F487797
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 997 | 443 | 997 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10937966|Ga0157372_109379662 |
| Length | 229 |
| Sequence | MEIKAPTPQIPPAVWTEFKDLQEWEKLHQERPEGDKHSALFESLTEGIQHFPGGFALTTVADAFFNWARKSSVWPVTFGLACCAIEMMATGAGRYDLARFGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMVEPKWVLSMGVCASSGGMFNNYAIVQGVDHVVPVDIYLPGCPPRPEMLINALLALHEEIQAMPLGVNRRRAAEAAERAAMEAVPTSKMKGLLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005870 | Rhizosphere microbial communities from Harvard Forest, USA - 4Rhizosphere_NRpos metaG | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 85 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027200 | Rhizosphere microbial communities from Harvard Forest, USA - 4Rhizosphere_NRpos metaG (SPAdes) | Metagenome | Rhizosphere |
| 130 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 141 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 142 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 144 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 147 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 148 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 149 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 150 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 166 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 167 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 169 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 170 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 186 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 193 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 194 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 205 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 206 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 207 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 212 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 213 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 217 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 218 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 219 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 220 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 221 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 222 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 223 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 224 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 225 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 226 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 227 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 228 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 229 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 230 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 231 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 232 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 233 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 243 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 353 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 390 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 391 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 404 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 406 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 407 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 409 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 411 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 413 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 414 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 415 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 416 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 417 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 418 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 420 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 421 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 424 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 425 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 426 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 428 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 429 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 430 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 431 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 432 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 433 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 434 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.99 |
| Metatranscriptomes | 2.01 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.32 |
| Nodule | 0.1 |
| Rhizoplane | 3.61 |
| Rhizosphere | 82.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10017517 | 3300001989 | Bacteria | 2584 |
| 2 | JGI24737J22298_10005199 | 3300001990 | Bacteria | 4505 |
| 3 | JGI24735J21928_10027305 | 3300002067 | Bacteria | 1711 |
| 4 | JGI25406J46586_10095938 | 3300003203 | Bacteria | 889 |
| 5 | JGI25160J50197_1007524 | 3300003354 | Bacteria | 4251 |
| 6 | JGI25160J50197_1027486 | 3300003354 | Bacteria | 1547 |
| 7 | Ga0006562J51391_1028667 | 3300003578 | Bacteria | 1109 |
| 8 | Ga0070658_10092336 | 3300005327 | Bacteria | 2496 |
| 9 | Ga0070683_100156880 | 3300005329 | Bacteria | 2159 |
| 10 | Ga0070683_101336697 | 3300005329 | Bacteria | 689 |
| 11 | Ga0068869_100160319 | 3300005334 | Bacteria | 1751 |
| 12 | Ga0068868_100317088 | 3300005338 | Bacteria | 1327 |
| 13 | Ga0070691_10223067 | 3300005341 | Bacteria | 1000 |
| 14 | Ga0070675_100252848 | 3300005354 | Bacteria | 1543 |
| 15 | Ga0070671_100593449 | 3300005355 | Bacteria | 957 |
| 16 | Ga0070714_100005638 | 3300005435 | Bacteria | 9577 |
| 17 | Ga0070714_100259945 | 3300005435 | Bacteria | 1607 |
| 18 | Ga0070713_100082501 | 3300005436 | Bacteria | 2745 |
| 19 | Ga0070710_10064545 | 3300005437 | Bacteria | 2095 |
| 20 | Ga0070711_100285287 | 3300005439 | Bacteria | 1308 |
| 21 | Ga0070708_100079381 | 3300005445 | Bacteria | 2969 |
| 22 | Ga0070708_100238153 | 3300005445 | Bacteria | 1709 |
| 23 | Ga0070708_100371712 | 3300005445 | Bacteria | 1348 |
| 24 | Ga0070708_100389335 | 3300005445 | Bacteria | 1314 |
| 25 | Ga0070681_10257637 | 3300005458 | Bacteria | 1656 |
| 26 | Ga0070685_10070335 | 3300005466 | Bacteria | 2072 |
| 27 | Ga0070685_10476889 | 3300005466 | Bacteria | 879 |
| 28 | Ga0070706_100021841 | 3300005467 | Bacteria | 5894 |
| 29 | Ga0070706_100022401 | 3300005467 | Bacteria | 5816 |
| 30 | Ga0070706_100028028 | 3300005467 | Bacteria | 5182 |
| 31 | Ga0070707_100060119 | 3300005468 | Bacteria | 3644 |
| 32 | Ga0070707_100085925 | 3300005468 | Bacteria | 3041 |
| 33 | Ga0070707_100092350 | 3300005468 | Bacteria | 2931 |
| 34 | Ga0070707_100096257 | 3300005468 | Bacteria | 2867 |
| 35 | Ga0070698_100000073 | 3300005471 | Bacteria | 75512 |
| 36 | Ga0070698_100007866 | 3300005471 | Bacteria | 11541 |
| 37 | Ga0070698_100240442 | 3300005471 | Bacteria | 1744 |
| 38 | Ga0070698_100268482 | 3300005471 | Bacteria | 1638 |
| 39 | Ga0070698_100288985 | 3300005471 | Bacteria | 1571 |
| 40 | Ga0070679_100078515 | 3300005530 | Bacteria | 3290 |
| 41 | Ga0070679_100234828 | 3300005530 | Bacteria | 1793 |
| 42 | Ga0070684_100129401 | 3300005535 | Bacteria | 2276 |
| 43 | Ga0070684_100318038 | 3300005535 | Bacteria | 1430 |
| 44 | Ga0070697_100068869 | 3300005536 | Bacteria | 2898 |
| 45 | Ga0068853_100049777 | 3300005539 | Bacteria | 3602 |
| 46 | Ga0070693_100098803 | 3300005547 | Bacteria | 1774 |
| 47 | Ga0070665_100040161 | 3300005548 | Bacteria | 4704 |
| 48 | Ga0070665_100127648 | 3300005548 | Bacteria | 2546 |
| 49 | Ga0068855_100063115 | 3300005563 | Bacteria | 4324 |
| 50 | Ga0068857_100081703 | 3300005577 | Bacteria | 2886 |
| 51 | Ga0068854_100050967 | 3300005578 | Bacteria | 2964 |
| 52 | Ga0068854_100694586 | 3300005578 | Bacteria | 878 |
| 53 | Ga0068856_100022041 | 3300005614 | Bacteria | 6195 |
| 54 | Ga0068856_100065456 | 3300005614 | Bacteria | 3592 |
| 55 | Ga0068852_100029725 | 3300005616 | Bacteria | 4491 |
| 56 | Ga0068852_100471772 | 3300005616 | Bacteria | 1246 |
| 57 | Ga0068864_100117330 | 3300005618 | Bacteria | 2376 |
| 58 | Ga0068864_100684381 | 3300005618 | Bacteria | 1001 |
| 59 | Ga0068863_100107785 | 3300005841 | Bacteria | 2651 |
| 60 | Ga0068860_100109475 | 3300005843 | Bacteria | 2640 |
| 61 | Ga0068862_100245460 | 3300005844 | Bacteria | 1630 |
| 62 | Ga0058723_100038 | 3300005870 | Bacteria | 764 |
| 63 | Ga0081455_10009867 | 3300005937 | Bacteria | 9770 |
| 64 | Ga0081455_10044055 | 3300005937 | Bacteria | 3897 |
| 65 | Ga0081540_1003156 | 3300005983 | Bacteria | 13157 |
| 66 | Ga0081540_1057177 | 3300005983 | Bacteria | 1888 |
| 67 | Ga0081539_10003492 | 3300005985 | Bacteria | 19204 |
| 68 | Ga0081539_10004406 | 3300005985 | Bacteria | 15592 |
| 69 | Ga0081539_10010250 | 3300005985 | Bacteria | 7655 |
| 70 | Ga0081539_10023002 | 3300005985 | Bacteria | 4097 |
| 71 | Ga0081539_10067109 | 3300005985 | Bacteria | 1941 |
| 72 | Ga0070717_10006986 | 3300006028 | Bacteria | 8350 |
| 73 | Ga0075365_10174846 | 3300006038 | Bacteria | 1499 |
| 74 | Ga0075368_10005635 | 3300006042 | Bacteria | 4321 |
| 75 | Ga0075368_10147976 | 3300006042 | Bacteria | 980 |
| 76 | Ga0075363_100041969 | 3300006048 | Bacteria | 2415 |
| 77 | Ga0070716_100065567 | 3300006173 | Bacteria | 2115 |
| 78 | Ga0075367_10027504 | 3300006178 | Bacteria | 3236 |
| 79 | Ga0075367_10087241 | 3300006178 | Bacteria | 1895 |
| 80 | Ga0097621_100143458 | 3300006237 | Bacteria | 2042 |
| 81 | Ga0075370_10011734 | 3300006353 | Bacteria | 4613 |
| 82 | Ga0075370_10148971 | 3300006353 | Bacteria | 1371 |
| 83 | Ga0075370_10320096 | 3300006353 | Bacteria | 924 |
| 84 | Ga0075430_100189014 | 3300006846 | Bacteria | 1712 |
| 85 | Ga0075434_100229942 | 3300006871 | Bacteria | 1874 |
| 86 | Ga0075436_100009981 | 3300006914 | Bacteria | 6496 |
| 87 | Ga0075436_100549664 | 3300006914 | Bacteria | 847 |
| 88 | Ga0099826_10142629 | 3300006948 | Bacteria | 1381 |
| 89 | Ga0075435_100351775 | 3300007076 | Bacteria | 1263 |
| 90 | Ga0105251_10012881 | 3300009011 | Bacteria | 4706 |
| 91 | Ga0105244_10171727 | 3300009036 | Bacteria | 1031 |
| 92 | Ga0105250_10024088 | 3300009092 | Bacteria | 2453 |
| 93 | Ga0105240_10015715 | 3300009093 | Bacteria | 10272 |
| 94 | Ga0105240_10645361 | 3300009093 | Bacteria | 1161 |
| 95 | Ga0105245_10261800 | 3300009098 | Bacteria | 1683 |
| 96 | Ga0114129_10091266 | 3300009147 | Bacteria | 4221 |
| 97 | Ga0105243_10000636 | 3300009148 | Bacteria | 34702 |
| 98 | Ga0105243_10020026 | 3300009148 | Bacteria | 5073 |
| 99 | Ga0105241_10077421 | 3300009174 | Bacteria | 2596 |
| 100 | Ga0105248_10075304 | 3300009177 | Bacteria | 3793 |
| 101 | Ga0105248_10212959 | 3300009177 | Bacteria | 2177 |
| 102 | Ga0105237_10004407 | 3300009545 | Bacteria | 16312 |
| 103 | Ga0105237_10227257 | 3300009545 | Bacteria | 1867 |
| 104 | Ga0105238_10000200 | 3300009551 | Bacteria | 66219 |
| 105 | Ga0105238_10368954 | 3300009551 | Bacteria | 1426 |
| 106 | Ga0105249_10262215 | 3300009553 | Bacteria | 1718 |
| 107 | Ga0105239_10032749 | 3300010375 | Bacteria | 5711 |
| 108 | Ga0105239_10048362 | 3300010375 | Bacteria | 4664 |
| 109 | Ga0105239_10227329 | 3300010375 | Bacteria | 2093 |
| 110 | Ga0105239_11010342 | 3300010375 | Bacteria | 956 |
| 111 | Ga0105246_10861047 | 3300011119 | Bacteria | 809 |
| 112 | Ga0157343_1005239 | 3300012488 | Bacteria | 834 |
| 113 | Ga0157373_10885815 | 3300013100 | Bacteria | 662 |
| 114 | Ga0157369_10059844 | 3300013105 | Bacteria | 4108 |
| 115 | Ga0157369_10364564 | 3300013105 | Bacteria | 1500 |
| 116 | Ga0157374_10097920 | 3300013296 | Bacteria | 2807 |
| 117 | Ga0157374_10175319 | 3300013296 | Bacteria | 2093 |
| 118 | Ga0163162_10194077 | 3300013306 | Bacteria | 2159 |
| 119 | Ga0163162_10891135 | 3300013306 | Bacteria | 1003 |
| 120 | Ga0157372_10535298 | 3300013307 | Bacteria | 1365 |
| 121 | Ga0157372_10937966 | 3300013307 | Bacteria | 1003 |
| 122 | Ga0157375_10136007 | 3300013308 | Bacteria | 2581 |
| 123 | Ga0157375_10161489 | 3300013308 | Bacteria | 2383 |
| 124 | Ga0157375_10183074 | 3300013308 | Bacteria | 2247 |
| 125 | Ga0163163_10013354 | 3300014325 | Bacteria | 7517 |
| 126 | Ga0163163_10525102 | 3300014325 | Bacteria | 1246 |
| 127 | Ga0157380_10145681 | 3300014326 | Bacteria | 2041 |
| 128 | Ga0182008_10011765 | 3300014497 | Bacteria | 4643 |
| 129 | Ga0157379_10187206 | 3300014968 | Bacteria | 1871 |
| 130 | Ga0157379_10471539 | 3300014968 | Bacteria | 1161 |
| 131 | Ga0157376_10003944 | 3300014969 | Bacteria | 10264 |
| 132 | Ga0157376_10150356 | 3300014969 | Bacteria | 2099 |
| 133 | Ga0182007_10001899 | 3300015262 | Bacteria | 10894 |
| 134 | Ga0182005_1007289 | 3300015265 | Bacteria | 3323 |
| 135 | Ga0206355_1363819 | 3300020076 | Bacteria | 857 |
| 136 | Ga0206350_11072649 | 3300020080 | Bacteria | 1458 |
| 137 | Ga0154015_1559063 | 3300020610 | Bacteria | 862 |
| 138 | Ga0224712_10000465 | 3300022467 | Bacteria | 8140 |
| 139 | Ga0224712_10003509 | 3300022467 | Bacteria | 4088 |
| 140 | Ga0224712_10157609 | 3300022467 | Bacteria | 1010 |
| 141 | Ga0209758_1005072 | 3300025297 | Bacteria | 10434 |
| 142 | Ga0207426_1004723 | 3300025302 | Bacteria | 6516 |
| 143 | Ga0207426_1005819 | 3300025302 | Bacteria | 5516 |
| 144 | Ga0207426_1014205 | 3300025302 | Bacteria | 2922 |
| 145 | Ga0207656_10071654 | 3300025321 | Bacteria | 1541 |
| 146 | Ga0207696_1021304 | 3300025711 | Bacteria | 2078 |
| 147 | Ga0207655_1086590 | 3300025728 | Bacteria | 1114 |
| 148 | Ga0207713_1060066 | 3300025735 | Bacteria | 1455 |
| 149 | Ga0207692_10002379 | 3300025898 | Bacteria | 7222 |
| 150 | Ga0207692_10195304 | 3300025898 | Bacteria | 1187 |
| 151 | Ga0207642_10080716 | 3300025899 | Bacteria | 1578 |
| 152 | Ga0207680_10131885 | 3300025903 | Bacteria | 1648 |
| 153 | Ga0207680_10543619 | 3300025903 | Bacteria | 829 |
| 154 | Ga0207647_10000384 | 3300025904 | Bacteria | 35996 |
| 155 | Ga0207647_10009432 | 3300025904 | Bacteria | 6934 |
| 156 | Ga0207647_10128796 | 3300025904 | Bacteria | 1488 |
| 157 | Ga0207685_10048624 | 3300025905 | Bacteria | 1626 |
| 158 | Ga0207699_10002064 | 3300025906 | Bacteria | 9489 |
| 159 | Ga0207699_10014455 | 3300025906 | Bacteria | 4070 |
| 160 | Ga0207705_10219756 | 3300025909 | Bacteria | 1443 |
| 161 | Ga0207684_10040407 | 3300025910 | Bacteria | 3954 |
| 162 | Ga0207684_10052520 | 3300025910 | Bacteria | 3458 |
| 163 | Ga0207684_10074704 | 3300025910 | Bacteria | 2880 |
| 164 | Ga0207684_10172630 | 3300025910 | Bacteria | 1863 |
| 165 | Ga0207684_10540319 | 3300025910 | Bacteria | 997 |
| 166 | Ga0207707_10158691 | 3300025912 | Bacteria | 1978 |
| 167 | Ga0207695_10000449 | 3300025913 | Bacteria | 89856 |
| 168 | Ga0207671_10000052 | 3300025914 | Bacteria | 188462 |
| 169 | Ga0207671_10495799 | 3300025914 | Bacteria | 974 |
| 170 | Ga0207663_10001812 | 3300025916 | Bacteria | 10093 |
| 171 | Ga0207663_10144374 | 3300025916 | Bacteria | 1662 |
| 172 | Ga0207646_10015555 | 3300025922 | Bacteria | 7181 |
| 173 | Ga0207646_10028005 | 3300025922 | Bacteria | 5134 |
| 174 | Ga0207646_10087778 | 3300025922 | Bacteria | 2783 |
| 175 | Ga0207646_10110238 | 3300025922 | Bacteria | 2470 |
| 176 | Ga0207646_10288670 | 3300025922 | Bacteria | 1482 |
| 177 | Ga0207694_10000079 | 3300025924 | Bacteria | 111767 |
| 178 | Ga0207650_11180467 | 3300025925 | Bacteria | 652 |
| 179 | Ga0207659_10833060 | 3300025926 | Bacteria | 793 |
| 180 | Ga0207687_10100335 | 3300025927 | Bacteria | 2129 |
| 181 | Ga0207687_10122885 | 3300025927 | Bacteria | 1944 |
| 182 | Ga0207687_10888245 | 3300025927 | Bacteria | 762 |
| 183 | Ga0207700_10008575 | 3300025928 | Bacteria | 6342 |
| 184 | Ga0207700_10014777 | 3300025928 | Bacteria | 5126 |
| 185 | Ga0207700_10260657 | 3300025928 | Bacteria | 1484 |
| 186 | Ga0207664_10000341 | 3300025929 | Bacteria | 34367 |
| 187 | Ga0207664_10031264 | 3300025929 | Bacteria | 4071 |
| 188 | Ga0207664_10296281 | 3300025929 | Bacteria | 1422 |
| 189 | Ga0207686_10980883 | 3300025934 | Bacteria | 685 |
| 190 | Ga0207709_10005302 | 3300025935 | Bacteria | 7335 |
| 191 | Ga0207709_10069295 | 3300025935 | Bacteria | 2232 |
| 192 | Ga0207665_10002727 | 3300025939 | Bacteria | 11848 |
| 193 | Ga0207665_10019025 | 3300025939 | Bacteria | 4511 |
| 194 | Ga0207665_10090596 | 3300025939 | Bacteria | 2119 |
| 195 | Ga0207665_10292424 | 3300025939 | Bacteria | 1215 |
| 196 | Ga0207691_10136399 | 3300025940 | Bacteria | 2164 |
| 197 | Ga0207711_10097161 | 3300025941 | Bacteria | 2600 |
| 198 | Ga0207711_10139384 | 3300025941 | Bacteria | 2181 |
| 199 | Ga0207711_10167793 | 3300025941 | Bacteria | 1990 |
| 200 | Ga0207689_10038451 | 3300025942 | Bacteria | 3963 |
| 201 | Ga0207661_10381463 | 3300025944 | Bacteria | 1276 |
| 202 | Ga0207661_11393665 | 3300025944 | Bacteria | 643 |
| 203 | Ga0207679_10118739 | 3300025945 | Bacteria | 2101 |
| 204 | Ga0207679_10707649 | 3300025945 | Bacteria | 914 |
| 205 | Ga0207667_10008068 | 3300025949 | Bacteria | 12548 |
| 206 | Ga0207667_10354176 | 3300025949 | Bacteria | 1497 |
| 207 | Ga0207667_10533626 | 3300025949 | Bacteria | 1188 |
| 208 | Ga0207668_10003383 | 3300025972 | Bacteria | 9352 |
| 209 | Ga0207668_11173018 | 3300025972 | Bacteria | 690 |
| 210 | Ga0207640_10042792 | 3300025981 | Bacteria | 2890 |
| 211 | Ga0207640_10162953 | 3300025981 | Bacteria | 1652 |
| 212 | Ga0207677_10035072 | 3300026023 | Bacteria | 3254 |
| 213 | Ga0207703_10014834 | 3300026035 | Bacteria | 6081 |
| 214 | Ga0207639_10173213 | 3300026041 | Bacteria | 1830 |
| 215 | Ga0207639_10228406 | 3300026041 | Bacteria | 1612 |
| 216 | Ga0207702_10151815 | 3300026078 | Bacteria | 2108 |
| 217 | Ga0207702_10185703 | 3300026078 | Bacteria | 1917 |
| 218 | Ga0207702_10256002 | 3300026078 | Bacteria | 1646 |
| 219 | Ga0207698_10023885 | 3300026142 | Bacteria | 4280 |
| 220 | Ga0208976_10089 | 3300027200 | Bacteria | 764 |
| 221 | Ga0209371_1031617 | 3300027312 | Bacteria | 1146 |
| 222 | Ga0209813_10005060 | 3300027866 | Bacteria | 3187 |
| 223 | Ga0268266_10015277 | 3300028379 | Bacteria | 6591 |
| 224 | Ga0268265_10057465 | 3300028380 | Bacteria | 2965 |
| 225 | Ga0265334_10000874 | 3300028573 | Bacteria | 15103 |
| 226 | Ga0265336_10002275 | 3300028666 | Bacteria | 8033 |
| 227 | Ga0307517_10002400 | 3300028786 | Bacteria | 30069 |
| 228 | Ga0307517_10006298 | 3300028786 | Bacteria | 17623 |
| 229 | Ga0307517_10086569 | 3300028786 | Bacteria | 2613 |
| 230 | Ga0307517_10213521 | 3300028786 | Bacteria | 1184 |
| 231 | Ga0307515_10000038 | 3300028794 | Bacteria | 331376 |
| 232 | Ga0307515_10001177 | 3300028794 | Bacteria | 59836 |
| 233 | Ga0307515_10033888 | 3300028794 | Bacteria | 8389 |
| 234 | Ga0307515_10086084 | 3300028794 | Bacteria | 4011 |
| 235 | Ga0307515_10104037 | 3300028794 | Bacteria | 3397 |
| 236 | Ga0307515_10210976 | 3300028794 | Bacteria | 1786 |
| 237 | Ga0265338_10001380 | 3300028800 | Bacteria | 39522 |
| 238 | Ga0268256_1013505 | 3300030500 | Bacteria | 2468 |
| 239 | Ga0307511_10002042 | 3300030521 | Bacteria | 21169 |
| 240 | Ga0307511_10109100 | 3300030521 | Bacteria | 1772 |
| 241 | Ga0307512_10005436 | 3300030522 | Bacteria | 13305 |
| 242 | Ga0307512_10006290 | 3300030522 | Bacteria | 12063 |
| 243 | Ga0307512_10027696 | 3300030522 | Bacteria | 4980 |
| 244 | Ga0265327_10000021 | 3300031251 | Bacteria | 417788 |
| 245 | Ga0307513_10007971 | 3300031456 | Bacteria | 13620 |
| 246 | Ga0307513_10023232 | 3300031456 | Bacteria | 7249 |
| 247 | Ga0307513_10045604 | 3300031456 | Bacteria | 4789 |
| 248 | Ga0307513_10228372 | 3300031456 | Bacteria | 1675 |
| 249 | Ga0307509_10015278 | 3300031507 | Bacteria | 8971 |
| 250 | Ga0307509_10069495 | 3300031507 | Bacteria | 3681 |
| 251 | Ga0307509_10163227 | 3300031507 | Bacteria | 2121 |
| 252 | Ga0307509_10316032 | 3300031507 | Bacteria | 1301 |
| 253 | Ga0307408_100017582 | 3300031548 | Bacteria | 4787 |
| 254 | Ga0307508_10000506 | 3300031616 | Bacteria | 46624 |
| 255 | Ga0307508_10001775 | 3300031616 | Bacteria | 23968 |
| 256 | Ga0307508_10014629 | 3300031616 | Bacteria | 7158 |
| 257 | Ga0307508_10030734 | 3300031616 | Bacteria | 4854 |
| 258 | Ga0307508_10064626 | 3300031616 | Bacteria | 3226 |
| 259 | Ga0307508_10201044 | 3300031616 | Bacteria | 1593 |
| 260 | Ga0307508_10303466 | 3300031616 | Bacteria | 1189 |
| 261 | Ga0307514_10006847 | 3300031649 | Bacteria | 9870 |
| 262 | Ga0307514_10037111 | 3300031649 | Bacteria | 3868 |
| 263 | Ga0307514_10181625 | 3300031649 | Bacteria | 1355 |
| 264 | Ga0316579_10002060 | 3300031691 | Bacteria | 7532 |
| 265 | Ga0316576_10002103 | 3300031727 | Bacteria | 11207 |
| 266 | Ga0316576_10004023 | 3300031727 | Bacteria | 8750 |
| 267 | Ga0316576_10017633 | 3300031727 | Bacteria | 4856 |
| 268 | Ga0307516_10002871 | 3300031730 | Bacteria | 22675 |
| 269 | Ga0307516_10010111 | 3300031730 | Bacteria | 10429 |
| 270 | Ga0307516_10017451 | 3300031730 | Bacteria | 7484 |
| 271 | Ga0307516_10021308 | 3300031730 | Bacteria | 6674 |
| 272 | Ga0307516_10119211 | 3300031730 | Bacteria | 2432 |
| 273 | Ga0307516_10168803 | 3300031730 | Bacteria | 1930 |
| 274 | Ga0307516_10641736 | 3300031730 | Bacteria | 716 |
| 275 | Ga0307405_10041322 | 3300031731 | Bacteria | 2798 |
| 276 | Ga0307405_10106693 | 3300031731 | Bacteria | 1889 |
| 277 | Ga0307405_10161691 | 3300031731 | Bacteria | 1587 |
| 278 | Ga0316577_10011667 | 3300031733 | Bacteria | 4766 |
| 279 | Ga0307413_10072273 | 3300031824 | Bacteria | 2177 |
| 280 | Ga0307413_10318605 | 3300031824 | Bacteria | 1187 |
| 281 | Ga0307518_10054920 | 3300031838 | Bacteria | 2894 |
| 282 | Ga0307410_10015291 | 3300031852 | Bacteria | 4547 |
| 283 | Ga0326468_10000710 | 3300031889 | Bacteria | 3368 |
| 284 | Ga0307406_10004254 | 3300031901 | Bacteria | 7791 |
| 285 | Ga0307406_10060114 | 3300031901 | Bacteria | 2449 |
| 286 | Ga0307407_10003337 | 3300031903 | Bacteria | 6563 |
| 287 | Ga0307412_10749474 | 3300031911 | Bacteria | 843 |
| 288 | Ga0307409_100000406 | 3300031995 | Bacteria | 18400 |
| 289 | Ga0307409_100025042 | 3300031995 | Bacteria | 4176 |
| 290 | Ga0307409_100342503 | 3300031995 | Bacteria | 1407 |
| 291 | Ga0307416_100005536 | 3300032002 | Bacteria | 7769 |
| 292 | Ga0307416_100006145 | 3300032002 | Bacteria | 7484 |
| 293 | Ga0307416_101172627 | 3300032002 | Bacteria | 873 |
| 294 | Ga0307414_10776620 | 3300032004 | Bacteria | 872 |
| 295 | Ga0307411_10581905 | 3300032005 | Bacteria | 960 |
| 296 | Ga0307415_100000422 | 3300032126 | Bacteria | 18141 |
| 297 | Ga0307415_100049687 | 3300032126 | Bacteria | 2837 |
| 298 | Ga0307415_100129203 | 3300032126 | Bacteria | 1909 |
| 299 | Ga0307415_100393824 | 3300032126 | Bacteria | 1180 |
| 300 | Ga0316585_10006376 | 3300032137 | Bacteria | 3373 |
| 301 | Ga0316585_10013650 | 3300032137 | Bacteria | 2419 |
| 302 | Ga0316585_10198398 | 3300032137 | Bacteria | 663 |
| 303 | Ga0316580_10001258 | 3300032139 | Bacteria | 6532 |
| 304 | Ga0316580_10093244 | 3300032139 | Bacteria | 921 |
| 305 | Ga0316593_10005924 | 3300032168 | Bacteria | 3265 |
| 306 | Ga0307507_10046747 | 3300033179 | Bacteria | 4238 |
| 307 | Ga0307507_10107969 | 3300033179 | Bacteria | 2291 |
| 308 | Ga0307507_10134600 | 3300033179 | Bacteria | 1920 |
| 309 | Ga0307507_10256224 | 3300033179 | Bacteria | 1123 |
| 310 | Ga0307510_10055624 | 3300033180 | Bacteria | 4131 |
| 311 | Ga0307510_10141040 | 3300033180 | Bacteria | 2053 |
| 312 | Ga0307510_10287223 | 3300033180 | Bacteria | 1112 |
| 313 | Ga0307510_10294043 | 3300033180 | Bacteria | 1089 |
| 314 | Ga0316592_1001020 | 3300033524 | Bacteria | 4341 |
| 315 | Ga0316588_1020277 | 3300033528 | Bacteria | 1504 |
| 316 | Ga0316596_1006584 | 3300033541 | Bacteria | 2707 |
| 317 | Ga0373926_0015043 | 3300035083 | Bacteria | 2635 |
| 318 | Ga0373926_0144764 | 3300035083 | Bacteria | 903 |
| 319 | Ga0373934_0000145 | 3300035086 | Bacteria | 25938 |
| 320 | Ga0373934_0055947 | 3300035086 | Bacteria | 1568 |
| 321 | Ga0373944_0018737 | 3300035089 | Bacteria | 1979 |
| 322 | Ga0373949_0139700 | 3300035090 | Bacteria | 693 |
| 323 | Ga0373951_0000115 | 3300035091 | Bacteria | 30473 |
| 324 | Ga0373923_0036634 | 3300035111 | Bacteria | 2003 |
| 325 | Ga0373932_0036450 | 3300035112 | Bacteria | 1397 |
| 326 | Ga0373932_0046447 | 3300035112 | Bacteria | 1273 |
| 327 | Ga0373953_0000082 | 3300035117 | Bacteria | 22843 |
| 328 | Ga0373956_0025341 | 3300035119 | Bacteria | 2562 |
| 329 | Ga0373957_0000047 | 3300035120 | Bacteria | 31450 |
| 330 | Ga0373957_0003440 | 3300035120 | Bacteria | 4680 |
| 331 | Ga0373955_0000020 | 3300035172 | Bacteria | 63100 |
| 332 | Ga0373955_0029205 | 3300035172 | Bacteria | 2865 |
| 333 | Ga0373942_0000196 | 3300035207 | Bacteria | 15484 |
| 334 | Ga0316574_0002467 | 3300035398 | Bacteria | 9293 |
| 335 | Ga0316574_0003441 | 3300035398 | Bacteria | 8157 |
| 336 | Ga0316574_0012516 | 3300035398 | Bacteria | 4854 |
| 337 | Ga0316574_0202237 | 3300035398 | Bacteria | 1276 |
| 338 | Ga0316574_0249145 | 3300035398 | Bacteria | 1135 |
| 339 | Ga0316574_0449297 | 3300035398 | Bacteria | 808 |
| 340 | Ga0373924_0001863 | 3300035410 | Bacteria | 6982 |
| 341 | Ga0373924_0054868 | 3300035410 | Bacteria | 1657 |
| 342 | Ga0373931_0067227 | 3300035691 | Bacteria | 1947 |
| 343 | Ga0373935_0001783 | 3300035692 | Bacteria | 12111 |
| 344 | Ga0373935_0231311 | 3300035692 | Bacteria | 1287 |
| 345 | Ga0373935_0404336 | 3300035692 | Bacteria | 981 |
| 346 | Ga0373933_0000192 | 3300035724 | Bacteria | 40573 |
| 347 | Ga0373947_0000009 | 3300035725 | Bacteria | 172751 |
| 348 | Ga0373937_0000067 | 3300036401 | Bacteria | 94291 |
| 349 | Ga0373937_0079660 | 3300036401 | Bacteria | 3027 |
| 350 | Ga0310112_023850 | 3300036458 | Bacteria | 851 |
| 351 | Ga0316582_0009552 | 3300036647 | Bacteria | 5269 |
| 352 | Ga0316582_0283237 | 3300036647 | Bacteria | 1138 |
| 353 | Ga0316582_0310176 | 3300036647 | Bacteria | 1084 |
| 354 | Ga0316584_0006927 | 3300036712 | Bacteria | 7705 |
| 355 | Ga0316584_0015007 | 3300036712 | Bacteria | 5532 |
| 356 | Ga0316584_0204214 | 3300036712 | Bacteria | 1457 |
| 357 | Ga0395899_0145964 | 3300037312 | Bacteria | 1680 |
| 358 | Ga0395900_0080690 | 3300037418 | Bacteria | 3343 |
| 359 | Ga0395900_0525259 | 3300037418 | Bacteria | 1131 |
| 360 | Ga0395898_0035335 | 3300037466 | Bacteria | 4971 |
| 361 | Ga0395898_0151508 | 3300037466 | Bacteria | 2218 |
| 362 | Ga0395898_0716200 | 3300037466 | Bacteria | 942 |
| 363 | Ga0395898_0813423 | 3300037466 | Bacteria | 874 |
| 364 | Ga0395905_0040914 | 3300037471 | Bacteria | 4348 |
| 365 | Ga0395905_0082226 | 3300037471 | Bacteria | 3018 |
| 366 | Ga0395905_0439594 | 3300037471 | Bacteria | 1202 |
| 367 | Ga0316581_0008926 | 3300037588 | Bacteria | 2742 |
| 368 | Ga0436364_0696641 | 3300037853 | Bacteria | 19004 |
| 369 | Ga0395901_0003772 | 3300038443 | Bacteria | 15271 |
| 370 | Ga0395901_0025204 | 3300038443 | Bacteria | 6106 |
| 371 | Ga0395901_0978121 | 3300038443 | Bacteria | 823 |
| 372 | Ga0400488_07225 | 3300038741 | Bacteria | 3313 |
| 373 | Ga0436363_0357854 | 3300039450 | Bacteria | 1031 |
| 374 | Ga0436362_0777364 | 3300039453 | Bacteria | 1098 |
| 375 | Ga0436362_1118715 | 3300039453 | Bacteria | 1331 |
| 376 | Ga0439436_0000647 | 3300041404 | Bacteria | 9264 |
| 377 | Ga0439439_0050921 | 3300041406 | Bacteria | 1085 |
| 378 | Ga0451793_0775163 | 3300041452 | Bacteria | 1195 |
| 379 | Ga0451795_0216371 | 3300041456 | Bacteria | 932 |
| 380 | Ga0451798_0034298 | 3300041458 | Bacteria | 1504 |
| 381 | Ga0451804_0745524 | 3300041463 | Bacteria | 780 |
| 382 | Ga0451804_0888423 | 3300041463 | Bacteria | 1039 |
| 383 | Ga0451835_1095149 | 3300041492 | Bacteria | 2265 |
| 384 | Ga0451841_0657617 | 3300041498 | Bacteria | 1034 |
| 385 | Ga0451845_0110932 | 3300041501 | Bacteria | 1148 |
| 386 | Ga0451853_0476250 | 3300041512 | Bacteria | 4496 |
| 387 | Ga0439431_0082966 | 3300041997 | Bacteria | 866 |
| 388 | Ga0439433_0000925 | 3300041999 | Bacteria | 5873 |
| 389 | Ga0439448_0068586 | 3300042005 | Bacteria | 1179 |
| 390 | Ga0439449_0007208 | 3300042007 | Bacteria | 4230 |
| 391 | Ga0439449_0061763 | 3300042007 | Bacteria | 1382 |
| 392 | Ga0439449_0114589 | 3300042007 | Bacteria | 999 |
| 393 | Ga0439454_012870 | 3300042011 | Bacteria | 1140 |
| 394 | Ga0439455_0007065 | 3300042012 | Bacteria | 2360 |
| 395 | Ga0439457_001642 | 3300042014 | Bacteria | 6667 |
| 396 | Ga0439462_0015964 | 3300042015 | Bacteria | 1937 |
| 397 | Ga0450914_010590 | 3300042118 | Bacteria | 894 |
| 398 | Ga0450894_000878 | 3300042131 | Bacteria | 4808 |
| 399 | Ga0450895_000300 | 3300042132 | Bacteria | 2602 |
| 400 | Ga0450900_025880 | 3300042136 | Bacteria | 837 |
| 401 | Ga0450902_010824 | 3300042137 | Bacteria | 1444 |
| 402 | Ga0450903_000042 | 3300042138 | Bacteria | 24733 |
| 403 | Ga0450903_021470 | 3300042138 | Bacteria | 997 |
| 404 | Ga0450906_003999 | 3300042145 | Bacteria | 3118 |
| 405 | Ga0450907_010517 | 3300042146 | Bacteria | 1535 |
| 406 | Ga0439458_0002401 | 3300042157 | Bacteria | 4574 |
| 407 | Ga0450908_011788 | 3300042184 | Bacteria | 1594 |
| 408 | Ga0450901_020097 | 3300042533 | Bacteria | 714 |
| 409 | Ga0451577_0111144 | 3300042876 | Bacteria | 2452 |
| 410 | Ga0466969_0001418 | 3300044656 | Bacteria | 12922 |
| 411 | Ga0466969_0003205 | 3300044656 | Bacteria | 8713 |
| 412 | Ga0466969_0004397 | 3300044656 | Bacteria | 7494 |
| 413 | Ga0466969_0391709 | 3300044656 | Bacteria | 630 |
| 414 | Ga0466972_0024378 | 3300044658 | Bacteria | 3002 |
| 415 | Ga0466972_0029293 | 3300044658 | Bacteria | 2710 |
| 416 | Ga0466972_0151363 | 3300044658 | Bacteria | 1091 |
| 417 | Ga0466972_0202942 | 3300044658 | Bacteria | 929 |
| 418 | Ga0466965_0077522 | 3300044683 | Bacteria | 1678 |
| 419 | Ga0466965_0118188 | 3300044683 | Bacteria | 1367 |
| 420 | Ga0466965_0234623 | 3300044683 | Bacteria | 981 |
| 421 | Ga0466966_0002225 | 3300044684 | Bacteria | 12619 |
| 422 | Ga0466966_0005406 | 3300044684 | Bacteria | 8394 |
| 423 | Ga0466966_0005466 | 3300044684 | Bacteria | 8354 |
| 424 | Ga0466966_0025916 | 3300044684 | Bacteria | 3830 |
| 425 | Ga0466966_0265793 | 3300044684 | Bacteria | 1032 |
| 426 | Ga0466961_0005647 | 3300044693 | Bacteria | 7909 |
| 427 | Ga0466961_0010029 | 3300044693 | Bacteria | 6034 |
| 428 | Ga0466961_0030018 | 3300044693 | Bacteria | 3493 |
| 429 | Ga0466961_0034304 | 3300044693 | Bacteria | 3258 |
| 430 | Ga0466961_0165088 | 3300044693 | Bacteria | 1379 |
| 431 | Ga0466963_0001853 | 3300044694 | Bacteria | 11530 |
| 432 | Ga0466963_0006392 | 3300044694 | Bacteria | 6969 |
| 433 | Ga0466963_0177807 | 3300044694 | Bacteria | 1485 |
| 434 | Ga0466963_0185911 | 3300044694 | Bacteria | 1451 |
| 435 | Ga0466964_0058623 | 3300044706 | Bacteria | 1597 |
| 436 | Ga0466971_0001269 | 3300044719 | Bacteria | 10524 |
| 437 | Ga0466971_0074212 | 3300044719 | Bacteria | 1546 |
| 438 | Ga0466968_0068045 | 3300044735 | Bacteria | 1545 |
| 439 | Ga0466970_0005211 | 3300044765 | Bacteria | 6433 |
| 440 | Ga0466970_0009711 | 3300044765 | Bacteria | 4868 |
| 441 | Ga0466970_0011518 | 3300044765 | Bacteria | 4508 |
| 442 | Ga0466970_0231915 | 3300044765 | Bacteria | 1032 |
| 443 | Ga0466957_0005140 | 3300044842 | Bacteria | 7314 |
| 444 | Ga0466957_0064142 | 3300044842 | Bacteria | 2259 |
| 445 | Ga0466957_0654104 | 3300044842 | Bacteria | 739 |
| 446 | Ga0466957_0770045 | 3300044842 | Bacteria | 682 |
| 447 | Ga0466960_0152786 | 3300044901 | Bacteria | 1234 |
| 448 | Ga0466959_0012115 | 3300045049 | Bacteria | 6223 |
| 449 | Ga0466959_0019353 | 3300045049 | Bacteria | 5006 |
| 450 | Ga0466959_0032027 | 3300045049 | Bacteria | 3890 |
| 451 | Ga0466959_0366316 | 3300045049 | Bacteria | 982 |
| 452 | Ga0466959_0380902 | 3300045049 | Bacteria | 960 |
| 453 | Ga0466958_0018495 | 3300045836 | Bacteria | 4044 |
| 454 | Ga0466958_0027371 | 3300045836 | Bacteria | 3375 |
| 455 | Ga0466958_0068692 | 3300045836 | Bacteria | 2166 |
| 456 | Ga0466958_0202720 | 3300045836 | Bacteria | 1263 |
| 457 | Ga0466958_0605152 | 3300045836 | Bacteria | 713 |
| 458 | Ga0466958_0619135 | 3300045836 | Bacteria | 704 |
| 459 | Ga0466967_0049198 | 3300045976 | Bacteria | 3685 |
| 460 | Ga0466967_0160826 | 3300045976 | Bacteria | 2107 |
| 461 | Ga0466967_0601572 | 3300045976 | Bacteria | 1085 |
| 462 | Ga0466967_1805276 | 3300045976 | Bacteria | 609 |
| 463 | Ga0495617_008519 | 3300046452 | Bacteria | 3533 |
| 464 | Ga0495627_046111 | 3300046453 | Bacteria | 1326 |
| 465 | Ga0495592_0000069 | 3300046454 | Bacteria | 94288 |
| 466 | Ga0495592_0086598 | 3300046454 | Bacteria | 2255 |
| 467 | Ga0495592_0113597 | 3300046454 | Bacteria | 1913 |
| 468 | Ga0495592_0139010 | 3300046454 | Bacteria | 1691 |
| 469 | Ga0495603_0014289 | 3300046455 | Bacteria | 4803 |
| 470 | Ga0495603_0049787 | 3300046455 | Bacteria | 2493 |
| 471 | Ga0495603_0106842 | 3300046455 | Bacteria | 1633 |
| 472 | Ga0495603_0107917 | 3300046455 | Bacteria | 1624 |
| 473 | Ga0495603_0125423 | 3300046455 | Bacteria | 1496 |
| 474 | Ga0495603_0172744 | 3300046455 | Bacteria | 1251 |
| 475 | Ga0495590_0074454 | 3300046457 | Bacteria | 1194 |
| 476 | Ga0495629_0004039 | 3300046459 | Bacteria | 11030 |
| 477 | Ga0495629_0037840 | 3300046459 | Bacteria | 3400 |
| 478 | Ga0495629_0099559 | 3300046459 | Bacteria | 2028 |
| 479 | Ga0495629_0218347 | 3300046459 | Bacteria | 1315 |
| 480 | Ga0495629_0221652 | 3300046459 | Bacteria | 1304 |
| 481 | Ga0495629_0245836 | 3300046459 | Bacteria | 1231 |
| 482 | Ga0495638_0056942 | 3300046460 | Bacteria | 2425 |
| 483 | Ga0495638_0254522 | 3300046460 | Bacteria | 966 |
| 484 | Ga0495638_0376605 | 3300046460 | Bacteria | 742 |
| 485 | Ga0495638_0415067 | 3300046460 | Bacteria | 695 |
| 486 | Ga0495641_0031258 | 3300046461 | Bacteria | 2545 |
| 487 | Ga0495641_0056976 | 3300046461 | Bacteria | 1770 |
| 488 | Ga0495641_0222014 | 3300046461 | Bacteria | 848 |
| 489 | Ga0495651_0000016 | 3300046462 | Bacteria | 125612 |
| 490 | Ga0495651_0000877 | 3300046462 | Bacteria | 23370 |
| 491 | Ga0495651_0002270 | 3300046462 | Bacteria | 14836 |
| 492 | Ga0495651_0024622 | 3300046462 | Bacteria | 4681 |
| 493 | Ga0495651_0064795 | 3300046462 | Bacteria | 2792 |
| 494 | Ga0495651_0267752 | 3300046462 | Bacteria | 1160 |
| 495 | Ga0495653_0000381 | 3300046463 | Bacteria | 35673 |
| 496 | Ga0495653_0022314 | 3300046463 | Bacteria | 5123 |
| 497 | Ga0495653_0147679 | 3300046463 | Bacteria | 1646 |
| 498 | Ga0495580_0105648 | 3300046472 | Bacteria | 1956 |
| 499 | Ga0495582_0103106 | 3300046473 | Bacteria | 1598 |
| 500 | Ga0495582_0112376 | 3300046473 | Bacteria | 1530 |
| 501 | Ga0495582_0287040 | 3300046473 | Bacteria | 945 |
| 502 | Ga0495605_0028928 | 3300046474 | Bacteria | 2856 |
| 503 | Ga0495605_0159786 | 3300046474 | Bacteria | 1001 |
| 504 | Ga0495605_0211553 | 3300046474 | Bacteria | 841 |
| 505 | Ga0495662_0002591 | 3300046476 | Bacteria | 9136 |
| 506 | Ga0495662_0017622 | 3300046476 | Bacteria | 3457 |
| 507 | Ga0495662_0062385 | 3300046476 | Bacteria | 1800 |
| 508 | Ga0495662_0181358 | 3300046476 | Bacteria | 1037 |
| 509 | Ga0495664_0011037 | 3300046477 | Bacteria | 5082 |
| 510 | Ga0495664_0047922 | 3300046477 | Bacteria | 2536 |
| 511 | Ga0495664_0358600 | 3300046477 | Bacteria | 877 |
| 512 | Ga0495584_0096326 | 3300046491 | Bacteria | 1494 |
| 513 | Ga0495585_0007060 | 3300046492 | Bacteria | 6907 |
| 514 | Ga0495585_0017360 | 3300046492 | Bacteria | 4157 |
| 515 | Ga0495585_0029333 | 3300046492 | Bacteria | 3132 |
| 516 | Ga0495585_0111505 | 3300046492 | Bacteria | 1454 |
| 517 | Ga0495585_0165981 | 3300046492 | Bacteria | 1143 |
| 518 | Ga0495594_0000534 | 3300046499 | Bacteria | 19485 |
| 519 | Ga0495594_0001342 | 3300046499 | Bacteria | 12775 |
| 520 | Ga0495594_0025045 | 3300046499 | Bacteria | 3206 |
| 521 | Ga0495594_0066921 | 3300046499 | Bacteria | 1993 |
| 522 | Ga0495594_0080354 | 3300046499 | Bacteria | 1820 |
| 523 | Ga0495594_0122822 | 3300046499 | Bacteria | 1468 |
| 524 | Ga0495594_0201958 | 3300046499 | Bacteria | 1133 |
| 525 | Ga0495596_0059337 | 3300046500 | Bacteria | 1491 |
| 526 | Ga0495607_0027985 | 3300046501 | Bacteria | 3480 |
| 527 | Ga0495607_0098590 | 3300046501 | Bacteria | 1569 |
| 528 | Ga0495607_0111703 | 3300046501 | Bacteria | 1448 |
| 529 | Ga0495607_0171270 | 3300046501 | Bacteria | 1096 |
| 530 | Ga0495583_0014310 | 3300046506 | Bacteria | 4383 |
| 531 | Ga0495608_0000051 | 3300046511 | Bacteria | 94719 |
| 532 | Ga0495610_0032653 | 3300046512 | Bacteria | 2701 |
| 533 | Ga0495616_0004473 | 3300046513 | Bacteria | 8801 |
| 534 | Ga0495618_0071355 | 3300046514 | Bacteria | 2209 |
| 535 | Ga0495618_0073416 | 3300046514 | Bacteria | 2178 |
| 536 | Ga0495620_0210712 | 3300046515 | Bacteria | 745 |
| 537 | Ga0495620_0210714 | 3300046515 | Bacteria | 745 |
| 538 | Ga0495628_0000126 | 3300046516 | Bacteria | 63839 |
| 539 | Ga0495628_0021083 | 3300046516 | Bacteria | 5366 |
| 540 | Ga0495628_0047595 | 3300046516 | Bacteria | 3401 |
| 541 | Ga0495628_0232483 | 3300046516 | Bacteria | 1381 |
| 542 | Ga0495630_0083686 | 3300046517 | Bacteria | 2409 |
| 543 | Ga0495630_0222633 | 3300046517 | Bacteria | 1440 |
| 544 | Ga0495630_0271273 | 3300046517 | Bacteria | 1296 |
| 545 | Ga0495630_0286596 | 3300046517 | Bacteria | 1258 |
| 546 | Ga0495631_0003096 | 3300046518 | Bacteria | 9166 |
| 547 | Ga0495631_0062705 | 3300046518 | Bacteria | 1610 |
| 548 | Ga0495631_0251352 | 3300046518 | Bacteria | 753 |
| 549 | Ga0495632_0013008 | 3300046519 | Bacteria | 4770 |
| 550 | Ga0495637_0009037 | 3300046520 | Bacteria | 4869 |
| 551 | Ga0495643_0003319 | 3300046522 | Bacteria | 11874 |
| 552 | Ga0495643_0011979 | 3300046522 | Bacteria | 5248 |
| 553 | Ga0495648_0052190 | 3300046524 | Bacteria | 2485 |
| 554 | Ga0495666_0042778 | 3300046526 | Bacteria | 2189 |
| 555 | Ga0495666_0071248 | 3300046526 | Bacteria | 1652 |
| 556 | Ga0495642_0098842 | 3300046528 | Bacteria | 1240 |
| 557 | Ga0495642_0151219 | 3300046528 | Bacteria | 1004 |
| 558 | Ga0495652_0000654 | 3300046529 | Bacteria | 40137 |
| 559 | Ga0495652_0000831 | 3300046529 | Bacteria | 35576 |
| 560 | Ga0495652_0006834 | 3300046529 | Bacteria | 10573 |
| 561 | Ga0495652_0018073 | 3300046529 | Bacteria | 6290 |
| 562 | Ga0495654_0055777 | 3300046530 | Bacteria | 1912 |
| 563 | Ga0495665_0007973 | 3300046531 | Bacteria | 5743 |
| 564 | Ga0495640_0018021 | 3300046533 | Bacteria | 5249 |
| 565 | Ga0495640_0032738 | 3300046533 | Bacteria | 3699 |
| 566 | Ga0495586_0067920 | 3300046535 | Bacteria | 1944 |
| 567 | Ga0495586_0186455 | 3300046535 | Bacteria | 1174 |
| 568 | Ga0495587_0000058 | 3300046536 | Bacteria | 94307 |
| 569 | Ga0495587_0000907 | 3300046536 | Bacteria | 19603 |
| 570 | Ga0495587_0003288 | 3300046536 | Bacteria | 10788 |
| 571 | Ga0495609_0007988 | 3300046538 | Bacteria | 5225 |
| 572 | Ga0495597_0026389 | 3300046542 | Bacteria | 2668 |
| 573 | Ga0495645_0004398 | 3300046543 | Bacteria | 9628 |
| 574 | Ga0495645_0044976 | 3300046543 | Bacteria | 3220 |
| 575 | Ga0495645_0277480 | 3300046543 | Bacteria | 1103 |
| 576 | Ga0495622_0009980 | 3300046557 | Bacteria | 4392 |
| 577 | Ga0495622_0010925 | 3300046557 | Bacteria | 4188 |
| 578 | Ga0495622_0011920 | 3300046557 | Bacteria | 4021 |
| 579 | Ga0495622_0018300 | 3300046557 | Bacteria | 3263 |
| 580 | Ga0495622_0215186 | 3300046557 | Bacteria | 852 |
| 581 | Ga0495633_0033673 | 3300046558 | Bacteria | 2469 |
| 582 | Ga0495633_0034749 | 3300046558 | Bacteria | 2423 |
| 583 | Ga0495633_0250474 | 3300046558 | Bacteria | 808 |
| 584 | Ga0495667_0000062 | 3300046559 | Bacteria | 94307 |
| 585 | Ga0495667_0055394 | 3300046559 | Bacteria | 2608 |
| 586 | Ga0495667_0073354 | 3300046559 | Bacteria | 2229 |
| 587 | Ga0495667_0182850 | 3300046559 | Bacteria | 1345 |
| 588 | Ga0495667_0294036 | 3300046559 | Bacteria | 1030 |
| 589 | Ga0495656_0042986 | 3300046615 | Bacteria | 1895 |
| 590 | Ga0495656_0171800 | 3300046615 | Bacteria | 1060 |
| 591 | Ga0495668_0000123 | 3300046616 | Bacteria | 115173 |
| 592 | Ga0495668_0419641 | 3300046616 | Bacteria | 735 |
| 593 | Ga0495634_0012335 | 3300046642 | Bacteria | 6192 |
| 594 | Ga0495634_0085861 | 3300046642 | Bacteria | 2050 |
| 595 | Ga0495634_0223669 | 3300046642 | Bacteria | 1161 |
| 596 | Ga0495611_0020510 | 3300046648 | Bacteria | 2845 |
| 597 | Ga0495611_0172956 | 3300046648 | Bacteria | 1009 |
| 598 | Ga0495625_0005807 | 3300046660 | Bacteria | 11145 |
| 599 | Ga0495625_0315112 | 3300046660 | Bacteria | 997 |
| 600 | Ga0495625_0393212 | 3300046660 | Bacteria | 867 |
| 601 | Ga0495635_0005875 | 3300046663 | Bacteria | 8556 |
| 602 | Ga0495635_0016061 | 3300046663 | Bacteria | 5228 |
| 603 | Ga0495635_0044394 | 3300046663 | Bacteria | 3067 |
| 604 | Ga0495635_0138722 | 3300046663 | Bacteria | 1656 |
| 605 | Ga0495635_0228830 | 3300046663 | Bacteria | 1256 |
| 606 | Ga0495635_0327665 | 3300046663 | Bacteria | 1024 |
| 607 | Ga0495661_0020242 | 3300046665 | Bacteria | 4348 |
| 608 | Ga0495588_0001306 | 3300046674 | Bacteria | 10661 |
| 609 | Ga0495588_0002549 | 3300046674 | Bacteria | 7786 |
| 610 | Ga0495588_0033182 | 3300046674 | Bacteria | 2606 |
| 611 | Ga0495588_0044870 | 3300046674 | Bacteria | 2265 |
| 612 | Ga0495588_0493970 | 3300046674 | Bacteria | 642 |
| 613 | Ga0495657_0000065 | 3300046675 | Bacteria | 94307 |
| 614 | Ga0495657_0003629 | 3300046675 | Bacteria | 12539 |
| 615 | Ga0495657_0085383 | 3300046675 | Bacteria | 2034 |
| 616 | Ga0495657_0153142 | 3300046675 | Bacteria | 1430 |
| 617 | Ga0495657_0258619 | 3300046675 | Bacteria | 1047 |
| 618 | Ga0495657_0280552 | 3300046675 | Bacteria | 997 |
| 619 | Ga0495599_0000045 | 3300046678 | Bacteria | 86086 |
| 620 | Ga0495599_0043568 | 3300046678 | Bacteria | 2816 |
| 621 | Ga0495599_0089876 | 3300046678 | Bacteria | 1917 |
| 622 | Ga0495623_0000051 | 3300046679 | Bacteria | 72814 |
| 623 | Ga0495623_0026038 | 3300046679 | Bacteria | 3767 |
| 624 | Ga0495623_0086019 | 3300046679 | Bacteria | 1938 |
| 625 | Ga0495623_0108105 | 3300046679 | Bacteria | 1688 |
| 626 | Ga0495623_0137046 | 3300046679 | Bacteria | 1460 |
| 627 | Ga0495646_0000855 | 3300046680 | Bacteria | 17256 |
| 628 | Ga0495646_0006164 | 3300046680 | Bacteria | 7603 |
| 629 | Ga0495646_0036344 | 3300046680 | Bacteria | 3051 |
| 630 | Ga0495646_0193007 | 3300046680 | Bacteria | 1112 |
| 631 | Ga0495658_0043519 | 3300046683 | Bacteria | 2512 |
| 632 | Ga0495658_0073541 | 3300046683 | Bacteria | 1990 |
| 633 | Ga0495669_0016530 | 3300046684 | Bacteria | 3161 |
| 634 | Ga0495613_0003081 | 3300046689 | Bacteria | 12453 |
| 635 | Ga0495613_0052882 | 3300046689 | Bacteria | 2990 |
| 636 | Ga0495613_0150761 | 3300046689 | Bacteria | 1658 |
| 637 | Ga0495613_0511424 | 3300046689 | Bacteria | 807 |
| 638 | Ga0495613_0608431 | 3300046689 | Bacteria | 726 |
| 639 | Ga0495624_0058266 | 3300046690 | Bacteria | 2426 |
| 640 | Ga0495624_0385078 | 3300046690 | Bacteria | 842 |
| 641 | Ga0495670_0006366 | 3300046691 | Bacteria | 5797 |
| 642 | Ga0495670_0139922 | 3300046691 | Bacteria | 1265 |
| 643 | Ga0495670_0172250 | 3300046691 | Bacteria | 1140 |
| 644 | Ga0495671_0027068 | 3300046692 | Bacteria | 2964 |
| 645 | Ga0495671_0101110 | 3300046692 | Bacteria | 1409 |
| 646 | Ga0495671_0140874 | 3300046692 | Bacteria | 1175 |
| 647 | Ga0495671_0238204 | 3300046692 | Bacteria | 879 |
| 648 | Ga0495649_0108145 | 3300046694 | Bacteria | 1475 |
| 649 | Ga0495649_0153422 | 3300046694 | Bacteria | 1209 |
| 650 | Ga0495649_0220882 | 3300046694 | Bacteria | 980 |
| 651 | Ga0495589_0052255 | 3300046794 | Bacteria | 2019 |
| 652 | Ga0495589_0081760 | 3300046794 | Bacteria | 1571 |
| 653 | Ga0495589_0100668 | 3300046794 | Bacteria | 1398 |
| 654 | Ga0495589_0149558 | 3300046794 | Bacteria | 1115 |
| 655 | Ga0495589_0309960 | 3300046794 | Bacteria | 730 |
| 656 | Ga0495600_0001072 | 3300046809 | Bacteria | 14861 |
| 657 | Ga0495600_0005303 | 3300046809 | Bacteria | 7767 |
| 658 | Ga0495600_0005439 | 3300046809 | Bacteria | 7677 |
| 659 | Ga0495600_0082971 | 3300046809 | Bacteria | 2092 |
| 660 | Ga0495600_0306200 | 3300046809 | Bacteria | 1001 |
| 661 | Ga0495660_0289822 | 3300046810 | Bacteria | 745 |
| 662 | Ga0495660_0289843 | 3300046810 | Bacteria | 745 |
| 663 | Ga0495581_0084198 | 3300047315 | Bacteria | 1843 |
| 664 | Ga0495581_0111016 | 3300047315 | Bacteria | 1595 |
| 665 | Ga0495604_0000233 | 3300047317 | Bacteria | 49951 |
| 666 | Ga0495604_0001536 | 3300047317 | Bacteria | 19010 |
| 667 | Ga0495604_0010118 | 3300047317 | Bacteria | 7472 |
| 668 | Ga0495604_0248821 | 3300047317 | Bacteria | 1212 |
| 669 | Ga0495636_0005810 | 3300047318 | Bacteria | 4838 |
| 670 | Ga0495636_0037681 | 3300047318 | Bacteria | 1997 |
| 671 | Ga0495636_0047587 | 3300047318 | Bacteria | 1791 |
| 672 | Ga0495636_0086946 | 3300047318 | Bacteria | 1352 |
| 673 | Ga0495636_0127086 | 3300047318 | Bacteria | 1132 |
| 674 | Ga0495636_0170319 | 3300047318 | Bacteria | 984 |
| 675 | Ga0495674_0215164 | 3300047319 | Bacteria | 1590 |
| 676 | Ga0495674_0436576 | 3300047319 | Bacteria | 1053 |
| 677 | Ga0495672_0019354 | 3300047320 | Bacteria | 4493 |
| 678 | Ga0495676_0013343 | 3300047321 | Bacteria | 7380 |
| 679 | Ga0495676_0026725 | 3300047321 | Bacteria | 4962 |
| 680 | Ga0495676_0028819 | 3300047321 | Bacteria | 4736 |
| 681 | Ga0495676_0066809 | 3300047321 | Bacteria | 2784 |
| 682 | Ga0495676_0101081 | 3300047321 | Bacteria | 2134 |
| 683 | Ga0495676_0111304 | 3300047321 | Bacteria | 2008 |
| 684 | Ga0495680_0000678 | 3300047322 | Bacteria | 38049 |
| 685 | Ga0495680_0044111 | 3300047322 | Bacteria | 3527 |
| 686 | Ga0495680_0084935 | 3300047322 | Bacteria | 2384 |
| 687 | Ga0495680_0577371 | 3300047322 | Bacteria | 754 |
| 688 | Ga0495683_0069931 | 3300047323 | Bacteria | 1724 |
| 689 | Ga0495683_0153368 | 3300047323 | Bacteria | 1070 |
| 690 | Ga0495683_0154877 | 3300047323 | Bacteria | 1063 |
| 691 | Ga0495683_0185626 | 3300047323 | Bacteria | 947 |
| 692 | Ga0495687_001147 | 3300047443 | Bacteria | 25643 |
| 693 | Ga0495687_003306 | 3300047443 | Bacteria | 11824 |
| 694 | Ga0495687_134956 | 3300047443 | Bacteria | 867 |
| 695 | Ga0495675_0000325 | 3300047444 | Bacteria | 33817 |
| 696 | Ga0495675_0000675 | 3300047444 | Bacteria | 21516 |
| 697 | Ga0495675_0007918 | 3300047444 | Bacteria | 6566 |
| 698 | Ga0495675_0077417 | 3300047444 | Bacteria | 2095 |
| 699 | Ga0495675_0295609 | 3300047444 | Bacteria | 963 |
| 700 | Ga0495679_057193 | 3300047446 | Bacteria | 1154 |
| 701 | Ga0495685_000486 | 3300047447 | Bacteria | 12295 |
| 702 | Ga0495685_020602 | 3300047447 | Bacteria | 2266 |
| 703 | Ga0495685_034258 | 3300047447 | Bacteria | 1744 |
| 704 | Ga0495685_034731 | 3300047447 | Bacteria | 1732 |
| 705 | Ga0495685_092198 | 3300047447 | Bacteria | 1003 |
| 706 | Ga0495685_169910 | 3300047447 | Bacteria | 704 |
| 707 | Ga0495681_0000590 | 3300047470 | Bacteria | 27737 |
| 708 | Ga0495681_0004760 | 3300047470 | Bacteria | 9198 |
| 709 | Ga0495684_0065573 | 3300047471 | Bacteria | 2760 |
| 710 | Ga0495684_0186585 | 3300047471 | Bacteria | 1535 |
| 711 | Ga0495686_0087868 | 3300047472 | Bacteria | 1890 |
| 712 | Ga0495686_0159404 | 3300047472 | Bacteria | 1319 |
| 713 | Ga0495686_0345750 | 3300047472 | Bacteria | 810 |
| 714 | Ga0495593_0037244 | 3300047673 | Bacteria | 2632 |
| 715 | Ga0495593_0105733 | 3300047673 | Bacteria | 1440 |
| 716 | Ga0495593_0106955 | 3300047673 | Bacteria | 1430 |
| 717 | Ga0495593_0226146 | 3300047673 | Bacteria | 938 |
| 718 | Ga0495602_0000079 | 3300048088 | Bacteria | 94307 |
| 719 | Ga0495602_0168435 | 3300048088 | Bacteria | 1702 |
| 720 | Ga0495602_0246286 | 3300048088 | Bacteria | 1334 |
| 721 | Ga0495602_0567654 | 3300048088 | Bacteria | 784 |
| 722 | Ga0495614_0000331 | 3300048089 | Bacteria | 18729 |
| 723 | Ga0495614_0002125 | 3300048089 | Bacteria | 8769 |
| 724 | Ga0495614_0174306 | 3300048089 | Bacteria | 966 |
| 725 | Ga0495614_0255350 | 3300048089 | Bacteria | 803 |
| 726 | Ga0495614_0501839 | 3300048089 | Bacteria | 577 |
| 727 | Ga0495626_0007219 | 3300048091 | Bacteria | 6208 |
| 728 | Ga0496101_0224705 | 3300048904 | Bacteria | 1458 |
| 729 | Ga0496102_0119267 | 3300048905 | Bacteria | 2463 |
| 730 | Ga0496102_0219017 | 3300048905 | Bacteria | 1794 |
| 731 | Ga0496104_0009222 | 3300048907 | Bacteria | 8771 |
| 732 | Ga0496104_0131038 | 3300048907 | Bacteria | 2408 |
| 733 | Ga0496105_0012096 | 3300048908 | Bacteria | 6835 |
| 734 | Ga0496105_0412330 | 3300048908 | Bacteria | 1071 |
| 735 | Ga0496105_0846831 | 3300048908 | Bacteria | 692 |
| 736 | Ga0496107_0072025 | 3300048910 | Bacteria | 2512 |
| 737 | Ga0496107_0853082 | 3300048910 | Bacteria | 665 |
| 738 | Ga0496108_0000959 | 3300048911 | Bacteria | 22428 |
| 739 | Ga0496108_0042183 | 3300048911 | Bacteria | 3809 |
| 740 | Ga0496108_0061256 | 3300048911 | Bacteria | 3166 |
| 741 | Ga0496109_0139325 | 3300048912 | Bacteria | 2268 |
| 742 | Ga0496109_0147279 | 3300048912 | Bacteria | 2203 |
| 743 | Ga0496109_0293706 | 3300048912 | Bacteria | 1532 |
| 744 | Ga0496110_0014056 | 3300048913 | Bacteria | 6636 |
| 745 | Ga0496110_0087314 | 3300048913 | Bacteria | 2786 |
| 746 | Ga0496110_0180538 | 3300048913 | Bacteria | 1916 |
| 747 | Ga0496110_0242064 | 3300048913 | Bacteria | 1641 |
| 748 | Ga0496111_0091211 | 3300048914 | Bacteria | 2233 |
| 749 | Ga0496111_0185530 | 3300048914 | Bacteria | 1546 |
| 750 | Ga0496111_0463243 | 3300048914 | Bacteria | 935 |
| 751 | Ga0496112_0009854 | 3300048915 | Bacteria | 8632 |
| 752 | Ga0496112_0364853 | 3300048915 | Bacteria | 1386 |
| 753 | Ga0496113_0298415 | 3300048916 | Bacteria | 1290 |
| 754 | Ga0496114_0008124 | 3300048917 | Bacteria | 8316 |
| 755 | Ga0496114_0078991 | 3300048917 | Bacteria | 2776 |
| 756 | Ga0496114_0158091 | 3300048917 | Bacteria | 1969 |
| 757 | Ga0496115_0248285 | 3300048918 | Bacteria | 1466 |
| 758 | Ga0496115_0413098 | 3300048918 | Bacteria | 1094 |
| 759 | Ga0496124_0429297 | 3300048927 | Bacteria | 908 |
| 760 | Ga0496126_0046187 | 3300048929 | Bacteria | 3997 |
| 761 | Ga0501310_000014 | 3300049130 | Bacteria | 16976 |
| 762 | Ga0495678_022611 | 3300049459 | Bacteria | 2746 |
| 763 | Ga0495682_0023182 | 3300049460 | Bacteria | 2318 |
| 764 | Ga0501031_0003124 | 3300049568 | Bacteria | 10615 |
| 765 | Ga0501031_0003254 | 3300049568 | Bacteria | 10440 |
| 766 | Ga0501031_0122493 | 3300049568 | Bacteria | 1699 |
| 767 | Ga0501031_0125833 | 3300049568 | Bacteria | 1674 |
| 768 | Ga0501031_0197093 | 3300049568 | Bacteria | 1314 |
| 769 | Ga0501031_0246077 | 3300049568 | Bacteria | 1162 |
| 770 | Ga0501032_0000686 | 3300049569 | Bacteria | 27531 |
| 771 | Ga0501032_0001522 | 3300049569 | Bacteria | 18477 |
| 772 | Ga0501032_0007044 | 3300049569 | Bacteria | 8247 |
| 773 | Ga0501032_0051495 | 3300049569 | Bacteria | 2776 |
| 774 | Ga0501032_0060063 | 3300049569 | Bacteria | 2550 |
| 775 | Ga0501032_0069873 | 3300049569 | Bacteria | 2343 |
| 776 | Ga0501032_0191272 | 3300049569 | Bacteria | 1337 |
| 777 | Ga0501033_0003959 | 3300049570 | Bacteria | 12010 |
| 778 | Ga0501033_0009007 | 3300049570 | Bacteria | 7700 |
| 779 | Ga0501033_0011728 | 3300049570 | Bacteria | 6702 |
| 780 | Ga0501033_0017170 | 3300049570 | Bacteria | 5469 |
| 781 | Ga0501033_0037585 | 3300049570 | Bacteria | 3623 |
| 782 | Ga0501033_0054186 | 3300049570 | Bacteria | 2968 |
| 783 | Ga0501033_0078686 | 3300049570 | Bacteria | 2419 |
| 784 | Ga0501033_0099712 | 3300049570 | Bacteria | 2120 |
| 785 | Ga0501033_0849378 | 3300049570 | Bacteria | 615 |
| 786 | Ga0501034_0000700 | 3300049571 | Bacteria | 50894 |
| 787 | Ga0501034_0000987 | 3300049571 | Bacteria | 40823 |
| 788 | Ga0501034_0033852 | 3300049571 | Bacteria | 5180 |
| 789 | Ga0501034_0037777 | 3300049571 | Bacteria | 4890 |
| 790 | Ga0501034_0110839 | 3300049571 | Bacteria | 2735 |
| 791 | Ga0501034_0112723 | 3300049571 | Bacteria | 2709 |
| 792 | Ga0501034_0234177 | 3300049571 | Bacteria | 1784 |
| 793 | Ga0501034_0263121 | 3300049571 | Bacteria | 1667 |
| 794 | Ga0501034_0440620 | 3300049571 | Bacteria | 1221 |
| 795 | Ga0501036_0001560 | 3300049572 | Bacteria | 17694 |
| 796 | Ga0501036_0003653 | 3300049572 | Bacteria | 12306 |
| 797 | Ga0501036_0014281 | 3300049572 | Bacteria | 6608 |
| 798 | Ga0501036_0030414 | 3300049572 | Bacteria | 4561 |
| 799 | Ga0501036_0045495 | 3300049572 | Bacteria | 3718 |
| 800 | Ga0501036_0046338 | 3300049572 | Bacteria | 3681 |
| 801 | Ga0501036_0091993 | 3300049572 | Bacteria | 2562 |
| 802 | Ga0501037_0001087 | 3300049573 | Bacteria | 20162 |
| 803 | Ga0501037_0025618 | 3300049573 | Bacteria | 4357 |
| 804 | Ga0501037_0061963 | 3300049573 | Bacteria | 2727 |
| 805 | Ga0501037_0080775 | 3300049573 | Bacteria | 2358 |
| 806 | Ga0501037_0221921 | 3300049573 | Bacteria | 1329 |
| 807 | Ga0501038_0001100 | 3300049574 | Bacteria | 24469 |
| 808 | Ga0501038_0001242 | 3300049574 | Bacteria | 23113 |
| 809 | Ga0501038_0006803 | 3300049574 | Bacteria | 10561 |
| 810 | Ga0501038_0088005 | 3300049574 | Bacteria | 2607 |
| 811 | Ga0501038_0141596 | 3300049574 | Bacteria | 1967 |
| 812 | Ga0501038_0174750 | 3300049574 | Bacteria | 1736 |
| 813 | Ga0501039_0004281 | 3300049575 | Bacteria | 10759 |
| 814 | Ga0501039_0014667 | 3300049575 | Bacteria | 5995 |
| 815 | Ga0501039_0017205 | 3300049575 | Bacteria | 5545 |
| 816 | Ga0501039_0021995 | 3300049575 | Bacteria | 4893 |
| 817 | Ga0501039_0219304 | 3300049575 | Bacteria | 1495 |
| 818 | Ga0501040_0001045 | 3300049576 | Bacteria | 17510 |
| 819 | Ga0501041_0012339 | 3300049577 | Bacteria | 5062 |
| 820 | Ga0501042_0002602 | 3300049578 | Bacteria | 11093 |
| 821 | Ga0501042_0016301 | 3300049578 | Bacteria | 5100 |
| 822 | Ga0501042_0093193 | 3300049578 | Bacteria | 2163 |
| 823 | Ga0501042_0216865 | 3300049578 | Bacteria | 1380 |
| 824 | Ga0501042_0333062 | 3300049578 | Bacteria | 1097 |
| 825 | Ga0501043_0000814 | 3300049579 | Bacteria | 27743 |
| 826 | Ga0501043_0000867 | 3300049579 | Bacteria | 26805 |
| 827 | Ga0501043_0029105 | 3300049579 | Bacteria | 4338 |
| 828 | Ga0501043_0033018 | 3300049579 | Bacteria | 4070 |
| 829 | Ga0501043_0035627 | 3300049579 | Bacteria | 3914 |
| 830 | Ga0501043_0044064 | 3300049579 | Bacteria | 3507 |
| 831 | Ga0501043_0060168 | 3300049579 | Bacteria | 2981 |
| 832 | Ga0501043_0193409 | 3300049579 | Bacteria | 1581 |
| 833 | Ga0501043_0592663 | 3300049579 | Bacteria | 819 |
| 834 | Ga0501046_0000707 | 3300049580 | Bacteria | 32240 |
| 835 | Ga0501046_0004881 | 3300049580 | Bacteria | 12082 |
| 836 | Ga0501046_0006561 | 3300049580 | Bacteria | 10288 |
| 837 | Ga0501046_0038654 | 3300049580 | Bacteria | 3827 |
| 838 | Ga0501046_0145295 | 3300049580 | Bacteria | 1792 |
| 839 | Ga0501046_0212742 | 3300049580 | Bacteria | 1434 |
| 840 | Ga0501047_0000112 | 3300049581 | Bacteria | 98939 |
| 841 | Ga0501047_0000544 | 3300049581 | Bacteria | 40681 |
| 842 | Ga0501047_0001995 | 3300049581 | Bacteria | 19595 |
| 843 | Ga0501047_0023263 | 3300049581 | Bacteria | 5950 |
| 844 | Ga0501047_0031600 | 3300049581 | Bacteria | 5107 |
| 845 | Ga0501047_0052789 | 3300049581 | Bacteria | 3929 |
| 846 | Ga0501047_0065503 | 3300049581 | Bacteria | 3502 |
| 847 | Ga0501047_0204643 | 3300049581 | Bacteria | 1833 |
| 848 | Ga0501047_0385953 | 3300049581 | Bacteria | 1234 |
| 849 | Ga0501047_0621977 | 3300049581 | Bacteria | 900 |
| 850 | Ga0501048_0002418 | 3300049582 | Bacteria | 14247 |
| 851 | Ga0501048_0010533 | 3300049582 | Bacteria | 6899 |
| 852 | Ga0501048_0015892 | 3300049582 | Bacteria | 5553 |
| 853 | Ga0501048_0144532 | 3300049582 | Bacteria | 1682 |
| 854 | Ga0501048_0227416 | 3300049582 | Bacteria | 1324 |
| 855 | Ga0501067_0001531 | 3300049583 | Bacteria | 12597 |
| 856 | Ga0501067_0228774 | 3300049583 | Bacteria | 1035 |
| 857 | Ga0501067_0313677 | 3300049583 | Bacteria | 873 |
| 858 | Ga0501068_0000652 | 3300049584 | Bacteria | 17789 |
| 859 | Ga0501068_0136793 | 3300049584 | Bacteria | 1534 |
| 860 | Ga0501069_0001987 | 3300049585 | Bacteria | 10227 |
| 861 | Ga0501069_0475695 | 3300049585 | Bacteria | 744 |
| 862 | Ga0501070_0005364 | 3300049586 | Bacteria | 10933 |
| 863 | Ga0501070_0007413 | 3300049586 | Bacteria | 9317 |
| 864 | Ga0501070_0008447 | 3300049586 | Bacteria | 8696 |
| 865 | Ga0501070_0028520 | 3300049586 | Bacteria | 4683 |
| 866 | Ga0501070_0054517 | 3300049586 | Bacteria | 3315 |
| 867 | Ga0501070_0238670 | 3300049586 | Bacteria | 1488 |
| 868 | Ga0501070_0297577 | 3300049586 | Bacteria | 1315 |
| 869 | Ga0501071_0003645 | 3300049587 | Bacteria | 9658 |
| 870 | Ga0501072_0008562 | 3300049588 | Bacteria | 7758 |
| 871 | Ga0501072_0425724 | 3300049588 | Bacteria | 1052 |
| 872 | Ga0501073_0014251 | 3300049589 | Bacteria | 5772 |
| 873 | Ga0501073_0022877 | 3300049589 | Bacteria | 4496 |
| 874 | Ga0501073_0066008 | 3300049589 | Bacteria | 2523 |
| 875 | Ga0501073_0259648 | 3300049589 | Bacteria | 1199 |
| 876 | Ga0501073_0307588 | 3300049589 | Bacteria | 1093 |
| 877 | Ga0501074_0002273 | 3300049590 | Bacteria | 13362 |
| 878 | Ga0501074_0012622 | 3300049590 | Bacteria | 6144 |
| 879 | Ga0501074_0039993 | 3300049590 | Bacteria | 3395 |
| 880 | Ga0501074_0132439 | 3300049590 | Bacteria | 1783 |
| 881 | Ga0501076_0036062 | 3300049592 | Bacteria | 3873 |
| 882 | Ga0501077_0017485 | 3300049593 | Bacteria | 4527 |
| 883 | Ga0501251_047748 | 3300049681 | Bacteria | 669 |
| 884 | Ga0501079_0002562 | 3300049741 | Bacteria | 13200 |
| 885 | Ga0501079_0094040 | 3300049741 | Bacteria | 2323 |
| 886 | Ga0501079_0100791 | 3300049741 | Bacteria | 2239 |
| 887 | Ga0501080_0023738 | 3300049742 | Bacteria | 5682 |
| 888 | Ga0501080_0081705 | 3300049742 | Bacteria | 3001 |
| 889 | Ga0501083_0010392 | 3300049744 | Bacteria | 6553 |
| 890 | Ga0501083_0019557 | 3300049744 | Bacteria | 4716 |
| 891 | Ga0501282_002622 | 3300049778 | Bacteria | 1947 |
| 892 | Ga0501035_0000870 | 3300049822 | Bacteria | 32141 |
| 893 | Ga0501035_0004451 | 3300049822 | Bacteria | 13296 |
| 894 | Ga0501035_0015420 | 3300049822 | Bacteria | 7050 |
| 895 | Ga0501035_0047700 | 3300049822 | Bacteria | 3843 |
| 896 | Ga0501035_0059386 | 3300049822 | Bacteria | 3405 |
| 897 | Ga0501035_0067815 | 3300049822 | Bacteria | 3164 |
| 898 | Ga0501035_0132440 | 3300049822 | Bacteria | 2172 |
| 899 | Ga0501035_0147643 | 3300049822 | Bacteria | 2041 |
| 900 | Ga0501035_0316416 | 3300049822 | Bacteria | 1312 |
| 901 | Ga0501044_0002317 | 3300049823 | Bacteria | 21701 |
| 902 | Ga0501044_0010614 | 3300049823 | Bacteria | 9992 |
| 903 | Ga0501044_0011995 | 3300049823 | Bacteria | 9389 |
| 904 | Ga0501044_0020341 | 3300049823 | Bacteria | 7085 |
| 905 | Ga0501044_0021399 | 3300049823 | Bacteria | 6900 |
| 906 | Ga0501044_0228012 | 3300049823 | Bacteria | 1811 |
| 907 | Ga0501044_0274536 | 3300049823 | Bacteria | 1620 |
| 908 | Ga0501044_0324586 | 3300049823 | Bacteria | 1463 |
| 909 | Ga0501044_0338707 | 3300049823 | Bacteria | 1425 |
| 910 | Ga0501044_0495460 | 3300049823 | Bacteria | 1123 |
| 911 | Ga0501045_0014319 | 3300049824 | Bacteria | 5619 |
| 912 | Ga0501045_0077506 | 3300049824 | Bacteria | 2449 |
| 913 | Ga0501045_0105868 | 3300049824 | Bacteria | 2084 |
| 914 | Ga0501045_0171368 | 3300049824 | Bacteria | 1616 |
| 915 | Ga0501045_0468240 | 3300049824 | Bacteria | 936 |
| 916 | nmdc:mga03n38_269825_c1 | 3300050490 | Bacteria | 905 |
| 917 | nmdc:mga03n38_50584_c1 | 3300050490 | Bacteria | 1853 |
| 918 | nmdc:mga00v17_171753_c1 | 3300050491 | Bacteria | 1398 |
| 919 | nmdc:mga0yw44_668391_c1 | 3300050492 | Bacteria | 706 |
| 920 | nmdc:mga0yw44_739629_c1 | 3300050492 | Bacteria | 668 |
| 921 | nmdc:mga06z11_222551_c1 | 3300050494 | Bacteria | 1103 |
| 922 | nmdc:mga06z11_242299_c1 | 3300050494 | Bacteria | 1059 |
| 923 | nmdc:mga06z11_9099_c1 | 3300050494 | Bacteria | 4173 |
| 924 | nmdc:mga04h51_7954_c1 | 3300050495 | Bacteria | 2821 |
| 925 | nmdc:mga07m45_61521_c1 | 3300050496 | Bacteria | 2127 |
| 926 | nmdc:mga07m45_84894_c1 | 3300050496 | Bacteria | 1810 |
| 927 | nmdc:mga05p37_856356_c1 | 3300050507 | Bacteria | 986 |
| 928 | nmdc:mga09592_220966_c1 | 3300050508 | Bacteria | 1641 |
| 929 | nmdc:mga08y16_1490131_c1 | 3300050511 | Bacteria | 637 |
| 930 | Ga0495601_0019263 | 3300053077 | Bacteria | 4161 |
| 931 | Ga0495601_0024467 | 3300053077 | Bacteria | 3719 |
| 932 | Ga0495601_0062260 | 3300053077 | Bacteria | 2369 |
| 933 | Ga0495612_0000768 | 3300053078 | Bacteria | 13075 |
| 934 | Ga0495612_0005175 | 3300053078 | Bacteria | 5388 |
| 935 | Ga0495612_0063444 | 3300053078 | Bacteria | 1532 |
| 936 | Ga0495655_0018188 | 3300053083 | Bacteria | 1541 |
| 937 | Ga0495595_0006106 | 3300053084 | Bacteria | 4895 |
| 938 | Ga0495619_0113133 | 3300053085 | Bacteria | 1856 |
| 939 | Ga0495619_0416383 | 3300053085 | Bacteria | 927 |
| 940 | Ga0500578_0008090 | 3300053086 | Bacteria | 6887 |
| 941 | Ga0500578_0089502 | 3300053086 | Bacteria | 1954 |
| 942 | Ga0500578_0115495 | 3300053086 | Bacteria | 1690 |
| 943 | Ga0500644_0380410 | 3300053088 | Bacteria | 613 |
| 944 | Ga0500583_0023379 | 3300053092 | Bacteria | 2604 |
| 945 | Ga0500651_0013535 | 3300053093 | Bacteria | 4973 |
| 946 | Ga0500651_0288322 | 3300053093 | Bacteria | 945 |
| 947 | Ga0500566_0086219 | 3300053094 | Bacteria | 1741 |
| 948 | Ga0500566_0145746 | 3300053094 | Bacteria | 1251 |
| 949 | Ga0500640_000199 | 3300053095 | Bacteria | 12879 |
| 950 | Ga0500641_0052684 | 3300053096 | Bacteria | 1677 |
| 951 | Ga0500641_0343873 | 3300053096 | Bacteria | 601 |
| 952 | Ga0500650_0016510 | 3300053098 | Bacteria | 3170 |
| 953 | Ga0500650_0176274 | 3300053098 | Bacteria | 981 |
| 954 | Ga0500654_049480 | 3300053099 | Bacteria | 2281 |
| 955 | Ga0500660_029746 | 3300053100 | Bacteria | 2856 |
| 956 | Ga0500553_091291 | 3300053101 | Bacteria | 1339 |
| 957 | Ga0500560_002560 | 3300053107 | Bacteria | 3501 |
| 958 | Ga0500560_034312 | 3300053107 | Bacteria | 1555 |
| 959 | Ga0500562_106921 | 3300053108 | Bacteria | 762 |
| 960 | Ga0500569_000546 | 3300053109 | Bacteria | 6301 |
| 961 | Ga0500569_007858 | 3300053109 | Bacteria | 2415 |
| 962 | Ga0500591_141766 | 3300053115 | Bacteria | 947 |
| 963 | Ga0500594_0006500 | 3300053118 | Bacteria | 2629 |
| 964 | Ga0500594_0017387 | 3300053118 | Bacteria | 1761 |
| 965 | Ga0500628_002653 | 3300053129 | Bacteria | 2950 |
| 966 | Ga0500628_056958 | 3300053129 | Bacteria | 944 |
| 967 | Ga0500652_000612 | 3300053131 | Bacteria | 12304 |
| 968 | Ga0500652_025122 | 3300053131 | Bacteria | 2279 |
| 969 | Ga0500658_0003635 | 3300053134 | Bacteria | 5819 |
| 970 | Ga0500561_0000617 | 3300053137 | Bacteria | 5682 |
| 971 | Ga0500573_0033390 | 3300053140 | Bacteria | 2970 |
| 972 | Ga0500573_0096693 | 3300053140 | Bacteria | 1664 |
| 973 | Ga0500573_0203833 | 3300053140 | Bacteria | 1048 |
| 974 | Ga0500577_0092516 | 3300053142 | Bacteria | 1224 |
| 975 | Ga0500579_028293 | 3300053143 | Bacteria | 3606 |
| 976 | Ga0500588_0010244 | 3300053146 | Bacteria | 2257 |
| 977 | Ga0500600_0003949 | 3300053149 | Bacteria | 8643 |
| 978 | Ga0500600_0048636 | 3300053149 | Bacteria | 2414 |
| 979 | Ga0500600_0126663 | 3300053149 | Bacteria | 1307 |
| 980 | Ga0500620_020076 | 3300053155 | Bacteria | 1976 |
| 981 | Ga0500624_041737 | 3300053157 | Bacteria | 826 |
| 982 | Ga0500633_0000470 | 3300053160 | Bacteria | 6396 |
| 983 | Ga0500634_0010585 | 3300053161 | Bacteria | 4717 |
| 984 | Ga0500656_000324 | 3300053732 | Bacteria | 3371 |
| 985 | Ga0500587_002977 | 3300053739 | Bacteria | 2397 |
| 986 | Ga0501084_0001814 | 3300054114 | Bacteria | 17044 |
| 987 | Ga0587082_094927 | 3300059504 | Bacteria | 642 |
| 988 | Ga0587083_0034247 | 3300059505 | Bacteria | 1029 |
| 989 | Ga0587101_074392 | 3300059623 | Bacteria | 632 |
| 990 | Ga0587072_072482 | 3300059643 | Bacteria | 730 |
| 991 | Ga0587107_056688 | 3300059652 | Bacteria | 680 |
| 992 | Ga0587071_102484 | 3300060344 | Bacteria | 664 |
| 993 | Ga0587111_0043853 | 3300060346 | Bacteria | 964 |
| 994 | Ga0501082_0009754 | 3300060353 | Bacteria | 8272 |
| 995 | Ga0501082_0009930 | 3300060353 | Bacteria | 8207 |
| 996 | Ga0466962_0001065 | 3300061719 | Bacteria | 12616 |
| 997 | Ga0466962_0059802 | 3300061719 | Bacteria | 1819 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100238153 | Ga0070708_1002381532 | 175 |
| 2 | 3300025910 | Ga0207684_10540319 | Ga0207684_105403192 | 175 |
| 3 | 3300005467 | Ga0070706_100022401 | Ga0070706_1000224015 | 176 |
| 4 | 3300005471 | Ga0070698_100000073 | Ga0070698_10000007360 | 176 |
| 5 | 3300006028 | Ga0070717_10006986 | Ga0070717_100069869 | 176 |
| 6 | 3300025910 | Ga0207684_10040407 | Ga0207684_100404075 | 176 |
| 7 | 3300039453 | Ga0436362_1118715 | Ga0436362_1118715_753_1313 | 176 |
| 8 | 3300005468 | Ga0070707_100096257 | Ga0070707_1000962572 | 179 |
| 9 | 3300006914 | Ga0075436_100009981 | Ga0075436_1000099815 | 179 |
| 10 | 3300025922 | Ga0207646_10015555 | Ga0207646_100155552 | 179 |
| 11 | 3300025939 | Ga0207665_10292424 | Ga0207665_102924242 | 179 |
| 12 | 3300035112 | Ga0373932_0036450 | Ga0373932_0036450_698_1264 | 179 |
| 13 | 3300044656 | Ga0466969_0391709 | Ga0466969_0391709_45_599 | 179 |
| 14 | 3300044842 | Ga0466957_0770045 | Ga0466957_0770045_105_659 | 179 |
| 15 | 3300059623 | Ga0587101_074392 | Ga0587101_074392_21_581 | 179 |
| 16 | 3300005467 | Ga0070706_100028028 | Ga0070706_1000280283 | 180 |
| 17 | 3300010375 | Ga0105239_10227329 | Ga0105239_102273293 | 180 |
| 18 | 3300025910 | Ga0207684_10052520 | Ga0207684_100525204 | 180 |
| 19 | 3300046684 | Ga0495669_0016530 | Ga0495669_0016530_495_1076 | 180 |
| 20 | 3300005341 | Ga0070691_10223067 | Ga0070691_102230672 | 181 |
| 21 | 3300005354 | Ga0070675_100252848 | Ga0070675_1002528482 | 181 |
| 22 | 3300005355 | Ga0070671_100593449 | Ga0070671_1005934492 | 181 |
| 23 | 3300005435 | Ga0070714_100005638 | Ga0070714_1000056383 | 181 |
| 24 | 3300005435 | Ga0070714_100259945 | Ga0070714_1002599452 | 181 |
| 25 | 3300005436 | Ga0070713_100082501 | Ga0070713_1000825012 | 181 |
| 26 | 3300005437 | Ga0070710_10064545 | Ga0070710_100645453 | 181 |
| 27 | 3300005439 | Ga0070711_100285287 | Ga0070711_1002852872 | 181 |
| 28 | 3300005445 | Ga0070708_100079381 | Ga0070708_1000793813 | 181 |
| 29 | 3300005445 | Ga0070708_100371712 | Ga0070708_1003717122 | 181 |
| 30 | 3300005445 | Ga0070708_100389335 | Ga0070708_1003893351 | 181 |
| 31 | 3300005466 | Ga0070685_10070335 | Ga0070685_100703352 | 181 |
| 32 | 3300005467 | Ga0070706_100021841 | Ga0070706_1000218413 | 181 |
| 33 | 3300005468 | Ga0070707_100060119 | Ga0070707_1000601193 | 181 |
| 34 | 3300005468 | Ga0070707_100085925 | Ga0070707_1000859252 | 181 |
| 35 | 3300005468 | Ga0070707_100092350 | Ga0070707_1000923502 | 181 |
| 36 | 3300005471 | Ga0070698_100007866 | Ga0070698_1000078664 | 181 |
| 37 | 3300005471 | Ga0070698_100240442 | Ga0070698_1002404422 | 181 |
| 38 | 3300005471 | Ga0070698_100288985 | Ga0070698_1002889852 | 181 |
| 39 | 3300005530 | Ga0070679_100234828 | Ga0070679_1002348283 | 181 |
| 40 | 3300005535 | Ga0070684_100129401 | Ga0070684_1001294012 | 181 |
| 41 | 3300005536 | Ga0070697_100068869 | Ga0070697_1000688692 | 181 |
| 42 | 3300005548 | Ga0070665_100127648 | Ga0070665_1001276483 | 181 |
| 43 | 3300005577 | Ga0068857_100081703 | Ga0068857_1000817032 | 181 |
| 44 | 3300005618 | Ga0068864_100117330 | Ga0068864_1001173303 | 181 |
| 45 | 3300005841 | Ga0068863_100107785 | Ga0068863_1001077853 | 181 |
| 46 | 3300005843 | Ga0068860_100109475 | Ga0068860_1001094753 | 181 |
| 47 | 3300005844 | Ga0068862_100245460 | Ga0068862_1002454602 | 181 |
| 48 | 3300005937 | Ga0081455_10044055 | Ga0081455_100440554 | 181 |
| 49 | 3300005983 | Ga0081540_1057177 | Ga0081540_10571772 | 181 |
| 50 | 3300005985 | Ga0081539_10003492 | Ga0081539_1000349214 | 181 |
| 51 | 3300005985 | Ga0081539_10004406 | Ga0081539_100044066 | 181 |
| 52 | 3300005985 | Ga0081539_10010250 | Ga0081539_100102503 | 181 |
| 53 | 3300006173 | Ga0070716_100065567 | Ga0070716_1000655673 | 181 |
| 54 | 3300006237 | Ga0097621_100143458 | Ga0097621_1001434582 | 181 |
| 55 | 3300006871 | Ga0075434_100229942 | Ga0075434_1002299422 | 181 |
| 56 | 3300006914 | Ga0075436_100549664 | Ga0075436_1005496642 | 181 |
| 57 | 3300007076 | Ga0075435_100351775 | Ga0075435_1003517751 | 181 |
| 58 | 3300009098 | Ga0105245_10261800 | Ga0105245_102618002 | 181 |
| 59 | 3300009174 | Ga0105241_10077421 | Ga0105241_100774212 | 181 |
| 60 | 3300009177 | Ga0105248_10075304 | Ga0105248_100753042 | 181 |
| 61 | 3300009545 | Ga0105237_10227257 | Ga0105237_102272573 | 181 |
| 62 | 3300010375 | Ga0105239_10032749 | Ga0105239_100327493 | 181 |
| 63 | 3300013296 | Ga0157374_10175319 | Ga0157374_101753193 | 181 |
| 64 | 3300013306 | Ga0163162_10194077 | Ga0163162_101940773 | 181 |
| 65 | 3300013307 | Ga0157372_10535298 | Ga0157372_105352983 | 181 |
| 66 | 3300014325 | Ga0163163_10013354 | Ga0163163_100133547 | 181 |
| 67 | 3300014325 | Ga0163163_10525102 | Ga0163163_105251022 | 181 |
| 68 | 3300014968 | Ga0157379_10471539 | Ga0157379_104715392 | 181 |
| 69 | 3300014969 | Ga0157376_10003944 | Ga0157376_100039443 | 181 |
| 70 | 3300014969 | Ga0157376_10150356 | Ga0157376_101503562 | 181 |
| 71 | 3300020080 | Ga0206350_11072649 | Ga0206350_110726493 | 181 |
| 72 | 3300022467 | Ga0224712_10000465 | Ga0224712_100004656 | 181 |
| 73 | 3300022467 | Ga0224712_10003509 | Ga0224712_100035093 | 181 |
| 74 | 3300022467 | Ga0224712_10157609 | Ga0224712_101576092 | 181 |
| 75 | 3300025898 | Ga0207692_10002379 | Ga0207692_100023795 | 181 |
| 76 | 3300025898 | Ga0207692_10195304 | Ga0207692_101953042 | 181 |
| 77 | 3300025903 | Ga0207680_10131885 | Ga0207680_101318852 | 181 |
| 78 | 3300025905 | Ga0207685_10048624 | Ga0207685_100486243 | 181 |
| 79 | 3300025906 | Ga0207699_10002064 | Ga0207699_100020648 | 181 |
| 80 | 3300025906 | Ga0207699_10014455 | Ga0207699_100144552 | 181 |
| 81 | 3300025910 | Ga0207684_10074704 | Ga0207684_100747043 | 181 |
| 82 | 3300025914 | Ga0207671_10495799 | Ga0207671_104957992 | 181 |
| 83 | 3300025916 | Ga0207663_10001812 | Ga0207663_100018128 | 181 |
| 84 | 3300025916 | Ga0207663_10144374 | Ga0207663_101443742 | 181 |
| 85 | 3300025922 | Ga0207646_10028005 | Ga0207646_100280053 | 181 |
| 86 | 3300025922 | Ga0207646_10087778 | Ga0207646_100877783 | 181 |
| 87 | 3300025922 | Ga0207646_10110238 | Ga0207646_101102383 | 181 |
| 88 | 3300025922 | Ga0207646_10288670 | Ga0207646_102886702 | 181 |
| 89 | 3300025926 | Ga0207659_10833060 | Ga0207659_108330601 | 181 |
| 90 | 3300025927 | Ga0207687_10122885 | Ga0207687_101228852 | 181 |
| 91 | 3300025928 | Ga0207700_10008575 | Ga0207700_100085755 | 181 |
| 92 | 3300025928 | Ga0207700_10014777 | Ga0207700_100147775 | 181 |
| 93 | 3300025928 | Ga0207700_10260657 | Ga0207700_102606572 | 181 |
| 94 | 3300025929 | Ga0207664_10000341 | Ga0207664_1000034127 | 181 |
| 95 | 3300025929 | Ga0207664_10031264 | Ga0207664_100312643 | 181 |
| 96 | 3300025929 | Ga0207664_10296281 | Ga0207664_102962812 | 181 |
| 97 | 3300025939 | Ga0207665_10002727 | Ga0207665_1000272711 | 181 |
| 98 | 3300025939 | Ga0207665_10019025 | Ga0207665_100190253 | 181 |
| 99 | 3300025939 | Ga0207665_10090596 | Ga0207665_100905963 | 181 |
| 100 | 3300025941 | Ga0207711_10097161 | Ga0207711_100971613 | 181 |
| 101 | 3300025941 | Ga0207711_10167793 | Ga0207711_101677932 | 181 |
| 102 | 3300025945 | Ga0207679_10118739 | Ga0207679_101187392 | 181 |
| 103 | 3300025945 | Ga0207679_10707649 | Ga0207679_107076492 | 181 |
| 104 | 3300025949 | Ga0207667_10354176 | Ga0207667_103541763 | 181 |
| 105 | 3300025972 | Ga0207668_10003383 | Ga0207668_100033836 | 181 |
| 106 | 3300026023 | Ga0207677_10035072 | Ga0207677_100350724 | 181 |
| 107 | 3300026035 | Ga0207703_10014834 | Ga0207703_100148343 | 181 |
| 108 | 3300026041 | Ga0207639_10228406 | Ga0207639_102284063 | 181 |
| 109 | 3300026078 | Ga0207702_10185703 | Ga0207702_101857033 | 181 |
| 110 | 3300028380 | Ga0268265_10057465 | Ga0268265_100574653 | 181 |
| 111 | 3300028666 | Ga0265336_10002275 | Ga0265336_100022753 | 181 |
| 112 | 3300028786 | Ga0307517_10086569 | Ga0307517_100865693 | 181 |
| 113 | 3300028786 | Ga0307517_10213521 | Ga0307517_102135212 | 181 |
| 114 | 3300028794 | Ga0307515_10000038 | Ga0307515_10000038133 | 181 |
| 115 | 3300028794 | Ga0307515_10033888 | Ga0307515_100338885 | 181 |
| 116 | 3300028794 | Ga0307515_10086084 | Ga0307515_100860844 | 181 |
| 117 | 3300028800 | Ga0265338_10001380 | Ga0265338_100013809 | 181 |
| 118 | 3300030522 | Ga0307512_10006290 | Ga0307512_1000629010 | 181 |
| 119 | 3300031456 | Ga0307513_10007971 | Ga0307513_100079717 | 181 |
| 120 | 3300031507 | Ga0307509_10015278 | Ga0307509_100152783 | 181 |
| 121 | 3300031548 | Ga0307408_100017582 | Ga0307408_1000175823 | 181 |
| 122 | 3300031616 | Ga0307508_10000506 | Ga0307508_1000050637 | 181 |
| 123 | 3300031616 | Ga0307508_10030734 | Ga0307508_100307343 | 181 |
| 124 | 3300031616 | Ga0307508_10201044 | Ga0307508_102010442 | 181 |
| 125 | 3300031730 | Ga0307516_10002871 | Ga0307516_100028718 | 181 |
| 126 | 3300031730 | Ga0307516_10017451 | Ga0307516_100174512 | 181 |
| 127 | 3300031730 | Ga0307516_10021308 | Ga0307516_100213083 | 181 |
| 128 | 3300031730 | Ga0307516_10641736 | Ga0307516_106417361 | 181 |
| 129 | 3300031731 | Ga0307405_10041322 | Ga0307405_100413223 | 181 |
| 130 | 3300031731 | Ga0307405_10106693 | Ga0307405_101066932 | 181 |
| 131 | 3300031731 | Ga0307405_10161691 | Ga0307405_101616914 | 181 |
| 132 | 3300031824 | Ga0307413_10072273 | Ga0307413_100722733 | 181 |
| 133 | 3300031824 | Ga0307413_10318605 | Ga0307413_103186052 | 181 |
| 134 | 3300031852 | Ga0307410_10015291 | Ga0307410_100152915 | 181 |
| 135 | 3300031889 | Ga0326468_10000710 | Ga0326468_100007103 | 181 |
| 136 | 3300031901 | Ga0307406_10004254 | Ga0307406_100042546 | 181 |
| 137 | 3300031901 | Ga0307406_10060114 | Ga0307406_100601143 | 181 |
| 138 | 3300031903 | Ga0307407_10003337 | Ga0307407_100033374 | 181 |
| 139 | 3300031995 | Ga0307409_100000406 | Ga0307409_1000004065 | 181 |
| 140 | 3300031995 | Ga0307409_100025042 | Ga0307409_1000250425 | 181 |
| 141 | 3300031995 | Ga0307409_100342503 | Ga0307409_1003425032 | 181 |
| 142 | 3300032002 | Ga0307416_100005536 | Ga0307416_1000055365 | 181 |
| 143 | 3300032126 | Ga0307415_100000422 | Ga0307415_1000004228 | 181 |
| 144 | 3300032126 | Ga0307415_100049687 | Ga0307415_1000496874 | 181 |
| 145 | 3300032126 | Ga0307415_100129203 | Ga0307415_1001292032 | 181 |
| 146 | 3300032126 | Ga0307415_100393824 | Ga0307415_1003938242 | 181 |
| 147 | 3300033179 | Ga0307507_10107969 | Ga0307507_101079693 | 181 |
| 148 | 3300035083 | Ga0373926_0015043 | Ga0373926_0015043_1017_1583 | 181 |
| 149 | 3300035083 | Ga0373926_0144764 | Ga0373926_0144764_247_807 | 181 |
| 150 | 3300035086 | Ga0373934_0000145 | Ga0373934_0000145_417_1028 | 181 |
| 151 | 3300035086 | Ga0373934_0055947 | Ga0373934_0055947_925_1491 | 181 |
| 152 | 3300035089 | Ga0373944_0018737 | Ga0373944_0018737_427_993 | 181 |
| 153 | 3300035090 | Ga0373949_0139700 | Ga0373949_0139700_38_604 | 181 |
| 154 | 3300035091 | Ga0373951_0000115 | Ga0373951_0000115_12993_13664 | 181 |
| 155 | 3300035111 | Ga0373923_0036634 | Ga0373923_0036634_1363_1929 | 181 |
| 156 | 3300035112 | Ga0373932_0046447 | Ga0373932_0046447_186_857 | 181 |
| 157 | 3300035117 | Ga0373953_0000082 | Ga0373953_0000082_242_853 | 181 |
| 158 | 3300035119 | Ga0373956_0025341 | Ga0373956_0025341_565_1131 | 181 |
| 159 | 3300035120 | Ga0373957_0000047 | Ga0373957_0000047_385_996 | 181 |
| 160 | 3300035120 | Ga0373957_0003440 | Ga0373957_0003440_2347_2913 | 181 |
| 161 | 3300035172 | Ga0373955_0000020 | Ga0373955_0000020_24042_24653 | 181 |
| 162 | 3300035172 | Ga0373955_0029205 | Ga0373955_0029205_1270_1836 | 181 |
| 163 | 3300035207 | Ga0373942_0000196 | Ga0373942_0000196_2850_3521 | 181 |
| 164 | 3300035410 | Ga0373924_0001863 | Ga0373924_0001863_3131_3742 | 181 |
| 165 | 3300035410 | Ga0373924_0054868 | Ga0373924_0054868_952_1518 | 181 |
| 166 | 3300035691 | Ga0373931_0067227 | Ga0373931_0067227_142_708 | 181 |
| 167 | 3300035692 | Ga0373935_0001783 | Ga0373935_0001783_3367_3927 | 181 |
| 168 | 3300035692 | Ga0373935_0231311 | Ga0373935_0231311_600_1193 | 181 |
| 169 | 3300035724 | Ga0373933_0000192 | Ga0373933_0000192_4549_5160 | 181 |
| 170 | 3300035725 | Ga0373947_0000009 | Ga0373947_0000009_133361_133921 | 181 |
| 171 | 3300036401 | Ga0373937_0000067 | Ga0373937_0000067_58679_59290 | 181 |
| 172 | 3300036401 | Ga0373937_0079660 | Ga0373937_0079660_1599_2165 | 181 |
| 173 | 3300037418 | Ga0395900_0080690 | Ga0395900_0080690_2060_2728 | 181 |
| 174 | 3300037466 | Ga0395898_0035335 | Ga0395898_0035335_422_1090 | 181 |
| 175 | 3300037471 | Ga0395905_0082226 | Ga0395905_0082226_455_1123 | 181 |
| 176 | 3300038443 | Ga0395901_0003772 | Ga0395901_0003772_12725_13393 | 181 |
| 177 | 3300042118 | Ga0450914_010590 | Ga0450914_010590_102_773 | 181 |
| 178 | 3300044694 | Ga0466963_0177807 | Ga0466963_0177807_774_1340 | 181 |
| 179 | 3300046454 | Ga0495592_0000069 | Ga0495592_0000069_34999_35610 | 181 |
| 180 | 3300046454 | Ga0495592_0113597 | Ga0495592_0113597_636_1202 | 181 |
| 181 | 3300046455 | Ga0495603_0125423 | Ga0495603_0125423_681_1247 | 181 |
| 182 | 3300046459 | Ga0495629_0245836 | Ga0495629_0245836_568_1134 | 181 |
| 183 | 3300046461 | Ga0495641_0056976 | Ga0495641_0056976_222_788 | 181 |
| 184 | 3300046462 | Ga0495651_0000016 | Ga0495651_0000016_58695_59306 | 181 |
| 185 | 3300046462 | Ga0495651_0024622 | Ga0495651_0024622_3185_3751 | 181 |
| 186 | 3300046463 | Ga0495653_0000381 | Ga0495653_0000381_9443_10054 | 181 |
| 187 | 3300046463 | Ga0495653_0022314 | Ga0495653_0022314_1488_2054 | 181 |
| 188 | 3300046472 | Ga0495580_0105648 | Ga0495580_0105648_1313_1879 | 181 |
| 189 | 3300046473 | Ga0495582_0287040 | Ga0495582_0287040_59_625 | 181 |
| 190 | 3300046476 | Ga0495662_0062385 | Ga0495662_0062385_548_1114 | 181 |
| 191 | 3300046477 | Ga0495664_0047922 | Ga0495664_0047922_1440_2006 | 181 |
| 192 | 3300046511 | Ga0495608_0000051 | Ga0495608_0000051_35414_36025 | 181 |
| 193 | 3300046514 | Ga0495618_0071355 | Ga0495618_0071355_1572_2138 | 181 |
| 194 | 3300046516 | Ga0495628_0000126 | Ga0495628_0000126_58695_59306 | 181 |
| 195 | 3300046516 | Ga0495628_0232483 | Ga0495628_0232483_351_917 | 181 |
| 196 | 3300046517 | Ga0495630_0083686 | Ga0495630_0083686_967_1554 | 181 |
| 197 | 3300046517 | Ga0495630_0222633 | Ga0495630_0222633_294_860 | 181 |
| 198 | 3300046526 | Ga0495666_0071248 | Ga0495666_0071248_136_702 | 181 |
| 199 | 3300046529 | Ga0495652_0000831 | Ga0495652_0000831_13566_14177 | 181 |
| 200 | 3300046529 | Ga0495652_0018073 | Ga0495652_0018073_5122_5688 | 181 |
| 201 | 3300046531 | Ga0495665_0007973 | Ga0495665_0007973_899_1465 | 181 |
| 202 | 3300046533 | Ga0495640_0032738 | Ga0495640_0032738_2605_3171 | 181 |
| 203 | 3300046535 | Ga0495586_0186455 | Ga0495586_0186455_571_1137 | 181 |
| 204 | 3300046536 | Ga0495587_0000058 | Ga0495587_0000058_58695_59306 | 181 |
| 205 | 3300046536 | Ga0495587_0000907 | Ga0495587_0000907_7362_7928 | 181 |
| 206 | 3300046559 | Ga0495667_0000062 | Ga0495667_0000062_35002_35613 | 181 |
| 207 | 3300046559 | Ga0495667_0073354 | Ga0495667_0073354_712_1278 | 181 |
| 208 | 3300046642 | Ga0495634_0085861 | Ga0495634_0085861_773_1339 | 181 |
| 209 | 3300046663 | Ga0495635_0138722 | Ga0495635_0138722_414_980 | 181 |
| 210 | 3300046674 | Ga0495588_0044870 | Ga0495588_0044870_942_1508 | 181 |
| 211 | 3300046675 | Ga0495657_0000065 | Ga0495657_0000065_58695_59306 | 181 |
| 212 | 3300046675 | Ga0495657_0085383 | Ga0495657_0085383_453_1019 | 181 |
| 213 | 3300046678 | Ga0495599_0000045 | Ga0495599_0000045_37259_37870 | 181 |
| 214 | 3300046678 | Ga0495599_0043568 | Ga0495599_0043568_1085_1651 | 181 |
| 215 | 3300046679 | Ga0495623_0000051 | Ga0495623_0000051_37390_38001 | 181 |
| 216 | 3300046679 | Ga0495623_0026038 | Ga0495623_0026038_812_1378 | 181 |
| 217 | 3300046680 | Ga0495646_0006164 | Ga0495646_0006164_239_850 | 181 |
| 218 | 3300046680 | Ga0495646_0036344 | Ga0495646_0036344_1166_1732 | 181 |
| 219 | 3300046689 | Ga0495613_0052882 | Ga0495613_0052882_353_919 | 181 |
| 220 | 3300046690 | Ga0495624_0058266 | Ga0495624_0058266_574_1140 | 181 |
| 221 | 3300046694 | Ga0495649_0220882 | Ga0495649_0220882_248_919 | 181 |
| 222 | 3300046809 | Ga0495600_0005303 | Ga0495600_0005303_2832_3443 | 181 |
| 223 | 3300046809 | Ga0495600_0005439 | Ga0495600_0005439_4194_4760 | 181 |
| 224 | 3300047317 | Ga0495604_0000233 | Ga0495604_0000233_12526_13137 | 181 |
| 225 | 3300047319 | Ga0495674_0215164 | Ga0495674_0215164_931_1497 | 181 |
| 226 | 3300047321 | Ga0495676_0066809 | Ga0495676_0066809_129_695 | 181 |
| 227 | 3300047321 | Ga0495676_0101081 | Ga0495676_0101081_1305_1859 | 181 |
| 228 | 3300047322 | Ga0495680_0000678 | Ga0495680_0000678_2437_3048 | 181 |
| 229 | 3300047322 | Ga0495680_0044111 | Ga0495680_0044111_1200_1766 | 181 |
| 230 | 3300047444 | Ga0495675_0000325 | Ga0495675_0000325_19758_20369 | 181 |
| 231 | 3300047444 | Ga0495675_0077417 | Ga0495675_0077417_985_1551 | 181 |
| 232 | 3300047471 | Ga0495684_0065573 | Ga0495684_0065573_1127_1693 | 181 |
| 233 | 3300048088 | Ga0495602_0000079 | Ga0495602_0000079_58695_59306 | 181 |
| 234 | 3300048088 | Ga0495602_0168435 | Ga0495602_0168435_339_905 | 181 |
| 235 | 3300048905 | Ga0496102_0119267 | Ga0496102_0119267_1232_1798 | 181 |
| 236 | 3300048907 | Ga0496104_0009222 | Ga0496104_0009222_742_1308 | 181 |
| 237 | 3300048908 | Ga0496105_0012096 | Ga0496105_0012096_5889_6455 | 181 |
| 238 | 3300048911 | Ga0496108_0000959 | Ga0496108_0000959_3067_3633 | 181 |
| 239 | 3300048913 | Ga0496110_0180538 | Ga0496110_0180538_1039_1605 | 181 |
| 240 | 3300048914 | Ga0496111_0185530 | Ga0496111_0185530_864_1430 | 181 |
| 241 | 3300048915 | Ga0496112_0364853 | Ga0496112_0364853_376_942 | 181 |
| 242 | 3300048918 | Ga0496115_0413098 | Ga0496115_0413098_127_720 | 181 |
| 243 | 3300049571 | Ga0501034_0263121 | Ga0501034_0263121_714_1274 | 181 |
| 244 | 3300049572 | Ga0501036_0003653 | Ga0501036_0003653_7308_7868 | 181 |
| 245 | 3300049574 | Ga0501038_0006803 | Ga0501038_0006803_829_1389 | 181 |
| 246 | 3300049574 | Ga0501038_0141596 | Ga0501038_0141596_1303_1863 | 181 |
| 247 | 3300049578 | Ga0501042_0016301 | Ga0501042_0016301_1241_1801 | 181 |
| 248 | 3300049579 | Ga0501043_0000814 | Ga0501043_0000814_21243_21803 | 181 |
| 249 | 3300049581 | Ga0501047_0001995 | Ga0501047_0001995_15634_16194 | 181 |
| 250 | 3300049582 | Ga0501048_0015892 | Ga0501048_0015892_1152_1712 | 181 |
| 251 | 3300049590 | Ga0501074_0012622 | Ga0501074_0012622_3171_3731 | 181 |
| 252 | 3300049823 | Ga0501044_0021399 | Ga0501044_0021399_2161_2721 | 181 |
| 253 | 3300049824 | Ga0501045_0468240 | Ga0501045_0468240_19_579 | 181 |
| 254 | 3300050507 | nmdc:mga05p37_856356_c1 | nmdc:mga05p37_856356_c1_290_961 | 181 |
| 255 | 3300053077 | Ga0495601_0062260 | Ga0495601_0062260_773_1339 | 181 |
| 256 | 3300053078 | Ga0495612_0063444 | Ga0495612_0063444_820_1386 | 181 |
| 257 | 3300053084 | Ga0495595_0006106 | Ga0495595_0006106_3830_4441 | 181 |
| 258 | 3300053086 | Ga0500578_0089502 | Ga0500578_0089502_312_980 | 181 |
| 259 | 3300053093 | Ga0500651_0013535 | Ga0500651_0013535_1951_2619 | 181 |
| 260 | 3300053096 | Ga0500641_0052684 | Ga0500641_0052684_682_1350 | 181 |
| 261 | 3300053098 | Ga0500650_0016510 | Ga0500650_0016510_477_1145 | 181 |
| 262 | 3300053108 | Ga0500562_106921 | Ga0500562_106921_67_735 | 181 |
| 263 | 3300053109 | Ga0500569_007858 | Ga0500569_007858_1011_1679 | 181 |
| 264 | 3300053118 | Ga0500594_0006500 | Ga0500594_0006500_649_1317 | 181 |
| 265 | 3300053131 | Ga0500652_025122 | Ga0500652_025122_482_1150 | 181 |
| 266 | 3300053142 | Ga0500577_0092516 | Ga0500577_0092516_77_748 | 181 |
| 267 | 3300053149 | Ga0500600_0048636 | Ga0500600_0048636_1181_1852 | 181 |
| 268 | 3300060346 | Ga0587111_0043853 | Ga0587111_0043853_352_918 | 181 |
| 269 | 3300006038 | Ga0075365_10174846 | Ga0075365_101748463 | 182 |
| 270 | 3300009093 | Ga0105240_10645361 | Ga0105240_106453612 | 182 |
| 271 | 3300036458 | Ga0310112_023850 | Ga0310112_023850_14_583 | 182 |
| 272 | 3300041456 | Ga0451795_0216371 | Ga0451795_0216371_311_865 | 182 |
| 273 | 3300044684 | Ga0466966_0005406 | Ga0466966_0005406_5049_5603 | 182 |
| 274 | 3300044693 | Ga0466961_0005647 | Ga0466961_0005647_3479_4033 | 182 |
| 275 | 3300044719 | Ga0466971_0074212 | Ga0466971_0074212_963_1517 | 182 |
| 276 | 3300045836 | Ga0466958_0027371 | Ga0466958_0027371_1324_1878 | 182 |
| 277 | 3300050492 | nmdc:mga0yw44_668391_c1 | nmdc:mga0yw44_668391_c1_75_629 | 182 |
| 278 | 3300050492 | nmdc:mga0yw44_739629_c1 | nmdc:mga0yw44_739629_c1_76_630 | 182 |
| 279 | 3300059643 | Ga0587072_072482 | Ga0587072_072482_94_663 | 182 |
| 280 | 3300050511 | nmdc:mga08y16_1490131_c1 | nmdc:mga08y16_1490131_c1_37_597 | 183 |
| 281 | 3300001989 | JGI24739J22299_10017517 | JGI24739J22299_100175172 | 184 |
| 282 | 3300001990 | JGI24737J22298_10005199 | JGI24737J22298_100051993 | 184 |
| 283 | 3300002067 | JGI24735J21928_10027305 | JGI24735J21928_100273052 | 184 |
| 284 | 3300003203 | JGI25406J46586_10095938 | JGI25406J46586_100959382 | 184 |
| 285 | 3300003354 | JGI25160J50197_1007524 | JGI25160J50197_10075242 | 184 |
| 286 | 3300003354 | JGI25160J50197_1027486 | JGI25160J50197_10274862 | 184 |
| 287 | 3300003578 | Ga0006562J51391_1028667 | Ga0006562J51391_10286672 | 184 |
| 288 | 3300005327 | Ga0070658_10092336 | Ga0070658_100923363 | 184 |
| 289 | 3300005329 | Ga0070683_100156880 | Ga0070683_1001568802 | 184 |
| 290 | 3300005329 | Ga0070683_101336697 | Ga0070683_1013366971 | 184 |
| 291 | 3300005334 | Ga0068869_100160319 | Ga0068869_1001603191 | 184 |
| 292 | 3300005338 | Ga0068868_100317088 | Ga0068868_1003170882 | 184 |
| 293 | 3300005458 | Ga0070681_10257637 | Ga0070681_102576372 | 184 |
| 294 | 3300005466 | Ga0070685_10476889 | Ga0070685_104768891 | 184 |
| 295 | 3300005471 | Ga0070698_100268482 | Ga0070698_1002684822 | 184 |
| 296 | 3300005530 | Ga0070679_100078515 | Ga0070679_1000785153 | 184 |
| 297 | 3300005535 | Ga0070684_100318038 | Ga0070684_1003180382 | 184 |
| 298 | 3300005539 | Ga0068853_100049777 | Ga0068853_1000497772 | 184 |
| 299 | 3300005547 | Ga0070693_100098803 | Ga0070693_1000988033 | 184 |
| 300 | 3300005548 | Ga0070665_100040161 | Ga0070665_1000401612 | 184 |
| 301 | 3300005563 | Ga0068855_100063115 | Ga0068855_1000631152 | 184 |
| 302 | 3300005578 | Ga0068854_100050967 | Ga0068854_1000509672 | 184 |
| 303 | 3300005578 | Ga0068854_100694586 | Ga0068854_1006945862 | 184 |
| 304 | 3300005614 | Ga0068856_100022041 | Ga0068856_1000220412 | 184 |
| 305 | 3300005614 | Ga0068856_100065456 | Ga0068856_1000654563 | 184 |
| 306 | 3300005616 | Ga0068852_100029725 | Ga0068852_1000297255 | 184 |
| 307 | 3300005616 | Ga0068852_100471772 | Ga0068852_1004717722 | 184 |
| 308 | 3300005618 | Ga0068864_100684381 | Ga0068864_1006843812 | 184 |
| 309 | 3300005870 | Ga0058723_100038 | Ga0058723_1000381 | 184 |
| 310 | 3300005937 | Ga0081455_10009867 | Ga0081455_100098676 | 184 |
| 311 | 3300005983 | Ga0081540_1003156 | Ga0081540_100315610 | 184 |
| 312 | 3300005985 | Ga0081539_10023002 | Ga0081539_100230023 | 184 |
| 313 | 3300005985 | Ga0081539_10067109 | Ga0081539_100671092 | 184 |
| 314 | 3300006042 | Ga0075368_10005635 | Ga0075368_100056352 | 184 |
| 315 | 3300006042 | Ga0075368_10147976 | Ga0075368_101479761 | 184 |
| 316 | 3300006048 | Ga0075363_100041969 | Ga0075363_1000419693 | 184 |
| 317 | 3300006178 | Ga0075367_10027504 | Ga0075367_100275044 | 184 |
| 318 | 3300006178 | Ga0075367_10087241 | Ga0075367_100872413 | 184 |
| 319 | 3300006353 | Ga0075370_10011734 | Ga0075370_100117344 | 184 |
| 320 | 3300006353 | Ga0075370_10148971 | Ga0075370_101489713 | 184 |
| 321 | 3300006353 | Ga0075370_10320096 | Ga0075370_103200961 | 184 |
| 322 | 3300006846 | Ga0075430_100189014 | Ga0075430_1001890142 | 184 |
| 323 | 3300006948 | Ga0099826_10142629 | Ga0099826_101426292 | 184 |
| 324 | 3300009011 | Ga0105251_10012881 | Ga0105251_100128812 | 184 |
| 325 | 3300009036 | Ga0105244_10171727 | Ga0105244_101717272 | 184 |
| 326 | 3300009092 | Ga0105250_10024088 | Ga0105250_100240882 | 184 |
| 327 | 3300009093 | Ga0105240_10015715 | Ga0105240_100157158 | 184 |
| 328 | 3300009147 | Ga0114129_10091266 | Ga0114129_100912665 | 184 |
| 329 | 3300009148 | Ga0105243_10000636 | Ga0105243_1000063627 | 184 |
| 330 | 3300009148 | Ga0105243_10020026 | Ga0105243_100200262 | 184 |
| 331 | 3300009177 | Ga0105248_10212959 | Ga0105248_102129592 | 184 |
| 332 | 3300009545 | Ga0105237_10004407 | Ga0105237_100044075 | 184 |
| 333 | 3300009551 | Ga0105238_10000200 | Ga0105238_1000020022 | 184 |
| 334 | 3300009551 | Ga0105238_10368954 | Ga0105238_103689542 | 184 |
| 335 | 3300009553 | Ga0105249_10262215 | Ga0105249_102622151 | 184 |
| 336 | 3300010375 | Ga0105239_10048362 | Ga0105239_100483625 | 184 |
| 337 | 3300010375 | Ga0105239_11010342 | Ga0105239_110103422 | 184 |
| 338 | 3300011119 | Ga0105246_10861047 | Ga0105246_108610472 | 184 |
| 339 | 3300012488 | Ga0157343_1005239 | Ga0157343_10052392 | 184 |
| 340 | 3300013100 | Ga0157373_10885815 | Ga0157373_108858152 | 184 |
| 341 | 3300013105 | Ga0157369_10059844 | Ga0157369_100598441 | 184 |
| 342 | 3300013105 | Ga0157369_10364564 | Ga0157369_103645641 | 184 |
| 343 | 3300013296 | Ga0157374_10097920 | Ga0157374_100979204 | 184 |
| 344 | 3300013306 | Ga0163162_10891135 | Ga0163162_108911352 | 184 |
| 345 | 3300013307 | Ga0157372_10937966 | Ga0157372_109379662 | 184 |
| 346 | 3300013308 | Ga0157375_10136007 | Ga0157375_101360073 | 184 |
| 347 | 3300013308 | Ga0157375_10161489 | Ga0157375_101614892 | 184 |
| 348 | 3300013308 | Ga0157375_10183074 | Ga0157375_101830743 | 184 |
| 349 | 3300014326 | Ga0157380_10145681 | Ga0157380_101456813 | 184 |
| 350 | 3300014497 | Ga0182008_10011765 | Ga0182008_100117654 | 184 |
| 351 | 3300014968 | Ga0157379_10187206 | Ga0157379_101872062 | 184 |
| 352 | 3300015262 | Ga0182007_10001899 | Ga0182007_1000189913 | 184 |
| 353 | 3300015265 | Ga0182005_1007289 | Ga0182005_10072893 | 184 |
| 354 | 3300020076 | Ga0206355_1363819 | Ga0206355_13638192 | 184 |
| 355 | 3300020610 | Ga0154015_1559063 | Ga0154015_15590632 | 184 |
| 356 | 3300025297 | Ga0209758_1005072 | Ga0209758_10050729 | 184 |
| 357 | 3300025302 | Ga0207426_1004723 | Ga0207426_10047235 | 184 |
| 358 | 3300025302 | Ga0207426_1005819 | Ga0207426_10058194 | 184 |
| 359 | 3300025302 | Ga0207426_1014205 | Ga0207426_10142052 | 184 |
| 360 | 3300025321 | Ga0207656_10071654 | Ga0207656_100716542 | 184 |
| 361 | 3300025711 | Ga0207696_1021304 | Ga0207696_10213043 | 184 |
| 362 | 3300025728 | Ga0207655_1086590 | Ga0207655_10865901 | 184 |
| 363 | 3300025735 | Ga0207713_1060066 | Ga0207713_10600662 | 184 |
| 364 | 3300025899 | Ga0207642_10080716 | Ga0207642_100807161 | 184 |
| 365 | 3300025903 | Ga0207680_10543619 | Ga0207680_105436192 | 184 |
| 366 | 3300025904 | Ga0207647_10000384 | Ga0207647_100003844 | 184 |
| 367 | 3300025904 | Ga0207647_10009432 | Ga0207647_100094323 | 184 |
| 368 | 3300025904 | Ga0207647_10128796 | Ga0207647_101287962 | 184 |
| 369 | 3300025909 | Ga0207705_10219756 | Ga0207705_102197562 | 184 |
| 370 | 3300025910 | Ga0207684_10172630 | Ga0207684_101726303 | 184 |
| 371 | 3300025912 | Ga0207707_10158691 | Ga0207707_101586912 | 184 |
| 372 | 3300025913 | Ga0207695_10000449 | Ga0207695_1000044959 | 184 |
| 373 | 3300025914 | Ga0207671_10000052 | Ga0207671_10000052114 | 184 |
| 374 | 3300025924 | Ga0207694_10000079 | Ga0207694_1000007921 | 184 |
| 375 | 3300025925 | Ga0207650_11180467 | Ga0207650_111804671 | 184 |
| 376 | 3300025927 | Ga0207687_10100335 | Ga0207687_101003353 | 184 |
| 377 | 3300025927 | Ga0207687_10888245 | Ga0207687_108882452 | 184 |
| 378 | 3300025934 | Ga0207686_10980883 | Ga0207686_109808831 | 184 |
| 379 | 3300025935 | Ga0207709_10005302 | Ga0207709_100053025 | 184 |
| 380 | 3300025935 | Ga0207709_10069295 | Ga0207709_100692953 | 184 |
| 381 | 3300025940 | Ga0207691_10136399 | Ga0207691_101363992 | 184 |
| 382 | 3300025941 | Ga0207711_10139384 | Ga0207711_101393843 | 184 |
| 383 | 3300025942 | Ga0207689_10038451 | Ga0207689_100384514 | 184 |
| 384 | 3300025944 | Ga0207661_10381463 | Ga0207661_103814632 | 184 |
| 385 | 3300025944 | Ga0207661_11393665 | Ga0207661_113936651 | 184 |
| 386 | 3300025949 | Ga0207667_10008068 | Ga0207667_1000806811 | 184 |
| 387 | 3300025949 | Ga0207667_10533626 | Ga0207667_105336262 | 184 |
| 388 | 3300025972 | Ga0207668_11173018 | Ga0207668_111730181 | 184 |
| 389 | 3300025981 | Ga0207640_10042792 | Ga0207640_100427922 | 184 |
| 390 | 3300025981 | Ga0207640_10162953 | Ga0207640_101629533 | 184 |
| 391 | 3300026041 | Ga0207639_10173213 | Ga0207639_101732132 | 184 |
| 392 | 3300026078 | Ga0207702_10151815 | Ga0207702_101518151 | 184 |
| 393 | 3300026078 | Ga0207702_10256002 | Ga0207702_102560022 | 184 |
| 394 | 3300026142 | Ga0207698_10023885 | Ga0207698_100238852 | 184 |
| 395 | 3300027200 | Ga0208976_10089 | Ga0208976_100891 | 184 |
| 396 | 3300027312 | Ga0209371_1031617 | Ga0209371_10316172 | 184 |
| 397 | 3300027866 | Ga0209813_10005060 | Ga0209813_100050602 | 184 |
| 398 | 3300028379 | Ga0268266_10015277 | Ga0268266_100152776 | 184 |
| 399 | 3300028573 | Ga0265334_10000874 | Ga0265334_1000087413 | 184 |
| 400 | 3300028786 | Ga0307517_10002400 | Ga0307517_100024006 | 184 |
| 401 | 3300028786 | Ga0307517_10006298 | Ga0307517_1000629812 | 184 |
| 402 | 3300028794 | Ga0307515_10001177 | Ga0307515_1000117736 | 184 |
| 403 | 3300028794 | Ga0307515_10104037 | Ga0307515_101040372 | 184 |
| 404 | 3300028794 | Ga0307515_10210976 | Ga0307515_102109762 | 184 |
| 405 | 3300030500 | Ga0268256_1013505 | Ga0268256_10135052 | 184 |
| 406 | 3300030521 | Ga0307511_10002042 | Ga0307511_1000204214 | 184 |
| 407 | 3300030521 | Ga0307511_10109100 | Ga0307511_101091001 | 184 |
| 408 | 3300030522 | Ga0307512_10005436 | Ga0307512_100054368 | 184 |
| 409 | 3300030522 | Ga0307512_10027696 | Ga0307512_100276963 | 184 |
| 410 | 3300031251 | Ga0265327_10000021 | Ga0265327_10000021122 | 184 |
| 411 | 3300031456 | Ga0307513_10023232 | Ga0307513_100232326 | 184 |
| 412 | 3300031456 | Ga0307513_10045604 | Ga0307513_100456042 | 184 |
| 413 | 3300031456 | Ga0307513_10228372 | Ga0307513_102283722 | 184 |
| 414 | 3300031507 | Ga0307509_10069495 | Ga0307509_100694954 | 184 |
| 415 | 3300031507 | Ga0307509_10163227 | Ga0307509_101632273 | 184 |
| 416 | 3300031507 | Ga0307509_10316032 | Ga0307509_103160322 | 184 |
| 417 | 3300031616 | Ga0307508_10001775 | Ga0307508_1000177514 | 184 |
| 418 | 3300031616 | Ga0307508_10014629 | Ga0307508_100146293 | 184 |
| 419 | 3300031616 | Ga0307508_10064626 | Ga0307508_100646264 | 184 |
| 420 | 3300031616 | Ga0307508_10303466 | Ga0307508_103034662 | 184 |
| 421 | 3300031649 | Ga0307514_10006847 | Ga0307514_100068478 | 184 |
| 422 | 3300031649 | Ga0307514_10037111 | Ga0307514_100371115 | 184 |
| 423 | 3300031649 | Ga0307514_10181625 | Ga0307514_101816252 | 184 |
| 424 | 3300031691 | Ga0316579_10002060 | Ga0316579_100020604 | 184 |
| 425 | 3300031727 | Ga0316576_10002103 | Ga0316576_100021039 | 184 |
| 426 | 3300031727 | Ga0316576_10004023 | Ga0316576_100040236 | 184 |
| 427 | 3300031727 | Ga0316576_10017633 | Ga0316576_100176335 | 184 |
| 428 | 3300031730 | Ga0307516_10010111 | Ga0307516_100101114 | 184 |
| 429 | 3300031730 | Ga0307516_10119211 | Ga0307516_101192113 | 184 |
| 430 | 3300031730 | Ga0307516_10168803 | Ga0307516_101688033 | 184 |
| 431 | 3300031733 | Ga0316577_10011667 | Ga0316577_100116674 | 184 |
| 432 | 3300031838 | Ga0307518_10054920 | Ga0307518_100549203 | 184 |
| 433 | 3300031911 | Ga0307412_10749474 | Ga0307412_107494742 | 184 |
| 434 | 3300032002 | Ga0307416_100006145 | Ga0307416_1000061452 | 184 |
| 435 | 3300032002 | Ga0307416_101172627 | Ga0307416_1011726272 | 184 |
| 436 | 3300032004 | Ga0307414_10776620 | Ga0307414_107766202 | 184 |
| 437 | 3300032005 | Ga0307411_10581905 | Ga0307411_105819052 | 184 |
| 438 | 3300032137 | Ga0316585_10006376 | Ga0316585_100063763 | 184 |
| 439 | 3300032137 | Ga0316585_10013650 | Ga0316585_100136502 | 184 |
| 440 | 3300032137 | Ga0316585_10198398 | Ga0316585_101983981 | 184 |
| 441 | 3300032139 | Ga0316580_10001258 | Ga0316580_100012585 | 184 |
| 442 | 3300032139 | Ga0316580_10093244 | Ga0316580_100932442 | 184 |
| 443 | 3300032168 | Ga0316593_10005924 | Ga0316593_100059244 | 184 |
| 444 | 3300033179 | Ga0307507_10046747 | Ga0307507_100467473 | 184 |
| 445 | 3300033179 | Ga0307507_10134600 | Ga0307507_101346003 | 184 |
| 446 | 3300033179 | Ga0307507_10256224 | Ga0307507_102562242 | 184 |
| 447 | 3300033180 | Ga0307510_10055624 | Ga0307510_100556245 | 184 |
| 448 | 3300033180 | Ga0307510_10141040 | Ga0307510_101410402 | 184 |
| 449 | 3300033180 | Ga0307510_10287223 | Ga0307510_102872232 | 184 |
| 450 | 3300033180 | Ga0307510_10294043 | Ga0307510_102940432 | 184 |
| 451 | 3300033524 | Ga0316592_1001020 | Ga0316592_10010203 | 184 |
| 452 | 3300033528 | Ga0316588_1020277 | Ga0316588_10202773 | 184 |
| 453 | 3300033541 | Ga0316596_1006584 | Ga0316596_10065843 | 184 |
| 454 | 3300035398 | Ga0316574_0002467 | Ga0316574_0002467_7405_8004 | 184 |
| 455 | 3300035398 | Ga0316574_0003441 | Ga0316574_0003441_3816_4370 | 184 |
| 456 | 3300035398 | Ga0316574_0012516 | Ga0316574_0012516_1751_2305 | 184 |
| 457 | 3300035398 | Ga0316574_0202237 | Ga0316574_0202237_16_570 | 184 |
| 458 | 3300035398 | Ga0316574_0249145 | Ga0316574_0249145_348_902 | 184 |
| 459 | 3300035398 | Ga0316574_0449297 | Ga0316574_0449297_198_752 | 184 |
| 460 | 3300035692 | Ga0373935_0404336 | Ga0373935_0404336_58_825 | 184 |
| 461 | 3300036647 | Ga0316582_0009552 | Ga0316582_0009552_1980_2579 | 184 |
| 462 | 3300036647 | Ga0316582_0283237 | Ga0316582_0283237_469_1023 | 184 |
| 463 | 3300036647 | Ga0316582_0310176 | Ga0316582_0310176_475_1029 | 184 |
| 464 | 3300036712 | Ga0316584_0006927 | Ga0316584_0006927_1751_2305 | 184 |
| 465 | 3300036712 | Ga0316584_0015007 | Ga0316584_0015007_3298_3897 | 184 |
| 466 | 3300036712 | Ga0316584_0204214 | Ga0316584_0204214_675_1229 | 184 |
| 467 | 3300037312 | Ga0395899_0145964 | Ga0395899_0145964_981_1535 | 184 |
| 468 | 3300037418 | Ga0395900_0525259 | Ga0395900_0525259_361_915 | 184 |
| 469 | 3300037466 | Ga0395898_0151508 | Ga0395898_0151508_1414_1968 | 184 |
| 470 | 3300037466 | Ga0395898_0716200 | Ga0395898_0716200_208_762 | 184 |
| 471 | 3300037466 | Ga0395898_0813423 | Ga0395898_0813423_193_747 | 184 |
| 472 | 3300037471 | Ga0395905_0040914 | Ga0395905_0040914_1144_1698 | 184 |
| 473 | 3300037471 | Ga0395905_0439594 | Ga0395905_0439594_212_766 | 184 |
| 474 | 3300037588 | Ga0316581_0008926 | Ga0316581_0008926_311_865 | 184 |
| 475 | 3300037853 | Ga0436364_0696641 | Ga0436364_0696641_174_728 | 184 |
| 476 | 3300038443 | Ga0395901_0025204 | Ga0395901_0025204_5411_5965 | 184 |
| 477 | 3300038443 | Ga0395901_0978121 | Ga0395901_0978121_143_697 | 184 |
| 478 | 3300038741 | Ga0400488_07225 | Ga0400488_07225_192_746 | 184 |
| 479 | 3300039450 | Ga0436363_0357854 | Ga0436363_0357854_176_730 | 184 |
| 480 | 3300039453 | Ga0436362_0777364 | Ga0436362_0777364_347_901 | 184 |
| 481 | 3300041404 | Ga0439436_0000647 | Ga0439436_0000647_5175_5729 | 184 |
| 482 | 3300041406 | Ga0439439_0050921 | Ga0439439_0050921_488_1042 | 184 |
| 483 | 3300041452 | Ga0451793_0775163 | Ga0451793_0775163_112_672 | 184 |
| 484 | 3300041458 | Ga0451798_0034298 | Ga0451798_0034298_861_1415 | 184 |
| 485 | 3300041463 | Ga0451804_0745524 | Ga0451804_0745524_126_680 | 184 |
| 486 | 3300041463 | Ga0451804_0888423 | Ga0451804_0888423_16_570 | 184 |
| 487 | 3300041492 | Ga0451835_1095149 | Ga0451835_1095149_571_1125 | 184 |
| 488 | 3300041498 | Ga0451841_0657617 | Ga0451841_0657617_454_1008 | 184 |
| 489 | 3300041501 | Ga0451845_0110932 | Ga0451845_0110932_421_975 | 184 |
| 490 | 3300041512 | Ga0451853_0476250 | Ga0451853_0476250_3133_3687 | 184 |
| 491 | 3300041997 | Ga0439431_0082966 | Ga0439431_0082966_178_732 | 184 |
| 492 | 3300041999 | Ga0439433_0000925 | Ga0439433_0000925_5294_5848 | 184 |
| 493 | 3300042005 | Ga0439448_0068586 | Ga0439448_0068586_119_673 | 184 |
| 494 | 3300042007 | Ga0439449_0007208 | Ga0439449_0007208_2375_2929 | 184 |
| 495 | 3300042007 | Ga0439449_0061763 | Ga0439449_0061763_150_704 | 184 |
| 496 | 3300042007 | Ga0439449_0114589 | Ga0439449_0114589_252_806 | 184 |
| 497 | 3300042011 | Ga0439454_012870 | Ga0439454_012870_522_1076 | 184 |
| 498 | 3300042012 | Ga0439455_0007065 | Ga0439455_0007065_912_1466 | 184 |
| 499 | 3300042014 | Ga0439457_001642 | Ga0439457_001642_5381_5935 | 184 |
| 500 | 3300042015 | Ga0439462_0015964 | Ga0439462_0015964_1217_1771 | 184 |
| 501 | 3300042131 | Ga0450894_000878 | Ga0450894_000878_2215_2769 | 184 |
| 502 | 3300042132 | Ga0450895_000300 | Ga0450895_000300_707_1261 | 184 |
| 503 | 3300042136 | Ga0450900_025880 | Ga0450900_025880_138_692 | 184 |
| 504 | 3300042137 | Ga0450902_010824 | Ga0450902_010824_411_965 | 184 |
| 505 | 3300042138 | Ga0450903_000042 | Ga0450903_000042_20102_20656 | 184 |
| 506 | 3300042138 | Ga0450903_021470 | Ga0450903_021470_354_908 | 184 |
| 507 | 3300042145 | Ga0450906_003999 | Ga0450906_003999_427_981 | 184 |
| 508 | 3300042146 | Ga0450907_010517 | Ga0450907_010517_810_1364 | 184 |
| 509 | 3300042157 | Ga0439458_0002401 | Ga0439458_0002401_761_1315 | 184 |
| 510 | 3300042184 | Ga0450908_011788 | Ga0450908_011788_750_1304 | 184 |
| 511 | 3300042533 | Ga0450901_020097 | Ga0450901_020097_123_677 | 184 |
| 512 | 3300042876 | Ga0451577_0111144 | Ga0451577_0111144_1868_2434 | 184 |
| 513 | 3300044656 | Ga0466969_0001418 | Ga0466969_0001418_5184_5738 | 184 |
| 514 | 3300044656 | Ga0466969_0003205 | Ga0466969_0003205_7077_7631 | 184 |
| 515 | 3300044656 | Ga0466969_0004397 | Ga0466969_0004397_1894_2448 | 184 |
| 516 | 3300044658 | Ga0466972_0024378 | Ga0466972_0024378_987_1541 | 184 |
| 517 | 3300044658 | Ga0466972_0029293 | Ga0466972_0029293_344_898 | 184 |
| 518 | 3300044658 | Ga0466972_0151363 | Ga0466972_0151363_322_876 | 184 |
| 519 | 3300044658 | Ga0466972_0202942 | Ga0466972_0202942_360_914 | 184 |
| 520 | 3300044683 | Ga0466965_0077522 | Ga0466965_0077522_111_665 | 184 |
| 521 | 3300044683 | Ga0466965_0118188 | Ga0466965_0118188_15_569 | 184 |
| 522 | 3300044683 | Ga0466965_0234623 | Ga0466965_0234623_109_663 | 184 |
| 523 | 3300044684 | Ga0466966_0002225 | Ga0466966_0002225_11650_12204 | 184 |
| 524 | 3300044684 | Ga0466966_0005466 | Ga0466966_0005466_2247_2801 | 184 |
| 525 | 3300044684 | Ga0466966_0025916 | Ga0466966_0025916_2620_3174 | 184 |
| 526 | 3300044684 | Ga0466966_0265793 | Ga0466966_0265793_415_969 | 184 |
| 527 | 3300044693 | Ga0466961_0010029 | Ga0466961_0010029_1946_2500 | 184 |
| 528 | 3300044693 | Ga0466961_0030018 | Ga0466961_0030018_2779_3333 | 184 |
| 529 | 3300044693 | Ga0466961_0034304 | Ga0466961_0034304_685_1239 | 184 |
| 530 | 3300044693 | Ga0466961_0165088 | Ga0466961_0165088_692_1246 | 184 |
| 531 | 3300044694 | Ga0466963_0001853 | Ga0466963_0001853_9270_9824 | 184 |
| 532 | 3300044694 | Ga0466963_0006392 | Ga0466963_0006392_3690_4244 | 184 |
| 533 | 3300044694 | Ga0466963_0185911 | Ga0466963_0185911_637_1191 | 184 |
| 534 | 3300044706 | Ga0466964_0058623 | Ga0466964_0058623_995_1549 | 184 |
| 535 | 3300044719 | Ga0466971_0001269 | Ga0466971_0001269_1848_2402 | 184 |
| 536 | 3300044735 | Ga0466968_0068045 | Ga0466968_0068045_44_598 | 184 |
| 537 | 3300044765 | Ga0466970_0005211 | Ga0466970_0005211_958_1512 | 184 |
| 538 | 3300044765 | Ga0466970_0009711 | Ga0466970_0009711_2197_2751 | 184 |
| 539 | 3300044765 | Ga0466970_0011518 | Ga0466970_0011518_1600_2154 | 184 |
| 540 | 3300044765 | Ga0466970_0231915 | Ga0466970_0231915_451_1005 | 184 |
| 541 | 3300044842 | Ga0466957_0005140 | Ga0466957_0005140_434_988 | 184 |
| 542 | 3300044842 | Ga0466957_0064142 | Ga0466957_0064142_362_916 | 184 |
| 543 | 3300044842 | Ga0466957_0654104 | Ga0466957_0654104_87_641 | 184 |
| 544 | 3300044901 | Ga0466960_0152786 | Ga0466960_0152786_663_1217 | 184 |
| 545 | 3300045049 | Ga0466959_0012115 | Ga0466959_0012115_5140_5694 | 184 |
| 546 | 3300045049 | Ga0466959_0019353 | Ga0466959_0019353_4043_4597 | 184 |
| 547 | 3300045049 | Ga0466959_0032027 | Ga0466959_0032027_2195_2749 | 184 |
| 548 | 3300045049 | Ga0466959_0366316 | Ga0466959_0366316_251_805 | 184 |
| 549 | 3300045049 | Ga0466959_0380902 | Ga0466959_0380902_395_949 | 184 |
| 550 | 3300045836 | Ga0466958_0018495 | Ga0466958_0018495_1819_2373 | 184 |
| 551 | 3300045836 | Ga0466958_0068692 | Ga0466958_0068692_977_1531 | 184 |
| 552 | 3300045836 | Ga0466958_0202720 | Ga0466958_0202720_15_569 | 184 |
| 553 | 3300045836 | Ga0466958_0605152 | Ga0466958_0605152_100_654 | 184 |
| 554 | 3300045836 | Ga0466958_0619135 | Ga0466958_0619135_31_585 | 184 |
| 555 | 3300045976 | Ga0466967_0049198 | Ga0466967_0049198_1103_1657 | 184 |
| 556 | 3300045976 | Ga0466967_0160826 | Ga0466967_0160826_132_686 | 184 |
| 557 | 3300045976 | Ga0466967_0601572 | Ga0466967_0601572_346_900 | 184 |
| 558 | 3300045976 | Ga0466967_1805276 | Ga0466967_1805276_40_594 | 184 |
| 559 | 3300046452 | Ga0495617_008519 | Ga0495617_008519_1916_2470 | 184 |
| 560 | 3300046453 | Ga0495627_046111 | Ga0495627_046111_590_1144 | 184 |
| 561 | 3300046454 | Ga0495592_0086598 | Ga0495592_0086598_1459_2013 | 184 |
| 562 | 3300046454 | Ga0495592_0139010 | Ga0495592_0139010_252_806 | 184 |
| 563 | 3300046455 | Ga0495603_0014289 | Ga0495603_0014289_204_758 | 184 |
| 564 | 3300046455 | Ga0495603_0049787 | Ga0495603_0049787_92_646 | 184 |
| 565 | 3300046455 | Ga0495603_0106842 | Ga0495603_0106842_504_1058 | 184 |
| 566 | 3300046455 | Ga0495603_0107917 | Ga0495603_0107917_954_1508 | 184 |
| 567 | 3300046455 | Ga0495603_0172744 | Ga0495603_0172744_119_673 | 184 |
| 568 | 3300046457 | Ga0495590_0074454 | Ga0495590_0074454_528_1082 | 184 |
| 569 | 3300046459 | Ga0495629_0004039 | Ga0495629_0004039_3535_4089 | 184 |
| 570 | 3300046459 | Ga0495629_0037840 | Ga0495629_0037840_951_1505 | 184 |
| 571 | 3300046459 | Ga0495629_0099559 | Ga0495629_0099559_319_873 | 184 |
| 572 | 3300046459 | Ga0495629_0218347 | Ga0495629_0218347_102_656 | 184 |
| 573 | 3300046459 | Ga0495629_0221652 | Ga0495629_0221652_659_1213 | 184 |
| 574 | 3300046460 | Ga0495638_0056942 | Ga0495638_0056942_131_685 | 184 |
| 575 | 3300046460 | Ga0495638_0254522 | Ga0495638_0254522_131_685 | 184 |
| 576 | 3300046460 | Ga0495638_0376605 | Ga0495638_0376605_133_687 | 184 |
| 577 | 3300046460 | Ga0495638_0415067 | Ga0495638_0415067_87_641 | 184 |
| 578 | 3300046461 | Ga0495641_0031258 | Ga0495641_0031258_1684_2238 | 184 |
| 579 | 3300046461 | Ga0495641_0222014 | Ga0495641_0222014_177_731 | 184 |
| 580 | 3300046462 | Ga0495651_0000877 | Ga0495651_0000877_12342_12896 | 184 |
| 581 | 3300046462 | Ga0495651_0002270 | Ga0495651_0002270_3702_4256 | 184 |
| 582 | 3300046462 | Ga0495651_0064795 | Ga0495651_0064795_2108_2662 | 184 |
| 583 | 3300046462 | Ga0495651_0267752 | Ga0495651_0267752_147_701 | 184 |
| 584 | 3300046463 | Ga0495653_0147679 | Ga0495653_0147679_620_1174 | 184 |
| 585 | 3300046473 | Ga0495582_0103106 | Ga0495582_0103106_76_630 | 184 |
| 586 | 3300046473 | Ga0495582_0112376 | Ga0495582_0112376_591_1145 | 184 |
| 587 | 3300046474 | Ga0495605_0028928 | Ga0495605_0028928_436_990 | 184 |
| 588 | 3300046474 | Ga0495605_0159786 | Ga0495605_0159786_121_675 | 184 |
| 589 | 3300046474 | Ga0495605_0211553 | Ga0495605_0211553_131_685 | 184 |
| 590 | 3300046476 | Ga0495662_0002591 | Ga0495662_0002591_8480_9034 | 184 |
| 591 | 3300046476 | Ga0495662_0017622 | Ga0495662_0017622_2753_3307 | 184 |
| 592 | 3300046476 | Ga0495662_0181358 | Ga0495662_0181358_57_611 | 184 |
| 593 | 3300046477 | Ga0495664_0011037 | Ga0495664_0011037_4402_4956 | 184 |
| 594 | 3300046477 | Ga0495664_0358600 | Ga0495664_0358600_81_635 | 184 |
| 595 | 3300046491 | Ga0495584_0096326 | Ga0495584_0096326_606_1160 | 184 |
| 596 | 3300046492 | Ga0495585_0007060 | Ga0495585_0007060_3239_3793 | 184 |
| 597 | 3300046492 | Ga0495585_0017360 | Ga0495585_0017360_811_1365 | 184 |
| 598 | 3300046492 | Ga0495585_0029333 | Ga0495585_0029333_1863_2417 | 184 |
| 599 | 3300046492 | Ga0495585_0111505 | Ga0495585_0111505_121_675 | 184 |
| 600 | 3300046492 | Ga0495585_0165981 | Ga0495585_0165981_474_1028 | 184 |
| 601 | 3300046499 | Ga0495594_0000534 | Ga0495594_0000534_9729_10283 | 184 |
| 602 | 3300046499 | Ga0495594_0001342 | Ga0495594_0001342_7098_7652 | 184 |
| 603 | 3300046499 | Ga0495594_0025045 | Ga0495594_0025045_2618_3172 | 184 |
| 604 | 3300046499 | Ga0495594_0066921 | Ga0495594_0066921_947_1501 | 184 |
| 605 | 3300046499 | Ga0495594_0080354 | Ga0495594_0080354_1184_1738 | 184 |
| 606 | 3300046499 | Ga0495594_0122822 | Ga0495594_0122822_256_810 | 184 |
| 607 | 3300046499 | Ga0495594_0201958 | Ga0495594_0201958_401_955 | 184 |
| 608 | 3300046500 | Ga0495596_0059337 | Ga0495596_0059337_113_667 | 184 |
| 609 | 3300046501 | Ga0495607_0027985 | Ga0495607_0027985_134_688 | 184 |
| 610 | 3300046501 | Ga0495607_0098590 | Ga0495607_0098590_786_1340 | 184 |
| 611 | 3300046501 | Ga0495607_0111703 | Ga0495607_0111703_133_687 | 184 |
| 612 | 3300046501 | Ga0495607_0171270 | Ga0495607_0171270_423_977 | 184 |
| 613 | 3300046506 | Ga0495583_0014310 | Ga0495583_0014310_2765_3319 | 184 |
| 614 | 3300046512 | Ga0495610_0032653 | Ga0495610_0032653_1778_2332 | 184 |
| 615 | 3300046513 | Ga0495616_0004473 | Ga0495616_0004473_3951_4505 | 184 |
| 616 | 3300046514 | Ga0495618_0073416 | Ga0495618_0073416_302_895 | 184 |
| 617 | 3300046515 | Ga0495620_0210712 | Ga0495620_0210712_135_689 | 184 |
| 618 | 3300046515 | Ga0495620_0210714 | Ga0495620_0210714_57_611 | 184 |
| 619 | 3300046516 | Ga0495628_0021083 | Ga0495628_0021083_975_1529 | 184 |
| 620 | 3300046516 | Ga0495628_0047595 | Ga0495628_0047595_1255_1809 | 184 |
| 621 | 3300046517 | Ga0495630_0271273 | Ga0495630_0271273_103_657 | 184 |
| 622 | 3300046517 | Ga0495630_0286596 | Ga0495630_0286596_204_758 | 184 |
| 623 | 3300046518 | Ga0495631_0003096 | Ga0495631_0003096_2171_2725 | 184 |
| 624 | 3300046518 | Ga0495631_0062705 | Ga0495631_0062705_30_584 | 184 |
| 625 | 3300046518 | Ga0495631_0251352 | Ga0495631_0251352_86_640 | 184 |
| 626 | 3300046519 | Ga0495632_0013008 | Ga0495632_0013008_2057_2611 | 184 |
| 627 | 3300046520 | Ga0495637_0009037 | Ga0495637_0009037_224_778 | 184 |
| 628 | 3300046522 | Ga0495643_0003319 | Ga0495643_0003319_4694_5248 | 184 |
| 629 | 3300046522 | Ga0495643_0011979 | Ga0495643_0011979_2477_3031 | 184 |
| 630 | 3300046524 | Ga0495648_0052190 | Ga0495648_0052190_135_689 | 184 |
| 631 | 3300046526 | Ga0495666_0042778 | Ga0495666_0042778_243_797 | 184 |
| 632 | 3300046528 | Ga0495642_0098842 | Ga0495642_0098842_267_821 | 184 |
| 633 | 3300046528 | Ga0495642_0151219 | Ga0495642_0151219_94_648 | 184 |
| 634 | 3300046529 | Ga0495652_0000654 | Ga0495652_0000654_29609_30163 | 184 |
| 635 | 3300046529 | Ga0495652_0006834 | Ga0495652_0006834_6545_7099 | 184 |
| 636 | 3300046530 | Ga0495654_0055777 | Ga0495654_0055777_487_1041 | 184 |
| 637 | 3300046533 | Ga0495640_0018021 | Ga0495640_0018021_1007_1561 | 184 |
| 638 | 3300046535 | Ga0495586_0067920 | Ga0495586_0067920_946_1500 | 184 |
| 639 | 3300046536 | Ga0495587_0003288 | Ga0495587_0003288_4803_5357 | 184 |
| 640 | 3300046538 | Ga0495609_0007988 | Ga0495609_0007988_279_833 | 184 |
| 641 | 3300046542 | Ga0495597_0026389 | Ga0495597_0026389_135_689 | 184 |
| 642 | 3300046543 | Ga0495645_0004398 | Ga0495645_0004398_2401_2955 | 184 |
| 643 | 3300046543 | Ga0495645_0044976 | Ga0495645_0044976_920_1474 | 184 |
| 644 | 3300046543 | Ga0495645_0277480 | Ga0495645_0277480_475_1068 | 184 |
| 645 | 3300046557 | Ga0495622_0009980 | Ga0495622_0009980_1664_2218 | 184 |
| 646 | 3300046557 | Ga0495622_0010925 | Ga0495622_0010925_317_871 | 184 |
| 647 | 3300046557 | Ga0495622_0011920 | Ga0495622_0011920_3404_3958 | 184 |
| 648 | 3300046557 | Ga0495622_0018300 | Ga0495622_0018300_578_1132 | 184 |
| 649 | 3300046557 | Ga0495622_0215186 | Ga0495622_0215186_168_722 | 184 |
| 650 | 3300046558 | Ga0495633_0033673 | Ga0495633_0033673_1057_1611 | 184 |
| 651 | 3300046558 | Ga0495633_0034749 | Ga0495633_0034749_630_1184 | 184 |
| 652 | 3300046558 | Ga0495633_0250474 | Ga0495633_0250474_94_648 | 184 |
| 653 | 3300046559 | Ga0495667_0055394 | Ga0495667_0055394_785_1339 | 184 |
| 654 | 3300046559 | Ga0495667_0182850 | Ga0495667_0182850_443_997 | 184 |
| 655 | 3300046559 | Ga0495667_0294036 | Ga0495667_0294036_57_626 | 184 |
| 656 | 3300046615 | Ga0495656_0042986 | Ga0495656_0042986_621_1175 | 184 |
| 657 | 3300046615 | Ga0495656_0171800 | Ga0495656_0171800_482_1036 | 184 |
| 658 | 3300046616 | Ga0495668_0000123 | Ga0495668_0000123_51470_52024 | 184 |
| 659 | 3300046616 | Ga0495668_0419641 | Ga0495668_0419641_47_601 | 184 |
| 660 | 3300046642 | Ga0495634_0012335 | Ga0495634_0012335_793_1347 | 184 |
| 661 | 3300046642 | Ga0495634_0223669 | Ga0495634_0223669_190_759 | 184 |
| 662 | 3300046648 | Ga0495611_0020510 | Ga0495611_0020510_347_901 | 184 |
| 663 | 3300046648 | Ga0495611_0172956 | Ga0495611_0172956_324_878 | 184 |
| 664 | 3300046660 | Ga0495625_0005807 | Ga0495625_0005807_10461_11015 | 184 |
| 665 | 3300046660 | Ga0495625_0315112 | Ga0495625_0315112_133_687 | 184 |
| 666 | 3300046660 | Ga0495625_0393212 | Ga0495625_0393212_131_685 | 184 |
| 667 | 3300046663 | Ga0495635_0005875 | Ga0495635_0005875_25_579 | 184 |
| 668 | 3300046663 | Ga0495635_0016061 | Ga0495635_0016061_125_679 | 184 |
| 669 | 3300046663 | Ga0495635_0044394 | Ga0495635_0044394_1088_1642 | 184 |
| 670 | 3300046663 | Ga0495635_0228830 | Ga0495635_0228830_515_1069 | 184 |
| 671 | 3300046663 | Ga0495635_0327665 | Ga0495635_0327665_204_854 | 184 |
| 672 | 3300046665 | Ga0495661_0020242 | Ga0495661_0020242_431_985 | 184 |
| 673 | 3300046674 | Ga0495588_0001306 | Ga0495588_0001306_10028_10582 | 184 |
| 674 | 3300046674 | Ga0495588_0002549 | Ga0495588_0002549_1793_2347 | 184 |
| 675 | 3300046674 | Ga0495588_0033182 | Ga0495588_0033182_309_863 | 184 |
| 676 | 3300046674 | Ga0495588_0493970 | Ga0495588_0493970_48_602 | 184 |
| 677 | 3300046675 | Ga0495657_0003629 | Ga0495657_0003629_11855_12409 | 184 |
| 678 | 3300046675 | Ga0495657_0153142 | Ga0495657_0153142_57_611 | 184 |
| 679 | 3300046675 | Ga0495657_0258619 | Ga0495657_0258619_437_991 | 184 |
| 680 | 3300046675 | Ga0495657_0280552 | Ga0495657_0280552_420_974 | 184 |
| 681 | 3300046678 | Ga0495599_0089876 | Ga0495599_0089876_1305_1859 | 184 |
| 682 | 3300046679 | Ga0495623_0086019 | Ga0495623_0086019_466_1020 | 184 |
| 683 | 3300046679 | Ga0495623_0108105 | Ga0495623_0108105_1031_1585 | 184 |
| 684 | 3300046679 | Ga0495623_0137046 | Ga0495623_0137046_14_568 | 184 |
| 685 | 3300046680 | Ga0495646_0000855 | Ga0495646_0000855_4780_5334 | 184 |
| 686 | 3300046680 | Ga0495646_0193007 | Ga0495646_0193007_103_657 | 184 |
| 687 | 3300046683 | Ga0495658_0043519 | Ga0495658_0043519_1803_2357 | 184 |
| 688 | 3300046683 | Ga0495658_0073541 | Ga0495658_0073541_459_1013 | 184 |
| 689 | 3300046689 | Ga0495613_0003081 | Ga0495613_0003081_6489_7043 | 184 |
| 690 | 3300046689 | Ga0495613_0150761 | Ga0495613_0150761_950_1504 | 184 |
| 691 | 3300046689 | Ga0495613_0511424 | Ga0495613_0511424_116_670 | 184 |
| 692 | 3300046689 | Ga0495613_0608431 | Ga0495613_0608431_57_611 | 184 |
| 693 | 3300046690 | Ga0495624_0385078 | Ga0495624_0385078_34_588 | 184 |
| 694 | 3300046691 | Ga0495670_0006366 | Ga0495670_0006366_2653_3207 | 184 |
| 695 | 3300046691 | Ga0495670_0139922 | Ga0495670_0139922_556_1110 | 184 |
| 696 | 3300046691 | Ga0495670_0172250 | Ga0495670_0172250_141_695 | 184 |
| 697 | 3300046692 | Ga0495671_0027068 | Ga0495671_0027068_2280_2834 | 184 |
| 698 | 3300046692 | Ga0495671_0101110 | Ga0495671_0101110_36_590 | 184 |
| 699 | 3300046692 | Ga0495671_0140874 | Ga0495671_0140874_504_1058 | 184 |
| 700 | 3300046692 | Ga0495671_0238204 | Ga0495671_0238204_131_685 | 184 |
| 701 | 3300046694 | Ga0495649_0108145 | Ga0495649_0108145_57_611 | 184 |
| 702 | 3300046694 | Ga0495649_0153422 | Ga0495649_0153422_137_691 | 184 |
| 703 | 3300046794 | Ga0495589_0052255 | Ga0495589_0052255_30_584 | 184 |
| 704 | 3300046794 | Ga0495589_0081760 | Ga0495589_0081760_834_1388 | 184 |
| 705 | 3300046794 | Ga0495589_0100668 | Ga0495589_0100668_135_689 | 184 |
| 706 | 3300046794 | Ga0495589_0149558 | Ga0495589_0149558_451_1005 | 184 |
| 707 | 3300046794 | Ga0495589_0309960 | Ga0495589_0309960_42_596 | 184 |
| 708 | 3300046809 | Ga0495600_0001072 | Ga0495600_0001072_7055_7609 | 184 |
| 709 | 3300046809 | Ga0495600_0082971 | Ga0495600_0082971_716_1270 | 184 |
| 710 | 3300046809 | Ga0495600_0306200 | Ga0495600_0306200_427_981 | 184 |
| 711 | 3300046810 | Ga0495660_0289822 | Ga0495660_0289822_57_611 | 184 |
| 712 | 3300046810 | Ga0495660_0289843 | Ga0495660_0289843_57_611 | 184 |
| 713 | 3300047315 | Ga0495581_0084198 | Ga0495581_0084198_132_686 | 184 |
| 714 | 3300047315 | Ga0495581_0111016 | Ga0495581_0111016_423_977 | 184 |
| 715 | 3300047317 | Ga0495604_0001536 | Ga0495604_0001536_1931_2485 | 184 |
| 716 | 3300047317 | Ga0495604_0010118 | Ga0495604_0010118_5988_6542 | 184 |
| 717 | 3300047317 | Ga0495604_0248821 | Ga0495604_0248821_103_657 | 184 |
| 718 | 3300047318 | Ga0495636_0005810 | Ga0495636_0005810_1907_2461 | 184 |
| 719 | 3300047318 | Ga0495636_0037681 | Ga0495636_0037681_100_654 | 184 |
| 720 | 3300047318 | Ga0495636_0047587 | Ga0495636_0047587_641_1195 | 184 |
| 721 | 3300047318 | Ga0495636_0086946 | Ga0495636_0086946_83_637 | 184 |
| 722 | 3300047318 | Ga0495636_0127086 | Ga0495636_0127086_58_612 | 184 |
| 723 | 3300047318 | Ga0495636_0170319 | Ga0495636_0170319_252_806 | 184 |
| 724 | 3300047319 | Ga0495674_0436576 | Ga0495674_0436576_488_1042 | 184 |
| 725 | 3300047320 | Ga0495672_0019354 | Ga0495672_0019354_1067_1621 | 184 |
| 726 | 3300047321 | Ga0495676_0013343 | Ga0495676_0013343_1086_1640 | 184 |
| 727 | 3300047321 | Ga0495676_0026725 | Ga0495676_0026725_92_646 | 184 |
| 728 | 3300047321 | Ga0495676_0028819 | Ga0495676_0028819_3547_4101 | 184 |
| 729 | 3300047321 | Ga0495676_0111304 | Ga0495676_0111304_92_646 | 184 |
| 730 | 3300047322 | Ga0495680_0084935 | Ga0495680_0084935_57_611 | 184 |
| 731 | 3300047322 | Ga0495680_0577371 | Ga0495680_0577371_144_698 | 184 |
| 732 | 3300047323 | Ga0495683_0069931 | Ga0495683_0069931_694_1248 | 184 |
| 733 | 3300047323 | Ga0495683_0153368 | Ga0495683_0153368_133_687 | 184 |
| 734 | 3300047323 | Ga0495683_0154877 | Ga0495683_0154877_376_930 | 184 |
| 735 | 3300047323 | Ga0495683_0185626 | Ga0495683_0185626_284_838 | 184 |
| 736 | 3300047443 | Ga0495687_001147 | Ga0495687_001147_8014_8568 | 184 |
| 737 | 3300047443 | Ga0495687_003306 | Ga0495687_003306_11140_11694 | 184 |
| 738 | 3300047443 | Ga0495687_134956 | Ga0495687_134956_131_685 | 184 |
| 739 | 3300047444 | Ga0495675_0000675 | Ga0495675_0000675_741_1295 | 184 |
| 740 | 3300047444 | Ga0495675_0007918 | Ga0495675_0007918_623_1177 | 184 |
| 741 | 3300047444 | Ga0495675_0295609 | Ga0495675_0295609_272_826 | 184 |
| 742 | 3300047446 | Ga0495679_057193 | Ga0495679_057193_310_864 | 184 |
| 743 | 3300047447 | Ga0495685_000486 | Ga0495685_000486_5928_6482 | 184 |
| 744 | 3300047447 | Ga0495685_020602 | Ga0495685_020602_1159_1713 | 184 |
| 745 | 3300047447 | Ga0495685_034258 | Ga0495685_034258_105_659 | 184 |
| 746 | 3300047447 | Ga0495685_034731 | Ga0495685_034731_995_1549 | 184 |
| 747 | 3300047447 | Ga0495685_092198 | Ga0495685_092198_420_974 | 184 |
| 748 | 3300047447 | Ga0495685_169910 | Ga0495685_169910_113_667 | 184 |
| 749 | 3300047470 | Ga0495681_0000590 | Ga0495681_0000590_6612_7166 | 184 |
| 750 | 3300047470 | Ga0495681_0004760 | Ga0495681_0004760_6611_7165 | 184 |
| 751 | 3300047471 | Ga0495684_0186585 | Ga0495684_0186585_568_1122 | 184 |
| 752 | 3300047472 | Ga0495686_0087868 | Ga0495686_0087868_410_964 | 184 |
| 753 | 3300047472 | Ga0495686_0159404 | Ga0495686_0159404_717_1271 | 184 |
| 754 | 3300047472 | Ga0495686_0345750 | Ga0495686_0345750_13_567 | 184 |
| 755 | 3300047673 | Ga0495593_0037244 | Ga0495593_0037244_120_674 | 184 |
| 756 | 3300047673 | Ga0495593_0105733 | Ga0495593_0105733_661_1215 | 184 |
| 757 | 3300047673 | Ga0495593_0106955 | Ga0495593_0106955_57_611 | 184 |
| 758 | 3300047673 | Ga0495593_0226146 | Ga0495593_0226146_328_882 | 184 |
| 759 | 3300048088 | Ga0495602_0246286 | Ga0495602_0246286_94_648 | 184 |
| 760 | 3300048088 | Ga0495602_0567654 | Ga0495602_0567654_25_579 | 184 |
| 761 | 3300048089 | Ga0495614_0000331 | Ga0495614_0000331_16157_16711 | 184 |
| 762 | 3300048089 | Ga0495614_0002125 | Ga0495614_0002125_131_685 | 184 |
| 763 | 3300048089 | Ga0495614_0174306 | Ga0495614_0174306_177_731 | 184 |
| 764 | 3300048089 | Ga0495614_0255350 | Ga0495614_0255350_119_673 | 184 |
| 765 | 3300048089 | Ga0495614_0501839 | Ga0495614_0501839_10_564 | 184 |
| 766 | 3300048091 | Ga0495626_0007219 | Ga0495626_0007219_2337_2891 | 184 |
| 767 | 3300048904 | Ga0496101_0224705 | Ga0496101_0224705_411_1010 | 184 |
| 768 | 3300048905 | Ga0496102_0219017 | Ga0496102_0219017_641_1195 | 184 |
| 769 | 3300048907 | Ga0496104_0131038 | Ga0496104_0131038_803_1357 | 184 |
| 770 | 3300048908 | Ga0496105_0412330 | Ga0496105_0412330_284_838 | 184 |
| 771 | 3300048908 | Ga0496105_0846831 | Ga0496105_0846831_102_656 | 184 |
| 772 | 3300048910 | Ga0496107_0072025 | Ga0496107_0072025_678_1232 | 184 |
| 773 | 3300048910 | Ga0496107_0853082 | Ga0496107_0853082_36_590 | 184 |
| 774 | 3300048911 | Ga0496108_0042183 | Ga0496108_0042183_2549_3103 | 184 |
| 775 | 3300048911 | Ga0496108_0061256 | Ga0496108_0061256_2067_2621 | 184 |
| 776 | 3300048912 | Ga0496109_0139325 | Ga0496109_0139325_735_1289 | 184 |
| 777 | 3300048912 | Ga0496109_0147279 | Ga0496109_0147279_1498_2052 | 184 |
| 778 | 3300048912 | Ga0496109_0293706 | Ga0496109_0293706_634_1188 | 184 |
| 779 | 3300048913 | Ga0496110_0014056 | Ga0496110_0014056_3292_3846 | 184 |
| 780 | 3300048913 | Ga0496110_0087314 | Ga0496110_0087314_1179_1733 | 184 |
| 781 | 3300048913 | Ga0496110_0242064 | Ga0496110_0242064_908_1462 | 184 |
| 782 | 3300048914 | Ga0496111_0091211 | Ga0496111_0091211_1546_2100 | 184 |
| 783 | 3300048914 | Ga0496111_0463243 | Ga0496111_0463243_351_905 | 184 |
| 784 | 3300048915 | Ga0496112_0009854 | Ga0496112_0009854_3533_4087 | 184 |
| 785 | 3300048916 | Ga0496113_0298415 | Ga0496113_0298415_213_767 | 184 |
| 786 | 3300048917 | Ga0496114_0008124 | Ga0496114_0008124_104_658 | 184 |
| 787 | 3300048917 | Ga0496114_0078991 | Ga0496114_0078991_1117_1716 | 184 |
| 788 | 3300048917 | Ga0496114_0158091 | Ga0496114_0158091_48_602 | 184 |
| 789 | 3300048918 | Ga0496115_0248285 | Ga0496115_0248285_732_1331 | 184 |
| 790 | 3300048927 | Ga0496124_0429297 | Ga0496124_0429297_204_758 | 184 |
| 791 | 3300048929 | Ga0496126_0046187 | Ga0496126_0046187_2654_3349 | 184 |
| 792 | 3300049130 | Ga0501310_000014 | Ga0501310_000014_15109_15675 | 184 |
| 793 | 3300049459 | Ga0495678_022611 | Ga0495678_022611_350_904 | 184 |
| 794 | 3300049460 | Ga0495682_0023182 | Ga0495682_0023182_204_758 | 184 |
| 795 | 3300049568 | Ga0501031_0003124 | Ga0501031_0003124_7259_7813 | 184 |
| 796 | 3300049568 | Ga0501031_0003254 | Ga0501031_0003254_8373_8927 | 184 |
| 797 | 3300049568 | Ga0501031_0122493 | Ga0501031_0122493_718_1272 | 184 |
| 798 | 3300049568 | Ga0501031_0125833 | Ga0501031_0125833_584_1138 | 184 |
| 799 | 3300049568 | Ga0501031_0197093 | Ga0501031_0197093_442_996 | 184 |
| 800 | 3300049568 | Ga0501031_0246077 | Ga0501031_0246077_461_1015 | 184 |
| 801 | 3300049569 | Ga0501032_0000686 | Ga0501032_0000686_16491_17045 | 184 |
| 802 | 3300049569 | Ga0501032_0001522 | Ga0501032_0001522_14681_15235 | 184 |
| 803 | 3300049569 | Ga0501032_0007044 | Ga0501032_0007044_5282_5836 | 184 |
| 804 | 3300049569 | Ga0501032_0051495 | Ga0501032_0051495_1888_2442 | 184 |
| 805 | 3300049569 | Ga0501032_0060063 | Ga0501032_0060063_1171_1725 | 184 |
| 806 | 3300049569 | Ga0501032_0069873 | Ga0501032_0069873_610_1164 | 184 |
| 807 | 3300049569 | Ga0501032_0191272 | Ga0501032_0191272_381_935 | 184 |
| 808 | 3300049570 | Ga0501033_0003959 | Ga0501033_0003959_1410_1964 | 184 |
| 809 | 3300049570 | Ga0501033_0009007 | Ga0501033_0009007_5250_5804 | 184 |
| 810 | 3300049570 | Ga0501033_0011728 | Ga0501033_0011728_5110_5664 | 184 |
| 811 | 3300049570 | Ga0501033_0017170 | Ga0501033_0017170_4454_5008 | 184 |
| 812 | 3300049570 | Ga0501033_0037585 | Ga0501033_0037585_125_679 | 184 |
| 813 | 3300049570 | Ga0501033_0054186 | Ga0501033_0054186_795_1349 | 184 |
| 814 | 3300049570 | Ga0501033_0078686 | Ga0501033_0078686_555_1109 | 184 |
| 815 | 3300049570 | Ga0501033_0099712 | Ga0501033_0099712_1161_1715 | 184 |
| 816 | 3300049570 | Ga0501033_0849378 | Ga0501033_0849378_38_592 | 184 |
| 817 | 3300049571 | Ga0501034_0000700 | Ga0501034_0000700_10162_10716 | 184 |
| 818 | 3300049571 | Ga0501034_0000987 | Ga0501034_0000987_38373_38927 | 184 |
| 819 | 3300049571 | Ga0501034_0033852 | Ga0501034_0033852_2672_3226 | 184 |
| 820 | 3300049571 | Ga0501034_0037777 | Ga0501034_0037777_4222_4776 | 184 |
| 821 | 3300049571 | Ga0501034_0110839 | Ga0501034_0110839_1436_2011 | 184 |
| 822 | 3300049571 | Ga0501034_0112723 | Ga0501034_0112723_136_690 | 184 |
| 823 | 3300049571 | Ga0501034_0234177 | Ga0501034_0234177_276_830 | 184 |
| 824 | 3300049571 | Ga0501034_0440620 | Ga0501034_0440620_288_842 | 184 |
| 825 | 3300049572 | Ga0501036_0001560 | Ga0501036_0001560_1863_2417 | 184 |
| 826 | 3300049572 | Ga0501036_0014281 | Ga0501036_0014281_133_708 | 184 |
| 827 | 3300049572 | Ga0501036_0030414 | Ga0501036_0030414_1180_1734 | 184 |
| 828 | 3300049572 | Ga0501036_0045495 | Ga0501036_0045495_798_1352 | 184 |
| 829 | 3300049572 | Ga0501036_0046338 | Ga0501036_0046338_2729_3283 | 184 |
| 830 | 3300049572 | Ga0501036_0091993 | Ga0501036_0091993_1927_2481 | 184 |
| 831 | 3300049573 | Ga0501037_0001087 | Ga0501037_0001087_7144_7698 | 184 |
| 832 | 3300049573 | Ga0501037_0025618 | Ga0501037_0025618_628_1203 | 184 |
| 833 | 3300049573 | Ga0501037_0061963 | Ga0501037_0061963_1884_2438 | 184 |
| 834 | 3300049573 | Ga0501037_0080775 | Ga0501037_0080775_650_1204 | 184 |
| 835 | 3300049573 | Ga0501037_0221921 | Ga0501037_0221921_661_1215 | 184 |
| 836 | 3300049574 | Ga0501038_0001100 | Ga0501038_0001100_15859_16413 | 184 |
| 837 | 3300049574 | Ga0501038_0001242 | Ga0501038_0001242_15301_15855 | 184 |
| 838 | 3300049574 | Ga0501038_0088005 | Ga0501038_0088005_1297_1851 | 184 |
| 839 | 3300049574 | Ga0501038_0174750 | Ga0501038_0174750_715_1290 | 184 |
| 840 | 3300049575 | Ga0501039_0004281 | Ga0501039_0004281_7690_8244 | 184 |
| 841 | 3300049575 | Ga0501039_0014667 | Ga0501039_0014667_3417_3992 | 184 |
| 842 | 3300049575 | Ga0501039_0017205 | Ga0501039_0017205_4166_4744 | 184 |
| 843 | 3300049575 | Ga0501039_0021995 | Ga0501039_0021995_2675_3229 | 184 |
| 844 | 3300049575 | Ga0501039_0219304 | Ga0501039_0219304_179_733 | 184 |
| 845 | 3300049576 | Ga0501040_0001045 | Ga0501040_0001045_8641_9195 | 184 |
| 846 | 3300049577 | Ga0501041_0012339 | Ga0501041_0012339_4079_4633 | 184 |
| 847 | 3300049578 | Ga0501042_0002602 | Ga0501042_0002602_7820_8374 | 184 |
| 848 | 3300049578 | Ga0501042_0093193 | Ga0501042_0093193_696_1250 | 184 |
| 849 | 3300049578 | Ga0501042_0216865 | Ga0501042_0216865_613_1188 | 184 |
| 850 | 3300049578 | Ga0501042_0333062 | Ga0501042_0333062_80_634 | 184 |
| 851 | 3300049579 | Ga0501043_0000867 | Ga0501043_0000867_6940_7494 | 184 |
| 852 | 3300049579 | Ga0501043_0029105 | Ga0501043_0029105_1112_1666 | 184 |
| 853 | 3300049579 | Ga0501043_0033018 | Ga0501043_0033018_1749_2303 | 184 |
| 854 | 3300049579 | Ga0501043_0035627 | Ga0501043_0035627_933_1487 | 184 |
| 855 | 3300049579 | Ga0501043_0044064 | Ga0501043_0044064_372_947 | 184 |
| 856 | 3300049579 | Ga0501043_0060168 | Ga0501043_0060168_149_703 | 184 |
| 857 | 3300049579 | Ga0501043_0193409 | Ga0501043_0193409_566_1120 | 184 |
| 858 | 3300049579 | Ga0501043_0592663 | Ga0501043_0592663_135_689 | 184 |
| 859 | 3300049580 | Ga0501046_0000707 | Ga0501046_0000707_7007_7582 | 184 |
| 860 | 3300049580 | Ga0501046_0004881 | Ga0501046_0004881_6568_7122 | 184 |
| 861 | 3300049580 | Ga0501046_0006561 | Ga0501046_0006561_6940_7494 | 184 |
| 862 | 3300049580 | Ga0501046_0038654 | Ga0501046_0038654_282_836 | 184 |
| 863 | 3300049580 | Ga0501046_0145295 | Ga0501046_0145295_474_1049 | 184 |
| 864 | 3300049580 | Ga0501046_0212742 | Ga0501046_0212742_717_1271 | 184 |
| 865 | 3300049581 | Ga0501047_0000112 | Ga0501047_0000112_22054_22608 | 184 |
| 866 | 3300049581 | Ga0501047_0000544 | Ga0501047_0000544_31325_31879 | 184 |
| 867 | 3300049581 | Ga0501047_0023263 | Ga0501047_0023263_1462_2016 | 184 |
| 868 | 3300049581 | Ga0501047_0031600 | Ga0501047_0031600_2010_2564 | 184 |
| 869 | 3300049581 | Ga0501047_0052789 | Ga0501047_0052789_3190_3744 | 184 |
| 870 | 3300049581 | Ga0501047_0065503 | Ga0501047_0065503_738_1292 | 184 |
| 871 | 3300049581 | Ga0501047_0204643 | Ga0501047_0204643_382_936 | 184 |
| 872 | 3300049581 | Ga0501047_0385953 | Ga0501047_0385953_71_625 | 184 |
| 873 | 3300049581 | Ga0501047_0621977 | Ga0501047_0621977_159_734 | 184 |
| 874 | 3300049582 | Ga0501048_0002418 | Ga0501048_0002418_1333_1887 | 184 |
| 875 | 3300049582 | Ga0501048_0010533 | Ga0501048_0010533_578_1132 | 184 |
| 876 | 3300049582 | Ga0501048_0144532 | Ga0501048_0144532_54_608 | 184 |
| 877 | 3300049582 | Ga0501048_0227416 | Ga0501048_0227416_623_1177 | 184 |
| 878 | 3300049583 | Ga0501067_0001531 | Ga0501067_0001531_9992_10546 | 184 |
| 879 | 3300049583 | Ga0501067_0228774 | Ga0501067_0228774_264_839 | 184 |
| 880 | 3300049583 | Ga0501067_0313677 | Ga0501067_0313677_235_789 | 184 |
| 881 | 3300049584 | Ga0501068_0000652 | Ga0501068_0000652_2689_3243 | 184 |
| 882 | 3300049584 | Ga0501068_0136793 | Ga0501068_0136793_551_1105 | 184 |
| 883 | 3300049585 | Ga0501069_0001987 | Ga0501069_0001987_2415_2969 | 184 |
| 884 | 3300049585 | Ga0501069_0475695 | Ga0501069_0475695_155_709 | 184 |
| 885 | 3300049586 | Ga0501070_0005364 | Ga0501070_0005364_455_1009 | 184 |
| 886 | 3300049586 | Ga0501070_0007413 | Ga0501070_0007413_7572_8126 | 184 |
| 887 | 3300049586 | Ga0501070_0008447 | Ga0501070_0008447_5327_5902 | 184 |
| 888 | 3300049586 | Ga0501070_0028520 | Ga0501070_0028520_255_809 | 184 |
| 889 | 3300049586 | Ga0501070_0054517 | Ga0501070_0054517_910_1464 | 184 |
| 890 | 3300049586 | Ga0501070_0238670 | Ga0501070_0238670_754_1308 | 184 |
| 891 | 3300049586 | Ga0501070_0297577 | Ga0501070_0297577_549_1103 | 184 |
| 892 | 3300049587 | Ga0501071_0003645 | Ga0501071_0003645_2690_3244 | 184 |
| 893 | 3300049588 | Ga0501072_0008562 | Ga0501072_0008562_2621_3175 | 184 |
| 894 | 3300049588 | Ga0501072_0425724 | Ga0501072_0425724_217_771 | 184 |
| 895 | 3300049589 | Ga0501073_0014251 | Ga0501073_0014251_1333_1887 | 184 |
| 896 | 3300049589 | Ga0501073_0022877 | Ga0501073_0022877_480_1055 | 184 |
| 897 | 3300049589 | Ga0501073_0066008 | Ga0501073_0066008_1124_1678 | 184 |
| 898 | 3300049589 | Ga0501073_0259648 | Ga0501073_0259648_76_630 | 184 |
| 899 | 3300049589 | Ga0501073_0307588 | Ga0501073_0307588_86_640 | 184 |
| 900 | 3300049590 | Ga0501074_0002273 | Ga0501074_0002273_8353_8907 | 184 |
| 901 | 3300049590 | Ga0501074_0039993 | Ga0501074_0039993_1467_2021 | 184 |
| 902 | 3300049590 | Ga0501074_0132439 | Ga0501074_0132439_1160_1714 | 184 |
| 903 | 3300049592 | Ga0501076_0036062 | Ga0501076_0036062_2553_3107 | 184 |
| 904 | 3300049593 | Ga0501077_0017485 | Ga0501077_0017485_1670_2224 | 184 |
| 905 | 3300049681 | Ga0501251_047748 | Ga0501251_047748_66_620 | 184 |
| 906 | 3300049741 | Ga0501079_0002562 | Ga0501079_0002562_7258_7812 | 184 |
| 907 | 3300049741 | Ga0501079_0094040 | Ga0501079_0094040_994_1548 | 184 |
| 908 | 3300049741 | Ga0501079_0100791 | Ga0501079_0100791_249_803 | 184 |
| 909 | 3300049742 | Ga0501080_0023738 | Ga0501080_0023738_1180_1734 | 184 |
| 910 | 3300049742 | Ga0501080_0081705 | Ga0501080_0081705_1961_2515 | 184 |
| 911 | 3300049744 | Ga0501083_0010392 | Ga0501083_0010392_2114_2668 | 184 |
| 912 | 3300049744 | Ga0501083_0019557 | Ga0501083_0019557_2176_2730 | 184 |
| 913 | 3300049778 | Ga0501282_002622 | Ga0501282_002622_712_1266 | 184 |
| 914 | 3300049822 | Ga0501035_0000870 | Ga0501035_0000870_18111_18665 | 184 |
| 915 | 3300049822 | Ga0501035_0004451 | Ga0501035_0004451_11173_11727 | 184 |
| 916 | 3300049822 | Ga0501035_0015420 | Ga0501035_0015420_4320_4874 | 184 |
| 917 | 3300049822 | Ga0501035_0047700 | Ga0501035_0047700_2712_3266 | 184 |
| 918 | 3300049822 | Ga0501035_0059386 | Ga0501035_0059386_816_1391 | 184 |
| 919 | 3300049822 | Ga0501035_0067815 | Ga0501035_0067815_533_1087 | 184 |
| 920 | 3300049822 | Ga0501035_0132440 | Ga0501035_0132440_1368_1922 | 184 |
| 921 | 3300049822 | Ga0501035_0147643 | Ga0501035_0147643_1024_1578 | 184 |
| 922 | 3300049822 | Ga0501035_0316416 | Ga0501035_0316416_726_1280 | 184 |
| 923 | 3300049823 | Ga0501044_0002317 | Ga0501044_0002317_19263_19817 | 184 |
| 924 | 3300049823 | Ga0501044_0010614 | Ga0501044_0010614_4470_5024 | 184 |
| 925 | 3300049823 | Ga0501044_0011995 | Ga0501044_0011995_4456_5010 | 184 |
| 926 | 3300049823 | Ga0501044_0020341 | Ga0501044_0020341_1038_1592 | 184 |
| 927 | 3300049823 | Ga0501044_0228012 | Ga0501044_0228012_1177_1731 | 184 |
| 928 | 3300049823 | Ga0501044_0274536 | Ga0501044_0274536_220_774 | 184 |
| 929 | 3300049823 | Ga0501044_0324586 | Ga0501044_0324586_77_631 | 184 |
| 930 | 3300049823 | Ga0501044_0338707 | Ga0501044_0338707_763_1317 | 184 |
| 931 | 3300049823 | Ga0501044_0495460 | Ga0501044_0495460_442_996 | 184 |
| 932 | 3300049824 | Ga0501045_0014319 | Ga0501045_0014319_1180_1734 | 184 |
| 933 | 3300049824 | Ga0501045_0077506 | Ga0501045_0077506_616_1170 | 184 |
| 934 | 3300049824 | Ga0501045_0105868 | Ga0501045_0105868_876_1430 | 184 |
| 935 | 3300049824 | Ga0501045_0171368 | Ga0501045_0171368_355_909 | 184 |
| 936 | 3300050490 | nmdc:mga03n38_269825_c1 | nmdc:mga03n38_269825_c1_25_579 | 184 |
| 937 | 3300050490 | nmdc:mga03n38_50584_c1 | nmdc:mga03n38_50584_c1_796_1350 | 184 |
| 938 | 3300050491 | nmdc:mga00v17_171753_c1 | nmdc:mga00v17_171753_c1_421_975 | 184 |
| 939 | 3300050494 | nmdc:mga06z11_222551_c1 | nmdc:mga06z11_222551_c1_495_1049 | 184 |
| 940 | 3300050494 | nmdc:mga06z11_242299_c1 | nmdc:mga06z11_242299_c1_489_1043 | 184 |
| 941 | 3300050494 | nmdc:mga06z11_9099_c1 | nmdc:mga06z11_9099_c1_974_1528 | 184 |
| 942 | 3300050495 | nmdc:mga04h51_7954_c1 | nmdc:mga04h51_7954_c1_1697_2251 | 184 |
| 943 | 3300050496 | nmdc:mga07m45_61521_c1 | nmdc:mga07m45_61521_c1_489_1043 | 184 |
| 944 | 3300050496 | nmdc:mga07m45_84894_c1 | nmdc:mga07m45_84894_c1_544_1098 | 184 |
| 945 | 3300050508 | nmdc:mga09592_220966_c1 | nmdc:mga09592_220966_c1_512_1066 | 184 |
| 946 | 3300053077 | Ga0495601_0019263 | Ga0495601_0019263_2820_3389 | 184 |
| 947 | 3300053077 | Ga0495601_0024467 | Ga0495601_0024467_2188_2742 | 184 |
| 948 | 3300053078 | Ga0495612_0000768 | Ga0495612_0000768_7089_7643 | 184 |
| 949 | 3300053078 | Ga0495612_0005175 | Ga0495612_0005175_1577_2170 | 184 |
| 950 | 3300053083 | Ga0495655_0018188 | Ga0495655_0018188_796_1350 | 184 |
| 951 | 3300053085 | Ga0495619_0113133 | Ga0495619_0113133_1282_1836 | 184 |
| 952 | 3300053085 | Ga0495619_0416383 | Ga0495619_0416383_69_719 | 184 |
| 953 | 3300053086 | Ga0500578_0008090 | Ga0500578_0008090_3660_4214 | 184 |
| 954 | 3300053086 | Ga0500578_0115495 | Ga0500578_0115495_76_630 | 184 |
| 955 | 3300053088 | Ga0500644_0380410 | Ga0500644_0380410_21_575 | 184 |
| 956 | 3300053092 | Ga0500583_0023379 | Ga0500583_0023379_1672_2226 | 184 |
| 957 | 3300053093 | Ga0500651_0288322 | Ga0500651_0288322_202_756 | 184 |
| 958 | 3300053094 | Ga0500566_0086219 | Ga0500566_0086219_98_664 | 184 |
| 959 | 3300053094 | Ga0500566_0145746 | Ga0500566_0145746_536_1090 | 184 |
| 960 | 3300053095 | Ga0500640_000199 | Ga0500640_000199_10741_11295 | 184 |
| 961 | 3300053096 | Ga0500641_0343873 | Ga0500641_0343873_15_569 | 184 |
| 962 | 3300053098 | Ga0500650_0176274 | Ga0500650_0176274_98_652 | 184 |
| 963 | 3300053099 | Ga0500654_049480 | Ga0500654_049480_1132_1686 | 184 |
| 964 | 3300053100 | Ga0500660_029746 | Ga0500660_029746_279_833 | 184 |
| 965 | 3300053101 | Ga0500553_091291 | Ga0500553_091291_139_693 | 184 |
| 966 | 3300053107 | Ga0500560_002560 | Ga0500560_002560_1761_2315 | 184 |
| 967 | 3300053107 | Ga0500560_034312 | Ga0500560_034312_506_1060 | 184 |
| 968 | 3300053109 | Ga0500569_000546 | Ga0500569_000546_428_982 | 184 |
| 969 | 3300053115 | Ga0500591_141766 | Ga0500591_141766_103_669 | 184 |
| 970 | 3300053118 | Ga0500594_0017387 | Ga0500594_0017387_1142_1696 | 184 |
| 971 | 3300053129 | Ga0500628_002653 | Ga0500628_002653_669_1223 | 184 |
| 972 | 3300053129 | Ga0500628_056958 | Ga0500628_056958_282_836 | 184 |
| 973 | 3300053131 | Ga0500652_000612 | Ga0500652_000612_5317_5871 | 184 |
| 974 | 3300053134 | Ga0500658_0003635 | Ga0500658_0003635_4047_4601 | 184 |
| 975 | 3300053137 | Ga0500561_0000617 | Ga0500561_0000617_1567_2121 | 184 |
| 976 | 3300053140 | Ga0500573_0033390 | Ga0500573_0033390_1490_2044 | 184 |
| 977 | 3300053140 | Ga0500573_0096693 | Ga0500573_0096693_234_803 | 184 |
| 978 | 3300053140 | Ga0500573_0203833 | Ga0500573_0203833_462_1016 | 184 |
| 979 | 3300053143 | Ga0500579_028293 | Ga0500579_028293_441_995 | 184 |
| 980 | 3300053146 | Ga0500588_0010244 | Ga0500588_0010244_1100_1654 | 184 |
| 981 | 3300053149 | Ga0500600_0003949 | Ga0500600_0003949_7408_7962 | 184 |
| 982 | 3300053149 | Ga0500600_0126663 | Ga0500600_0126663_253_807 | 184 |
| 983 | 3300053155 | Ga0500620_020076 | Ga0500620_020076_292_858 | 184 |
| 984 | 3300053157 | Ga0500624_041737 | Ga0500624_041737_237_791 | 184 |
| 985 | 3300053160 | Ga0500633_0000470 | Ga0500633_0000470_590_1144 | 184 |
| 986 | 3300053161 | Ga0500634_0010585 | Ga0500634_0010585_3838_4392 | 184 |
| 987 | 3300053732 | Ga0500656_000324 | Ga0500656_000324_2558_3112 | 184 |
| 988 | 3300053739 | Ga0500587_002977 | Ga0500587_002977_169_723 | 184 |
| 989 | 3300054114 | Ga0501084_0001814 | Ga0501084_0001814_1180_1734 | 184 |
| 990 | 3300059504 | Ga0587082_094927 | Ga0587082_094927_27_581 | 184 |
| 991 | 3300059505 | Ga0587083_0034247 | Ga0587083_0034247_33_587 | 184 |
| 992 | 3300059652 | Ga0587107_056688 | Ga0587107_056688_59_613 | 184 |
| 993 | 3300060344 | Ga0587071_102484 | Ga0587071_102484_32_586 | 184 |
| 994 | 3300060353 | Ga0501082_0009754 | Ga0501082_0009754_3250_3804 | 184 |
| 995 | 3300060353 | Ga0501082_0009930 | Ga0501082_0009930_5729_6283 | 184 |
| 996 | 3300061719 | Ga0466962_0001065 | Ga0466962_0001065_1237_1791 | 184 |
| 997 | 3300061719 | Ga0466962_0059802 | Ga0466962_0059802_592_1146 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar