300046692 Ga0495671_0140874 Ga0495671_0140874_504_1058 184
700 3300046692 Ga0495671_0238204 Ga0495671_0238204_131_685 184
701 3300046694 Ga0495649_0108145 Ga0495649_0108145_57_611 184
702 3300046694 Ga0495649_0153422 Ga0495649_0153422_137_691 184
703 3300046794 Ga0495589_0052255 Ga0495589_0052255_30_584 184
704 3300046794 Ga0495589_0081760 Ga0495589_0081760_834_1388 184
705 3300046794 Ga0495589_0100668 Ga0495589_0100668_135_689 184
706 3300046794 Ga0495589_0149558 Ga0495589_0149558_451_1005 184
707 3300046794 Ga0495589_0309960 Ga0495589_0309960_42_596 184
708 3300046809 Ga0495600_0001072 Ga0495600_0001072_7055_7609 184
709 3300046809 Ga0495600_0082971 Ga0495600_0082971_716_1270 184
710 3300046809 Ga0495600_0306200 Ga0495600_0306200_427_981 184
711 3300046810 Ga0495660_0289822 Ga0495660_0289822_57_611 184
712 3300046810 Ga0495660_0289843 Ga0495660_0289843_57_611 184
713 3300047315 Ga0495581_0084198 Ga0495581_0084198_132_686 184
714 3300047315 Ga0495581_0111016 Ga0495581_0111016_423_977 184
715 3300047317 Ga0495604_0001536 Ga0495604_0001536_1931_2485 184
716 3300047317 Ga0495604_0010118 Ga0495604_0010118_5988_6542 184
717 3300047317 Ga0495604_0248821 Ga0495604_0248821_103_657 184
718 3300047318 Ga0495636_0005810 Ga0495636_0005810_1907_2461 184
719 3300047318 Ga0495636_0037681 Ga0495636_0037681_100_654 184
720 3300047318 Ga0495636_0047587 Ga0495636_0047587_641_1195 184
721 3300047318 Ga0495636_0086946 Ga0495636_0086946_83_637 184
722 3300047318 Ga0495636_0127086 Ga0495636_0127086_58_612 184
723 3300047318 Ga0495636_0170319 Ga0495636_0170319_252_806 184
724 3300047319 Ga0495674_0436576 Ga0495674_0436576_488_1042 184
725 3300047320 Ga0495672_0019354 Ga0495672_0019354_1067_1621 184
726 3300047321 Ga0495676_0013343 Ga0495676_0013343_1086_1640 184
727 3300047321 Ga0495676_0026725 Ga0495676_0026725_92_646 184
728 3300047321 Ga0495676_0028819 Ga0495676_0028819_3547_4101 184
729 3300047321 Ga0495676_0111304 Ga0495676_0111304_92_646 184
730 3300047322 Ga0495680_0084935 Ga0495680_0084935_57_611 184
731 3300047322 Ga0495680_0577371 Ga0495680_0577371_144_698 184
732 3300047323 Ga0495683_0069931 Ga0495683_0069931_694_1248 184
733 3300047323 Ga0495683_0153368 Ga0495683_0153368_133_687 184
734 3300047323 Ga0495683_0154877 Ga0495683_0154877_376_930 184
735 3300047323 Ga0495683_0185626 Ga0495683_0185626_284_838 184
736 3300047443 Ga0495687_001147 Ga0495687_001147_8014_8568 184
737 3300047443 Ga0495687_003306 Ga0495687_003306_11140_11694 184
738 3300047443 Ga0495687_134956 Ga0495687_134956_131_685 184
739 3300047444 Ga0495675_0000675 Ga0495675_0000675_741_1295 184
740 3300047444 Ga0495675_0007918 Ga0495675_0007918_623_1177 184
741 3300047444 Ga0495675_0295609 Ga0495675_0295609_272_826 184
742 3300047446 Ga0495679_057193 Ga0495679_057193_310_864 184
743 3300047447 Ga0495685_000486 Ga0495685_000486_5928_6482 184
744 3300047447 Ga0495685_020602 Ga0495685_020602_1159_1713 184
745 3300047447 Ga0495685_034258 Ga0495685_034258_105_659 184
746 3300047447 Ga0495685_034731 Ga0495685_034731_995_1549 184
747 3300047447 Ga0495685_092198 Ga0495685_092198_420_974 184
748 3300047447 Ga0495685_169910 Ga0495685_169910_113_667 184
749 3300047470 Ga0495681_0000590 Ga0495681_0000590_6612_7166 184
750 3300047470 Ga0495681_0004760 Ga0495681_0004760_6611_7165 184
751 3300047471 Ga0495684_0186585 Ga0495684_0186585_568_1122 184
752 3300047472 Ga0495686_0087868 Ga0495686_0087868_410_964 184
753 3300047472 Ga0495686_0159404 Ga0495686_0159404_717_1271 184
754 3300047472 Ga0495686_0345750 Ga0495686_0345750_13_567 184
755 3300047673 Ga0495593_0037244 Ga0495593_0037244_120_674 184
756 3300047673 Ga0495593_0105733 Ga0495593_0105733_661_1215 184
757 3300047673 Ga0495593_0106955 Ga0495593_0106955_57_611 184
758 3300047673 Ga0495593_0226146 Ga0495593_0226146_328_882 184
759 3300048088 Ga0495602_0246286 Ga0495602_0246286_94_648 184
760 3300048088 Ga0495602_0567654 Ga0495602_0567654_25_579 184
761 3300048089 Ga0495614_0000331 Ga0495614_0000331_16157_16711 184
762 3300048089 Ga0495614_0002125 Ga0495614_0002125_131_685 184
763 3300048089 Ga0495614_0174306 Ga0495614_0174306_177_731 184
764 3300048089 Ga0495614_0255350 Ga0495614_0255350_119_673 184
765 3300048089 Ga0495614_0501839 Ga0495614_0501839_10_564 184
766 3300048091 Ga0495626_0007219 Ga0495626_0007219_2337_2891 184
767 3300048904 Ga0496101_0224705 Ga0496101_0224705_411_1010 184
768 3300048905 Ga0496102_0219017 Ga0496102_0219017_641_1195 184
769 3300048907 Ga0496104_0131038 Ga0496104_0131038_803_1357 184
770 3300048908 Ga0496105_0412330 Ga0496105_0412330_284_838 184
771 3300048908 Ga0496105_0846831 Ga0496105_0846831_102_656 184
772 3300048910 Ga0496107_0072025 Ga0496107_0072025_678_1232 184
773 3300048910 Ga0496107_0853082 Ga0496107_0853082_36_590 184
774 3300048911 Ga0496108_0042183 Ga0496108_0042183_2549_3103 184
775 3300048911 Ga0496108_0061256 Ga0496108_0061256_2067_2621 184
776 3300048912 Ga0496109_0139325 Ga0496109_0139325_735_1289 184
777 3300048912 Ga0496109_0147279 Ga0496109_0147279_1498_2052 184
778 3300048912 Ga0496109_0293706 Ga0496109_0293706_634_1188 184
779 3300048913 Ga0496110_0014056 Ga0496110_0014056_3292_3846 184
780 3300048913 Ga0496110_0087314 Ga0496110_0087314_1179_1733 184
781 3300048913 Ga0496110_0242064 Ga0496110_0242064_908_1462 184
782 3300048914 Ga0496111_0091211 Ga0496111_0091211_1546_2100 184
783 3300048914 Ga0496111_0463243 Ga0496111_0463243_351_905 184
784 3300048915 Ga0496112_0009854 Ga0496112_0009854_3533_4087 184
785 3300048916 Ga0496113_0298415 Ga0496113_0298415_213_767 184
786 3300048917 Ga0496114_0008124 Ga0496114_0008124_104_658 184
787 3300048917 Ga0496114_0078991 Ga0496114_0078991_1117_1716 184
788 3300048917 Ga0496114_0158091 Ga0496114_0158091_48_602 184
789 3300048918 Ga0496115_0248285 Ga0496115_0248285_732_1331 184
790 3300048927 Ga0496124_0429297 Ga0496124_0429297_204_758 184
791 3300048929 Ga0496126_0046187 Ga0496126_0046187_2654_3349 184
792 3300049130 Ga0501310_000014 Ga0501310_000014_15109_15675 184
793 3300049459 Ga0495678_022611 Ga0495678_022611_350_904 184
794 3300049460 Ga0495682_0023182 Ga0495682_0023182_204_758 184
795 3300049568 Ga0501031_0003124 Ga0501031_0003124_7259_7813 184
796 3300049568 Ga0501031_0003254 Ga0501031_0003254_8373_8927 184
797 3300049568 Ga0501031_0122493 Ga0501031_0122493_718_1272 184
798 3300049568 Ga0501031_0125833 Ga0501031_0125833_584_1138 184
799 3300049568 Ga0501031_0197093 Ga0501031_0197093_442_996 184
800 3300049568 Ga0501031_0246077 Ga0501031_0246077_461_1015 184
801 3300049569 Ga0501032_0000686 Ga0501032_0000686_16491_17045 184
802 3300049569 Ga0501032_0001522 Ga0501032_0001522_14681_15235 184
803 3300049569 Ga0501032_0007044 Ga0501032_0007044_5282_5836 184
804 3300049569 Ga0501032_0051495 Ga0501032_0051495_1888_2442 184
805 3300049569 Ga0501032_0060063 Ga0501032_0060063_1171_1725 184
806 3300049569 Ga0501032_0069873 Ga0501032_0069873_610_1164 184
807 3300049569 Ga0501032_0191272 Ga0501032_0191272_381_935 184
808 3300049570 Ga0501033_0003959 Ga0501033_0003959_1410_1964 184
809 3300049570 Ga0501033_0009007 Ga0501033_0009007_5250_5804 184
810 3300049570 Ga0501033_0011728 Ga0501033_0011728_5110_5664 184
811 3300049570 Ga0501033_0017170 Ga0501033_0017170_4454_5008 184
812 3300049570 Ga0501033_0037585 Ga0501033_0037585_125_679 184
813 3300049570 Ga0501033_0054186 Ga0501033_0054186_795_1349 184
814 3300049570 Ga0501033_0078686 Ga0501033_0078686_555_1109 184
815 3300049570 Ga0501033_0099712 Ga0501033_0099712_1161_1715 184
816 3300049570 Ga0501033_0849378 Ga0501033_0849378_38_592 184
817 3300049571 Ga0501034_0000700 Ga0501034_0000700_10162_10716 184
818 3300049571 Ga0501034_0000987 Ga0501034_0000987_38373_38927 184
819 3300049571 Ga0501034_0033852 Ga0501034_0033852_2672_3226 184
820 3300049571 Ga0501034_0037777 Ga0501034_0037777_4222_4776 184
821 3300049571 Ga0501034_0110839 Ga0501034_0110839_1436_2011 184
822 3300049571 Ga0501034_0112723 Ga0501034_0112723_136_690 184
823 3300049571 Ga0501034_0234177 Ga0501034_0234177_276_830 184
824 3300049571 Ga0501034_0440620 Ga0501034_0440620_288_842 184
825 3300049572 Ga0501036_0001560 Ga0501036_0001560_1863_2417 184
826 3300049572 Ga0501036_0014281 Ga0501036_0014281_133_708 184
827 3300049572 Ga0501036_0030414 Ga0501036_0030414_1180_1734 184
828 3300049572 Ga0501036_0045495 Ga0501036_0045495_798_1352 184
829 3300049572 Ga0501036_0046338 Ga0501036_0046338_2729_3283 184
830 3300049572 Ga0501036_0091993 Ga0501036_0091993_1927_2481 184
831 3300049573 Ga0501037_0001087 Ga0501037_0001087_7144_7698 184
832 3300049573 Ga0501037_0025618 Ga0501037_0025618_628_1203 184
833 3300049573 Ga0501037_0061963 Ga0501037_0061963_1884_2438 184
834 3300049573 Ga0501037_0080775 Ga0501037_0080775_650_1204 184
835 3300049573 Ga0501037_0221921 Ga0501037_0221921_661_1215 184
836 3300049574 Ga0501038_0001100 Ga0501038_0001100_15859_16413 184
837 3300049574 Ga0501038_0001242 Ga0501038_0001242_15301_15855 184
838 3300049574 Ga0501038_0088005 Ga0501038_0088005_1297_1851 184
839 3300049574 Ga0501038_0174750 Ga0501038_0174750_715_1290 184
840 3300049575 Ga0501039_0004281 Ga0501039_0004281_7690_8244 184
841 3300049575 Ga0501039_0014667 Ga0501039_0014667_3417_3992 184
842 3300049575 Ga0501039_0017205 Ga0501039_0017205_4166_4744 184
843 3300049575 Ga0501039_0021995 Ga0501039_0021995_2675_3229 184
844 3300049575 Ga0501039_0219304 Ga0501039_0219304_179_733 184
845 3300049576 Ga0501040_0001045 Ga0501040_0001045_8641_9195 184
846 3300049577 Ga0501041_0012339 Ga0501041_0012339_4079_4633 184
847 3300049578 Ga0501042_0002602 Ga0501042_0002602_7820_8374 184
848 3300049578 Ga0501042_0093193 Ga0501042_0093193_696_1250 184
849 3300049578 Ga0501042_0216865 Ga0501042_0216865_613_1188 184
850 3300049578 Ga0501042_0333062 Ga0501042_0333062_80_634 184
851 3300049579 Ga0501043_0000867 Ga0501043_0000867_6940_7494 184
852 3300049579 Ga0501043_0029105 Ga0501043_0029105_1112_1666 184
853 3300049579 Ga0501043_0033018 Ga0501043_0033018_1749_2303 184
854 3300049579 Ga0501043_0035627 Ga0501043_0035627_933_1487 184
855 3300049579 Ga0501043_0044064 Ga0501043_0044064_372_947 184
856 3300049579 Ga0501043_0060168 Ga0501043_0060168_149_703 184
857 3300049579 Ga0501043_0193409 Ga0501043_0193409_566_1120 184
858 3300049579 Ga0501043_0592663 Ga0501043_0592663_135_689 184
859 3300049580 Ga0501046_0000707 Ga0501046_0000707_7007_7582 184
860 3300049580 Ga0501046_0004881 Ga0501046_0004881_6568_7122 184
861 3300049580 Ga0501046_0006561 Ga0501046_0006561_6940_7494 184
862 3300049580 Ga0501046_0038654 Ga0501046_0038654_282_836 184
863 3300049580 Ga0501046_0145295 Ga0501046_0145295_474_1049 184
864 3300049580 Ga0501046_0212742 Ga0501046_0212742_717_1271 184
865 3300049581 Ga0501047_0000112 Ga0501047_0000112_22054_22608 184
866 3300049581 Ga0501047_0000544 Ga0501047_0000544_31325_31879 184
867 3300049581 Ga0501047_0023263 Ga0501047_0023263_1462_2016 184
868 3300049581 Ga0501047_0031600 Ga0501047_0031600_2010_2564 184
869 3300049581 Ga0501047_0052789 Ga0501047_0052789_3190_3744 184
870 3300049581 Ga0501047_0065503 Ga0501047_0065503_738_1292 184
871 3300049581 Ga0501047_0204643 Ga0501047_0204643_382_936 184
872 3300049581 Ga0501047_0385953 Ga0501047_0385953_71_625 184
873 3300049581 Ga0501047_0621977 Ga0501047_0621977_159_734 184
874 3300049582 Ga0501048_0002418 Ga0501048_0002418_1333_1887 184
875 3300049582 Ga0501048_0010533 Ga0501048_0010533_578_1132 184
876 3300049582 Ga0501048_0144532 Ga0501048_0144532_54_608 184
877 3300049582 Ga0501048_0227416 Ga0501048_0227416_623_1177 184
878 3300049583 Ga0501067_0001531 Ga0501067_0001531_9992_10546 184
879 3300049583 Ga0501067_0228774 Ga0501067_0228774_264_839 184
880 3300049583 Ga0501067_0313677 Ga0501067_0313677_235_789 184
881 3300049584 Ga0501068_0000652 Ga0501068_0000652_2689_3243 184
882 3300049584 Ga0501068_0136793 Ga0501068_0136793_551_1105 184
883 3300049585 Ga0501069_0001987 Ga0501069_0001987_2415_2969 184
884 3300049585 Ga0501069_0475695 Ga0501069_0475695_155_709 184
885 3300049586 Ga0501070_0005364 Ga0501070_0005364_455_1009 184
886 3300049586 Ga0501070_0007413 Ga0501070_0007413_7572_8126 184
887 3300049586 Ga0501070_0008447 Ga0501070_0008447_5327_5902 184
888 3300049586 Ga0501070_0028520 Ga0501070_0028520_255_809 184
889 3300049586 Ga0501070_0054517 Ga0501070_0054517_910_1464 184
890 3300049586 Ga0501070_0238670 Ga0501070_0238670_754_1308 184
891 3300049586 Ga0501070_0297577 Ga0501070_0297577_549_1103 184
892 3300049587 Ga0501071_0003645 Ga0501071_0003645_2690_3244 184
893 3300049588 Ga0501072_0008562 Ga0501072_0008562_2621_3175 184
894 3300049588 Ga0501072_0425724 Ga0501072_0425724_217_771 184
895 3300049589 Ga0501073_0014251 Ga0501073_0014251_1333_1887 184
896 3300049589 Ga0501073_0022877 Ga0501073_0022877_480_1055 184
897 3300049589 Ga0501073_0066008 Ga0501073_0066008_1124_1678 184
898 3300049589 Ga0501073_0259648 Ga0501073_0259648_76_630 184
899 3300049589 Ga0501073_0307588 Ga0501073_0307588_86_640 184
900 3300049590 Ga0501074_0002273 Ga0501074_0002273_8353_8907 184
901 3300049590 Ga0501074_0039993 Ga0501074_0039993_1467_2021 184
902 3300049590 Ga0501074_0132439 Ga0501074_0132439_1160_1714 184
903 3300049592 Ga0501076_0036062 Ga0501076_0036062_2553_3107 184
904 3300049593 Ga0501077_0017485 Ga0501077_0017485_1670_2224 184
905 3300049681 Ga0501251_047748 Ga0501251_047748_66_620 184
906 3300049741 Ga0501079_0002562 Ga0501079_0002562_7258_7812 184
907 3300049741 Ga0501079_0094040 Ga0501079_0094040_994_1548 184
908 3300049741 Ga0501079_0100791 Ga0501079_0100791_249_803 184
909 3300049742 Ga0501080_0023738 Ga0501080_0023738_1180_1734 184
910 3300049742 Ga0501080_0081705 Ga0501080_0081705_1961_2515 184
911 3300049744 Ga0501083_0010392 Ga0501083_0010392_2114_2668 184
912 3300049744 Ga0501083_0019557 Ga0501083_0019557_2176_2730 184
913 3300049778 Ga0501282_002622 Ga0501282_002622_712_1266 184
914 3300049822 Ga0501035_0000870 Ga0501035_0000870_18111_18665 184
915 3300049822 Ga0501035_0004451 Ga0501035_0004451_11173_11727 184
916 3300049822 Ga0501035_0015420 Ga0501035_0015420_4320_4874 184
917 3300049822 Ga0501035_0047700 Ga0501035_0047700_2712_3266 184
918 3300049822 Ga0501035_0059386 Ga0501035_0059386_816_1391 184
919 3300049822 Ga0501035_0067815 Ga0501035_0067815_533_1087 184
920 3300049822 Ga0501035_0132440 Ga0501035_0132440_1368_1922 184
921 3300049822 Ga0501035_0147643 Ga0501035_0147643_1024_1578 184
922 3300049822 Ga0501035_0316416 Ga0501035_0316416_726_1280 184
923 3300049823 Ga0501044_0002317 Ga0501044_0002317_19263_19817 184
924 3300049823 Ga0501044_0010614 Ga0501044_0010614_4470_5024 184
925 3300049823 Ga0501044_0011995 Ga0501044_0011995_4456_5010 184
926 3300049823 Ga0501044_0020341 Ga0501044_0020341_1038_1592 184
927 3300049823 Ga0501044_0228012 Ga0501044_0228012_1177_1731 184
928 3300049823 Ga0501044_0274536 Ga0501044_0274536_220_774 184
929 3300049823 Ga0501044_0324586 Ga0501044_0324586_77_631 184
930 3300049823 Ga0501044_0338707 Ga0501044_0338707_763_1317 184
931 3300049823 Ga0501044_0495460 Ga0501044_0495460_442_996 184
932 3300049824 Ga0501045_0014319 Ga0501045_0014319_1180_1734 184
933 3300049824 Ga0501045_0077506 Ga0501045_0077506_616_1170 184
934 3300049824 Ga0501045_0105868 Ga0501045_0105868_876_1430 184
935 3300049824 Ga0501045_0171368 Ga0501045_0171368_355_909 184
936 3300050490 nmdc:mga03n38_269825_c1 nmdc:mga03n38_269825_c1_25_579 184
937 3300050490 nmdc:mga03n38_50584_c1 nmdc:mga03n38_50584_c1_796_1350 184
938 3300050491 nmdc:mga00v17_171753_c1 nmdc:mga00v17_171753_c1_421_975 184
939 3300050494 nmdc:mga06z11_222551_c1 nmdc:mga06z11_222551_c1_495_1049 184
940 3300050494 nmdc:mga06z11_242299_c1 nmdc:mga06z11_242299_c1_489_1043 184
941 3300050494 nmdc:mga06z11_9099_c1 nmdc:mga06z11_9099_c1_974_1528 184
942 3300050495 nmdc:mga04h51_7954_c1 nmdc:mga04h51_7954_c1_1697_2251 184
943 3300050496 nmdc:mga07m45_61521_c1 nmdc:mga07m45_61521_c1_489_1043 184
944 3300050496 nmdc:mga07m45_84894_c1 nmdc:mga07m45_84894_c1_544_1098 184
945 3300050508 nmdc:mga09592_220966_c1 nmdc:mga09592_220966_c1_512_1066 184
946 3300053077 Ga0495601_0019263 Ga0495601_0019263_2820_3389 184
947 3300053077 Ga0495601_0024467 Ga0495601_0024467_2188_2742 184
948 3300053078 Ga0495612_0000768 Ga0495612_0000768_7089_7643 184
949 3300053078 Ga0495612_0005175 Ga0495612_0005175_1577_2170 184
950 3300053083 Ga0495655_0018188 Ga0495655_0018188_796_1350 184
951 3300053085 Ga0495619_0113133 Ga0495619_0113133_1282_1836 184
952 3300053085 Ga0495619_0416383 Ga0495619_0416383_69_719 184
953 3300053086 Ga0500578_0008090 Ga0500578_0008090_3660_4214 184
954 3300053086 Ga0500578_0115495 Ga0500578_0115495_76_630 184
955 3300053088 Ga0500644_0380410 Ga0500644_0380410_21_575 184
956 3300053092 Ga0500583_0023379 Ga0500583_0023379_1672_2226 184
957 3300053093 Ga0500651_0288322 Ga0500651_0288322_202_756 184
958 3300053094 Ga0500566_0086219 Ga0500566_0086219_98_664 184
959 3300053094 Ga0500566_0145746 Ga0500566_0145746_536_1090 184
960 3300053095 Ga0500640_000199 Ga0500640_000199_10741_11295 184
961 3300053096 Ga0500641_0343873 Ga0500641_0343873_15_569 184
962 3300053098 Ga0500650_0176274 Ga0500650_0176274_98_652 184
963 3300053099 Ga0500654_049480 Ga0500654_049480_1132_1686 184
964 3300053100 Ga0500660_029746 Ga0500660_029746_279_833 184
965 3300053101 Ga0500553_091291 Ga0500553_091291_139_693 184
966 3300053107 Ga0500560_002560 Ga0500560_002560_1761_2315 184
967 3300053107 Ga0500560_034312 Ga0500560_034312_506_1060 184
968 3300053109 Ga0500569_000546 Ga0500569_000546_428_982 184
969 3300053115 Ga0500591_141766 Ga0500591_141766_103_669 184
970 3300053118 Ga0500594_0017387 Ga0500594_0017387_1142_1696 184
971 3300053129 Ga0500628_002653 Ga0500628_002653_669_1223 184
972 3300053129 Ga0500628_056958 Ga0500628_056958_282_836 184
973 3300053131 Ga0500652_000612 Ga0500652_000612_5317_5871 184
974 3300053134 Ga0500658_0003635 Ga0500658_0003635_4047_4601 184
975 3300053137 Ga0500561_0000617 Ga0500561_0000617_1567_2121 184
976 3300053140 Ga0500573_0033390 Ga0500573_0033390_1490_2044 184
977 3300053140 Ga0500573_0096693 Ga0500573_0096693_234_803 184
978 3300053140 Ga0500573_0203833 Ga0500573_0203833_462_1016 184
979 3300053143 Ga0500579_028293 Ga0500579_028293_441_995 184
980 3300053146 Ga0500588_0010244 Ga0500588_0010244_1100_1654 184
981 3300053149 Ga0500600_0003949 Ga0500600_0003949_7408_7962 184
982 3300053149 Ga0500600_0126663 Ga0500600_0126663_253_807 184
983 3300053155 Ga0500620_020076 Ga0500620_020076_292_858 184
984 3300053157 Ga0500624_041737 Ga0500624_041737_237_791 184
985 3300053160 Ga0500633_0000470 Ga0500633_0000470_590_1144 184
986 3300053161 Ga0500634_0010585 Ga0500634_0010585_3838_4392 184
987 3300053732 Ga0500656_000324 Ga0500656_000324_2558_3112 184
988 3300053739 Ga0500587_002977 Ga0500587_002977_169_723 184
989 3300054114 Ga0501084_0001814 Ga0501084_0001814_1180_1734 184
990 3300059504 Ga0587082_094927 Ga0587082_094927_27_581 184
991 3300059505 Ga0587083_0034247 Ga0587083_0034247_33_587 184
992 3300059652 Ga0587107_056688 Ga0587107_056688_59_613 184
993 3300060344 Ga0587071_102484 Ga0587071_102484_32_586 184
994 3300060353 Ga0501082_0009754 Ga0501082_0009754_3250_3804 184
995 3300060353 Ga0501082_0009930 Ga0501082_0009930_5729_6283 184
996 3300061719 Ga0466962_0001065 Ga0466962_0001065_1237_1791 184
997 3300061719 Ga0466962_0059802 Ga0466962_0059802_592_1146 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

81

191

0.92

Feature Viewer

pLDDT pTM Quality
56.87 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map