F487683

General Info

Members Datasets Scaffolds Average Seq Length
993 419 989 246

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10024939|Ga0157369_100249394
Length 278
Sequence MAAAPAGDGASQLMAHETVSGFSMVLIFLRSLVFNILFYVVFLAYALLALPTFVMPRAATLKIASWWAKTSIILMRAICGIKVEFRGVEKIPKGPLIVASKHQSMWETISLLRFFEAPFFVVKRELKFIPLFGLYIIKTDMIAINRSAGHRSLLAVMRRAAEEVRHGRQFVIFPEGTRRPVGAPPHYKAGVGLIYTDCGVPCLPVALNSGLFWPRRTFMRYPGTLVVEFLDPIPPGLKRDEFLSRVETAIETATNRIVAVAQEEQKELFGGIPVSSGS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
5 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
6 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
7 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
8 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
9 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
10 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
129 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
221 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
222 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
223 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
224 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
233 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
234 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
237 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
238 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
239 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
243 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
244 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
245 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
246 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
247 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
265 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
282 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
283 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
284 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
285 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
286 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
287 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
288 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
289 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
300 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
301 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
307 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
308 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
309 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
310 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
311 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
315 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
335 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
336 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
337 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
338 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
339 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
352 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
358 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
359 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
360 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
361 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
362 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
363 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
366 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
367 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
368 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
369 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
370 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
371 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
381 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
385 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
386 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
387 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
388 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
394 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
406 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
407 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
408 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
409 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
410 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
411 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
412 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
413 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
414 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
415 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
416 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
417 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
418 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
419 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.1
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0.3
Rhizoplane 5.34
Rhizosphere 90.33
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214828537 2209111006 Bacteria 9410
2 ARcpr5oldR_c000095 3300000041 Bacteria 16151
3 ARSoilYngRDRAFT_c00083 3300000042 Bacteria 15786
4 ARcpr5yngRDRAFT_c000131 3300000043 Bacteria 11784
5 ARSoilOldRDRAFT_c000103 3300000044 Bacteria 15976
6 ARCol0yngRDRAFT_1000337 3300000652 Bacteria 6856
7 JGI24033J26618_1016091 3300002155 Bacteria 927
8 JGI24742J22300_10000394 3300002244 Bacteria 6499
9 rootH2_10100165 3300003320 Bacteria 1594
10 rootL2_10030933 3300003322 Bacteria 1424
11 JGI25405J52794_10002014 3300003911 Bacteria 3446
12 JGI25405J52794_10007463 3300003911 Bacteria 2017
13 Ga0065716_1001619 3300005277 Bacteria 5054
14 Ga0065704_10137881 3300005289 Bacteria 1550
15 Ga0065712_10001578 3300005290 Bacteria 5614
16 Ga0065712_10069047 3300005290 Bacteria 8166
17 Ga0065715_10121747 3300005293 Unclassified 2221
18 Ga0065707_10187075 3300005295 Bacteria 1382
19 Ga0070676_10006196 3300005328 Bacteria 6386
20 Ga0070676_10013024 3300005328 Bacteria 4557
21 Ga0070676_10433655 3300005328 Bacteria 921
22 Ga0070683_100007348 3300005329 Bacteria 9308
23 Ga0070683_100020306 3300005329 Bacteria 5911
24 Ga0070683_100040405 3300005329 Bacteria 4289
25 Ga0070683_100153675 3300005329 Bacteria 2182
26 Ga0070690_100005074 3300005330 Bacteria 7380
27 Ga0070690_100027317 3300005330 Bacteria 3528
28 Ga0070690_100035846 3300005330 Bacteria 3115
29 Ga0070690_100049679 3300005330 Unclassified 2675
30 Ga0070670_100055447 3300005331 Bacteria 3402
31 Ga0070677_10000267 3300005333 Bacteria 18125
32 Ga0068869_100000991 3300005334 Bacteria 16479
33 Ga0068869_100294255 3300005334 Bacteria 1309
34 Ga0070666_10008226 3300005335 Bacteria 6464
35 Ga0070666_10018891 3300005335 Bacteria 4441
36 Ga0070666_10207604 3300005335 Bacteria 1379
37 Ga0070680_100007000 3300005336 Bacteria 8594
38 Ga0070680_100008439 3300005336 Bacteria 7888
39 Ga0070680_100012702 3300005336 Bacteria 6545
40 Ga0070680_100020815 3300005336 Bacteria 5206
41 Ga0070680_100067552 3300005336 Bacteria 2932
42 Ga0070680_100088015 3300005336 Bacteria 2568
43 Ga0070680_100250314 3300005336 Bacteria 1498
44 Ga0070680_100435067 3300005336 Bacteria 1120
45 Ga0070682_100002591 3300005337 Bacteria 9989
46 Ga0070682_100289852 3300005337 Bacteria 1197
47 Ga0070682_100378258 3300005337 Bacteria 1064
48 Ga0068868_100000857 3300005338 Bacteria 20647
49 Ga0068868_100023591 3300005338 Bacteria 4657
50 Ga0070660_100014299 3300005339 Bacteria 5715
51 Ga0070660_100399214 3300005339 Bacteria 1137
52 Ga0070689_100010361 3300005340 Bacteria 6646
53 Ga0070689_100013180 3300005340 Bacteria 5976
54 Ga0070689_100051337 3300005340 Unclassified 3188
55 Ga0070689_100063300 3300005340 Bacteria 2878
56 Ga0070691_10029246 3300005341 Bacteria 2577
57 Ga0070691_10030530 3300005341 Bacteria 2524
58 Ga0070691_10042286 3300005341 Bacteria 2156
59 Ga0070691_10046674 3300005341 Bacteria 2058
60 Ga0070687_100000879 3300005343 Bacteria 10108
61 Ga0070692_10007430 3300005345 Bacteria 4825
62 Ga0070668_100008333 3300005347 Bacteria 7697
63 Ga0070668_100067259 3300005347 Bacteria 2783
64 Ga0070669_100019607 3300005353 Bacteria 4830
65 Ga0070669_100304549 3300005353 Bacteria 1283
66 Ga0070675_100010826 3300005354 Bacteria 7133
67 Ga0070675_100232557 3300005354 Bacteria 1608
68 Ga0070675_100727188 3300005354 Bacteria 905
69 Ga0070671_100000944 3300005355 Bacteria 21285
70 Ga0070671_100157183 3300005355 Unclassified 1921
71 Ga0070674_100017336 3300005356 Bacteria 4528
72 Ga0070674_100660329 3300005356 Bacteria 890
73 Ga0070673_100000633 3300005364 Bacteria 19280
74 Ga0070673_100116722 3300005364 Unclassified 2221
75 Ga0070688_100035313 3300005365 Bacteria 3036
76 Ga0070688_100375379 3300005365 Bacteria 1047
77 Ga0070659_100064907 3300005366 Bacteria 2891
78 Ga0070659_100115832 3300005366 Bacteria 2166
79 Ga0070667_100001396 3300005367 Bacteria 21599
80 Ga0070667_100050018 3300005367 Bacteria 3521
81 Ga0070703_10011756 3300005406 Bacteria 2476
82 Ga0070709_10000722 3300005434 Bacteria 18707
83 Ga0070709_10004671 3300005434 Bacteria 7398
84 Ga0070709_10023256 3300005434 Bacteria 3636
85 Ga0070709_10050036 3300005434 Bacteria 2616
86 Ga0070709_10092801 3300005434 Bacteria 1995
87 Ga0070709_10160974 3300005434 Bacteria 1561
88 Ga0070714_100008512 3300005435 Bacteria 8018
89 Ga0070714_100129629 3300005435 Bacteria 2253
90 Ga0070714_100256954 3300005435 Bacteria 1617
91 Ga0070714_100349371 3300005435 Bacteria 1388
92 Ga0070713_100000642 3300005436 Bacteria 22311
93 Ga0070713_100004821 3300005436 Bacteria 9134
94 Ga0070713_100007931 3300005436 Bacteria 7497
95 Ga0070713_100026650 3300005436 Bacteria 4541
96 Ga0070713_100097930 3300005436 Bacteria 2535
97 Ga0070713_100242144 3300005436 Bacteria 1643
98 Ga0070710_10004932 3300005437 Bacteria 6312
99 Ga0070710_10020026 3300005437 Bacteria 3467
100 Ga0070710_10021462 3300005437 Bacteria 3366
101 Ga0070701_10000873 3300005438 Bacteria 10826
102 Ga0070701_10307819 3300005438 Bacteria 976
103 Ga0070711_100009459 3300005439 Bacteria 6007
104 Ga0070711_100115031 3300005439 Bacteria 1980
105 Ga0070711_100124647 3300005439 Bacteria 1911
106 Ga0070705_100059308 3300005440 Bacteria 2266
107 Ga0070700_100004739 3300005441 Bacteria 7133
108 Ga0070700_100150192 3300005441 Unclassified 1593
109 Ga0070694_100008321 3300005444 Bacteria 6344
110 Ga0070694_100490016 3300005444 Bacteria 977
111 Ga0070663_100016280 3300005455 Bacteria 4824
112 Ga0070663_100072228 3300005455 Bacteria 2513
113 Ga0070663_100225715 3300005455 Bacteria 1472
114 Ga0070663_100245411 3300005455 Bacteria 1415
115 Ga0070663_100451305 3300005455 Bacteria 1060
116 Ga0070678_100002344 3300005456 Bacteria 10343
117 Ga0070678_100141545 3300005456 Bacteria 1925
118 Ga0070678_100341518 3300005456 Bacteria 1285
119 Ga0070662_100009494 3300005457 Bacteria 6362
120 Ga0070662_100498264 3300005457 Bacteria 1016
121 Ga0070681_10004197 3300005458 Bacteria 13650
122 Ga0070681_10016746 3300005458 Bacteria 7318
123 Ga0070681_10017495 3300005458 Bacteria 7164
124 Ga0070681_10062004 3300005458 Bacteria 3713
125 Ga0070681_10097011 3300005458 Bacteria 2895
126 Ga0070681_10593025 3300005458 Unclassified 1022
127 Ga0068867_100012755 3300005459 Bacteria 5946
128 Ga0068867_100082812 3300005459 Bacteria 2421
129 Ga0070685_10003301 3300005466 Bacteria 8193
130 Ga0070685_10099406 3300005466 Unclassified 1774
131 Ga0070706_100499672 3300005467 Bacteria 1132
132 Ga0070707_100110317 3300005468 Bacteria 2668
133 Ga0070698_100112916 3300005471 Bacteria 2682
134 Ga0070679_100025393 3300005530 Bacteria 5813
135 Ga0070679_100026721 3300005530 Bacteria 5675
136 Ga0070679_100036897 3300005530 Bacteria 4852
137 Ga0070679_100040995 3300005530 Bacteria 4608
138 Ga0070679_100044254 3300005530 Bacteria 4435
139 Ga0070679_100095895 3300005530 Bacteria 2954
140 Ga0070679_100411539 3300005530 Bacteria 1298
141 Ga0070679_100437629 3300005530 Bacteria 1252
142 Ga0070679_100509116 3300005530 Bacteria 1148
143 Ga0070684_100001263 3300005535 Bacteria 18118
144 Ga0070684_100010983 3300005535 Bacteria 7201
145 Ga0070684_100043638 3300005535 Bacteria 3873
146 Ga0070684_100644737 3300005535 Bacteria 986
147 Ga0070697_100283828 3300005536 Bacteria 1421
148 Ga0068853_100054922 3300005539 Bacteria 3432
149 Ga0068853_100106418 3300005539 Bacteria 2486
150 Ga0068853_100220556 3300005539 Bacteria 1732
151 Ga0068853_100266189 3300005539 Bacteria 1577
152 Ga0070672_100001723 3300005543 Bacteria 13671
153 Ga0070686_100000756 3300005544 Bacteria 18724
154 Ga0070695_100015352 3300005545 Bacteria 4624
155 Ga0070695_100024416 3300005545 Bacteria 3723
156 Ga0070695_100229826 3300005545 Bacteria 1340
157 Ga0070696_100050404 3300005546 Bacteria 2894
158 Ga0070696_100102807 3300005546 Bacteria 2049
159 Ga0070696_100117701 3300005546 Unclassified 1920
160 Ga0070693_100002926 3300005547 Bacteria 7888
161 Ga0070693_100027245 3300005547 Bacteria 3095
162 Ga0070693_100030565 3300005547 Unclassified 2945
163 Ga0070693_100091036 3300005547 Bacteria 1839
164 Ga0070665_100289292 3300005548 Bacteria 1641
165 Ga0070665_100367669 3300005548 Bacteria 1445
166 Ga0070665_100383269 3300005548 Bacteria 1413
167 Ga0070704_100001802 3300005549 Bacteria 11780
168 Ga0070704_100005673 3300005549 Bacteria 7291
169 Ga0070704_100240939 3300005549 Bacteria 1480
170 Ga0068855_100095859 3300005563 Bacteria 3419
171 Ga0068855_100112221 3300005563 Bacteria 3128
172 Ga0068855_100225181 3300005563 Bacteria 2102
173 Ga0068855_100324424 3300005563 Bacteria 1701
174 Ga0068855_100630414 3300005563 Bacteria 1153
175 Ga0068855_100701696 3300005563 Bacteria 1083
176 Ga0070664_100280384 3300005564 Unclassified 1503
177 Ga0070664_100307577 3300005564 Bacteria 1434
178 Ga0070664_100581472 3300005564 Bacteria 1038
179 Ga0068857_100025885 3300005577 Bacteria 5167
180 Ga0068857_100190520 3300005577 Bacteria 1868
181 Ga0068854_100004810 3300005578 Bacteria 8523
182 Ga0068854_100095436 3300005578 Bacteria 2220
183 Ga0068854_100279882 3300005578 Bacteria 1343
184 Ga0068854_100357345 3300005578 Bacteria 1197
185 Ga0068856_100004424 3300005614 Bacteria 14002
186 Ga0068856_100044447 3300005614 Bacteria 4372
187 Ga0068856_100074648 3300005614 Bacteria 3358
188 Ga0068856_100111050 3300005614 Bacteria 2739
189 Ga0070702_100006077 3300005615 Bacteria 5690
190 Ga0070702_100244126 3300005615 Bacteria 1214
191 Ga0068859_100546039 3300005617 Bacteria 1253
192 Ga0068864_100064945 3300005618 Bacteria 3166
193 Ga0068864_100081011 3300005618 Unclassified 2845
194 Ga0068866_10012989 3300005718 Unclassified 3641
195 Ga0068861_100002263 3300005719 Bacteria 12509
196 Ga0068861_100058064 3300005719 Bacteria 2958
197 Ga0068870_10000323 3300005840 Bacteria 17781
198 Ga0068863_100001487 3300005841 Bacteria 23230
199 Ga0068863_100647762 3300005841 Bacteria 1048
200 Ga0068858_100015978 3300005842 Bacteria 7049
201 Ga0068858_100036975 3300005842 Bacteria 4526
202 Ga0068858_100289241 3300005842 Bacteria 1562
203 Ga0068860_100001886 3300005843 Bacteria 22272
204 Ga0068862_100001462 3300005844 Bacteria 21734
205 Ga0068862_100047241 3300005844 Bacteria 3673
206 Ga0068862_100274895 3300005844 Bacteria 1542
207 Ga0081455_10000313 3300005937 Bacteria 63616
208 Ga0081455_10009815 3300005937 Bacteria 9803
209 Ga0081455_10047326 3300005937 Bacteria 3726
210 Ga0081455_10086807 3300005937 Bacteria 2548
211 Ga0081540_1002067 3300005983 Bacteria 16739
212 Ga0081540_1006887 3300005983 Bacteria 8200
213 Ga0081540_1055532 3300005983 Bacteria 1928
214 Ga0081540_1062498 3300005983 Bacteria 1768
215 Ga0070717_10000881 3300006028 Bacteria 19843
216 Ga0070717_10001127 3300006028 Bacteria 18067
217 Ga0070717_10735485 3300006028 Bacteria 897
218 Ga0070717_10775371 3300006028 Bacteria 872
219 Ga0075363_100028488 3300006048 Unclassified 2873
220 Ga0075364_10227177 3300006051 Bacteria 1267
221 Ga0075432_10005045 3300006058 Bacteria 4494
222 Ga0070715_10001210 3300006163 Bacteria 7423
223 Ga0070715_10026914 3300006163 Bacteria 2292
224 Ga0070715_10055823 3300006163 Bacteria 1716
225 Ga0070716_100004315 3300006173 Bacteria 6777
226 Ga0070716_100090133 3300006173 Bacteria 1854
227 Ga0070712_100015115 3300006175 Bacteria 4963
228 Ga0070712_100056898 3300006175 Bacteria 2745
229 Ga0070712_100105863 3300006175 Bacteria 2090
230 Ga0070712_100122249 3300006175 Bacteria 1960
231 Ga0070712_100379739 3300006175 Bacteria 1163
232 Ga0070712_100459103 3300006175 Bacteria 1062
233 Ga0097621_100006440 3300006237 Bacteria 8336
234 Ga0097621_100059826 3300006237 Bacteria 3120
235 Ga0097621_100150879 3300006237 Bacteria 1993
236 Ga0097621_100365557 3300006237 Bacteria 1286
237 Ga0068871_100004355 3300006358 Bacteria 9840
238 Ga0068871_100009057 3300006358 Bacteria 7188
239 Ga0068871_100350093 3300006358 Bacteria 1306
240 Ga0075428_100002380 3300006844 Bacteria 20410
241 Ga0075430_100000422 3300006846 Bacteria 31579
242 Ga0075431_100001159 3300006847 Bacteria 23724
243 Ga0075433_10002900 3300006852 Bacteria 13140
244 Ga0075433_10080016 3300006852 Bacteria 2880
245 Ga0075433_10363321 3300006852 Bacteria 1279
246 Ga0075434_100002589 3300006871 Bacteria 15970
247 Ga0075434_100008987 3300006871 Bacteria 9307
248 Ga0075434_100027877 3300006871 Bacteria 5545
249 Ga0075434_100060417 3300006871 Bacteria 3770
250 Ga0075434_100115476 3300006871 Bacteria 2697
251 Ga0075434_100241713 3300006871 Bacteria 1825
252 Ga0075429_100003486 3300006880 Bacteria 13420
253 Ga0068865_100006898 3300006881 Bacteria 6960
254 Ga0068865_100018491 3300006881 Bacteria 4497
255 Ga0075436_100058123 3300006914 Bacteria 2671
256 Ga0075436_100064617 3300006914 Bacteria 2530
257 Ga0075436_100083937 3300006914 Bacteria 2211
258 Ga0075436_100296666 3300006914 Bacteria 1158
259 Ga0075436_100327171 3300006914 Bacteria 1102
260 Ga0097620_100546037 3300006931 Bacteria 1253
261 Ga0075435_100012862 3300007076 Bacteria 6206
262 Ga0075435_100063381 3300007076 Bacteria 3002
263 Ga0075435_100155614 3300007076 Bacteria 1923
264 Ga0099795_10054166 3300007788 Bacteria 1470
265 Ga0105251_10036006 3300009011 Unclassified 2439
266 Ga0105251_10046512 3300009011 Bacteria 2088
267 Ga0105244_10025315 3300009036 Bacteria 3227
268 Ga0105240_10016134 3300009093 Bacteria 10123
269 Ga0105240_10135357 3300009093 Bacteria 2951
270 Ga0105240_10157777 3300009093 Bacteria 2697
271 Ga0105240_10202198 3300009093 Bacteria 2327
272 Ga0105240_10287364 3300009093 Bacteria 1887
273 Ga0111539_10001208 3300009094 Bacteria 34372
274 Ga0111539_10002538 3300009094 Bacteria 24172
275 Ga0111539_10007068 3300009094 Bacteria 14397
276 Ga0111539_10068084 3300009094 Bacteria 4203
277 Ga0111539_10110947 3300009094 Bacteria 3219
278 Ga0111539_10520713 3300009094 Bacteria 1385
279 Ga0105245_10001702 3300009098 Bacteria 20025
280 Ga0105245_10083618 3300009098 Unclassified 2922
281 Ga0105245_10096314 3300009098 Bacteria 2731
282 Ga0105247_10006797 3300009101 Bacteria 7054
283 Ga0105247_10025125 3300009101 Bacteria 3595
284 Ga0105247_10046650 3300009101 Bacteria 2660
285 Ga0114129_10006052 3300009147 Bacteria 17153
286 Ga0114129_10026846 3300009147 Bacteria 8152
287 Ga0114129_10733833 3300009147 Bacteria 1266
288 Ga0105243_10171211 3300009148 Bacteria 1881
289 Ga0105243_10374563 3300009148 Bacteria 1315
290 Ga0105241_10010244 3300009174 Bacteria 6885
291 Ga0105241_10012838 3300009174 Bacteria 6148
292 Ga0105241_10053215 3300009174 Bacteria 3094
293 Ga0105241_10145394 3300009174 Unclassified 1934
294 Ga0105242_10016257 3300009176 Bacteria 5784
295 Ga0105248_10002716 3300009177 Bacteria 19655
296 Ga0105248_10037966 3300009177 Bacteria 5388
297 Ga0105237_10018000 3300009545 Bacteria 7320
298 Ga0105237_10031225 3300009545 Bacteria 5404
299 Ga0105237_10066349 3300009545 Bacteria 3604
300 Ga0105237_10073966 3300009545 Bacteria 3399
301 Ga0105237_10536303 3300009545 Bacteria 1177
302 Ga0105238_10006569 3300009551 Bacteria 11582
303 Ga0105238_10038081 3300009551 Bacteria 4885
304 Ga0105238_10073004 3300009551 Bacteria 3426
305 Ga0105238_10132187 3300009551 Bacteria 2474
306 Ga0105238_10163176 3300009551 Bacteria 2204
307 Ga0105238_10332019 3300009551 Bacteria 1507
308 Ga0105238_10424691 3300009551 Bacteria 1324
309 Ga0105249_10071773 3300009553 Bacteria 3200
310 Ga0105239_10031427 3300010375 Bacteria 5839
311 Ga0105239_10073909 3300010375 Bacteria 3748
312 Ga0105239_10280344 3300010375 Bacteria 1876
313 Ga0105239_10280449 3300010375 Bacteria 1876
314 Ga0105239_10884579 3300010375 Bacteria 1025
315 Ga0105246_10000456 3300011119 Bacteria 21904
316 Ga0105246_10113699 3300011119 Unclassified 1993
317 Ga0157345_1002250 3300012498 Bacteria 1357
318 Ga0157342_1000563 3300012507 Unclassified 2334
319 Ga0157371_10075338 3300013102 Bacteria 2390
320 Ga0157371_10087728 3300013102 Bacteria 2203
321 Ga0157370_10100187 3300013104 Bacteria 2714
322 Ga0157370_10153587 3300013104 Bacteria 2142
323 Ga0157369_10015067 3300013105 Bacteria 8727
324 Ga0157369_10024939 3300013105 Bacteria 6644
325 Ga0157369_10160014 3300013105 Bacteria 2377
326 Ga0157369_10415968 3300013105 Bacteria 1394
327 Ga0157374_10034155 3300013296 Bacteria 4643
328 Ga0157374_10043727 3300013296 Bacteria 4139
329 Ga0157374_11028529 3300013296 Unclassified 843
330 Ga0157378_10002239 3300013297 Bacteria 17169
331 Ga0157378_10045507 3300013297 Bacteria 3899
332 Ga0157378_10071403 3300013297 Bacteria 3118
333 Ga0163162_10030118 3300013306 Bacteria 5376
334 Ga0163162_10068914 3300013306 Bacteria 3589
335 Ga0157372_10020685 3300013307 Bacteria 7102
336 Ga0157372_10074269 3300013307 Bacteria 3834
337 Ga0157372_10152439 3300013307 Bacteria 2668
338 Ga0157372_10280402 3300013307 Bacteria 1938
339 Ga0157375_10005758 3300013308 Bacteria 10780
340 Ga0157375_10055503 3300013308 Bacteria 3906
341 Ga0163163_10014654 3300014325 Bacteria 7209
342 Ga0163163_10111908 3300014325 Unclassified 2759
343 Ga0163163_10191967 3300014325 Bacteria 2091
344 Ga0157380_10217494 3300014326 Bacteria 1707
345 Ga0157377_10024854 3300014745 Bacteria 3188
346 Ga0157377_10137805 3300014745 Bacteria 1497
347 Ga0157379_10013988 3300014968 Bacteria 7032
348 Ga0157379_10032340 3300014968 Bacteria 4664
349 Ga0157379_10274816 3300014968 Unclassified 1532
350 Ga0157376_10005756 3300014969 Bacteria 8681
351 Ga0157376_10140218 3300014969 Bacteria 2168
352 Ga0157376_10295230 3300014969 Unclassified 1532
353 Ga0163161_10006245 3300017792 Bacteria 8254
354 Ga0163161_10125273 3300017792 Unclassified 1934
355 Ga0213873_10026281 3300021358 Bacteria 1412
356 Ga0213876_10015832 3300021384 Bacteria 3990
357 Ga0213876_10073960 3300021384 Bacteria 1800
358 Ga0213875_10141946 3300021388 Bacteria 1124
359 Ga0209233_1000798 3300025261 Bacteria 14123
360 Ga0207666_1005675 3300025271 Bacteria 1599
361 Ga0207697_10002825 3300025315 Bacteria 8836
362 Ga0207655_1039908 3300025728 Bacteria 2033
363 Ga0207713_1055334 3300025735 Bacteria 1549
364 Ga0207653_10023381 3300025885 Bacteria 1968
365 Ga0207682_10000143 3300025893 Bacteria 32063
366 Ga0207692_10001544 3300025898 Bacteria 8653
367 Ga0207642_10080556 3300025899 Bacteria 1580
368 Ga0207710_10003619 3300025900 Bacteria 6849
369 Ga0207710_10018917 3300025900 Bacteria 2934
370 Ga0207688_10001469 3300025901 Bacteria 12347
371 Ga0207680_10029590 3300025903 Unclassified 3079
372 Ga0207680_10076238 3300025903 Bacteria 2094
373 Ga0207647_10098196 3300025904 Bacteria 1740
374 Ga0207647_10168272 3300025904 Bacteria 1277
375 Ga0207647_10230941 3300025904 Unclassified 1064
376 Ga0207685_10005498 3300025905 Bacteria 3352
377 Ga0207685_10006477 3300025905 Bacteria 3191
378 Ga0207685_10016450 3300025905 Unclassified 2368
379 Ga0207685_10062571 3300025905 Bacteria 1479
380 Ga0207699_10011898 3300025906 Bacteria 4410
381 Ga0207699_10037563 3300025906 Bacteria 2770
382 Ga0207699_10337908 3300025906 Bacteria 1060
383 Ga0207645_10002217 3300025907 Bacteria 15495
384 Ga0207645_10014177 3300025907 Bacteria 5339
385 Ga0207645_10024316 3300025907 Bacteria 3929
386 Ga0207643_10000336 3300025908 Bacteria 32116
387 Ga0207654_10006679 3300025911 Bacteria 5805
388 Ga0207654_10041916 3300025911 Bacteria 2588
389 Ga0207654_10116824 3300025911 Bacteria 1669
390 Ga0207654_10327574 3300025911 Bacteria 1049
391 Ga0207654_10555515 3300025911 Eukaryota 816
392 Ga0207707_10012389 3300025912 Bacteria 7412
393 Ga0207707_10017176 3300025912 Bacteria 6306
394 Ga0207707_10038190 3300025912 Bacteria 4196
395 Ga0207707_10054577 3300025912 Bacteria 3479
396 Ga0207707_10116255 3300025912 Bacteria 2337
397 Ga0207695_10031611 3300025913 Bacteria 5803
398 Ga0207695_10134614 3300025913 Bacteria 2426
399 Ga0207695_10205357 3300025913 Bacteria 1883
400 Ga0207671_10244902 3300025914 Bacteria 1409
401 Ga0207671_10332688 3300025914 Bacteria 1203
402 Ga0207693_10004427 3300025915 Bacteria 11879
403 Ga0207693_10007401 3300025915 Bacteria 9031
404 Ga0207693_10035421 3300025915 Bacteria 3935
405 Ga0207693_10038153 3300025915 Bacteria 3784
406 Ga0207693_10072563 3300025915 Bacteria 2695
407 Ga0207693_10132793 3300025915 Bacteria 1957
408 Ga0207693_10266309 3300025915 Unclassified 1343
409 Ga0207663_10067158 3300025916 Bacteria 2298
410 Ga0207663_10077560 3300025916 Unclassified 2163
411 Ga0207660_10014956 3300025917 Bacteria 5114
412 Ga0207660_10022567 3300025917 Bacteria 4241
413 Ga0207660_10033243 3300025917 Bacteria 3566
414 Ga0207660_10161860 3300025917 Bacteria 1727
415 Ga0207660_10175556 3300025917 Bacteria 1661
416 Ga0207660_10211800 3300025917 Bacteria 1518
417 Ga0207662_10004640 3300025918 Bacteria 7249
418 Ga0207662_10092431 3300025918 Bacteria 1863
419 Ga0207657_10022892 3300025919 Bacteria 5831
420 Ga0207657_10025017 3300025919 Bacteria 5516
421 Ga0207657_10035264 3300025919 Bacteria 4487
422 Ga0207657_10058740 3300025919 Bacteria 3308
423 Ga0207657_10087461 3300025919 Bacteria 2607
424 Ga0207649_10077511 3300025920 Bacteria 2142
425 Ga0207652_10005136 3300025921 Bacteria 10622
426 Ga0207652_10061720 3300025921 Bacteria 3238
427 Ga0207652_10095945 3300025921 Bacteria 2612
428 Ga0207681_10000782 3300025923 Bacteria 20961
429 Ga0207681_10208023 3300025923 Bacteria 1506
430 Ga0207694_10020377 3300025924 Bacteria 5017
431 Ga0207694_10113403 3300025924 Bacteria 2158
432 Ga0207694_10360359 3300025924 Bacteria 1205
433 Ga0207650_10062541 3300025925 Unclassified 2782
434 Ga0207659_10000676 3300025926 Bacteria 20223
435 Ga0207659_10580363 3300025926 Bacteria 955
436 Ga0207687_10009816 3300025927 Bacteria 6266
437 Ga0207687_10040369 3300025927 Unclassified 3199
438 Ga0207700_10016838 3300025928 Bacteria 4868
439 Ga0207700_10020680 3300025928 Bacteria 4477
440 Ga0207700_10049668 3300025928 Bacteria 3121
441 Ga0207700_10056575 3300025928 Bacteria 2953
442 Ga0207700_10385924 3300025928 Bacteria 1225
443 Ga0207664_10054670 3300025929 Unclassified 3164
444 Ga0207664_10296003 3300025929 Bacteria 1423
445 Ga0207664_10380134 3300025929 Bacteria 1254
446 Ga0207644_10001040 3300025931 Bacteria 17793
447 Ga0207644_10129955 3300025931 Unclassified 1927
448 Ga0207690_10091295 3300025932 Bacteria 2152
449 Ga0207706_10007938 3300025933 Bacteria 9797
450 Ga0207706_10009667 3300025933 Bacteria 8852
451 Ga0207706_10052806 3300025933 Bacteria 3588
452 Ga0207706_10164769 3300025933 Bacteria 1948
453 Ga0207686_10016943 3300025934 Bacteria 4095
454 Ga0207686_10049722 3300025934 Bacteria 2604
455 Ga0207686_10054482 3300025934 Bacteria 2506
456 Ga0207686_10372761 3300025934 Bacteria 1080
457 Ga0207709_10001567 3300025935 Bacteria 15670
458 Ga0207670_10003338 3300025936 Bacteria 8514
459 Ga0207670_10013045 3300025936 Bacteria 4886
460 Ga0207670_10049984 3300025936 Bacteria 2799
461 Ga0207704_10000410 3300025938 Bacteria 19429
462 Ga0207704_10027002 3300025938 Bacteria 3159
463 Ga0207704_10090195 3300025938 Bacteria 2011
464 Ga0207665_10007323 3300025939 Bacteria 7301
465 Ga0207665_10012708 3300025939 Bacteria 5537
466 Ga0207665_10047075 3300025939 Bacteria 2890
467 Ga0207691_10010570 3300025940 Bacteria 8852
468 Ga0207691_10100246 3300025940 Bacteria 2585
469 Ga0207711_10029312 3300025941 Bacteria 4641
470 Ga0207711_10120249 3300025941 Unclassified 2344
471 Ga0207711_10449340 3300025941 Bacteria 1200
472 Ga0207689_10000929 3300025942 Bacteria 28093
473 Ga0207689_10013055 3300025942 Bacteria 7093
474 Ga0207689_10293949 3300025942 Bacteria 1346
475 Ga0207661_10013325 3300025944 Bacteria 6005
476 Ga0207661_10029325 3300025944 Bacteria 4225
477 Ga0207661_10068242 3300025944 Bacteria 2895
478 Ga0207661_10123389 3300025944 Bacteria 2209
479 Ga0207679_10000504 3300025945 Bacteria 26784
480 Ga0207679_10428981 3300025945 Unclassified 1168
481 Ga0207667_10123000 3300025949 Bacteria 2673
482 Ga0207667_10305583 3300025949 Bacteria 1625
483 Ga0207667_10511260 3300025949 Bacteria 1217
484 Ga0207651_10000218 3300025960 Bacteria 24731
485 Ga0207651_10133965 3300025960 Unclassified 1902
486 Ga0207712_10055512 3300025961 Bacteria 2787
487 Ga0207712_10070427 3300025961 Bacteria 2512
488 Ga0207712_10118256 3300025961 Bacteria 2000
489 Ga0207712_10373465 3300025961 Bacteria 1191
490 Ga0207640_10016579 3300025981 Bacteria 4289
491 Ga0207640_10060612 3300025981 Bacteria 2502
492 Ga0207640_10077019 3300025981 Bacteria 2266
493 Ga0207658_10011585 3300025986 Bacteria 6003
494 Ga0207658_10141156 3300025986 Bacteria 1949
495 Ga0207703_10034601 3300026035 Bacteria 4009
496 Ga0207703_10077391 3300026035 Bacteria 2761
497 Ga0207639_10076924 3300026041 Bacteria 2629
498 Ga0207639_10114505 3300026041 Bacteria 2204
499 Ga0207639_10116901 3300026041 Bacteria 2184
500 Ga0207639_10353630 3300026041 Bacteria 1313
501 Ga0207639_10675727 3300026041 Bacteria 957
502 Ga0207639_10824395 3300026041 Bacteria 865
503 Ga0207678_10009656 3300026067 Bacteria 8486
504 Ga0207678_10401490 3300026067 Bacteria 1187
505 Ga0207678_10524003 3300026067 Bacteria 1035
506 Ga0207708_10006214 3300026075 Bacteria 8852
507 Ga0207708_10047822 3300026075 Bacteria 3255
508 Ga0207708_10065389 3300026075 Bacteria 2780
509 Ga0207702_10080934 3300026078 Bacteria 2819
510 Ga0207702_10134646 3300026078 Bacteria 2228
511 Ga0207641_10066451 3300026088 Bacteria 3086
512 Ga0207641_10082855 3300026088 Bacteria 2787
513 Ga0207648_10005804 3300026089 Bacteria 12366
514 Ga0207648_10074468 3300026089 Bacteria 2959
515 Ga0207674_10002908 3300026116 Bacteria 21261
516 Ga0207674_10026497 3300026116 Bacteria 6153
517 Ga0207674_10142978 3300026116 Bacteria 2352
518 Ga0207674_10678702 3300026116 Bacteria 995
519 Ga0207675_100007822 3300026118 Bacteria 10088
520 Ga0207675_100257635 3300026118 Unclassified 1690
521 Ga0207683_10001206 3300026121 Bacteria 23425
522 Ga0207683_10030863 3300026121 Bacteria 4647
523 Ga0207683_10107403 3300026121 Bacteria 2497
524 Ga0207698_10087950 3300026142 Bacteria 2532
525 Ga0207698_10365372 3300026142 Bacteria 1368
526 Ga0209982_1003211 3300027552 Bacteria 2313
527 Ga0209971_1003797 3300027682 Bacteria 3571
528 Ga0209966_1004315 3300027695 Bacteria 2409
529 Ga0209998_10003781 3300027717 Bacteria 3270
530 Ga0209998_10003792 3300027717 Bacteria 3266
531 Ga0209974_10022402 3300027876 Bacteria 2093
532 Ga0207428_10000141 3300027907 Bacteria 97064
533 Ga0207428_10001593 3300027907 Bacteria 23627
534 Ga0207428_10005136 3300027907 Bacteria 12260
535 Ga0207428_10187030 3300027907 Bacteria 1562
536 Ga0268266_10088165 3300028379 Bacteria 2715
537 Ga0268266_10088568 3300028379 Bacteria 2709
538 Ga0268266_10177780 3300028379 Bacteria 1936
539 Ga0268266_10512456 3300028379 Bacteria 1146
540 Ga0268265_10001135 3300028380 Bacteria 23498
541 Ga0268265_10731894 3300028380 Bacteria 958
542 Ga0268264_10014457 3300028381 Bacteria 6487
543 Ga0268264_10163889 3300028381 Bacteria 2005
544 Ga0265337_1000296 3300028556 Bacteria 26607
545 Ga0265319_1027513 3300028563 Bacteria 2016
546 Ga0265334_10001692 3300028573 Bacteria 10542
547 Ga0265323_10003727 3300028653 Bacteria 6664
548 Ga0265336_10000986 3300028666 Bacteria 14032
549 Ga0265338_10000231 3300028800 Bacteria 103805
550 Ga0265338_10483496 3300028800 Bacteria 873
551 Ga0265324_10013312 3300029957 Bacteria 3072
552 Ga0265330_10014658 3300031235 Bacteria 3635
553 Ga0265325_10000690 3300031241 Bacteria 24604
554 Ga0265325_10010027 3300031241 Bacteria 5506
555 Ga0265325_10028932 3300031241 Bacteria 2982
556 Ga0265325_10035022 3300031241 Bacteria 2668
557 Ga0265325_10135278 3300031241 Bacteria 1176
558 Ga0265340_10026105 3300031247 Bacteria 2954
559 Ga0265340_10030643 3300031247 Bacteria 2695
560 Ga0265340_10031252 3300031247 Bacteria 2664
561 Ga0265339_10037681 3300031249 Bacteria 2701
562 Ga0265313_10002305 3300031595 Bacteria 16724
563 Ga0265313_10009868 3300031595 Bacteria 6141
564 Ga0265313_10188762 3300031595 Bacteria 863
565 Ga0316575_10110383 3300031665 Bacteria 1122
566 Ga0316579_10054401 3300031691 Bacteria 1876
567 Ga0265314_10003178 3300031711 Bacteria 16088
568 Ga0265314_10052110 3300031711 Bacteria 2846
569 Ga0307416_100611729 3300032002 Bacteria 1171
570 Ga0373948_0000029 3300034817 Bacteria 17717
571 Ga0373950_0002591 3300034818 Bacteria 2503
572 Ga0373958_0000728 3300034819 Bacteria 4187
573 Ga0373959_0016626 3300034820 Bacteria 1365
574 Ga0373938_0001423 3300034957 Bacteria 3829
575 Ga0373938_0001812 3300034957 Bacteria 3411
576 Ga0373926_0004945 3300035083 Bacteria 4376
577 Ga0373926_0011123 3300035083 Bacteria 3024
578 Ga0373928_0000732 3300035084 Bacteria 6430
579 Ga0373929_0003270 3300035085 Bacteria 2930
580 Ga0373929_0045536 3300035085 Bacteria 988
581 Ga0373934_0003323 3300035086 Bacteria 5889
582 Ga0373934_0020637 3300035086 Bacteria 2533
583 Ga0373940_0000020 3300035088 Bacteria 18639
584 Ga0373940_0018133 3300035088 Bacteria 1762
585 Ga0373944_0000638 3300035089 Bacteria 8357
586 Ga0373949_0001031 3300035090 Bacteria 8546
587 Ga0373949_0017194 3300035090 Bacteria 1628
588 Ga0373951_0000632 3300035091 Bacteria 9701
589 Ga0373952_0001277 3300035092 Bacteria 4598
590 Ga0373923_0000650 3300035111 Bacteria 8771
591 Ga0373923_0004056 3300035111 Bacteria 4808
592 Ga0373923_0007503 3300035111 Bacteria 3838
593 Ga0373932_0000824 3300035112 Bacteria 9169
594 Ga0373932_0010463 3300035112 Bacteria 2245
595 Ga0373932_0090026 3300035112 Bacteria 983
596 Ga0373936_0047880 3300035113 Bacteria 1725
597 Ga0373936_0056963 3300035113 Unclassified 1589
598 Ga0373939_0000304 3300035114 Bacteria 12763
599 Ga0373939_0002434 3300035114 Bacteria 4388
600 Ga0373939_0051291 3300035114 Bacteria 1282
601 Ga0373941_0000192 3300035115 Bacteria 11629
602 Ga0373945_0005539 3300035116 Bacteria 4045
603 Ga0373945_0015166 3300035116 Bacteria 2590
604 Ga0373945_0019235 3300035116 Bacteria 2330
605 Ga0373945_0032407 3300035116 Bacteria 1851
606 Ga0373953_0007644 3300035117 Bacteria 3631
607 Ga0373953_0123569 3300035117 Bacteria 1100
608 Ga0373954_0005424 3300035118 Bacteria 5518
609 Ga0373954_0012703 3300035118 Bacteria 3747
610 Ga0373956_0022469 3300035119 Bacteria 2700
611 Ga0373956_0024959 3300035119 Bacteria 2580
612 Ga0373956_0031625 3300035119 Bacteria 2320
613 Ga0373956_0047276 3300035119 Bacteria 1925
614 Ga0373960_0002257 3300035121 Bacteria 4334
615 Ga0373960_0064629 3300035121 Bacteria 1118
616 Ga0373943_0002507 3300035170 Bacteria 8346
617 Ga0373943_0011522 3300035170 Bacteria 3979
618 Ga0373943_0051729 3300035170 Bacteria 2023
619 Ga0373946_0001871 3300035171 Bacteria 7350
620 Ga0373946_0002136 3300035171 Bacteria 6931
621 Ga0373946_0028827 3300035171 Bacteria 2204
622 Ga0373955_0001041 3300035172 Bacteria 11788
623 Ga0373955_0001377 3300035172 Bacteria 10319
624 Ga0373955_0004535 3300035172 Bacteria 6156
625 Ga0373955_0022802 3300035172 Bacteria 3180
626 Ga0373942_0000056 3300035207 Bacteria 22957
627 Ga0373942_0019892 3300035207 Bacteria 1680
628 Ga0373961_0002275 3300035241 Bacteria 5026
629 Ga0373962_0001582 3300035242 Bacteria 5397
630 Ga0373962_0031991 3300035242 Bacteria 1445
631 Ga0373924_0017621 3300035410 Bacteria 2742
632 Ga0373924_0029920 3300035410 Bacteria 2180
633 Ga0373931_0003875 3300035691 Bacteria 6767
634 Ga0373931_0013186 3300035691 Bacteria 4021
635 Ga0373931_0115102 3300035691 Bacteria 1530
636 Ga0373935_0011194 3300035692 Bacteria 5385
637 Ga0373935_0021066 3300035692 Bacteria 3989
638 Ga0373935_0040207 3300035692 Bacteria 2934
639 Ga0373927_0009888 3300035695 Bacteria 6396
640 Ga0373927_0133121 3300035695 Bacteria 1624
641 Ga0373933_0000018 3300035724 Bacteria 98044
642 Ga0373933_0000947 3300035724 Bacteria 17708
643 Ga0373933_0007487 3300035724 Bacteria 5961
644 Ga0373933_0012539 3300035724 Bacteria 4683
645 Ga0373933_0019220 3300035724 Bacteria 3855
646 Ga0373933_0219099 3300035724 Bacteria 1220
647 Ga0373947_0003178 3300035725 Bacteria 9770
648 Ga0373947_0008118 3300035725 Bacteria 6052
649 Ga0373947_0038172 3300035725 Bacteria 2852
650 Ga0373947_0055070 3300035725 Bacteria 2401
651 Ga0373937_0010961 3300036401 Bacteria 7940
652 Ga0373937_0012538 3300036401 Bacteria 7457
653 Ga0373937_0022444 3300036401 Bacteria 5674
654 Ga0373937_0064009 3300036401 Bacteria 3382
655 Ga0373937_0169963 3300036401 Bacteria 2045
656 Ga0373937_0702098 3300036401 Bacteria 958
657 Ga0372808_009206 3300036459 Bacteria 1378
658 Ga0373925_0001829 3300037068 Bacteria 17750
659 Ga0373925_0014335 3300037068 Bacteria 5734
660 Ga0373925_0017621 3300037068 Bacteria 5181
661 Ga0373925_0046807 3300037068 Bacteria 3217
662 Ga0373925_0352840 3300037068 Bacteria 1194
663 Ga0395899_0009962 3300037312 Bacteria 7289
664 Ga0395900_0014780 3300037418 Bacteria 7955
665 Ga0395900_0184650 3300037418 Bacteria 2117
666 Ga0395898_0012953 3300037466 Bacteria 8601
667 Ga0395898_0049422 3300037466 Bacteria 4121
668 Ga0395898_0057402 3300037466 Bacteria 3794
669 Ga0395898_0073836 3300037466 Bacteria 3295
670 Ga0395898_0120450 3300037466 Bacteria 2514
671 Ga0436364_0055850 3300037853 Bacteria 3170
672 Ga0436364_0957724 3300037853 Bacteria 2162
673 Ga0395901_0019387 3300038443 Bacteria 6954
674 Ga0436365_0304554 3300039437 Bacteria 1031
675 Ga0436365_0498505 3300039437 Bacteria 20124
676 Ga0436365_1010370 3300039437 Bacteria 1466
677 Ga0436365_1336866 3300039437 Bacteria 3729
678 Ga0436365_1836375 3300039437 Unclassified 1048
679 Ga0436360_1364050 3300039438 Bacteria 1331
680 Ga0436361_1043239 3300039447 Bacteria 1819
681 Ga0436363_1235120 3300039450 Bacteria 4322
682 Ga0436363_1385382 3300039450 Bacteria 1474
683 Ga0436362_1148916 3300039453 Bacteria 3099
684 Ga0439453_0011877 3300041408 Bacteria 1459
685 Ga0451835_0128270 3300041492 Bacteria 1038
686 Ga0439464_0042294 3300042439 Bacteria 1301
687 Ga0439460_0003764 3300042461 Bacteria 3669
688 Ga0439440_0016980 3300042993 Bacteria 1599
689 Ga0466963_0235879 3300044694 Bacteria 1282
690 Ga0466963_0256468 3300044694 Bacteria 1227
691 Ga0466971_0043662 3300044719 Bacteria 2014
692 Ga0466970_0067062 3300044765 Bacteria 1927
693 Ga0466957_0308189 3300044842 Bacteria 1065
694 Ga0466959_0038915 3300045049 Bacteria 3514
695 Ga0451576_0022284 3300045051 Bacteria 6871
696 Ga0466967_0074228 3300045976 Bacteria 3054
697 Ga0466967_0412851 3300045976 Bacteria 1315
698 Ga0495592_0001825 3300046454 Bacteria 14963
699 Ga0495592_0015108 3300046454 Bacteria 5864
700 Ga0495592_0035863 3300046454 Bacteria 3737
701 Ga0495592_0051175 3300046454 Bacteria 3068
702 Ga0495592_0279315 3300046454 Bacteria 1093
703 Ga0495603_0153592 3300046455 Bacteria 1336
704 Ga0495629_0001405 3300046459 Bacteria 18978
705 Ga0495629_0082010 3300046459 Bacteria 2250
706 Ga0495651_0004808 3300046462 Bacteria 10341
707 Ga0495651_0011428 3300046462 Bacteria 6822
708 Ga0495651_0065559 3300046462 Bacteria 2773
709 Ga0495653_0012845 3300046463 Bacteria 6836
710 Ga0495653_0021904 3300046463 Bacteria 5173
711 Ga0495653_0070163 3300046463 Bacteria 2623
712 Ga0495580_0020304 3300046472 Bacteria 4919
713 Ga0495580_0163984 3300046472 Unclassified 1537
714 Ga0495582_0004476 3300046473 Bacteria 7857
715 Ga0495582_0022967 3300046473 Bacteria 3411
716 Ga0495582_0023491 3300046473 Bacteria 3373
717 Ga0495582_0060488 3300046473 Bacteria 2090
718 Ga0495639_0001267 3300046475 Bacteria 11371
719 Ga0495639_0015062 3300046475 Bacteria 3352
720 Ga0495662_0000915 3300046476 Bacteria 14429
721 Ga0495664_0008068 3300046477 Bacteria 5860
722 Ga0495664_0024949 3300046477 Bacteria 3477
723 Ga0495664_0029568 3300046477 Bacteria 3205
724 Ga0495664_0129358 3300046477 Bacteria 1528
725 Ga0495584_0006685 3300046491 Bacteria 6030
726 Ga0495585_0003492 3300046492 Bacteria 10604
727 Ga0495594_0001091 3300046499 Bacteria 14170
728 Ga0495608_0002687 3300046511 Bacteria 12772
729 Ga0495608_0013496 3300046511 Bacteria 5666
730 Ga0495608_0035870 3300046511 Bacteria 3341
731 Ga0495608_0056957 3300046511 Bacteria 2580
732 Ga0495608_0176487 3300046511 Bacteria 1353
733 Ga0495618_0005633 3300046514 Bacteria 7614
734 Ga0495618_0064917 3300046514 Bacteria 2320
735 Ga0495618_0252411 3300046514 Bacteria 1106
736 Ga0495628_0001666 3300046516 Bacteria 20271
737 Ga0495628_0053343 3300046516 Unclassified 3190
738 Ga0495628_0131579 3300046516 Bacteria 1913
739 Ga0495628_0162174 3300046516 Bacteria 1698
740 Ga0495630_0017808 3300046517 Bacteria 5209
741 Ga0495630_0020266 3300046517 Bacteria 4901
742 Ga0495630_0066746 3300046517 Bacteria 2704
743 Ga0495644_0006543 3300046523 Bacteria 4509
744 Ga0495663_0010205 3300046525 Bacteria 2610
745 Ga0495666_0004018 3300046526 Bacteria 7436
746 Ga0495666_0033606 3300046526 Bacteria 2505
747 Ga0495652_0002710 3300046529 Bacteria 17983
748 Ga0495652_0053222 3300046529 Bacteria 3451
749 Ga0495665_0002969 3300046531 Bacteria 9164
750 Ga0495665_0013009 3300046531 Bacteria 4505
751 Ga0495640_0018476 3300046533 Bacteria 5167
752 Ga0495586_0017979 3300046535 Bacteria 3760
753 Ga0495587_0003832 3300046536 Bacteria 9975
754 Ga0495587_0053542 3300046536 Bacteria 2379
755 Ga0495587_0180290 3300046536 Bacteria 1198
756 Ga0495587_0293597 3300046536 Bacteria 910
757 Ga0495598_0091172 3300046537 Bacteria 994
758 Ga0495645_0003698 3300046543 Bacteria 10399
759 Ga0495645_0004662 3300046543 Bacteria 9355
760 Ga0495645_0012374 3300046543 Bacteria 6012
761 Ga0495645_0132163 3300046543 Bacteria 1748
762 Ga0495622_0005528 3300046557 Bacteria 5859
763 Ga0495622_0039362 3300046557 Bacteria 2202
764 Ga0495633_0014595 3300046558 Bacteria 4100
765 Ga0495667_0001506 3300046559 Bacteria 15362
766 Ga0495667_0003229 3300046559 Bacteria 10930
767 Ga0495667_0005185 3300046559 Bacteria 8807
768 Ga0495667_0025062 3300046559 Bacteria 4020
769 Ga0495656_0001233 3300046615 Bacteria 8320
770 Ga0495634_0049186 3300046642 Bacteria 2836
771 Ga0495634_0081531 3300046642 Unclassified 2115
772 Ga0495635_0008083 3300046663 Bacteria 7351
773 Ga0495635_0020956 3300046663 Bacteria 4555
774 Ga0495635_0024504 3300046663 Bacteria 4204
775 Ga0495635_0041738 3300046663 Bacteria 3169
776 Ga0495635_0217894 3300046663 Bacteria 1291
777 Ga0495661_0014295 3300046665 Bacteria 5320
778 Ga0495588_0002749 3300046674 Bacteria 7550
779 Ga0495657_0002223 3300046675 Bacteria 16437
780 Ga0495657_0085270 3300046675 Bacteria 2036
781 Ga0495657_0196370 3300046675 Bacteria 1231
782 Ga0495599_0005815 3300046678 Bacteria 7406
783 Ga0495599_0049331 3300046678 Bacteria 2638
784 Ga0495599_0104681 3300046678 Bacteria 1763
785 Ga0495599_0220191 3300046678 Bacteria 1162
786 Ga0495623_0020165 3300046679 Bacteria 4308
787 Ga0495623_0037236 3300046679 Bacteria 3114
788 Ga0495646_0016004 3300046680 Bacteria 4759
789 Ga0495646_0016027 3300046680 Bacteria 4757
790 Ga0495646_0033558 3300046680 Unclassified 3190
791 Ga0495646_0076350 3300046680 Bacteria 1962
792 Ga0495647_0002278 3300046681 Bacteria 6021
793 Ga0495658_0000324 3300046683 Bacteria 26774
794 Ga0495658_0013771 3300046683 Bacteria 4122
795 Ga0495658_0063056 3300046683 Bacteria 2132
796 Ga0495658_0158236 3300046683 Bacteria 1395
797 Ga0495669_0112739 3300046684 Bacteria 1271
798 Ga0495613_0016947 3300046689 Bacteria 5424
799 Ga0495613_0058378 3300046689 Bacteria 2832
800 Ga0495624_0003658 3300046690 Bacteria 11369
801 Ga0495624_0021563 3300046690 Bacteria 4270
802 Ga0495624_0061839 3300046690 Bacteria 2344
803 Ga0495670_0006352 3300046691 Bacteria 5804
804 Ga0495589_0051403 3300046794 Unclassified 2038
805 Ga0495600_0001403 3300046809 Bacteria 13299
806 Ga0495600_0017296 3300046809 Bacteria 4584
807 Ga0495600_0020344 3300046809 Bacteria 4245
808 Ga0495581_0028637 3300047315 Bacteria 3229
809 Ga0495581_0043319 3300047315 Bacteria 2603
810 Ga0495604_0007422 3300047317 Bacteria 8684
811 Ga0495604_0009389 3300047317 Bacteria 7737
812 Ga0495604_0017550 3300047317 Bacteria 5730
813 Ga0495604_0048028 3300047317 Bacteria 3321
814 Ga0495674_0066216 3300047319 Bacteria 3135
815 Ga0495674_0084429 3300047319 Bacteria 2721
816 Ga0495674_0111053 3300047319 Bacteria 2324
817 Ga0495674_0352454 3300047319 Bacteria 1194
818 Ga0495676_0041785 3300047321 Bacteria 3770
819 Ga0495676_0120217 3300047321 Bacteria 1912
820 Ga0495680_0003143 3300047322 Bacteria 16455
821 Ga0495680_0004047 3300047322 Bacteria 14135
822 Ga0495680_0010930 3300047322 Bacteria 8066
823 Ga0495680_0015013 3300047322 Bacteria 6688
824 Ga0495680_0032161 3300047322 Bacteria 4262
825 Ga0495680_0197558 3300047322 Bacteria 1444
826 Ga0495675_0000855 3300047444 Bacteria 18610
827 Ga0495675_0041667 3300047444 Bacteria 2926
828 Ga0495675_0296928 3300047444 Bacteria 960
829 Ga0495677_0169583 3300047445 Bacteria 844
830 Ga0495679_050851 3300047446 Bacteria 1245
831 Ga0495684_0000281 3300047471 Bacteria 41079
832 Ga0495684_0080691 3300047471 Unclassified 2469
833 Ga0495684_0200681 3300047471 Bacteria 1470
834 Ga0495602_0002833 3300048088 Bacteria 17757
835 Ga0495602_0008505 3300048088 Bacteria 10717
836 Ga0495602_0071789 3300048088 Bacteria 2955
837 Ga0496100_0031614 3300048903 Bacteria 3292
838 Ga0496100_0057790 3300048903 Bacteria 2542
839 Ga0496101_0024709 3300048904 Bacteria 4161
840 Ga0496101_0027498 3300048904 Bacteria 3963
841 Ga0496101_0030324 3300048904 Bacteria 3790
842 Ga0496102_0028999 3300048905 Bacteria 4947
843 Ga0496102_0444389 3300048905 Bacteria 1216
844 Ga0496103_0010637 3300048906 Bacteria 5443
845 Ga0496103_0021493 3300048906 Bacteria 3882
846 Ga0496103_0207957 3300048906 Bacteria 1258
847 Ga0496103_0233061 3300048906 Bacteria 1184
848 Ga0496104_0000140 3300048907 Bacteria 67259
849 Ga0496104_0025301 3300048907 Bacteria 5471
850 Ga0496104_0407161 3300048907 Bacteria 1272
851 Ga0496105_0012751 3300048908 Bacteria 6659
852 Ga0496105_0133364 3300048908 Bacteria 2046
853 Ga0496106_0080930 3300048909 Unclassified 2495
854 Ga0496106_0148107 3300048909 Bacteria 1850
855 Ga0496106_0433304 3300048909 Bacteria 1056
856 Ga0496107_0055339 3300048910 Bacteria 2865
857 Ga0496107_0065131 3300048910 Bacteria 2641
858 Ga0496107_0072288 3300048910 Unclassified 2507
859 Ga0496107_0094950 3300048910 Bacteria 2181
860 Ga0496107_0362690 3300048910 Bacteria 1078
861 Ga0496108_0026962 3300048911 Bacteria 4741
862 Ga0496108_0092663 3300048911 Bacteria 2569
863 Ga0496108_0142857 3300048911 Bacteria 2062
864 Ga0496109_0000619 3300048912 Bacteria 29616
865 Ga0496109_0004242 3300048912 Bacteria 11968
866 Ga0496109_0015606 3300048912 Bacteria 6624
867 Ga0496109_0061522 3300048912 Bacteria 3432
868 Ga0496109_0113086 3300048912 Bacteria 2525
869 Ga0496110_0074313 3300048913 Bacteria 3018
870 Ga0496110_0267849 3300048913 Bacteria 1555
871 Ga0496111_0038109 3300048914 Bacteria 3443
872 Ga0496111_0333777 3300048914 Bacteria 1122
873 Ga0496112_0028452 3300048915 Bacteria 5394
874 Ga0496112_0055487 3300048915 Bacteria 3895
875 Ga0496112_0072199 3300048915 Bacteria 3412
876 Ga0496112_0134035 3300048915 Bacteria 2448
877 Ga0496112_0139189 3300048915 Unclassified 2396
878 Ga0496112_0431710 3300048915 Bacteria 1256
879 Ga0496113_0002588 3300048916 Bacteria 10566
880 Ga0496113_0043744 3300048916 Bacteria 3315
881 Ga0496113_0065836 3300048916 Bacteria 2743
882 Ga0496114_0004604 3300048917 Bacteria 10712
883 Ga0496114_0025212 3300048917 Bacteria 4859
884 Ga0496114_0033283 3300048917 Bacteria 4246
885 Ga0496115_0014172 3300048918 Bacteria 6032
886 Ga0496115_0055554 3300048918 Unclassified 3180
887 Ga0496115_0068679 3300048918 Bacteria 2870
888 Ga0496115_0093633 3300048918 Bacteria 2457
889 Ga0496115_0106822 3300048918 Bacteria 2298
890 Ga0496119_0349193 3300048922 Unclassified 717
891 Ga0496121_0041970 3300048924 Bacteria 3988
892 Ga0496125_0113922 3300048928 Bacteria 1949
893 Ga0496125_0307167 3300048928 Bacteria 968
894 Ga0496126_0119958 3300048929 Bacteria 2282
895 Ga0501032_0132880 3300049569 Bacteria 1641
896 Ga0501034_0013429 3300049571 Bacteria 8430
897 Ga0501034_0421960 3300049571 Bacteria 1255
898 Ga0501037_0122421 3300049573 Bacteria 1869
899 Ga0501043_0029684 3300049579 Bacteria 4296
900 Ga0501046_0300203 3300049580 Bacteria 1173
901 Ga0501047_0202871 3300049581 Bacteria 1843
902 Ga0501047_0339206 3300049581 Bacteria 1341
903 Ga0501070_0009862 3300049586 Bacteria 8075
904 Ga0501070_0024450 3300049586 Bacteria 5067
905 Ga0501071_0528986 3300049587 Bacteria 905
906 Ga0501073_0357568 3300049589 Bacteria 1008
907 Ga0501074_0011255 3300049590 Bacteria 6503
908 Ga0501076_0152857 3300049592 Bacteria 1877
909 Ga0501077_0021570 3300049593 Bacteria 4077
910 Ga0501079_0411035 3300049741 Bacteria 1062
911 Ga0501080_0022077 3300049742 Bacteria 5897
912 Ga0501080_0207364 3300049742 Bacteria 1797
913 Ga0501080_0239302 3300049742 Bacteria 1657
914 Ga0501081_0026167 3300049743 Bacteria 3932
915 Ga0501044_0014594 3300049823 Bacteria 8473
916 nmdc:mga03n38_17568_c2 3300050490 Unclassified 1905
917 nmdc:mga06z11_282720_c1 3300050494 Bacteria 983
918 nmdc:mga05p37_40044_c1 3300050507 Bacteria 5755
919 nmdc:mga05p37_819_c2 3300050507 Bacteria 27529
920 nmdc:mga09592_324_c1 3300050508 Bacteria 34853
921 nmdc:mga0qj67_656_c1 3300050509 Bacteria 23860
922 nmdc:mga06r32_1450_c1 3300050510 Bacteria 21424
923 nmdc:mga08y16_210372_c1 3300050511 Bacteria 2014
924 nmdc:mga08y16_22135_c1 3300050511 Bacteria 6711
925 nmdc:mga08y16_335733_c1 3300050511 Bacteria 1554
926 nmdc:mga08y16_4006_c1 3300050511 Bacteria 15356
927 nmdc:mga08y16_697_c1 3300050511 Bacteria 31905
928 nmdc:mga0n895_100511_c1 3300050512 Bacteria 2901
929 nmdc:mga0n895_111676_c1 3300050512 Bacteria 2750
930 nmdc:mga0n895_16263_c1 3300050512 Bacteria 6821
931 nmdc:mga0n895_261728_c1 3300050512 Bacteria 1755
932 nmdc:mga0n895_2721_c1 3300050512 Bacteria 13944
933 nmdc:mga0n895_275559_c1 3300050512 Bacteria 1706
934 nmdc:mga0n895_415187_c1 3300050512 Bacteria 1361
935 nmdc:mga0n895_609_c1 3300050512 Bacteria 24818
936 nmdc:mga0n895_711369_c1 3300050512 Unclassified 1000
937 nmdc:mga0rr50_136834_c1 3300050513 Bacteria 1967
938 nmdc:mga0rr50_17588_c1 3300050513 Bacteria 4777
939 nmdc:mga0rr50_55646_c1 3300050513 Bacteria 2952
940 nmdc:mga0rr50_75998_c1 3300050513 Bacteria 2577
941 nmdc:mga0rr50_937_c1 3300050513 Bacteria 15770
942 nmdc:mga08x19_147437_c1 3300050514 Unclassified 1592
943 nmdc:mga08x19_157081_c1 3300050514 Bacteria 1543
944 nmdc:mga08x19_57716_c1 3300050514 Bacteria 2509
945 nmdc:mga0a205_16026_c1 3300050515 Bacteria 7015
946 nmdc:mga0a205_6688_c1 3300050515 Bacteria 10430
947 Ga0495601_0001033 3300053077 Bacteria 15194
948 Ga0495601_0004507 3300053077 Bacteria 8052
949 Ga0495601_0016338 3300053077 Bacteria 4497
950 Ga0495601_0017173 3300053077 Bacteria 4392
951 Ga0495601_0047971 3300053077 Bacteria 2689
952 Ga0495601_0076263 3300053077 Bacteria 2146
953 Ga0495601_0088267 3300053077 Bacteria 1994
954 Ga0495601_0591607 3300053077 Bacteria 712
955 Ga0495612_0001046 3300053078 Bacteria 11336
956 Ga0495612_0001141 3300053078 Bacteria 10900
957 Ga0495612_0006352 3300053078 Bacteria 4868
958 Ga0495612_0008725 3300053078 Bacteria 4112
959 Ga0495612_0013910 3300053078 Bacteria 3242
960 Ga0495612_0014541 3300053078 Bacteria 3163
961 Ga0495612_0046103 3300053078 Bacteria 1785
962 Ga0495612_0089950 3300053078 Bacteria 1298
963 Ga0495595_0000992 3300053084 Bacteria 10951
964 Ga0495595_0001007 3300053084 Bacteria 10852
965 Ga0495595_0001438 3300053084 Bacteria 9274
966 Ga0495595_0003165 3300053084 Bacteria 6527
967 Ga0495595_0004374 3300053084 Bacteria 5688
968 Ga0495619_0000421 3300053085 Bacteria 28651
969 Ga0495619_0000715 3300053085 Bacteria 21668
970 Ga0495619_0001421 3300053085 Bacteria 15730
971 Ga0495619_0003244 3300053085 Bacteria 10530
972 Ga0495619_0007425 3300053085 Bacteria 6944
973 Ga0495619_0022678 3300053085 Bacteria 4020
974 Ga0495619_0378416 3300053085 Unclassified 978
975 Ga0500647_0075881 3300053091 Bacteria 1613
976 Ga0500566_0000805 3300053094 Bacteria 17856
977 Ga0500640_019219 3300053095 Bacteria 2923
978 Ga0500572_002826 3300053111 Bacteria 4091
979 Ga0500591_067383 3300053115 Bacteria 1631
980 Ga0500608_033532 3300053122 Bacteria 2444
981 Ga0500614_001346 3300053123 Bacteria 5914
982 Ga0500559_0009559 3300053136 Bacteria 4188
983 Ga0500590_055973 3300053148 Bacteria 1994
984 Ga0500603_000530 3300053150 Bacteria 9625
985 Ga0500630_000445 3300053159 Bacteria 18003
986 Ga0500639_000103 3300053163 Bacteria 39784
987 Ga0500596_000547 3300053735 Bacteria 7142
988 Ga0501084_0132795 3300054114 Bacteria 2096
989 Ga0466962_0072446 3300061719 Bacteria 1646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035112 Ga0373932_0010463 Ga0373932_0010463_1574_2215 213
2 3300048922 Ga0496119_0349193 Ga0496119_0349193_20_661 213
3 3300053077 Ga0495601_0591607 Ga0495601_0591607_58_699 213
4 3300049587 Ga0501071_0528986 Ga0501071_0528986_243_890 215
5 3300005435 Ga0070714_100129629 Ga0070714_1001296292 221
6 3300005436 Ga0070713_100007931 Ga0070713_1000079313 221
7 3300006028 Ga0070717_10000881 Ga0070717_1000088115 221
8 3300006175 Ga0070712_100459103 Ga0070712_1004591031 221
9 3300035724 Ga0373933_0000018 Ga0373933_0000018_66289_67071 221
10 3300048907 Ga0496104_0000140 Ga0496104_0000140_52836_53522 224
11 3300006237 Ga0097621_100150879 Ga0097621_1001508792 225
12 3300025915 Ga0207693_10132793 Ga0207693_101327932 226
13 3300046809 Ga0495600_0017296 Ga0495600_0017296_23_715 226
14 3300053085 Ga0495619_0378416 Ga0495619_0378416_85_777 226
15 3300025261 Ga0209233_1000798 Ga0209233_100079816 230
16 3300009011 Ga0105251_10036006 Ga0105251_100360063 231
17 3300009094 Ga0111539_10110947 Ga0111539_101109473 231
18 3300009098 Ga0105245_10083618 Ga0105245_100836183 231
19 3300009101 Ga0105247_10025125 Ga0105247_100251252 231
20 3300009174 Ga0105241_10145394 Ga0105241_101453942 231
21 3300009176 Ga0105242_10016257 Ga0105242_100162572 231
22 3300009545 Ga0105237_10536303 Ga0105237_105363031 231
23 3300009551 Ga0105238_10038081 Ga0105238_100380815 231
24 3300010375 Ga0105239_10280449 Ga0105239_102804492 231
25 3300011119 Ga0105246_10113699 Ga0105246_101136992 231
26 3300012507 Ga0157342_1000563 Ga0157342_10005633 231
27 3300013296 Ga0157374_11028529 Ga0157374_110285291 231
28 3300013297 Ga0157378_10071403 Ga0157378_100714032 231
29 3300014325 Ga0163163_10111908 Ga0163163_101119083 231
30 3300014969 Ga0157376_10295230 Ga0157376_102952302 231
31 3300035085 Ga0373929_0003270 Ga0373929_0003270_484_1179 231
32 3300035090 Ga0373949_0017194 Ga0373949_0017194_15_710 231
33 3300035111 Ga0373923_0004056 Ga0373923_0004056_3572_4402 231
34 3300035114 Ga0373939_0051291 Ga0373939_0051291_290_985 231
35 3300035116 Ga0373945_0005539 Ga0373945_0005539_2918_3613 231
36 3300035119 Ga0373956_0047276 Ga0373956_0047276_872_1702 231
37 3300035121 Ga0373960_0064629 Ga0373960_0064629_80_775 231
38 3300035170 Ga0373943_0002507 Ga0373943_0002507_825_1520 231
39 3300035171 Ga0373946_0002136 Ga0373946_0002136_3901_4596 231
40 3300035242 Ga0373962_0031991 Ga0373962_0031991_729_1424 231
41 3300035691 Ga0373931_0115102 Ga0373931_0115102_554_1249 231
42 3300035692 Ga0373935_0021066 Ga0373935_0021066_2209_2904 231
43 3300035695 Ga0373927_0009888 Ga0373927_0009888_5232_5927 231
44 3300035725 Ga0373947_0003178 Ga0373947_0003178_7470_8165 231
45 3300036401 Ga0373937_0702098 Ga0373937_0702098_157_852 231
46 3300037068 Ga0373925_0001829 Ga0373925_0001829_4681_5376 231
47 3300037068 Ga0373925_0046807 Ga0373925_0046807_596_1426 231
48 3300046459 Ga0495629_0001405 Ga0495629_0001405_10801_11496 231
49 3300046473 Ga0495582_0004476 Ga0495582_0004476_678_1373 231
50 3300046499 Ga0495594_0001091 Ga0495594_0001091_8880_9575 231
51 3300046514 Ga0495618_0064917 Ga0495618_0064917_512_1342 231
52 3300046536 Ga0495587_0293597 Ga0495587_0293597_149_844 231
53 3300046681 Ga0495647_0002278 Ga0495647_0002278_4383_5078 231
54 3300046683 Ga0495658_0000324 Ga0495658_0000324_14951_15646 231
55 3300046690 Ga0495624_0021563 Ga0495624_0021563_2791_3621 231
56 3300047321 Ga0495676_0120217 Ga0495676_0120217_1091_1786 231
57 3300047322 Ga0495680_0004047 Ga0495680_0004047_6784_7479 231
58 3300048904 Ga0496101_0027498 Ga0496101_0027498_2801_3496 231
59 3300048905 Ga0496102_0444389 Ga0496102_0444389_510_1205 231
60 3300048906 Ga0496103_0021493 Ga0496103_0021493_1317_2012 231
61 3300048906 Ga0496103_0207957 Ga0496103_0207957_473_1168 231
62 3300048907 Ga0496104_0407161 Ga0496104_0407161_110_805 231
63 3300048908 Ga0496105_0133364 Ga0496105_0133364_1236_1931 231
64 3300048910 Ga0496107_0094950 Ga0496107_0094950_1236_1931 231
65 3300048910 Ga0496107_0362690 Ga0496107_0362690_191_886 231
66 3300048911 Ga0496108_0026962 Ga0496108_0026962_3330_4025 231
67 3300048911 Ga0496108_0092663 Ga0496108_0092663_110_805 231
68 3300048912 Ga0496109_0015606 Ga0496109_0015606_1871_2566 231
69 3300048912 Ga0496109_0061522 Ga0496109_0061522_2011_2706 231
70 3300048913 Ga0496110_0074313 Ga0496110_0074313_817_1512 231
71 3300048914 Ga0496111_0333777 Ga0496111_0333777_122_817 231
72 3300048915 Ga0496112_0055487 Ga0496112_0055487_3081_3776 231
73 3300048915 Ga0496112_0139189 Ga0496112_0139189_790_1485 231
74 3300048916 Ga0496113_0043744 Ga0496113_0043744_730_1425 231
75 3300048916 Ga0496113_0065836 Ga0496113_0065836_1843_2538 231
76 3300048917 Ga0496114_0004604 Ga0496114_0004604_9626_10321 231
77 3300048918 Ga0496115_0055554 Ga0496115_0055554_714_1409 231
78 3300048928 Ga0496125_0113922 Ga0496125_0113922_457_1152 231
79 3300050511 nmdc:mga08y16_210372_c1 nmdc:mga08y16_210372_c1_207_902 231
80 3300050512 nmdc:mga0n895_100511_c1 nmdc:mga0n895_100511_c1_905_1600 231
81 3300050512 nmdc:mga0n895_111676_c1 nmdc:mga0n895_111676_c1_1664_2359 231
82 3300050513 nmdc:mga0rr50_55646_c1 nmdc:mga0rr50_55646_c1_817_1512 231
83 3300050514 nmdc:mga08x19_147437_c1 nmdc:mga08x19_147437_c1_709_1404 231
84 3300053085 Ga0495619_0001421 Ga0495619_0001421_7470_8165 231
85 3300035083 Ga0373926_0011123 Ga0373926_0011123_2172_3002 232
86 3300035116 Ga0373945_0015166 Ga0373945_0015166_1670_2500 232
87 3300035117 Ga0373953_0123569 Ga0373953_0123569_153_908 232
88 3300035171 Ga0373946_0028827 Ga0373946_0028827_568_1398 232
89 3300035410 Ga0373924_0017621 Ga0373924_0017621_317_1147 232
90 3300035695 Ga0373927_0133121 Ga0373927_0133121_247_1077 232
91 3300035724 Ga0373933_0219099 Ga0373933_0219099_143_973 232
92 3300035725 Ga0373947_0008118 Ga0373947_0008118_1904_2734 232
93 3300036401 Ga0373937_0169963 Ga0373937_0169963_812_1642 232
94 3300046454 Ga0495592_0051175 Ga0495592_0051175_1681_2511 232
95 3300046473 Ga0495582_0060488 Ga0495582_0060488_738_1568 232
96 3300046475 Ga0495639_0015062 Ga0495639_0015062_27_857 232
97 3300046477 Ga0495664_0029568 Ga0495664_0029568_1944_2774 232
98 3300046511 Ga0495608_0176487 Ga0495608_0176487_393_1148 232
99 3300046517 Ga0495630_0020266 Ga0495630_0020266_3821_4651 232
100 3300046531 Ga0495665_0013009 Ga0495665_0013009_2861_3691 232
101 3300046536 Ga0495587_0180290 Ga0495587_0180290_244_1074 232
102 3300046543 Ga0495645_0132163 Ga0495645_0132163_409_1239 232
103 3300046642 Ga0495634_0049186 Ga0495634_0049186_314_1144 232
104 3300046663 Ga0495635_0217894 Ga0495635_0217894_373_1203 232
105 3300046680 Ga0495646_0016027 Ga0495646_0016027_112_942 232
106 3300046683 Ga0495658_0158236 Ga0495658_0158236_247_1077 232
107 3300046689 Ga0495613_0058378 Ga0495613_0058378_1491_2321 232
108 3300047315 Ga0495581_0028637 Ga0495581_0028637_1997_2827 232
109 3300047319 Ga0495674_0066216 Ga0495674_0066216_23_784 232
110 3300047471 Ga0495684_0200681 Ga0495684_0200681_251_1081 232
111 3300053078 Ga0495612_0008725 Ga0495612_0008725_1317_2147 232
112 3300021358 Ga0213873_10026281 Ga0213873_100262812 233
113 3300021384 Ga0213876_10015832 Ga0213876_100158321 233
114 3300039437 Ga0436365_0498505 Ga0436365_0498505_8375_9142 233
115 3300039450 Ga0436363_1385382 Ga0436363_1385382_416_1183 233
116 3300039453 Ga0436362_1148916 Ga0436362_1148916_1676_2443 233
117 3300035410 Ga0373924_0029920 Ga0373924_0029920_353_1069 234
118 3300037312 Ga0395899_0009962 Ga0395899_0009962_4389_5102 236
119 3300037418 Ga0395900_0014780 Ga0395900_0014780_4780_5493 236
120 3300037466 Ga0395898_0012953 Ga0395898_0012953_1056_1769 236
121 3300038443 Ga0395901_0019387 Ga0395901_0019387_3549_4262 236
122 3300005337 Ga0070682_100378258 Ga0070682_1003782582 237
123 3300031665 Ga0316575_10110383 Ga0316575_101103832 237
124 3300037466 Ga0395898_0120450 Ga0395898_0120450_1259_1975 237
125 3300005530 Ga0070679_100095895 Ga0070679_1000958954 238
126 3300005983 Ga0081540_1062498 Ga0081540_10624982 238
127 3300025921 Ga0207652_10061720 Ga0207652_100617202 238
128 3300054114 Ga0501084_0132795 Ga0501084_0132795_1303_2079 238
129 3300028800 Ga0265338_10483496 Ga0265338_104834961 239
130 3300031247 Ga0265340_10031252 Ga0265340_100312522 239
131 3300035118 Ga0373954_0012703 Ga0373954_0012703_1477_2196 239
132 3300035119 Ga0373956_0022469 Ga0373956_0022469_533_1252 239
133 3300035172 Ga0373955_0001377 Ga0373955_0001377_2148_2867 239
134 3300035724 Ga0373933_0000947 Ga0373933_0000947_193_912 239
135 3300036401 Ga0373937_0010961 Ga0373937_0010961_5164_5883 239
136 3300046511 Ga0495608_0013496 Ga0495608_0013496_4488_5207 239
137 3300046675 Ga0495657_0196370 Ga0495657_0196370_201_920 239
138 3300047317 Ga0495604_0048028 Ga0495604_0048028_1724_2443 239
139 3300047322 Ga0495680_0015013 Ga0495680_0015013_905_1624 239
140 3300049571 Ga0501034_0013429 Ga0501034_0013429_4529_5251 239
141 3300049586 Ga0501070_0024450 Ga0501070_0024450_1190_1912 239
142 3300049742 Ga0501080_0207364 Ga0501080_0207364_593_1315 239
143 3300053077 Ga0495601_0017173 Ga0495601_0017173_626_1345 239
144 3300053078 Ga0495612_0089950 Ga0495612_0089950_269_988 239
145 3300053084 Ga0495595_0003165 Ga0495595_0003165_2952_3671 239
146 3300053085 Ga0495619_0003244 Ga0495619_0003244_7334_8053 239
147 3300031241 Ga0265325_10010027 Ga0265325_100100272 240
148 3300031241 Ga0265325_10135278 Ga0265325_101352782 240
149 3300031249 Ga0265339_10037681 Ga0265339_100376812 240
150 3300031595 Ga0265313_10002305 Ga0265313_1000230517 240
151 3300031711 Ga0265314_10003178 Ga0265314_1000317817 240
152 3300031711 Ga0265314_10052110 Ga0265314_100521103 240
153 iso_pu_bacteria 2791355197 2793070500 240
154 3300005336 Ga0070680_100067552 Ga0070680_1000675523 241
155 3300005437 Ga0070710_10021462 Ga0070710_100214621 241
156 3300005530 Ga0070679_100025393 Ga0070679_1000253935 241
157 3300005535 Ga0070684_100043638 Ga0070684_1000436384 241
158 3300005539 Ga0068853_100220556 Ga0068853_1002205563 241
159 3300005547 Ga0070693_100027245 Ga0070693_1000272453 241
160 3300005563 Ga0068855_100095859 Ga0068855_1000958593 241
161 3300006175 Ga0070712_100122249 Ga0070712_1001222493 241
162 3300006914 Ga0075436_100327171 Ga0075436_1003271712 241
163 3300025906 Ga0207699_10337908 Ga0207699_103379082 241
164 3300025913 Ga0207695_10134614 Ga0207695_101346142 241
165 3300025915 Ga0207693_10035421 Ga0207693_100354215 241
166 3300025917 Ga0207660_10022567 Ga0207660_100225672 241
167 3300025944 Ga0207661_10123389 Ga0207661_101233893 241
168 3300026078 Ga0207702_10134646 Ga0207702_101346463 241
169 3300026142 Ga0207698_10365372 Ga0207698_103653722 241
170 3300039437 Ga0436365_1836375 Ga0436365_1836375_202_930 241
171 3300046516 Ga0495628_0131579 Ga0495628_0131579_332_1150 241
172 3300003911 JGI25405J52794_10002014 JGI25405J52794_100020142 242
173 3300005295 Ga0065707_10187075 Ga0065707_101870752 242
174 3300005328 Ga0070676_10013024 Ga0070676_100130243 242
175 3300005329 Ga0070683_100020306 Ga0070683_1000203062 242
176 3300005330 Ga0070690_100049679 Ga0070690_1000496793 242
177 3300005331 Ga0070670_100055447 Ga0070670_1000554472 242
178 3300005335 Ga0070666_10008226 Ga0070666_100082266 242
179 3300005338 Ga0068868_100023591 Ga0068868_1000235913 242
180 3300005340 Ga0070689_100063300 Ga0070689_1000633003 242
181 3300005354 Ga0070675_100727188 Ga0070675_1007271881 242
182 3300005364 Ga0070673_100116722 Ga0070673_1001167222 242
183 3300005367 Ga0070667_100050018 Ga0070667_1000500183 242
184 3300005434 Ga0070709_10000722 Ga0070709_1000072211 242
185 3300005435 Ga0070714_100008512 Ga0070714_1000085122 242
186 3300005436 Ga0070713_100004821 Ga0070713_1000048213 242
187 3300005437 Ga0070710_10020026 Ga0070710_100200264 242
188 3300005439 Ga0070711_100115031 Ga0070711_1001150313 242
189 3300005441 Ga0070700_100150192 Ga0070700_1001501922 242
190 3300005455 Ga0070663_100245411 Ga0070663_1002454112 242
191 3300005456 Ga0070678_100341518 Ga0070678_1003415181 242
192 3300005466 Ga0070685_10099406 Ga0070685_100994062 242
193 3300005546 Ga0070696_100117701 Ga0070696_1001177012 242
194 3300005547 Ga0070693_100030565 Ga0070693_1000305653 242
195 3300005548 Ga0070665_100383269 Ga0070665_1003832692 242
196 3300005615 Ga0070702_100244126 Ga0070702_1002441262 242
197 3300005618 Ga0068864_100081011 Ga0068864_1000810113 242
198 3300005718 Ga0068866_10012989 Ga0068866_100129893 242
199 3300005842 Ga0068858_100036975 Ga0068858_1000369755 242
200 3300005844 Ga0068862_100274895 Ga0068862_1002748952 242
201 3300005937 Ga0081455_10047326 Ga0081455_100473263 242
202 3300006028 Ga0070717_10001127 Ga0070717_100011275 242
203 3300006051 Ga0075364_10227177 Ga0075364_102271772 242
204 3300006058 Ga0075432_10005045 Ga0075432_100050453 242
205 3300006163 Ga0070715_10001210 Ga0070715_100012103 242
206 3300006173 Ga0070716_100004315 Ga0070716_1000043154 242
207 3300006175 Ga0070712_100379739 Ga0070712_1003797391 242
208 3300006358 Ga0068871_100009057 Ga0068871_1000090573 242
209 3300006844 Ga0075428_100002380 Ga0075428_1000023805 242
210 3300006846 Ga0075430_100000422 Ga0075430_10000042214 242
211 3300006847 Ga0075431_100001159 Ga0075431_1000011599 242
212 3300006852 Ga0075433_10002900 Ga0075433_1000290011 242
213 3300006852 Ga0075433_10363321 Ga0075433_103633212 242
214 3300006871 Ga0075434_100002589 Ga0075434_10000258914 242
215 3300006871 Ga0075434_100115476 Ga0075434_1001154763 242
216 3300006871 Ga0075434_100241713 Ga0075434_1002417133 242
217 3300006880 Ga0075429_100003486 Ga0075429_1000034866 242
218 3300006881 Ga0068865_100018491 Ga0068865_1000184912 242
219 3300006914 Ga0075436_100083937 Ga0075436_1000839372 242
220 3300007076 Ga0075435_100012862 Ga0075435_1000128623 242
221 3300009093 Ga0105240_10135357 Ga0105240_101353573 242
222 3300009174 Ga0105241_10053215 Ga0105241_100532153 242
223 3300013105 Ga0157369_10160014 Ga0157369_101600143 242
224 3300013307 Ga0157372_10152439 Ga0157372_101524393 242
225 3300017792 Ga0163161_10125273 Ga0163161_101252732 242
226 3300021388 Ga0213875_10141946 Ga0213875_101419462 242
227 3300025735 Ga0207713_1055334 Ga0207713_10553341 242
228 3300025898 Ga0207692_10001544 Ga0207692_100015447 242
229 3300025899 Ga0207642_10080556 Ga0207642_100805562 242
230 3300025900 Ga0207710_10003619 Ga0207710_100036194 242
231 3300025903 Ga0207680_10029590 Ga0207680_100295903 242
232 3300025904 Ga0207647_10230941 Ga0207647_102309412 242
233 3300025905 Ga0207685_10005498 Ga0207685_100054984 242
234 3300025906 Ga0207699_10011898 Ga0207699_100118983 242
235 3300025907 Ga0207645_10014177 Ga0207645_100141775 242
236 3300025911 Ga0207654_10327574 Ga0207654_103275742 242
237 3300025914 Ga0207671_10244902 Ga0207671_102449022 242
238 3300025915 Ga0207693_10007401 Ga0207693_100074012 242
239 3300025919 Ga0207657_10058740 Ga0207657_100587402 242
240 3300025920 Ga0207649_10077511 Ga0207649_100775113 242
241 3300025925 Ga0207650_10062541 Ga0207650_100625412 242
242 3300025926 Ga0207659_10580363 Ga0207659_105803632 242
243 3300025927 Ga0207687_10040369 Ga0207687_100403693 242
244 3300025928 Ga0207700_10049668 Ga0207700_100496684 242
245 3300025929 Ga0207664_10054670 Ga0207664_100546702 242
246 3300025933 Ga0207706_10052806 Ga0207706_100528062 242
247 3300025934 Ga0207686_10016943 Ga0207686_100169434 242
248 3300025936 Ga0207670_10049984 Ga0207670_100499843 242
249 3300025938 Ga0207704_10027002 Ga0207704_100270024 242
250 3300025939 Ga0207665_10012708 Ga0207665_100127086 242
251 3300025942 Ga0207689_10013055 Ga0207689_100130557 242
252 3300025944 Ga0207661_10068242 Ga0207661_100682423 242
253 3300025945 Ga0207679_10428981 Ga0207679_104289812 242
254 3300025960 Ga0207651_10133965 Ga0207651_101339652 242
255 3300025961 Ga0207712_10055512 Ga0207712_100555122 242
256 3300025961 Ga0207712_10373465 Ga0207712_103734651 242
257 3300025986 Ga0207658_10141156 Ga0207658_101411563 242
258 3300026035 Ga0207703_10034601 Ga0207703_100346014 242
259 3300026075 Ga0207708_10047822 Ga0207708_100478224 242
260 3300026078 Ga0207702_10080934 Ga0207702_100809344 242
261 3300026088 Ga0207641_10082855 Ga0207641_100828552 242
262 3300026089 Ga0207648_10074468 Ga0207648_100744682 242
263 3300026118 Ga0207675_100257635 Ga0207675_1002576351 242
264 3300026121 Ga0207683_10030863 Ga0207683_100308632 242
265 3300027907 Ga0207428_10000141 Ga0207428_1000014197 242
266 3300028379 Ga0268266_10088165 Ga0268266_100881653 242
267 3300031691 Ga0316579_10054401 Ga0316579_100544012 242
268 3300032002 Ga0307416_100611729 Ga0307416_1006117292 242
269 3300037853 Ga0436364_0055850 Ga0436364_0055850_2065_2802 242
270 3300041408 Ga0439453_0011877 Ga0439453_0011877_596_1348 242
271 3300048915 Ga0496112_0431710 Ga0496112_0431710_112_852 242
272 3300049571 Ga0501034_0421960 Ga0501034_0421960_506_1234 242
273 3300050494 nmdc:mga06z11_282720_c1 nmdc:mga06z11_282720_c1_174_926 242
274 iso_pu_bacteria 2508501128 2509146400 242
275 iso_pu_bacteria 2513237141 2513892511 242
276 iso_pu_bacteria 2885383462 2885391802 242
277 3300003911 JGI25405J52794_10007463 JGI25405J52794_100074632 243
278 3300005330 Ga0070690_100027317 Ga0070690_1000273173 243
279 3300005335 Ga0070666_10207604 Ga0070666_102076042 243
280 3300005336 Ga0070680_100088015 Ga0070680_1000880153 243
281 3300005337 Ga0070682_100289852 Ga0070682_1002898522 243
282 3300005339 Ga0070660_100399214 Ga0070660_1003992142 243
283 3300005341 Ga0070691_10029246 Ga0070691_100292462 243
284 3300005434 Ga0070709_10160974 Ga0070709_101609742 243
285 3300005435 Ga0070714_100256954 Ga0070714_1002569542 243
286 3300005436 Ga0070713_100026650 Ga0070713_1000266502 243
287 3300005438 Ga0070701_10307819 Ga0070701_103078191 243
288 3300005440 Ga0070705_100059308 Ga0070705_1000593083 243
289 3300005455 Ga0070663_100225715 Ga0070663_1002257152 243
290 3300005456 Ga0070678_100141545 Ga0070678_1001415452 243
291 3300005457 Ga0070662_100498264 Ga0070662_1004982641 243
292 3300005458 Ga0070681_10097011 Ga0070681_100970113 243
293 3300005530 Ga0070679_100036897 Ga0070679_1000368975 243
294 3300005530 Ga0070679_100509116 Ga0070679_1005091162 243
295 3300005536 Ga0070697_100283828 Ga0070697_1002838282 243
296 3300005545 Ga0070695_100229826 Ga0070695_1002298262 243
297 3300005546 Ga0070696_100050404 Ga0070696_1000504043 243
298 3300005547 Ga0070693_100091036 Ga0070693_1000910362 243
299 3300005548 Ga0070665_100367669 Ga0070665_1003676692 243
300 3300005549 Ga0070704_100240939 Ga0070704_1002409392 243
301 3300005563 Ga0068855_100630414 Ga0068855_1006304142 243
302 3300005578 Ga0068854_100357345 Ga0068854_1003573451 243
303 3300005614 Ga0068856_100044447 Ga0068856_1000444472 243
304 3300005614 Ga0068856_100074648 Ga0068856_1000746484 243
305 3300005937 Ga0081455_10000313 Ga0081455_1000031355 243
306 3300005983 Ga0081540_1055532 Ga0081540_10555322 243
307 3300006237 Ga0097621_100059826 Ga0097621_1000598263 243
308 3300006358 Ga0068871_100350093 Ga0068871_1003500932 243
309 3300006914 Ga0075436_100058123 Ga0075436_1000581233 243
310 3300007076 Ga0075435_100155614 Ga0075435_1001556142 243
311 3300009093 Ga0105240_10202198 Ga0105240_102021983 243
312 3300009094 Ga0111539_10001208 Ga0111539_100012088 243
313 3300009094 Ga0111539_10520713 Ga0111539_105207132 243
314 3300009098 Ga0105245_10096314 Ga0105245_100963143 243
315 3300009101 Ga0105247_10046650 Ga0105247_100466502 243
316 3300009147 Ga0114129_10006052 Ga0114129_1000605213 243
317 3300009147 Ga0114129_10026846 Ga0114129_100268467 243
318 3300009148 Ga0105243_10171211 Ga0105243_101712112 243
319 3300009545 Ga0105237_10031225 Ga0105237_100312254 243
320 3300010375 Ga0105239_10073909 Ga0105239_100739092 243
321 3300013102 Ga0157371_10087728 Ga0157371_100877282 243
322 3300013297 Ga0157378_10045507 Ga0157378_100455072 243
323 3300013308 Ga0157375_10055503 Ga0157375_100555034 243
324 3300014745 Ga0157377_10137805 Ga0157377_101378051 243
325 3300014968 Ga0157379_10032340 Ga0157379_100323404 243
326 3300014969 Ga0157376_10140218 Ga0157376_101402182 243
327 3300025903 Ga0207680_10076238 Ga0207680_100762383 243
328 3300025905 Ga0207685_10006477 Ga0207685_100064772 243
329 3300025907 Ga0207645_10024316 Ga0207645_100243163 243
330 3300025911 Ga0207654_10041916 Ga0207654_100419162 243
331 3300025911 Ga0207654_10555515 Ga0207654_105555151 243
332 3300025912 Ga0207707_10116255 Ga0207707_101162553 243
333 3300025915 Ga0207693_10038153 Ga0207693_100381535 243
334 3300025918 Ga0207662_10092431 Ga0207662_100924312 243
335 3300025919 Ga0207657_10035264 Ga0207657_100352646 243
336 3300025919 Ga0207657_10087461 Ga0207657_100874612 243
337 3300025928 Ga0207700_10056575 Ga0207700_100565753 243
338 3300025933 Ga0207706_10007938 Ga0207706_100079387 243
339 3300025934 Ga0207686_10054482 Ga0207686_100544822 243
340 3300025934 Ga0207686_10372761 Ga0207686_103727612 243
341 3300025938 Ga0207704_10090195 Ga0207704_100901952 243
342 3300025939 Ga0207665_10007323 Ga0207665_100073235 243
343 3300025940 Ga0207691_10100246 Ga0207691_101002463 243
344 3300025941 Ga0207711_10449340 Ga0207711_104493402 243
345 3300025942 Ga0207689_10293949 Ga0207689_102939492 243
346 3300025961 Ga0207712_10118256 Ga0207712_101182563 243
347 3300025981 Ga0207640_10016579 Ga0207640_100165792 243
348 3300026121 Ga0207683_10107403 Ga0207683_101074033 243
349 3300028381 Ga0268264_10163889 Ga0268264_101638892 243
350 3300028556 Ga0265337_1000296 Ga0265337_100029615 243
351 3300031235 Ga0265330_10014658 Ga0265330_100146583 243
352 3300031241 Ga0265325_10028932 Ga0265325_100289324 243
353 3300031247 Ga0265340_10030643 Ga0265340_100306431 243
354 3300031595 Ga0265313_10188762 Ga0265313_101887621 243
355 3300035083 Ga0373926_0004945 Ga0373926_0004945_1176_1907 243
356 3300035086 Ga0373934_0003323 Ga0373934_0003323_3194_3925 243
357 3300035086 Ga0373934_0020637 Ga0373934_0020637_224_955 243
358 3300035089 Ga0373944_0000638 Ga0373944_0000638_5026_5757 243
359 3300035111 Ga0373923_0000650 Ga0373923_0000650_3339_4070 243
360 3300035111 Ga0373923_0007503 Ga0373923_0007503_334_1065 243
361 3300035116 Ga0373945_0019235 Ga0373945_0019235_1279_2010 243
362 3300035116 Ga0373945_0032407 Ga0373945_0032407_59_790 243
363 3300035118 Ga0373954_0005424 Ga0373954_0005424_2447_3178 243
364 3300035119 Ga0373956_0031625 Ga0373956_0031625_1166_1897 243
365 3300035170 Ga0373943_0011522 Ga0373943_0011522_2927_3658 243
366 3300035170 Ga0373943_0051729 Ga0373943_0051729_533_1264 243
367 3300035171 Ga0373946_0001871 Ga0373946_0001871_5058_5789 243
368 3300035172 Ga0373955_0001041 Ga0373955_0001041_10658_11389 243
369 3300035172 Ga0373955_0004535 Ga0373955_0004535_2250_2981 243
370 3300035692 Ga0373935_0011194 Ga0373935_0011194_1600_2331 243
371 3300035692 Ga0373935_0040207 Ga0373935_0040207_2138_2869 243
372 3300035724 Ga0373933_0012539 Ga0373933_0012539_3539_4270 243
373 3300035724 Ga0373933_0019220 Ga0373933_0019220_961_1692 243
374 3300035725 Ga0373947_0055070 Ga0373947_0055070_709_1440 243
375 3300036401 Ga0373937_0012538 Ga0373937_0012538_230_961 243
376 3300036401 Ga0373937_0064009 Ga0373937_0064009_2330_3061 243
377 3300037068 Ga0373925_0017621 Ga0373925_0017621_1557_2288 243
378 3300037068 Ga0373925_0352840 Ga0373925_0352840_194_925 243
379 3300046454 Ga0495592_0015108 Ga0495592_0015108_3943_4674 243
380 3300046454 Ga0495592_0035863 Ga0495592_0035863_2609_3340 243
381 3300046454 Ga0495592_0279315 Ga0495592_0279315_194_925 243
382 3300046455 Ga0495603_0153592 Ga0495603_0153592_208_939 243
383 3300046459 Ga0495629_0082010 Ga0495629_0082010_686_1417 243
384 3300046462 Ga0495651_0004808 Ga0495651_0004808_2506_3237 243
385 3300046462 Ga0495651_0011428 Ga0495651_0011428_1069_1800 243
386 3300046463 Ga0495653_0012845 Ga0495653_0012845_5073_5804 243
387 3300046463 Ga0495653_0021904 Ga0495653_0021904_275_1006 243
388 3300046472 Ga0495580_0020304 Ga0495580_0020304_3433_4164 243
389 3300046472 Ga0495580_0163984 Ga0495580_0163984_311_1042 243
390 3300046473 Ga0495582_0022967 Ga0495582_0022967_2283_3014 243
391 3300046473 Ga0495582_0023491 Ga0495582_0023491_109_840 243
392 3300046475 Ga0495639_0001267 Ga0495639_0001267_55_786 243
393 3300046476 Ga0495662_0000915 Ga0495662_0000915_11090_11821 243
394 3300046477 Ga0495664_0008068 Ga0495664_0008068_2785_3516 243
395 3300046477 Ga0495664_0129358 Ga0495664_0129358_270_1001 243
396 3300046511 Ga0495608_0002687 Ga0495608_0002687_8644_9375 243
397 3300046511 Ga0495608_0056957 Ga0495608_0056957_777_1508 243
398 3300046514 Ga0495618_0005633 Ga0495618_0005633_735_1466 243
399 3300046514 Ga0495618_0252411 Ga0495618_0252411_343_1074 243
400 3300046516 Ga0495628_0053343 Ga0495628_0053343_1429_2160 243
401 3300046516 Ga0495628_0162174 Ga0495628_0162174_197_928 243
402 3300046517 Ga0495630_0017808 Ga0495630_0017808_2314_3045 243
403 3300046517 Ga0495630_0066746 Ga0495630_0066746_186_917 243
404 3300046526 Ga0495666_0004018 Ga0495666_0004018_1890_2621 243
405 3300046526 Ga0495666_0033606 Ga0495666_0033606_31_762 243
406 3300046529 Ga0495652_0002710 Ga0495652_0002710_14256_14987 243
407 3300046531 Ga0495665_0002969 Ga0495665_0002969_7787_8518 243
408 3300046533 Ga0495640_0018476 Ga0495640_0018476_2174_2905 243
409 3300046535 Ga0495586_0017979 Ga0495586_0017979_1744_2475 243
410 3300046536 Ga0495587_0003832 Ga0495587_0003832_2401_3132 243
411 3300046536 Ga0495587_0053542 Ga0495587_0053542_1379_2110 243
412 3300046543 Ga0495645_0012374 Ga0495645_0012374_903_1634 243
413 3300046557 Ga0495622_0005528 Ga0495622_0005528_2721_3452 243
414 3300046557 Ga0495622_0039362 Ga0495622_0039362_1339_2070 243
415 3300046559 Ga0495667_0001506 Ga0495667_0001506_3602_4333 243
416 3300046559 Ga0495667_0003229 Ga0495667_0003229_4881_5612 243
417 3300046559 Ga0495667_0025062 Ga0495667_0025062_838_1569 243
418 3300046642 Ga0495634_0081531 Ga0495634_0081531_188_919 243
419 3300046663 Ga0495635_0020956 Ga0495635_0020956_2863_3594 243
420 3300046663 Ga0495635_0024504 Ga0495635_0024504_2459_3190 243
421 3300046663 Ga0495635_0041738 Ga0495635_0041738_1544_2275 243
422 3300046674 Ga0495588_0002749 Ga0495588_0002749_792_1523 243
423 3300046675 Ga0495657_0002223 Ga0495657_0002223_13048_13779 243
424 3300046678 Ga0495599_0005815 Ga0495599_0005815_5781_6512 243
425 3300046678 Ga0495599_0049331 Ga0495599_0049331_1005_1736 243
426 3300046679 Ga0495623_0037236 Ga0495623_0037236_1036_1767 243
427 3300046680 Ga0495646_0016004 Ga0495646_0016004_1728_2459 243
428 3300046680 Ga0495646_0033558 Ga0495646_0033558_1429_2160 243
429 3300046683 Ga0495658_0013771 Ga0495658_0013771_102_833 243
430 3300046683 Ga0495658_0063056 Ga0495658_0063056_741_1472 243
431 3300046689 Ga0495613_0016947 Ga0495613_0016947_2609_3340 243
432 3300046690 Ga0495624_0003658 Ga0495624_0003658_2928_3659 243
433 3300046690 Ga0495624_0061839 Ga0495624_0061839_1278_2009 243
434 3300046809 Ga0495600_0001403 Ga0495600_0001403_3102_3833 243
435 3300046809 Ga0495600_0020344 Ga0495600_0020344_411_1142 243
436 3300047315 Ga0495581_0043319 Ga0495581_0043319_581_1312 243
437 3300047317 Ga0495604_0007422 Ga0495604_0007422_3601_4332 243
438 3300047317 Ga0495604_0009389 Ga0495604_0009389_903_1634 243
439 3300047319 Ga0495674_0084429 Ga0495674_0084429_1133_1864 243
440 3300047319 Ga0495674_0111053 Ga0495674_0111053_1294_2025 243
441 3300047319 Ga0495674_0352454 Ga0495674_0352454_194_925 243
442 3300047321 Ga0495676_0041785 Ga0495676_0041785_2909_3640 243
443 3300047322 Ga0495680_0003143 Ga0495680_0003143_14891_15622 243
444 3300047322 Ga0495680_0032161 Ga0495680_0032161_2269_3000 243
445 3300047322 Ga0495680_0197558 Ga0495680_0197558_205_936 243
446 3300047444 Ga0495675_0000855 Ga0495675_0000855_7690_8421 243
447 3300047444 Ga0495675_0296928 Ga0495675_0296928_51_782 243
448 3300047471 Ga0495684_0000281 Ga0495684_0000281_25840_26571 243
449 3300048088 Ga0495602_0008505 Ga0495602_0008505_8152_8883 243
450 3300048088 Ga0495602_0071789 Ga0495602_0071789_76_807 243
451 3300048903 Ga0496100_0031614 Ga0496100_0031614_2453_3184 243
452 3300048904 Ga0496101_0030324 Ga0496101_0030324_312_1043 243
453 3300048905 Ga0496102_0028999 Ga0496102_0028999_1859_2590 243
454 3300048906 Ga0496103_0233061 Ga0496103_0233061_147_878 243
455 3300048907 Ga0496104_0025301 Ga0496104_0025301_2420_3151 243
456 3300048908 Ga0496105_0012751 Ga0496105_0012751_2948_3679 243
457 3300048909 Ga0496106_0148107 Ga0496106_0148107_724_1455 243
458 3300048910 Ga0496107_0065131 Ga0496107_0065131_846_1577 243
459 3300048912 Ga0496109_0113086 Ga0496109_0113086_1475_2206 243
460 3300048913 Ga0496110_0267849 Ga0496110_0267849_89_820 243
461 3300048914 Ga0496111_0038109 Ga0496111_0038109_2602_3333 243
462 3300048915 Ga0496112_0072199 Ga0496112_0072199_1288_2019 243
463 3300048917 Ga0496114_0025212 Ga0496114_0025212_1461_2192 243
464 3300048918 Ga0496115_0014172 Ga0496115_0014172_1544_2275 243
465 3300048918 Ga0496115_0068679 Ga0496115_0068679_820_1551 243
466 3300048918 Ga0496115_0106822 Ga0496115_0106822_430_1161 243
467 3300049569 Ga0501032_0132880 Ga0501032_0132880_343_1077 243
468 3300050507 nmdc:mga05p37_40044_c1 nmdc:mga05p37_40044_c1_2774_3526 243
469 3300050507 nmdc:mga05p37_819_c2 nmdc:mga05p37_819_c2_7322_8074 243
470 3300050508 nmdc:mga09592_324_c1 nmdc:mga09592_324_c1_22949_23701 243
471 3300050509 nmdc:mga0qj67_656_c1 nmdc:mga0qj67_656_c1_14657_15409 243
472 3300050510 nmdc:mga06r32_1450_c1 nmdc:mga06r32_1450_c1_14523_15275 243
473 3300050511 nmdc:mga08y16_697_c1 nmdc:mga08y16_697_c1_14239_14991 243
474 3300050512 nmdc:mga0n895_261728_c1 nmdc:mga0n895_261728_c1_83_814 243
475 3300050512 nmdc:mga0n895_415187_c1 nmdc:mga0n895_415187_c1_162_914 243
476 3300050512 nmdc:mga0n895_609_c1 nmdc:mga0n895_609_c1_22725_23477 243
477 3300050512 nmdc:mga0n895_711369_c1 nmdc:mga0n895_711369_c1_11_742 243
478 3300050513 nmdc:mga0rr50_136834_c1 nmdc:mga0rr50_136834_c1_627_1358 243
479 3300050513 nmdc:mga0rr50_17588_c1 nmdc:mga0rr50_17588_c1_2486_3238 243
480 3300050513 nmdc:mga0rr50_937_c1 nmdc:mga0rr50_937_c1_6365_7117 243
481 3300050514 nmdc:mga08x19_57716_c1 nmdc:mga08x19_57716_c1_1290_2042 243
482 3300050515 nmdc:mga0a205_6688_c1 nmdc:mga0a205_6688_c1_7449_8201 243
483 3300053077 Ga0495601_0004507 Ga0495601_0004507_6466_7197 243
484 3300053077 Ga0495601_0016338 Ga0495601_0016338_597_1328 243
485 3300053077 Ga0495601_0047971 Ga0495601_0047971_1005_1736 243
486 3300053077 Ga0495601_0076263 Ga0495601_0076263_400_1131 243
487 3300053078 Ga0495612_0001141 Ga0495612_0001141_7503_8234 243
488 3300053078 Ga0495612_0013910 Ga0495612_0013910_1654_2385 243
489 3300053078 Ga0495612_0014541 Ga0495612_0014541_903_1634 243
490 3300053078 Ga0495612_0046103 Ga0495612_0046103_978_1709 243
491 3300053084 Ga0495595_0000992 Ga0495595_0000992_6726_7457 243
492 3300053084 Ga0495595_0001007 Ga0495595_0001007_3657_4388 243
493 3300053084 Ga0495595_0004374 Ga0495595_0004374_1132_1863 243
494 3300053085 Ga0495619_0000715 Ga0495619_0000715_11928_12659 243
495 3300053085 Ga0495619_0007425 Ga0495619_0007425_5326_6057 243
496 3300053085 Ga0495619_0022678 Ga0495619_0022678_2432_3163 243
497 3300006852 Ga0075433_10080016 Ga0075433_100800164 244
498 3300006914 Ga0075436_100064617 Ga0075436_1000646173 244
499 3300009147 Ga0114129_10733833 Ga0114129_107338331 244
500 3300026041 Ga0207639_10675727 Ga0207639_106757271 244
501 3300046678 Ga0495599_0104681 Ga0495599_0104681_612_1370 244
502 3300049741 Ga0501079_0411035 Ga0501079_0411035_69_827 244
503 2209111006 2214828537 2213866824 245
504 3300000041 ARcpr5oldR_c000095 ARcpr5oldR_00009512 245
505 3300000042 ARSoilYngRDRAFT_c00083 ARSoilYngRDRAFT_0008312 245
506 3300000043 ARcpr5yngRDRAFT_c000131 ARcpr5yngRDRAFT_0001317 245
507 3300000044 ARSoilOldRDRAFT_c000103 ARSoilOldRDRAFT_00010311 245
508 3300000652 ARCol0yngRDRAFT_1000337 ARCol0yngRDRAFT_10003378 245
509 3300002155 JGI24033J26618_1016091 JGI24033J26618_10160912 245
510 3300002244 JGI24742J22300_10000394 JGI24742J22300_100003946 245
511 3300003320 rootH2_10100165 rootH2_101001651 245
512 3300003322 rootL2_10030933 rootL2_100309331 245
513 3300005277 Ga0065716_1001619 Ga0065716_10016196 245
514 3300005289 Ga0065704_10137881 Ga0065704_101378813 245
515 3300005290 Ga0065712_10001578 Ga0065712_100015782 245
516 3300005290 Ga0065712_10069047 Ga0065712_100690473 245
517 3300005293 Ga0065715_10121747 Ga0065715_101217473 245
518 3300005328 Ga0070676_10006196 Ga0070676_100061965 245
519 3300005328 Ga0070676_10433655 Ga0070676_104336551 245
520 3300005329 Ga0070683_100007348 Ga0070683_1000073488 245
521 3300005329 Ga0070683_100040405 Ga0070683_1000404053 245
522 3300005329 Ga0070683_100153675 Ga0070683_1001536753 245
523 3300005330 Ga0070690_100005074 Ga0070690_1000050746 245
524 3300005330 Ga0070690_100035846 Ga0070690_1000358462 245
525 3300005333 Ga0070677_10000267 Ga0070677_100002676 245
526 3300005334 Ga0068869_100000991 Ga0068869_1000009913 245
527 3300005334 Ga0068869_100294255 Ga0068869_1002942552 245
528 3300005335 Ga0070666_10018891 Ga0070666_100188912 245
529 3300005336 Ga0070680_100007000 Ga0070680_1000070007 245
530 3300005336 Ga0070680_100008439 Ga0070680_1000084396 245
531 3300005336 Ga0070680_100012702 Ga0070680_1000127023 245
532 3300005336 Ga0070680_100020815 Ga0070680_1000208155 245
533 3300005336 Ga0070680_100250314 Ga0070680_1002503142 245
534 3300005336 Ga0070680_100435067 Ga0070680_1004350672 245
535 3300005337 Ga0070682_100002591 Ga0070682_1000025916 245
536 3300005338 Ga0068868_100000857 Ga0068868_10000085721 245
537 3300005339 Ga0070660_100014299 Ga0070660_1000142995 245
538 3300005340 Ga0070689_100010361 Ga0070689_1000103615 245
539 3300005340 Ga0070689_100013180 Ga0070689_1000131807 245
540 3300005340 Ga0070689_100051337 Ga0070689_1000513373 245
541 3300005341 Ga0070691_10030530 Ga0070691_100305302 245
542 3300005341 Ga0070691_10042286 Ga0070691_100422863 245
543 3300005341 Ga0070691_10046674 Ga0070691_100466742 245
544 3300005343 Ga0070687_100000879 Ga0070687_10000087911 245
545 3300005345 Ga0070692_10007430 Ga0070692_100074304 245
546 3300005347 Ga0070668_100008333 Ga0070668_1000083336 245
547 3300005347 Ga0070668_100067259 Ga0070668_1000672592 245
548 3300005353 Ga0070669_100019607 Ga0070669_1000196073 245
549 3300005353 Ga0070669_100304549 Ga0070669_1003045492 245
550 3300005354 Ga0070675_100010826 Ga0070675_1000108265 245
551 3300005354 Ga0070675_100232557 Ga0070675_1002325572 245
552 3300005355 Ga0070671_100000944 Ga0070671_10000094422 245
553 3300005355 Ga0070671_100157183 Ga0070671_1001571832 245
554 3300005356 Ga0070674_100017336 Ga0070674_1000173364 245
555 3300005356 Ga0070674_100660329 Ga0070674_1006603291 245
556 3300005364 Ga0070673_100000633 Ga0070673_10000063322 245
557 3300005365 Ga0070688_100035313 Ga0070688_1000353134 245
558 3300005365 Ga0070688_100375379 Ga0070688_1003753791 245
559 3300005366 Ga0070659_100064907 Ga0070659_1000649072 245
560 3300005366 Ga0070659_100115832 Ga0070659_1001158323 245
561 3300005367 Ga0070667_100001396 Ga0070667_10000139621 245
562 3300005406 Ga0070703_10011756 Ga0070703_100117562 245
563 3300005434 Ga0070709_10004671 Ga0070709_100046718 245
564 3300005434 Ga0070709_10023256 Ga0070709_100232565 245
565 3300005434 Ga0070709_10050036 Ga0070709_100500363 245
566 3300005434 Ga0070709_10092801 Ga0070709_100928013 245
567 3300005435 Ga0070714_100349371 Ga0070714_1003493711 245
568 3300005436 Ga0070713_100000642 Ga0070713_10000064215 245
569 3300005436 Ga0070713_100097930 Ga0070713_1000979302 245
570 3300005436 Ga0070713_100242144 Ga0070713_1002421442 245
571 3300005437 Ga0070710_10004932 Ga0070710_100049324 245
572 3300005438 Ga0070701_10000873 Ga0070701_100008738 245
573 3300005439 Ga0070711_100009459 Ga0070711_1000094595 245
574 3300005439 Ga0070711_100124647 Ga0070711_1001246472 245
575 3300005441 Ga0070700_100004739 Ga0070700_1000047394 245
576 3300005444 Ga0070694_100008321 Ga0070694_1000083216 245
577 3300005444 Ga0070694_100490016 Ga0070694_1004900161 245
578 3300005455 Ga0070663_100016280 Ga0070663_1000162803 245
579 3300005455 Ga0070663_100072228 Ga0070663_1000722282 245
580 3300005455 Ga0070663_100451305 Ga0070663_1004513052 245
581 3300005456 Ga0070678_100002344 Ga0070678_1000023446 245
582 3300005457 Ga0070662_100009494 Ga0070662_1000094943 245
583 3300005458 Ga0070681_10004197 Ga0070681_100041975 245
584 3300005458 Ga0070681_10016746 Ga0070681_100167467 245
585 3300005458 Ga0070681_10017495 Ga0070681_100174955 245
586 3300005458 Ga0070681_10062004 Ga0070681_100620042 245
587 3300005458 Ga0070681_10593025 Ga0070681_105930251 245
588 3300005459 Ga0068867_100012755 Ga0068867_1000127555 245
589 3300005459 Ga0068867_100082812 Ga0068867_1000828122 245
590 3300005466 Ga0070685_10003301 Ga0070685_100033012 245
591 3300005467 Ga0070706_100499672 Ga0070706_1004996722 245
592 3300005468 Ga0070707_100110317 Ga0070707_1001103172 245
593 3300005471 Ga0070698_100112916 Ga0070698_1001129162 245
594 3300005530 Ga0070679_100026721 Ga0070679_1000267214 245
595 3300005530 Ga0070679_100040995 Ga0070679_1000409953 245
596 3300005530 Ga0070679_100044254 Ga0070679_1000442544 245
597 3300005530 Ga0070679_100411539 Ga0070679_1004115392 245
598 3300005530 Ga0070679_100437629 Ga0070679_1004376291 245
599 3300005535 Ga0070684_100001263 Ga0070684_1000012634 245
600 3300005535 Ga0070684_100010983 Ga0070684_1000109834 245
601 3300005535 Ga0070684_100644737 Ga0070684_1006447371 245
602 3300005539 Ga0068853_100054922 Ga0068853_1000549223 245
603 3300005539 Ga0068853_100106418 Ga0068853_1001064183 245
604 3300005539 Ga0068853_100266189 Ga0068853_1002661891 245
605 3300005543 Ga0070672_100001723 Ga0070672_1000017237 245
606 3300005544 Ga0070686_100000756 Ga0070686_10000075619 245
607 3300005545 Ga0070695_100015352 Ga0070695_1000153523 245
608 3300005545 Ga0070695_100024416 Ga0070695_1000244163 245
609 3300005546 Ga0070696_100102807 Ga0070696_1001028073 245
610 3300005547 Ga0070693_100002926 Ga0070693_1000029266 245
611 3300005548 Ga0070665_100289292 Ga0070665_1002892922 245
612 3300005549 Ga0070704_100001802 Ga0070704_1000018029 245
613 3300005549 Ga0070704_100005673 Ga0070704_1000056735 245
614 3300005563 Ga0068855_100112221 Ga0068855_1001122212 245
615 3300005563 Ga0068855_100225181 Ga0068855_1002251812 245
616 3300005563 Ga0068855_100324424 Ga0068855_1003244242 245
617 3300005563 Ga0068855_100701696 Ga0068855_1007016962 245
618 3300005564 Ga0070664_100280384 Ga0070664_1002803842 245
619 3300005564 Ga0070664_100307577 Ga0070664_1003075772 245
620 3300005564 Ga0070664_100581472 Ga0070664_1005814722 245
621 3300005577 Ga0068857_100025885 Ga0068857_1000258853 245
622 3300005577 Ga0068857_100190520 Ga0068857_1001905202 245
623 3300005578 Ga0068854_100004810 Ga0068854_1000048107 245
624 3300005578 Ga0068854_100095436 Ga0068854_1000954363 245
625 3300005578 Ga0068854_100279882 Ga0068854_1002798822 245
626 3300005614 Ga0068856_100004424 Ga0068856_10000442411 245
627 3300005614 Ga0068856_100111050 Ga0068856_1001110504 245
628 3300005615 Ga0070702_100006077 Ga0070702_1000060774 245
629 3300005617 Ga0068859_100546039 Ga0068859_1005460392 245
630 3300005618 Ga0068864_100064945 Ga0068864_1000649451 245
631 3300005719 Ga0068861_100002263 Ga0068861_1000022638 245
632 3300005719 Ga0068861_100058064 Ga0068861_1000580642 245
633 3300005840 Ga0068870_10000323 Ga0068870_1000032312 245
634 3300005841 Ga0068863_100001487 Ga0068863_10000148725 245
635 3300005841 Ga0068863_100647762 Ga0068863_1006477622 245
636 3300005842 Ga0068858_100015978 Ga0068858_1000159786 245
637 3300005842 Ga0068858_100289241 Ga0068858_1002892412 245
638 3300005843 Ga0068860_100001886 Ga0068860_10000188620 245
639 3300005844 Ga0068862_100001462 Ga0068862_10000146217 245
640 3300005844 Ga0068862_100047241 Ga0068862_1000472415 245
641 3300005937 Ga0081455_10009815 Ga0081455_100098157 245
642 3300005937 Ga0081455_10086807 Ga0081455_100868072 245
643 3300005983 Ga0081540_1002067 Ga0081540_100206714 245
644 3300005983 Ga0081540_1006887 Ga0081540_10068879 245
645 3300006028 Ga0070717_10735485 Ga0070717_107354851 245
646 3300006028 Ga0070717_10775371 Ga0070717_107753711 245
647 3300006048 Ga0075363_100028488 Ga0075363_1000284883 245
648 3300006163 Ga0070715_10026914 Ga0070715_100269142 245
649 3300006163 Ga0070715_10055823 Ga0070715_100558232 245
650 3300006173 Ga0070716_100090133 Ga0070716_1000901332 245
651 3300006175 Ga0070712_100015115 Ga0070712_1000151153 245
652 3300006175 Ga0070712_100056898 Ga0070712_1000568983 245
653 3300006175 Ga0070712_100105863 Ga0070712_1001058631 245
654 3300006237 Ga0097621_100006440 Ga0097621_1000064406 245
655 3300006237 Ga0097621_100365557 Ga0097621_1003655572 245
656 3300006358 Ga0068871_100004355 Ga0068871_1000043552 245
657 3300006871 Ga0075434_100008987 Ga0075434_1000089875 245
658 3300006871 Ga0075434_100027877 Ga0075434_1000278776 245
659 3300006871 Ga0075434_100060417 Ga0075434_1000604173 245
660 3300006881 Ga0068865_100006898 Ga0068865_1000068986 245
661 3300006914 Ga0075436_100296666 Ga0075436_1002966662 245
662 3300006931 Ga0097620_100546037 Ga0097620_1005460371 245
663 3300007076 Ga0075435_100063381 Ga0075435_1000633813 245
664 3300007788 Ga0099795_10054166 Ga0099795_100541661 245
665 3300009011 Ga0105251_10046512 Ga0105251_100465122 245
666 3300009036 Ga0105244_10025315 Ga0105244_100253152 245
667 3300009093 Ga0105240_10016134 Ga0105240_1001613410 245
668 3300009093 Ga0105240_10157777 Ga0105240_101577773 245
669 3300009093 Ga0105240_10287364 Ga0105240_102873643 245
670 3300009094 Ga0111539_10002538 Ga0111539_100025386 245
671 3300009094 Ga0111539_10007068 Ga0111539_100070686 245
672 3300009094 Ga0111539_10068084 Ga0111539_100680845 245
673 3300009098 Ga0105245_10001702 Ga0105245_100017024 245
674 3300009101 Ga0105247_10006797 Ga0105247_100067976 245
675 3300009148 Ga0105243_10374563 Ga0105243_103745632 245
676 3300009174 Ga0105241_10010244 Ga0105241_100102445 245
677 3300009174 Ga0105241_10012838 Ga0105241_100128387 245
678 3300009177 Ga0105248_10002716 Ga0105248_1000271615 245
679 3300009177 Ga0105248_10037966 Ga0105248_100379662 245
680 3300009545 Ga0105237_10018000 Ga0105237_100180003 245
681 3300009545 Ga0105237_10066349 Ga0105237_100663494 245
682 3300009545 Ga0105237_10073966 Ga0105237_100739664 245
683 3300009551 Ga0105238_10006569 Ga0105238_100065694 245
684 3300009551 Ga0105238_10073004 Ga0105238_100730045 245
685 3300009551 Ga0105238_10132187 Ga0105238_101321873 245
686 3300009551 Ga0105238_10163176 Ga0105238_101631763 245
687 3300009551 Ga0105238_10332019 Ga0105238_103320192 245
688 3300009551 Ga0105238_10424691 Ga0105238_104246912 245
689 3300009553 Ga0105249_10071773 Ga0105249_100717732 245
690 3300010375 Ga0105239_10031427 Ga0105239_100314274 245
691 3300010375 Ga0105239_10280344 Ga0105239_102803442 245
692 3300010375 Ga0105239_10884579 Ga0105239_108845792 245
693 3300011119 Ga0105246_10000456 Ga0105246_100004566 245
694 3300012498 Ga0157345_1002250 Ga0157345_10022502 245
695 3300013102 Ga0157371_10075338 Ga0157371_100753382 245
696 3300013104 Ga0157370_10100187 Ga0157370_101001873 245
697 3300013104 Ga0157370_10153587 Ga0157370_101535872 245
698 3300013105 Ga0157369_10015067 Ga0157369_100150677 245
699 3300013105 Ga0157369_10024939 Ga0157369_100249394 245
700 3300013105 Ga0157369_10415968 Ga0157369_104159682 245
701 3300013296 Ga0157374_10034155 Ga0157374_100341553 245
702 3300013296 Ga0157374_10043727 Ga0157374_100437272 245
703 3300013297 Ga0157378_10002239 Ga0157378_1000223921 245
704 3300013306 Ga0163162_10030118 Ga0163162_100301182 245
705 3300013306 Ga0163162_10068914 Ga0163162_100689143 245
706 3300013307 Ga0157372_10020685 Ga0157372_100206856 245
707 3300013307 Ga0157372_10074269 Ga0157372_100742693 245
708 3300013307 Ga0157372_10280402 Ga0157372_102804022 245
709 3300013308 Ga0157375_10005758 Ga0157375_100057586 245
710 3300014325 Ga0163163_10014654 Ga0163163_100146547 245
711 3300014325 Ga0163163_10191967 Ga0163163_101919672 245
712 3300014326 Ga0157380_10217494 Ga0157380_102174942 245
713 3300014745 Ga0157377_10024854 Ga0157377_100248543 245
714 3300014968 Ga0157379_10013988 Ga0157379_100139885 245
715 3300014968 Ga0157379_10274816 Ga0157379_102748162 245
716 3300014969 Ga0157376_10005756 Ga0157376_100057566 245
717 3300017792 Ga0163161_10006245 Ga0163161_100062456 245
718 3300021384 Ga0213876_10073960 Ga0213876_100739602 245
719 3300025271 Ga0207666_1005675 Ga0207666_10056752 245
720 3300025315 Ga0207697_10002825 Ga0207697_100028253 245
721 3300025728 Ga0207655_1039908 Ga0207655_10399083 245
722 3300025885 Ga0207653_10023381 Ga0207653_100233812 245
723 3300025893 Ga0207682_10000143 Ga0207682_1000014313 245
724 3300025900 Ga0207710_10018917 Ga0207710_100189174 245
725 3300025901 Ga0207688_10001469 Ga0207688_100014696 245
726 3300025904 Ga0207647_10098196 Ga0207647_100981962 245
727 3300025904 Ga0207647_10168272 Ga0207647_101682721 245
728 3300025905 Ga0207685_10016450 Ga0207685_100164501 245
729 3300025905 Ga0207685_10062571 Ga0207685_100625712 245
730 3300025906 Ga0207699_10037563 Ga0207699_100375632 245
731 3300025907 Ga0207645_10002217 Ga0207645_100022178 245
732 3300025908 Ga0207643_10000336 Ga0207643_1000033613 245
733 3300025911 Ga0207654_10006679 Ga0207654_100066796 245
734 3300025911 Ga0207654_10116824 Ga0207654_101168242 245
735 3300025912 Ga0207707_10012389 Ga0207707_100123894 245
736 3300025912 Ga0207707_10017176 Ga0207707_100171764 245
737 3300025912 Ga0207707_10038190 Ga0207707_100381902 245
738 3300025912 Ga0207707_10054577 Ga0207707_100545772 245
739 3300025913 Ga0207695_10031611 Ga0207695_100316113 245
740 3300025913 Ga0207695_10205357 Ga0207695_102053573 245
741 3300025914 Ga0207671_10332688 Ga0207671_103326881 245
742 3300025915 Ga0207693_10004427 Ga0207693_1000442710 245
743 3300025915 Ga0207693_10072563 Ga0207693_100725633 245
744 3300025915 Ga0207693_10266309 Ga0207693_102663092 245
745 3300025916 Ga0207663_10067158 Ga0207663_100671582 245
746 3300025916 Ga0207663_10077560 Ga0207663_100775603 245
747 3300025917 Ga0207660_10014956 Ga0207660_100149565 245
748 3300025917 Ga0207660_10033243 Ga0207660_100332434 245
749 3300025917 Ga0207660_10161860 Ga0207660_101618602 245
750 3300025917 Ga0207660_10175556 Ga0207660_101755563 245
751 3300025917 Ga0207660_10211800 Ga0207660_102118003 245
752 3300025918 Ga0207662_10004640 Ga0207662_100046406 245
753 3300025919 Ga0207657_10022892 Ga0207657_100228922 245
754 3300025919 Ga0207657_10025017 Ga0207657_100250173 245
755 3300025921 Ga0207652_10005136 Ga0207652_100051368 245
756 3300025921 Ga0207652_10095945 Ga0207652_100959452 245
757 3300025923 Ga0207681_10000782 Ga0207681_100007826 245
758 3300025923 Ga0207681_10208023 Ga0207681_102080232 245
759 3300025924 Ga0207694_10020377 Ga0207694_100203777 245
760 3300025924 Ga0207694_10113403 Ga0207694_101134032 245
761 3300025924 Ga0207694_10360359 Ga0207694_103603592 245
762 3300025926 Ga0207659_10000676 Ga0207659_1000067621 245
763 3300025927 Ga0207687_10009816 Ga0207687_100098165 245
764 3300025928 Ga0207700_10016838 Ga0207700_100168384 245
765 3300025928 Ga0207700_10020680 Ga0207700_100206801 245
766 3300025928 Ga0207700_10385924 Ga0207700_103859242 245
767 3300025929 Ga0207664_10296003 Ga0207664_102960031 245
768 3300025929 Ga0207664_10380134 Ga0207664_103801342 245
769 3300025931 Ga0207644_10001040 Ga0207644_100010402 245
770 3300025931 Ga0207644_10129955 Ga0207644_101299552 245
771 3300025932 Ga0207690_10091295 Ga0207690_100912952 245
772 3300025933 Ga0207706_10009667 Ga0207706_100096673 245
773 3300025933 Ga0207706_10164769 Ga0207706_101647693 245
774 3300025934 Ga0207686_10049722 Ga0207686_100497224 245
775 3300025935 Ga0207709_10001567 Ga0207709_1000156715 245
776 3300025936 Ga0207670_10003338 Ga0207670_100033384 245
777 3300025936 Ga0207670_10013045 Ga0207670_100130455 245
778 3300025938 Ga0207704_10000410 Ga0207704_100004104 245
779 3300025939 Ga0207665_10047075 Ga0207665_100470752 245
780 3300025940 Ga0207691_10010570 Ga0207691_100105703 245
781 3300025941 Ga0207711_10029312 Ga0207711_100293123 245
782 3300025941 Ga0207711_10120249 Ga0207711_101202492 245
783 3300025942 Ga0207689_10000929 Ga0207689_1000092913 245
784 3300025944 Ga0207661_10013325 Ga0207661_100133257 245
785 3300025944 Ga0207661_10029325 Ga0207661_100293254 245
786 3300025945 Ga0207679_10000504 Ga0207679_100005044 245
787 3300025949 Ga0207667_10123000 Ga0207667_101230002 245
788 3300025949 Ga0207667_10305583 Ga0207667_103055832 245
789 3300025949 Ga0207667_10511260 Ga0207667_105112601 245
790 3300025960 Ga0207651_10000218 Ga0207651_1000021813 245
791 3300025961 Ga0207712_10070427 Ga0207712_100704272 245
792 3300025981 Ga0207640_10060612 Ga0207640_100606124 245
793 3300025981 Ga0207640_10077019 Ga0207640_100770193 245
794 3300025986 Ga0207658_10011585 Ga0207658_100115856 245
795 3300026035 Ga0207703_10077391 Ga0207703_100773912 245
796 3300026041 Ga0207639_10076924 Ga0207639_100769244 245
797 3300026041 Ga0207639_10114505 Ga0207639_101145052 245
798 3300026041 Ga0207639_10116901 Ga0207639_101169012 245
799 3300026041 Ga0207639_10353630 Ga0207639_103536302 245
800 3300026041 Ga0207639_10824395 Ga0207639_108243951 245
801 3300026067 Ga0207678_10009656 Ga0207678_100096567 245
802 3300026067 Ga0207678_10401490 Ga0207678_104014902 245
803 3300026067 Ga0207678_10524003 Ga0207678_105240032 245
804 3300026075 Ga0207708_10006214 Ga0207708_100062143 245
805 3300026075 Ga0207708_10065389 Ga0207708_100653892 245
806 3300026088 Ga0207641_10066451 Ga0207641_100664514 245
807 3300026089 Ga0207648_10005804 Ga0207648_100058046 245
808 3300026116 Ga0207674_10002908 Ga0207674_1000290824 245
809 3300026116 Ga0207674_10026497 Ga0207674_100264977 245
810 3300026116 Ga0207674_10142978 Ga0207674_101429782 245
811 3300026116 Ga0207674_10678702 Ga0207674_106787021 245
812 3300026118 Ga0207675_100007822 Ga0207675_1000078223 245
813 3300026121 Ga0207683_10001206 Ga0207683_100012068 245
814 3300026142 Ga0207698_10087950 Ga0207698_100879503 245
815 3300027552 Ga0209982_1003211 Ga0209982_10032113 245
816 3300027682 Ga0209971_1003797 Ga0209971_10037974 245
817 3300027695 Ga0209966_1004315 Ga0209966_10043152 245
818 3300027717 Ga0209998_10003781 Ga0209998_100037814 245
819 3300027717 Ga0209998_10003792 Ga0209998_100037922 245
820 3300027876 Ga0209974_10022402 Ga0209974_100224024 245
821 3300027907 Ga0207428_10001593 Ga0207428_100015937 245
822 3300027907 Ga0207428_10005136 Ga0207428_100051367 245
823 3300027907 Ga0207428_10187030 Ga0207428_101870302 245
824 3300028379 Ga0268266_10088568 Ga0268266_100885682 245
825 3300028379 Ga0268266_10177780 Ga0268266_101777801 245
826 3300028379 Ga0268266_10512456 Ga0268266_105124562 245
827 3300028380 Ga0268265_10001135 Ga0268265_1000113520 245
828 3300028380 Ga0268265_10731894 Ga0268265_107318941 245
829 3300028381 Ga0268264_10014457 Ga0268264_100144575 245
830 3300028563 Ga0265319_1027513 Ga0265319_10275133 245
831 3300028573 Ga0265334_10001692 Ga0265334_100016922 245
832 3300028653 Ga0265323_10003727 Ga0265323_100037276 245
833 3300028666 Ga0265336_10000986 Ga0265336_100009862 245
834 3300028800 Ga0265338_10000231 Ga0265338_1000023115 245
835 3300029957 Ga0265324_10013312 Ga0265324_100133123 245
836 3300031241 Ga0265325_10000690 Ga0265325_1000069010 245
837 3300031241 Ga0265325_10035022 Ga0265325_100350223 245
838 3300031247 Ga0265340_10026105 Ga0265340_100261053 245
839 3300031595 Ga0265313_10009868 Ga0265313_100098686 245
840 3300034817 Ga0373948_0000029 Ga0373948_0000029_15260_15997 245
841 3300034818 Ga0373950_0002591 Ga0373950_0002591_1696_2433 245
842 3300034819 Ga0373958_0000728 Ga0373958_0000728_3016_3753 245
843 3300034820 Ga0373959_0016626 Ga0373959_0016626_580_1317 245
844 3300034957 Ga0373938_0001423 Ga0373938_0001423_1777_2514 245
845 3300034957 Ga0373938_0001812 Ga0373938_0001812_62_799 245
846 3300035084 Ga0373928_0000732 Ga0373928_0000732_130_867 245
847 3300035085 Ga0373929_0045536 Ga0373929_0045536_172_909 245
848 3300035088 Ga0373940_0000020 Ga0373940_0000020_14423_15160 245
849 3300035088 Ga0373940_0018133 Ga0373940_0018133_686_1423 245
850 3300035090 Ga0373949_0001031 Ga0373949_0001031_4722_5459 245
851 3300035091 Ga0373951_0000632 Ga0373951_0000632_2786_3523 245
852 3300035092 Ga0373952_0001277 Ga0373952_0001277_377_1114 245
853 3300035112 Ga0373932_0000824 Ga0373932_0000824_4823_5560 245
854 3300035112 Ga0373932_0090026 Ga0373932_0090026_190_963 245
855 3300035113 Ga0373936_0047880 Ga0373936_0047880_786_1553 245
856 3300035113 Ga0373936_0056963 Ga0373936_0056963_739_1491 245
857 3300035114 Ga0373939_0000304 Ga0373939_0000304_4058_4795 245
858 3300035114 Ga0373939_0002434 Ga0373939_0002434_2971_3708 245
859 3300035115 Ga0373941_0000192 Ga0373941_0000192_522_1259 245
860 3300035117 Ga0373953_0007644 Ga0373953_0007644_1721_2473 245
861 3300035119 Ga0373956_0024959 Ga0373956_0024959_629_1381 245
862 3300035121 Ga0373960_0002257 Ga0373960_0002257_498_1235 245
863 3300035172 Ga0373955_0022802 Ga0373955_0022802_306_1058 245
864 3300035207 Ga0373942_0000056 Ga0373942_0000056_4684_5421 245
865 3300035207 Ga0373942_0019892 Ga0373942_0019892_452_1189 245
866 3300035241 Ga0373961_0002275 Ga0373961_0002275_338_1075 245
867 3300035242 Ga0373962_0001582 Ga0373962_0001582_157_894 245
868 3300035691 Ga0373931_0003875 Ga0373931_0003875_2049_2786 245
869 3300035691 Ga0373931_0013186 Ga0373931_0013186_1397_2134 245
870 3300035724 Ga0373933_0007487 Ga0373933_0007487_4386_5138 245
871 3300035725 Ga0373947_0038172 Ga0373947_0038172_1561_2313 245
872 3300036401 Ga0373937_0022444 Ga0373937_0022444_457_1209 245
873 3300036459 Ga0372808_009206 Ga0372808_009206_183_947 245
874 3300037068 Ga0373925_0014335 Ga0373925_0014335_2729_3481 245
875 3300037418 Ga0395900_0184650 Ga0395900_0184650_290_1054 245
876 3300037466 Ga0395898_0049422 Ga0395898_0049422_3012_3785 245
877 3300037466 Ga0395898_0057402 Ga0395898_0057402_1028_1792 245
878 3300037466 Ga0395898_0073836 Ga0395898_0073836_261_1025 245
879 3300037853 Ga0436364_0957724 Ga0436364_0957724_1006_1764 245
880 3300039437 Ga0436365_0304554 Ga0436365_0304554_31_792 245
881 3300039437 Ga0436365_1010370 Ga0436365_1010370_329_1093 245
882 3300039437 Ga0436365_1336866 Ga0436365_1336866_1094_1858 245
883 3300039438 Ga0436360_1364050 Ga0436360_1364050_435_1202 245
884 3300039447 Ga0436361_1043239 Ga0436361_1043239_967_1740 245
885 3300039450 Ga0436363_1235120 Ga0436363_1235120_2958_3731 245
886 3300041492 Ga0451835_0128270 Ga0451835_0128270_177_944 245
887 3300042439 Ga0439464_0042294 Ga0439464_0042294_125_892 245
888 3300042461 Ga0439460_0003764 Ga0439460_0003764_171_908 245
889 3300042993 Ga0439440_0016980 Ga0439440_0016980_718_1455 245
890 3300044694 Ga0466963_0235879 Ga0466963_0235879_226_999 245
891 3300044694 Ga0466963_0256468 Ga0466963_0256468_95_853 245
892 3300044719 Ga0466971_0043662 Ga0466971_0043662_272_1039 245
893 3300044765 Ga0466970_0067062 Ga0466970_0067062_665_1432 245
894 3300044842 Ga0466957_0308189 Ga0466957_0308189_23_790 245
895 3300045049 Ga0466959_0038915 Ga0466959_0038915_638_1405 245
896 3300045051 Ga0451576_0022284 Ga0451576_0022284_4711_5448 245
897 3300045976 Ga0466967_0074228 Ga0466967_0074228_197_967 245
898 3300045976 Ga0466967_0412851 Ga0466967_0412851_34_792 245
899 3300046454 Ga0495592_0001825 Ga0495592_0001825_11934_12686 245
900 3300046462 Ga0495651_0065559 Ga0495651_0065559_1886_2638 245
901 3300046463 Ga0495653_0070163 Ga0495653_0070163_691_1443 245
902 3300046477 Ga0495664_0024949 Ga0495664_0024949_698_1459 245
903 3300046491 Ga0495584_0006685 Ga0495584_0006685_2642_3397 245
904 3300046492 Ga0495585_0003492 Ga0495585_0003492_7490_8245 245
905 3300046511 Ga0495608_0035870 Ga0495608_0035870_1228_1980 245
906 3300046516 Ga0495628_0001666 Ga0495628_0001666_5879_6631 245
907 3300046523 Ga0495644_0006543 Ga0495644_0006543_694_1449 245
908 3300046525 Ga0495663_0010205 Ga0495663_0010205_11_766 245
909 3300046529 Ga0495652_0053222 Ga0495652_0053222_2532_3284 245
910 3300046537 Ga0495598_0091172 Ga0495598_0091172_150_905 245
911 3300046543 Ga0495645_0003698 Ga0495645_0003698_1311_2063 245
912 3300046543 Ga0495645_0004662 Ga0495645_0004662_927_1688 245
913 3300046558 Ga0495633_0014595 Ga0495633_0014595_3165_3920 245
914 3300046559 Ga0495667_0005185 Ga0495667_0005185_27_779 245
915 3300046615 Ga0495656_0001233 Ga0495656_0001233_2728_3483 245
916 3300046663 Ga0495635_0008083 Ga0495635_0008083_5552_6304 245
917 3300046665 Ga0495661_0014295 Ga0495661_0014295_3312_4067 245
918 3300046675 Ga0495657_0085270 Ga0495657_0085270_328_1080 245
919 3300046678 Ga0495599_0220191 Ga0495599_0220191_200_952 245
920 3300046679 Ga0495623_0020165 Ga0495623_0020165_1405_2157 245
921 3300046680 Ga0495646_0076350 Ga0495646_0076350_502_1254 245
922 3300046684 Ga0495669_0112739 Ga0495669_0112739_85_822 245
923 3300046691 Ga0495670_0006352 Ga0495670_0006352_3488_4243 245
924 3300046794 Ga0495589_0051403 Ga0495589_0051403_1048_1803 245
925 3300047317 Ga0495604_0017550 Ga0495604_0017550_631_1383 245
926 3300047322 Ga0495680_0010930 Ga0495680_0010930_5265_6017 245
927 3300047444 Ga0495675_0041667 Ga0495675_0041667_16_768 245
928 3300047445 Ga0495677_0169583 Ga0495677_0169583_70_825 245
929 3300047446 Ga0495679_050851 Ga0495679_050851_287_1042 245
930 3300047471 Ga0495684_0080691 Ga0495684_0080691_1435_2187 245
931 3300048088 Ga0495602_0002833 Ga0495602_0002833_1973_2725 245
932 3300048903 Ga0496100_0057790 Ga0496100_0057790_39_776 245
933 3300048904 Ga0496101_0024709 Ga0496101_0024709_2886_3623 245
934 3300048906 Ga0496103_0010637 Ga0496103_0010637_3258_3995 245
935 3300048909 Ga0496106_0080930 Ga0496106_0080930_646_1383 245
936 3300048909 Ga0496106_0433304 Ga0496106_0433304_237_974 245
937 3300048910 Ga0496107_0055339 Ga0496107_0055339_1590_2327 245
938 3300048910 Ga0496107_0072288 Ga0496107_0072288_885_1622 245
939 3300048911 Ga0496108_0142857 Ga0496108_0142857_145_882 245
940 3300048912 Ga0496109_0000619 Ga0496109_0000619_26663_27400 245
941 3300048912 Ga0496109_0004242 Ga0496109_0004242_342_1079 245
942 3300048915 Ga0496112_0028452 Ga0496112_0028452_3185_3922 245
943 3300048915 Ga0496112_0134035 Ga0496112_0134035_718_1488 245
944 3300048916 Ga0496113_0002588 Ga0496113_0002588_9539_10276 245
945 3300048917 Ga0496114_0033283 Ga0496114_0033283_1236_1973 245
946 3300048918 Ga0496115_0093633 Ga0496115_0093633_1659_2396 245
947 3300048924 Ga0496121_0041970 Ga0496121_0041970_1793_2551 245
948 3300048928 Ga0496125_0307167 Ga0496125_0307167_120_887 245
949 3300048929 Ga0496126_0119958 Ga0496126_0119958_51_818 245
950 3300049573 Ga0501037_0122421 Ga0501037_0122421_340_1104 245
951 3300049579 Ga0501043_0029684 Ga0501043_0029684_1774_2538 245
952 3300049580 Ga0501046_0300203 Ga0501046_0300203_197_955 245
953 3300049581 Ga0501047_0202871 Ga0501047_0202871_557_1315 245
954 3300049581 Ga0501047_0339206 Ga0501047_0339206_66_806 245
955 3300049586 Ga0501070_0009862 Ga0501070_0009862_4271_5029 245
956 3300049589 Ga0501073_0357568 Ga0501073_0357568_153_911 245
957 3300049590 Ga0501074_0011255 Ga0501074_0011255_3115_3873 245
958 3300049592 Ga0501076_0152857 Ga0501076_0152857_981_1778 245
959 3300049593 Ga0501077_0021570 Ga0501077_0021570_13_810 245
960 3300049742 Ga0501080_0022077 Ga0501080_0022077_4777_5535 245
961 3300049742 Ga0501080_0239302 Ga0501080_0239302_819_1616 245
962 3300049743 Ga0501081_0026167 Ga0501081_0026167_1023_1820 245
963 3300049823 Ga0501044_0014594 Ga0501044_0014594_4548_5306 245
964 3300050490 nmdc:mga03n38_17568_c2 nmdc:mga03n38_17568_c2_695_1432 245
965 3300050511 nmdc:mga08y16_22135_c1 nmdc:mga08y16_22135_c1_3440_4177 245
966 3300050511 nmdc:mga08y16_335733_c1 nmdc:mga08y16_335733_c1_315_1082 245
967 3300050511 nmdc:mga08y16_4006_c1 nmdc:mga08y16_4006_c1_14022_14759 245
968 3300050512 nmdc:mga0n895_16263_c1 nmdc:mga0n895_16263_c1_682_1419 245
969 3300050512 nmdc:mga0n895_2721_c1 nmdc:mga0n895_2721_c1_7622_8395 245
970 3300050512 nmdc:mga0n895_275559_c1 nmdc:mga0n895_275559_c1_570_1343 245
971 3300050513 nmdc:mga0rr50_75998_c1 nmdc:mga0rr50_75998_c1_1724_2497 245
972 3300050514 nmdc:mga08x19_157081_c1 nmdc:mga08x19_157081_c1_470_1243 245
973 3300050515 nmdc:mga0a205_16026_c1 nmdc:mga0a205_16026_c1_1974_2711 245
974 3300053077 Ga0495601_0001033 Ga0495601_0001033_6705_7457 245
975 3300053077 Ga0495601_0088267 Ga0495601_0088267_433_1194 245
976 3300053078 Ga0495612_0001046 Ga0495612_0001046_227_979 245
977 3300053078 Ga0495612_0006352 Ga0495612_0006352_314_1075 245
978 3300053084 Ga0495595_0001438 Ga0495595_0001438_3579_4331 245
979 3300053085 Ga0495619_0000421 Ga0495619_0000421_15076_15828 245
980 3300053091 Ga0500647_0075881 Ga0500647_0075881_295_1062 245
981 3300053094 Ga0500566_0000805 Ga0500566_0000805_3255_4022 245
982 3300053095 Ga0500640_019219 Ga0500640_019219_1504_2271 245
983 3300053111 Ga0500572_002826 Ga0500572_002826_3237_4004 245
984 3300053115 Ga0500591_067383 Ga0500591_067383_182_949 245
985 3300053122 Ga0500608_033532 Ga0500608_033532_1363_2130 245
986 3300053123 Ga0500614_001346 Ga0500614_001346_3273_4040 245
987 3300053136 Ga0500559_0009559 Ga0500559_0009559_917_1684 245
988 3300053148 Ga0500590_055973 Ga0500590_055973_737_1504 245
989 3300053150 Ga0500603_000530 Ga0500603_000530_3237_4004 245
990 3300053159 Ga0500630_000445 Ga0500630_000445_16238_17005 245
991 3300053163 Ga0500639_000103 Ga0500639_000103_21536_22303 245
992 3300053735 Ga0500596_000547 Ga0500596_000547_6049_6816 245
993 3300061719 Ga0466962_0072446 Ga0466962_0072446_88_855 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

82

208

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.833 5 233
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8267 5 233
2ot3-assembly1.cif.gz_A crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21 0.8145 2 53
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.804 5 233
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7922 5 233
ID Description Score Start End Superfamily
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8951 58 180 3.40.50.620
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8852 62 180 3.40.50.2000
af_Q9VYJ4_80_210_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8813 58 180 3.40.50.620
af_Q7KTI0_75_205_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8783 60 180 3.40.50.620
af_Q22267_77_205_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8746 63 180 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A212LKU4-F1-model_v4 1-acylglycerol-3-phosphate O-acyltransferase 0.9827 4 240 GO:0003841
GO:0006654
GO:0016020
AF-A0A843REA4-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9822 3 235 GO:0003841
GO:0006654
GO:0016020
AF-A0A840M7T5-F1-model_v4 deleted 0.9808 3 237
AF-A0A519L7D5-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9788 5 180 GO:0003841
GO:0006654
GO:0016020
AF-A0A7W2BA42-F1-model_v4 DUF2125 domain-containing protein 0.977 3 238 GO:0003841
GO:0006654
GO:0016020

Feature Viewer

pLDDT pTM Quality
94.9 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map