F487664

General Info

Members Datasets Scaffolds Average Seq Length
992 573 1984 288

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1018608|Ga0436361_1018608_293_1252
Length 319
Sequence MSWPALCGHFCKNPAAQDKVQGANDIMLKQDVEDVKGLVPGKDFNRRDFVKGAVGTGFAAAVLPVTADTIKTDAEGLETGEVFIPVGDLKMPAYRAMPSGKKNAPVVLVISEIFGVHEHIADVARRFAKLGYMAIAPELFVRQGDAGAYGELAKLMSEVIAKVPDEQVMGDLDATVAWAKGQGADTGRLAITGFCWGGRITWLYAEHNPGVKAGVAWYGRLLGPTDPLHPSHPIDGVAHLHGPVLGLYGGADSGIPVDTVDKMKSALSQGSVAARKSEFIVYPDTPHAFNADYRPSYRKEPAEDGWKRCLAWFKANGVA

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
112 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
113 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
148 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
149 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
150 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
164 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
165 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
231 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
242 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
245 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
251 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
252 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
253 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
254 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
255 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
258 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
259 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
260 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
267 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
268 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
278 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
280 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
281 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
282 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
283 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
284 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
285 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
286 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
287 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
288 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
289 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
290 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
291 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
296 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
297 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
301 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
308 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
309 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
310 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
311 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
312 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
313 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
314 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
315 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
316 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
317 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
318 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
319 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
320 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
321 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
322 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
323 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
324 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
325 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
328 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
329 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
330 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
331 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
332 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
333 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
334 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
335 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
336 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
337 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
338 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
339 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
340 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
341 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
342 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
345 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
346 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
347 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
348 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
349 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
350 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
356 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
357 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
358 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
359 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
360 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
361 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
362 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
365 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
366 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
367 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
368 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
369 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
370 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
371 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
372 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
373 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
374 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
375 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
376 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
377 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
378 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
379 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
380 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
381 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
382 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
383 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
384 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
385 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
386 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
390 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
391 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
392 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
393 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
394 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
395 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
396 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
397 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
398 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
399 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
400 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
401 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
402 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
403 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
406 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
407 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
419 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
420 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
421 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
422 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
423 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
424 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
425 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
426 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
427 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
428 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
429 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
431 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
432 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
433 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
434 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
435 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
436 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
437 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
438 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
439 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
440 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
441 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
442 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
443 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
444 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
445 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
446 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
447 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
448 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
449 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
450 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
451 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
452 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
453 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
454 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
455 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
456 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
457 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
458 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
459 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
460 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
461 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
462 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
463 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
464 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
465 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
466 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
467 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
468 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
469 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
470 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
471 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
472 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
473 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
474 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
475 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
476 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
477 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
478 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
479 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
480 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
481 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
482 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
483 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
486 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
487 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
488 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
489 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
490 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
491 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
492 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
493 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
494 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
495 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
496 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
497 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
498 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
499 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
500 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
501 2643221594 Achromobacter sp. Root170 Isolate Unclassified
502 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
503 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
504 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
505 2643221660 Methylibium sp. Root1272 Isolate Unclassified
506 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
507 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
508 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
509 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
510 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
511 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
512 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
513 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
514 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
515 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
516 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
517 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
518 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
519 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
520 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
521 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
522 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
523 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
524 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
525 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
526 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
527 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
528 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
529 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
530 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
531 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
532 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
533 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
534 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
535 2922368715
536 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
537 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
538 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
539 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
540 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
541 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
542 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
543 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
544 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
545 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
546 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
547 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
548 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
549 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
550 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
551 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
552 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
553 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
554 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
555 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
556 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
557 641522639 Methylobacterium sp. 4-46 Isolate Nodule
558 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
559 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
560 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
561 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
562 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
563 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
564 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
565 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
566 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
567 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
568 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
569 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
570 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
571 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
572 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
573 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.92
Metatranscriptomes 0.5
Isolates 8.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.02
Nodule 5.75
Rhizoplane 2.22
Rhizosphere 68.95
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_1018608 3300039447 Bacteria 1557
2 JGI24741J21665_1001359 3300001915 Bacteria 7076
3 JGI24740J21852_10000340 3300001979 Bacteria 19873
4 JGI25156J39149_1007929 3300002705 Bacteria 2731
5 JGI25165J46597_1002623 3300003214 Bacteria 5431
6 JGI25153J46596_10002073 3300003215 Bacteria 11806
7 rootL2_10103177 3300003322 Bacteria 1825
8 rootH1_10079502 3300003323 Bacteria 2091
9 JGI26128J50194_1001320 3300003347 Bacteria 1559
10 JGI25404J52841_10008884 3300003659 Bacteria 2145
11 Ga0055539_1000068 3300003752 Bacteria 134912
12 Ga0055532_1000028 3300003758 Bacteria 234512
13 Ga0055525_1000031 3300003759 Bacteria 314909
14 Ga0055525_1000598 3300003759 Bacteria 15433
15 Ga0055525_1000665 3300003759 Bacteria 13242
16 Ga0055527_1000927 3300003760 Bacteria 7231
17 Ga0055535_1000022 3300003761 Bacteria 234512
18 Ga0055542_1008305 3300003762 Bacteria 2041
19 Ga0055529_1000063 3300003763 Bacteria 181573
20 Ga0055529_1000145 3300003763 Bacteria 101255
21 Ga0055524_1000125 3300003775 Bacteria 90042
22 Ga0055524_1025374 3300003775 Bacteria 1858
23 Ga0055530_10009462 3300003791 Bacteria 3742
24 Ga0055540_1000011 3300003792 Bacteria 282927
25 Ga0055531_10002564 3300003794 Bacteria 12058
26 Ga0055531_10015195 3300003794 Bacteria 3413
27 Ga0055541_1002371 3300003841 Bacteria 3787
28 Ga0055543_1002653 3300004625 Bacteria 5758
29 Ga0065165_1000254 3300005262 Bacteria 92762
30 Ga0065165_1000967 3300005262 Bacteria 36011
31 Ga0065165_1001979 3300005262 Bacteria 19337
32 Ga0065707_10118193 3300005295 Bacteria 2192
33 Ga0070676_10049365 3300005328 Bacteria 2464
34 Ga0070683_100137858 3300005329 Bacteria 2311
35 Ga0070683_100556618 3300005329 Bacteria 1097
36 Ga0070690_100018246 3300005330 Bacteria 4234
37 Ga0070677_10019642 3300005333 Bacteria 2451
38 Ga0070677_10060467 3300005333 Bacteria 1561
39 Ga0068869_100000502 3300005334 Bacteria 21805
40 Ga0068869_100012836 3300005334 Bacteria 5545
41 Ga0068869_100024065 3300005334 Bacteria 4216
42 Ga0068869_100056212 3300005334 Bacteria 2870
43 Ga0070680_100000089 3300005336 Bacteria 51222
44 Ga0070682_100002252 3300005337 Bacteria 10695
45 Ga0068868_100063676 3300005338 Bacteria 2925
46 Ga0068868_100123975 3300005338 Bacteria 2109
47 Ga0068868_100252845 3300005338 Bacteria 1484
48 Ga0068868_100556778 3300005338 Bacteria 1011
49 Ga0070689_100002936 3300005340 Bacteria 11212
50 Ga0070689_100084434 3300005340 Bacteria 2496
51 Ga0070689_100259421 3300005340 Bacteria 1436
52 Ga0070689_100547109 3300005340 Bacteria 997
53 Ga0070689_100575549 3300005340 Bacteria 973
54 Ga0070691_10000090 3300005341 Bacteria 25810
55 Ga0070687_100001346 3300005343 Bacteria 8618
56 Ga0070661_100000127 3300005344 Bacteria 63148
57 Ga0070661_100005430 3300005344 Bacteria 8788
58 Ga0070692_10014366 3300005345 Bacteria 3718
59 Ga0070668_100052347 3300005347 Bacteria 3147
60 Ga0070668_100139484 3300005347 Bacteria 1953
61 Ga0070669_100002477 3300005353 Bacteria 13373
62 Ga0070675_100004892 3300005354 Bacteria 10219
63 Ga0070675_100022483 3300005354 Bacteria 5039
64 Ga0070671_100001183 3300005355 Bacteria 19526
65 Ga0070671_100007139 3300005355 Bacteria 8925
66 Ga0070671_100133093 3300005355 Bacteria 2095
67 Ga0070674_100005318 3300005356 Bacteria 7423
68 Ga0070674_100018061 3300005356 Bacteria 4451
69 Ga0070674_100222984 3300005356 Bacteria 1467
70 Ga0070673_100042923 3300005364 Bacteria 3490
71 Ga0070688_100030488 3300005365 Bacteria 3238
72 Ga0070688_100073602 3300005365 Bacteria 2192
73 Ga0070659_100011766 3300005366 Bacteria 6475
74 Ga0070703_10018681 3300005406 Bacteria 2007
75 Ga0070701_10000812 3300005438 Bacteria 11149
76 Ga0070705_100021947 3300005440 Bacteria 3403
77 Ga0070700_100001359 3300005441 Bacteria 12155
78 Ga0070700_100007592 3300005441 Bacteria 5865
79 Ga0070700_100031885 3300005441 Bacteria 3163
80 Ga0070700_100206542 3300005441 Bacteria 1383
81 Ga0070694_100038194 3300005444 Bacteria 3189
82 Ga0070708_100045396 3300005445 Bacteria 3870
83 Ga0070663_100000005 3300005455 Bacteria 251758
84 Ga0070663_100027938 3300005455 Bacteria 3836
85 Ga0070663_100155245 3300005455 Bacteria 1758
86 Ga0070663_100227719 3300005455 Bacteria 1466
87 Ga0070678_100007153 3300005456 Bacteria 6600
88 Ga0070678_100355420 3300005456 Bacteria 1261
89 Ga0070662_100004421 3300005457 Bacteria 8886
90 Ga0070662_100021663 3300005457 Bacteria 4391
91 Ga0070681_10000283 3300005458 Bacteria 40794
92 Ga0070681_10208203 3300005458 Bacteria 1872
93 Ga0068867_100001413 3300005459 Bacteria 16602
94 Ga0068867_100003697 3300005459 Bacteria 10763
95 Ga0068867_100005468 3300005459 Bacteria 8990
96 Ga0068867_100063193 3300005459 Bacteria 2752
97 Ga0068867_100069066 3300005459 Bacteria 2638
98 Ga0068867_100098489 3300005459 Bacteria 2230
99 Ga0068867_100252837 3300005459 Bacteria 1434
100 Ga0068867_100267922 3300005459 Bacteria 1395
101 Ga0070685_10051229 3300005466 Bacteria 2387
102 Ga0070685_10064875 3300005466 Bacteria 2148
103 Ga0070706_100110330 3300005467 Bacteria 2560
104 Ga0070698_100024456 3300005471 Bacteria 6302
105 Ga0070699_100142456 3300005518 Bacteria 2118
106 Ga0070679_100066906 3300005530 Bacteria 3583
107 Ga0070697_100011628 3300005536 Bacteria 6879
108 Ga0070697_100017879 3300005536 Bacteria 5584
109 Ga0070697_100026559 3300005536 Bacteria 4627
110 Ga0068853_100029225 3300005539 Bacteria 4644
111 Ga0068853_100073699 3300005539 Bacteria 2977
112 Ga0070672_100030112 3300005543 Bacteria 4074
113 Ga0070672_100030729 3300005543 Bacteria 4038
114 Ga0070672_100036955 3300005543 Bacteria 3724
115 Ga0070672_100089475 3300005543 Bacteria 2481
116 Ga0070672_100089717 3300005543 Bacteria 2477
117 Ga0070672_100102653 3300005543 Bacteria 2321
118 Ga0070672_100225988 3300005543 Bacteria 1571
119 Ga0070686_100105076 3300005544 Bacteria 1914
120 Ga0070686_100274013 3300005544 Bacteria 1242
121 Ga0070695_100002400 3300005545 Bacteria 10764
122 Ga0070696_100002203 3300005546 Bacteria 12849
123 Ga0070696_100007677 3300005546 Bacteria 7208
124 Ga0070696_100010522 3300005546 Bacteria 6200
125 Ga0070696_100086641 3300005546 Bacteria 2224
126 Ga0070696_100264225 3300005546 Bacteria 1306
127 Ga0070693_100000477 3300005547 Bacteria 17942
128 Ga0070693_100146321 3300005547 Bacteria 1493
129 Ga0070693_100301986 3300005547 Bacteria 1079
130 Ga0070665_100009833 3300005548 Bacteria 9668
131 Ga0070665_100036818 3300005548 Bacteria 4920
132 Ga0070665_100042872 3300005548 Bacteria 4549
133 Ga0070665_100483678 3300005548 Bacteria 1249
134 Ga0070704_100000091 3300005549 Bacteria 31281
135 Ga0070704_100153732 3300005549 Bacteria 1812
136 Ga0068855_100006008 3300005563 Bacteria 14806
137 Ga0068855_100220413 3300005563 Bacteria 2127
138 Ga0070664_100000001 3300005564 Bacteria 551832
139 Ga0068857_100015540 3300005577 Bacteria 6650
140 Ga0068854_100000360 3300005578 Bacteria 29154
141 Ga0068854_100200088 3300005578 Bacteria 1570
142 Ga0068854_100228772 3300005578 Bacteria 1475
143 Ga0068856_100000008 3300005614 Bacteria 190886
144 Ga0068856_100235370 3300005614 Bacteria 1847
145 Ga0068856_100551586 3300005614 Bacteria 1174
146 Ga0070702_100099270 3300005615 Bacteria 1782
147 Ga0068852_100055789 3300005616 Bacteria 3411
148 Ga0068852_100068366 3300005616 Bacteria 3109
149 Ga0068852_100232487 3300005616 Bacteria 1758
150 Ga0068852_100741774 3300005616 Bacteria 994
151 Ga0068859_100056765 3300005617 Bacteria 3942
152 Ga0068859_100098055 3300005617 Bacteria 2985
153 Ga0068859_100133850 3300005617 Bacteria 2551
154 Ga0068859_100150397 3300005617 Bacteria 2403
155 Ga0068866_10000144 3300005718 Bacteria 32128
156 Ga0068866_10267196 3300005718 Bacteria 1054
157 Ga0068861_100002139 3300005719 Bacteria 12782
158 Ga0068861_100002723 3300005719 Bacteria 11577
159 Ga0068851_10068336 3300005834 Bacteria 1834
160 Ga0068851_10103052 3300005834 Bacteria 1516
161 Ga0068863_100246015 3300005841 Bacteria 1727
162 Ga0068858_100025874 3300005842 Bacteria 5457
163 Ga0068858_100375352 3300005842 Bacteria 1364
164 Ga0068860_100168771 3300005843 Bacteria 2113
165 Ga0068860_100263430 3300005843 Bacteria 1681
166 Ga0068862_100003743 3300005844 Bacteria 12974
167 Ga0068862_100038361 3300005844 Bacteria 4063
168 Ga0068862_100065330 3300005844 Bacteria 3133
169 Ga0068862_100287515 3300005844 Bacteria 1509
170 Ga0068862_100475814 3300005844 Bacteria 1182
171 Ga0081455_10000751 3300005937 Bacteria 42140
172 Ga0081455_10001528 3300005937 Bacteria 28516
173 Ga0081455_10011979 3300005937 Bacteria 8681
174 Ga0081540_1019214 3300005983 Bacteria 4163
175 Ga0081540_1032895 3300005983 Bacteria 2823
176 Ga0081539_10003869 3300005985 Bacteria 17514
177 Ga0081539_10011435 3300005985 Bacteria 7013
178 Ga0075365_10028989 3300006038 Bacteria 3533
179 Ga0075365_10045207 3300006038 Bacteria 2888
180 Ga0075365_10088146 3300006038 Bacteria 2111
181 Ga0075365_10248595 3300006038 Bacteria 1249
182 Ga0075365_10272515 3300006038 Bacteria 1190
183 Ga0075368_10129893 3300006042 Bacteria 1047
184 Ga0075363_100105192 3300006048 Bacteria 1565
185 Ga0075364_10147201 3300006051 Bacteria 1586
186 Ga0075432_10095659 3300006058 Bacteria 1092
187 Ga0075362_10003542 3300006177 Bacteria 5480
188 Ga0075362_10005668 3300006177 Bacteria 4590
189 Ga0075362_10006041 3300006177 Bacteria 4483
190 Ga0075362_10010288 3300006177 Bacteria 3647
191 Ga0075362_10055151 3300006177 Bacteria 1788
192 Ga0075362_10063661 3300006177 Bacteria 1673
193 Ga0075362_10130267 3300006177 Bacteria 1196
194 Ga0075367_10022378 3300006178 Bacteria 3545
195 Ga0075367_10043219 3300006178 Bacteria 2639
196 Ga0075367_10119129 3300006178 Bacteria 1626
197 Ga0075367_10167920 3300006178 Bacteria 1366
198 Ga0075367_10181141 3300006178 Bacteria 1314
199 Ga0075369_10000518 3300006186 Bacteria 12088
200 Ga0075369_10004751 3300006186 Bacteria 5043
201 Ga0075369_10039005 3300006186 Bacteria 2027
202 Ga0075366_10003352 3300006195 Bacteria 8430
203 Ga0075366_10004000 3300006195 Bacteria 7878
204 Ga0075366_10012500 3300006195 Bacteria 4815
205 Ga0075366_10015974 3300006195 Bacteria 4310
206 Ga0075366_10310297 3300006195 Bacteria 966
207 Ga0097621_100018437 3300006237 Bacteria 5331
208 Ga0097621_100050124 3300006237 Bacteria 3394
209 Ga0097621_100059627 3300006237 Bacteria 3125
210 Ga0097621_100288175 3300006237 Bacteria 1447
211 Ga0075370_10016151 3300006353 Bacteria 4013
212 Ga0075370_10088756 3300006353 Bacteria 1783
213 Ga0068871_100000744 3300006358 Bacteria 22076
214 Ga0068871_100030240 3300006358 Bacteria 4262
215 Ga0068871_100040766 3300006358 Bacteria 3720
216 Ga0068871_100125569 3300006358 Bacteria 2171
217 Ga0075428_100001109 3300006844 Bacteria 28681
218 Ga0075428_100181988 3300006844 Bacteria 2274
219 Ga0075428_100317654 3300006844 Bacteria 1674
220 Ga0075430_100163046 3300006846 Bacteria 1856
221 Ga0075430_100363898 3300006846 Bacteria 1194
222 Ga0075431_100002501 3300006847 Bacteria 17729
223 Ga0075431_100119334 3300006847 Bacteria 2721
224 Ga0075433_10001605 3300006852 Bacteria 16762
225 Ga0075434_100000018 3300006871 Bacteria 73715
226 Ga0075429_100000175 3300006880 Bacteria 41423
227 Ga0075429_100001595 3300006880 Bacteria 18685
228 Ga0068865_100000710 3300006881 Bacteria 18708
229 Ga0075436_100000651 3300006914 Bacteria 22851
230 Ga0075436_100003324 3300006914 Bacteria 11006
231 Ga0097620_100056768 3300006931 Bacteria 3942
232 Ga0097620_100098053 3300006931 Bacteria 2985
233 Ga0097620_100133857 3300006931 Bacteria 2551
234 Ga0097620_100150396 3300006931 Bacteria 2403
235 Ga0099824_1019151 3300006942 Bacteria 5420
236 Ga0099823_1000031 3300006944 Bacteria 69036
237 Ga0079104_1000465 3300006946 Bacteria 45434
238 Ga0075435_100003818 3300007076 Bacteria 10280
239 Ga0099794_10141377 3300007265 Bacteria 1219
240 Ga0105251_10022893 3300009011 Bacteria 3234
241 Ga0105240_10219749 3300009093 Unclassified 2214
242 Ga0105240_10482639 3300009093 Bacteria 1381
243 Ga0111539_10042972 3300009094 Bacteria 5422
244 Ga0111539_10090987 3300009094 Bacteria 3585
245 Ga0105245_10015461 3300009098 Bacteria 6653
246 Ga0105245_10139054 3300009098 Bacteria 2285
247 Ga0114129_10002499 3300009147 Bacteria 25510
248 Ga0114129_10167428 3300009147 Bacteria 2998
249 Ga0114129_10336234 3300009147 Bacteria 2004
250 Ga0114129_10348176 3300009147 Unclassified 1963
251 Ga0114129_10592113 3300009147 Bacteria 1438
252 Ga0114129_11098300 3300009147 Bacteria 996
253 Ga0105243_10004163 3300009148 Bacteria 11477
254 Ga0105243_10024763 3300009148 Bacteria 4581
255 Ga0105241_10008217 3300009174 Bacteria 7684
256 Ga0105241_10051192 3300009174 Bacteria 3149
257 Ga0105241_10071533 3300009174 Bacteria 2693
258 Ga0105242_10001851 3300009176 Bacteria 16595
259 Ga0105242_10004900 3300009176 Bacteria 10363
260 Ga0105242_10034893 3300009176 Bacteria 4032
261 Ga0105248_10124837 3300009177 Bacteria 2904
262 Ga0105248_10148985 3300009177 Bacteria 2640
263 Ga0105248_10161345 3300009177 Bacteria 2528
264 Ga0105248_10229761 3300009177 Bacteria 2088
265 Ga0105248_10472974 3300009177 Bacteria 1413
266 Ga0105237_10057572 3300009545 Bacteria 3889
267 Ga0105237_10242243 3300009545 Bacteria 1805
268 Ga0105249_10000917 3300009553 Bacteria 26070
269 Ga0105249_10010652 3300009553 Bacteria 8076
270 Ga0105249_10150834 3300009553 Bacteria 2238
271 Ga0105249_10664523 3300009553 Bacteria 1100
272 Ga0099796_10014631 3300010159 Bacteria 2271
273 Ga0105239_10046688 3300010375 Bacteria 4746
274 Ga0105239_10101673 3300010375 Bacteria 3180
275 Ga0105246_10319452 3300011119 Bacteria 1261
276 Ga0157371_10000035 3300013102 Bacteria 223396
277 Ga0157370_10000021 3300013104 Bacteria 166168
278 Ga0157370_10055308 3300013104 Bacteria 3781
279 Ga0157370_10465088 3300013104 Bacteria 1162
280 Ga0157374_10010968 3300013296 Bacteria 7825
281 Ga0157374_10050535 3300013296 Bacteria 3865
282 Ga0157374_10379068 3300013296 Bacteria 1409
283 Ga0157374_10392993 3300013296 Bacteria 1382
284 Ga0157378_10003846 3300013297 Bacteria 13282
285 Ga0157378_10411834 3300013297 Bacteria 1334
286 Ga0163162_10035901 3300013306 Bacteria 4938
287 Ga0163162_10193361 3300013306 Bacteria 2162
288 Ga0163162_10381065 3300013306 Bacteria 1544
289 Ga0163162_10881465 3300013306 Bacteria 1009
290 Ga0157372_10000331 3300013307 Bacteria 51927
291 Ga0157375_10015275 3300013308 Bacteria 6871
292 Ga0157375_10016183 3300013308 Bacteria 6690
293 Ga0157375_10643871 3300013308 Bacteria 1216
294 Ga0163163_10030553 3300014325 Bacteria 5192
295 Ga0157380_10140659 3300014326 Bacteria 2073
296 Ga0157380_10263862 3300014326 Bacteria 1566
297 Ga0157380_10338899 3300014326 Bacteria 1402
298 Ga0157377_10154253 3300014745 Bacteria 1422
299 Ga0157377_10205410 3300014745 Bacteria 1253
300 Ga0157379_10010706 3300014968 Bacteria 7991
301 Ga0157379_10151204 3300014968 Bacteria 2094
302 Ga0157379_10156831 3300014968 Bacteria 2054
303 Ga0157379_10259874 3300014968 Bacteria 1577
304 Ga0157379_10496213 3300014968 Bacteria 1131
305 Ga0157376_10004616 3300014969 Bacteria 9595
306 Ga0157376_10051551 3300014969 Bacteria 3419
307 Ga0157376_10113467 3300014969 Bacteria 2389
308 Ga0157376_10182261 3300014969 Bacteria 1921
309 Ga0182006_1000956 3300015261 Bacteria 19183
310 Ga0163161_10216564 3300017792 Bacteria 1481
311 Ga0206351_10374936 3300020077 Bacteria 15602
312 Ga0206353_10735033 3300020082 Bacteria 1864
313 Ga0154015_1042038 3300020610 Bacteria 50222
314 Ga0214544_1000001 3300021320 Bacteria 783667
315 Ga0214542_1000005 3300021321 Bacteria 389646
316 Ga0214545_1000003 3300021324 Bacteria 720274
317 Ga0214543_1000002 3300021327 Bacteria 712733
318 Ga0213872_10000006 3300021361 Bacteria 249845
319 Ga0213872_10000102 3300021361 Bacteria 79440
320 Ga0213872_10019477 3300021361 Bacteria 3125
321 Ga0213874_10008232 3300021377 Bacteria 2536
322 Ga0213876_10007766 3300021384 Bacteria 5822
323 Ga0213876_10081347 3300021384 Bacteria 1713
324 Ga0209784_100014 3300025224 Bacteria 496182
325 Ga0209566_100011 3300025225 Bacteria 496182
326 Ga0209674_100032 3300025226 Bacteria 426888
327 Ga0209672_100217 3300025228 Bacteria 44942
328 Ga0209147_100002 3300025229 Bacteria 2158988
329 Ga0209563_100029 3300025230 Bacteria 496182
330 Ga0209563_100044 3300025230 Bacteria 396812
331 Ga0209563_109055 3300025230 Bacteria 1530
332 Ga0209258_100002 3300025242 Bacteria 2158988
333 Ga0209677_100042 3300025253 Bacteria 225037
334 Ga0209148_1000303 3300025254 Bacteria 70843
335 Ga0209759_1001265 3300025256 Bacteria 15220
336 Ga0209233_1015836 3300025261 Bacteria 2089
337 Ga0209455_1000009 3300025272 Bacteria 1042273
338 Ga0209673_1002426 3300025273 Bacteria 12963
339 Ga0209673_1013089 3300025273 Bacteria 3300
340 Ga0209675_1006741 3300025291 Bacteria 4545
341 Ga0209758_1009145 3300025297 Bacteria 6235
342 Ga0209050_1000303 3300025298 Bacteria 101498
343 Ga0209050_1000532 3300025298 Bacteria 63063
344 Ga0209050_1002916 3300025298 Bacteria 13427
345 Ga0209050_1013549 3300025298 Bacteria 3609
346 Ga0209256_1000113 3300025299 Bacteria 175296
347 Ga0209256_1001555 3300025299 Bacteria 22789
348 Ga0207426_1000504 3300025302 Bacteria 57637
349 Ga0207426_1018836 3300025302 Bacteria 2425
350 Ga0207426_1023869 3300025302 Bacteria 2082
351 Ga0209051_1000020 3300025303 Bacteria 508628
352 Ga0209051_1002125 3300025303 Bacteria 14777
353 Ga0209257_1000085 3300025304 Bacteria 291117
354 Ga0209257_1002626 3300025304 Bacteria 17340
355 Ga0207697_10022960 3300025315 Bacteria 2555
356 Ga0207656_10050777 3300025321 Bacteria 1792
357 Ga0207653_10054404 3300025885 Bacteria 1338
358 Ga0207653_10075945 3300025885 Bacteria 1155
359 Ga0207682_10011915 3300025893 Bacteria 3396
360 Ga0207682_10063202 3300025893 Bacteria 1554
361 Ga0207642_10003770 3300025899 Bacteria 4824
362 Ga0207688_10034179 3300025901 Bacteria 2814
363 Ga0207688_10082350 3300025901 Bacteria 1839
364 Ga0207688_10153040 3300025901 Bacteria 1363
365 Ga0207645_10004810 3300025907 Bacteria 9928
366 Ga0207645_10022855 3300025907 Bacteria 4064
367 Ga0207645_10036572 3300025907 Bacteria 3152
368 Ga0207645_10058352 3300025907 Bacteria 2464
369 Ga0207643_10023693 3300025908 Bacteria 3386
370 Ga0207643_10087488 3300025908 Bacteria 1812
371 Ga0207684_10090709 3300025910 Bacteria 2604
372 Ga0207654_10047529 3300025911 Bacteria 2452
373 Ga0207707_10000946 3300025912 Bacteria 27996
374 Ga0207695_10002489 3300025913 Bacteria 27124
375 Ga0207671_10010822 3300025914 Bacteria 7485
376 Ga0207671_10108873 3300025914 Bacteria 2106
377 Ga0207663_10383015 3300025916 Bacteria 1072
378 Ga0207660_10009196 3300025917 Bacteria 6392
379 Ga0207662_10001703 3300025918 Bacteria 10769
380 Ga0207662_10147577 3300025918 Bacteria 1494
381 Ga0207649_10000951 3300025920 Bacteria 18067
382 Ga0207681_10000560 3300025923 Bacteria 25447
383 Ga0207681_10009154 3300025923 Bacteria 6048
384 Ga0207694_10373003 3300025924 Bacteria 1184
385 Ga0207650_10013530 3300025925 Bacteria 5651
386 Ga0207650_10229446 3300025925 Bacteria 1497
387 Ga0207650_10495156 3300025925 Bacteria 1021
388 Ga0207659_10001039 3300025926 Bacteria 16428
389 Ga0207659_10012111 3300025926 Bacteria 5471
390 Ga0207659_10027577 3300025926 Bacteria 3848
391 Ga0207687_10032123 3300025927 Bacteria 3553
392 Ga0207687_10093940 3300025927 Bacteria 2194
393 Ga0207687_10451919 3300025927 Bacteria 1066
394 Ga0207644_10000702 3300025931 Bacteria 21239
395 Ga0207644_10006395 3300025931 Bacteria 7674
396 Ga0207644_10137126 3300025931 Bacteria 1880
397 Ga0207690_10161946 3300025932 Bacteria 1669
398 Ga0207690_10180123 3300025932 Bacteria 1590
399 Ga0207706_10071324 3300025933 Bacteria 3055
400 Ga0207706_10219425 3300025933 Bacteria 1665
401 Ga0207686_10025103 3300025934 Bacteria 3462
402 Ga0207709_10001315 3300025935 Bacteria 17635
403 Ga0207709_10003990 3300025935 Bacteria 8604
404 Ga0207670_10058628 3300025936 Bacteria 2616
405 Ga0207670_10079977 3300025936 Bacteria 2283
406 Ga0207670_10237971 3300025936 Bacteria 1401
407 Ga0207669_10014738 3300025937 Bacteria 3924
408 Ga0207669_10042994 3300025937 Bacteria 2643
409 Ga0207669_10085942 3300025937 Bacteria 2032
410 Ga0207669_10200073 3300025937 Bacteria 1449
411 Ga0207704_10000483 3300025938 Bacteria 17756
412 Ga0207704_10009250 3300025938 Bacteria 4744
413 Ga0207665_10228541 3300025939 Bacteria 1366
414 Ga0207691_10011150 3300025940 Bacteria 8627
415 Ga0207691_10041479 3300025940 Bacteria 4249
416 Ga0207691_10067756 3300025940 Bacteria 3226
417 Ga0207691_10092488 3300025940 Bacteria 2708
418 Ga0207691_10214882 3300025940 Bacteria 1669
419 Ga0207691_10226698 3300025940 Bacteria 1619
420 Ga0207691_10236482 3300025940 Bacteria 1580
421 Ga0207711_10410234 3300025941 Bacteria 1259
422 Ga0207689_10000544 3300025942 Bacteria 35849
423 Ga0207689_10003145 3300025942 Bacteria 15148
424 Ga0207689_10018985 3300025942 Bacteria 5798
425 Ga0207689_10020712 3300025942 Bacteria 5529
426 Ga0207661_10121962 3300025944 Bacteria 2220
427 Ga0207679_10000003 3300025945 Bacteria 597553
428 Ga0207679_10002740 3300025945 Bacteria 10903
429 Ga0207679_10030714 3300025945 Bacteria 3754
430 Ga0207679_10177488 3300025945 Bacteria 1759
431 Ga0207679_10283324 3300025945 Bacteria 1422
432 Ga0207667_10008307 3300025949 Bacteria 12352
433 Ga0207651_10091417 3300025960 Bacteria 2228
434 Ga0207651_10164415 3300025960 Bacteria 1743
435 Ga0207651_10634423 3300025960 Bacteria 937
436 Ga0207712_10071400 3300025961 Bacteria 2497
437 Ga0207640_10001688 3300025981 Bacteria 11829
438 Ga0207640_10195989 3300025981 Bacteria 1526
439 Ga0207640_10203779 3300025981 Bacteria 1501
440 Ga0207658_10297486 3300025986 Bacteria 1389
441 Ga0207677_10003254 3300026023 Bacteria 8578
442 Ga0207677_10450338 3300026023 Bacteria 1103
443 Ga0207703_10018888 3300026035 Bacteria 5385
444 Ga0207703_10147850 3300026035 Bacteria 2045
445 Ga0207703_10190818 3300026035 Bacteria 1814
446 Ga0207703_10296210 3300026035 Bacteria 1474
447 Ga0207639_10029968 3300026041 Bacteria 3988
448 Ga0207639_10364684 3300026041 Bacteria 1294
449 Ga0207678_10000002 3300026067 Bacteria 371723
450 Ga0207678_10194219 3300026067 Bacteria 1735
451 Ga0207678_10344791 3300026067 Bacteria 1284
452 Ga0207678_10533730 3300026067 Bacteria 1025
453 Ga0207708_10000417 3300026075 Bacteria 33347
454 Ga0207708_10001699 3300026075 Bacteria 16293
455 Ga0207708_10085683 3300026075 Bacteria 2424
456 Ga0207702_10187404 3300026078 Bacteria 1909
457 Ga0207641_10017267 3300026088 Bacteria 5907
458 Ga0207641_10035620 3300026088 Bacteria 4148
459 Ga0207641_10167484 3300026088 Bacteria 2003
460 Ga0207641_10183889 3300026088 Bacteria 1916
461 Ga0207648_10000135 3300026089 Bacteria 73544
462 Ga0207648_10015768 3300026089 Bacteria 6931
463 Ga0207648_10030637 3300026089 Bacteria 4761
464 Ga0207648_10042910 3300026089 Bacteria 3972
465 Ga0207648_10309026 3300026089 Bacteria 1419
466 Ga0207676_10074049 3300026095 Bacteria 2742
467 Ga0207674_10004769 3300026116 Bacteria 16262
468 Ga0207674_10060567 3300026116 Bacteria 3827
469 Ga0207675_100000825 3300026118 Bacteria 30861
470 Ga0207675_100004517 3300026118 Bacteria 13434
471 Ga0207675_100004922 3300026118 Bacteria 12870
472 Ga0207683_10008076 3300026121 Bacteria 9000
473 Ga0207683_10010913 3300026121 Bacteria 7748
474 Ga0207683_10189381 3300026121 Bacteria 1867
475 Ga0207698_10072498 3300026142 Bacteria 2738
476 Ga0207698_10195923 3300026142 Bacteria 1805
477 Ga0207698_10781987 3300026142 Bacteria 955
478 Ga0209281_1000195 3300027111 Bacteria 139144
479 Ga0209969_1010576 3300027360 Bacteria 1321
480 Ga0209489_100105 3300027361 Bacteria 118979
481 Ga0209996_1000738 3300027395 Bacteria 3897
482 Ga0210000_1007955 3300027462 Bacteria 1554
483 Ga0209968_1000109 3300027526 Bacteria 15068
484 Ga0209970_1000101 3300027614 Bacteria 12138
485 Ga0209966_1000074 3300027695 Bacteria 43833
486 Ga0209974_10006416 3300027876 Bacteria 4107
487 Ga0207428_10000265 3300027907 Bacteria 70984
488 Ga0207428_10000836 3300027907 Bacteria 34639
489 Ga0207428_10054857 3300027907 Bacteria 3172
490 Ga0268266_10032817 3300028379 Bacteria 4412
491 Ga0268266_10051142 3300028379 Bacteria 3546
492 Ga0268265_10003452 3300028380 Bacteria 11365
493 Ga0268265_10077386 3300028380 Bacteria 2613
494 Ga0268265_10371746 3300028380 Bacteria 1312
495 Ga0268264_10112365 3300028381 Bacteria 2388
496 Ga0268264_10154193 3300028381 Bacteria 2063
497 Ga0268264_10258073 3300028381 Bacteria 1622
498 Ga0307517_10002354 3300028786 Bacteria 30505
499 Ga0307515_10000090 3300028794 Bacteria 215043
500 Ga0307515_10000889 3300028794 Bacteria 68865
501 Ga0307515_10020693 3300028794 Bacteria 11719
502 Ga0307515_10103312 3300028794 Bacteria 3417
503 Ga0307515_10107740 3300028794 Bacteria 3290
504 Ga0307515_10159127 3300028794 Bacteria 2313
505 Ga0307515_10307039 3300028794 Bacteria 1265
506 Ga0265338_10016868 3300028800 Bacteria 7907
507 Ga0307512_10056274 3300030522 Bacteria 3091
508 Ga0265325_10002473 3300031241 Bacteria 12450
509 Ga0265339_10001421 3300031249 Bacteria 17763
510 Ga0265331_10000240 3300031250 Bacteria 65865
511 Ga0307509_10129304 3300031507 Bacteria 2484
512 Ga0307509_10178407 3300031507 Bacteria 1993
513 Ga0307408_100151497 3300031548 Bacteria 1831
514 Ga0307408_100553016 3300031548 Bacteria 1016
515 Ga0265313_10000232 3300031595 Bacteria 60255
516 Ga0307508_10000007 3300031616 Bacteria 268359
517 Ga0307508_10004454 3300031616 Bacteria 13689
518 Ga0307514_10033870 3300031649 Bacteria 4073
519 Ga0307514_10169149 3300031649 Bacteria 1431
520 Ga0265314_10000324 3300031711 Bacteria 67246
521 Ga0265342_10130378 3300031712 Bacteria 1409
522 Ga0307516_10004597 3300031730 Bacteria 16937
523 Ga0307516_10007334 3300031730 Bacteria 12692
524 Ga0307516_10239909 3300031730 Bacteria 1512
525 Ga0307405_10000256 3300031731 Bacteria 19416
526 Ga0307405_10000317 3300031731 Bacteria 17864
527 Ga0307413_10038225 3300031824 Bacteria 2780
528 Ga0307410_10009377 3300031852 Bacteria 5487
529 Ga0307410_10190831 3300031852 Bacteria 1558
530 Ga0307410_10484449 3300031852 Bacteria 1015
531 Ga0307406_10033622 3300031901 Bacteria 3140
532 Ga0307406_10234044 3300031901 Bacteria 1374
533 Ga0307407_10033554 3300031903 Bacteria 2802
534 Ga0307412_10314058 3300031911 Bacteria 1244
535 Ga0307409_100044659 3300031995 Bacteria 3339
536 Ga0307416_100156973 3300032002 Bacteria 2096
537 Ga0307416_100208489 3300032002 Bacteria 1862
538 Ga0307414_10098951 3300032004 Bacteria 2190
539 Ga0307411_10000283 3300032005 Bacteria 16905
540 Ga0307411_10036738 3300032005 Bacteria 3073
541 Ga0307507_10031222 3300033179 Bacteria 5597
542 Ga0307510_10033672 3300033180 Bacteria 5750
543 Ga0307510_10078585 3300033180 Bacteria 3226
544 Ga0373938_0002656 3300034957 Bacteria 2886
545 Ga0373928_0012773 3300035084 Bacteria 1679
546 Ga0373929_0025057 3300035085 Bacteria 1236
547 Ga0373934_0018376 3300035086 Bacteria 2674
548 Ga0373940_0012338 3300035088 Bacteria 2046
549 Ga0373944_0024059 3300035089 Bacteria 1782
550 Ga0373951_0025750 3300035091 Bacteria 1367
551 Ga0373952_0026336 3300035092 Bacteria 1263
552 Ga0373923_0046420 3300035111 Bacteria 1807
553 Ga0373923_0066977 3300035111 Bacteria 1535
554 Ga0373932_0001394 3300035112 Bacteria 6773
555 Ga0373936_0025459 3300035113 Bacteria 2314
556 Ga0373939_0000406 3300035114 Bacteria 10849
557 Ga0373941_0036774 3300035115 Bacteria 1491
558 Ga0373941_0073198 3300035115 Bacteria 1142
559 Ga0373945_0083346 3300035116 Bacteria 1228
560 Ga0373953_0010816 3300035117 Bacteria 3186
561 Ga0373954_0000002 3300035118 Bacteria 147478
562 Ga0373954_0009550 3300035118 Bacteria 4268
563 Ga0373954_0053837 3300035118 Bacteria 1892
564 Ga0373957_0085145 3300035120 Bacteria 1251
565 Ga0373960_0002546 3300035121 Bacteria 4111
566 Ga0373960_0004307 3300035121 Bacteria 3253
567 Ga0373943_0008194 3300035170 Bacteria 4690
568 Ga0373943_0033692 3300035170 Bacteria 2441
569 Ga0373946_0036790 3300035171 Bacteria 1987
570 Ga0373955_0004737 3300035172 Bacteria 6051
571 Ga0373955_0011704 3300035172 Bacteria 4192
572 Ga0373955_0025766 3300035172 Bacteria 3023
573 Ga0373942_0008825 3300035207 Bacteria 2354
574 Ga0373942_0048776 3300035207 Bacteria 1181
575 Ga0373961_0006144 3300035241 Bacteria 2886
576 Ga0373961_0084546 3300035241 Bacteria 1003
577 Ga0373962_0003364 3300035242 Bacteria 3844
578 Ga0373924_0160968 3300035410 Bacteria 984
579 Ga0373931_0000878 3300035691 Bacteria 12684
580 Ga0373931_0006926 3300035691 Bacteria 5333
581 Ga0373931_0017131 3300035691 Bacteria 3577
582 Ga0373931_0022447 3300035691 Bacteria 3176
583 Ga0373931_0215910 3300035691 Bacteria 1153
584 Ga0373935_0067260 3300035692 Bacteria 2303
585 Ga0373935_0077485 3300035692 Bacteria 2155
586 Ga0373927_0006363 3300035695 Bacteria 8046
587 Ga0373927_0027536 3300035695 Bacteria 3710
588 Ga0373927_0116608 3300035695 Bacteria 1741
589 Ga0373933_0002915 3300035724 Bacteria 9553
590 Ga0373933_0014814 3300035724 Bacteria 4338
591 Ga0373947_0042799 3300035725 Bacteria 2703
592 Ga0373937_0000775 3300036401 Bacteria 27575
593 Ga0373937_0005397 3300036401 Bacteria 10937
594 Ga0373937_0012387 3300036401 Bacteria 7499
595 Ga0373937_0049472 3300036401 Bacteria 3849
596 Ga0373937_0062381 3300036401 Bacteria 3427
597 Ga0373937_0082710 3300036401 Bacteria 2970
598 Ga0373937_0100512 3300036401 Bacteria 2684
599 Ga0373937_0273523 3300036401 Bacteria 1594
600 Ga0373925_0029060 3300037068 Bacteria 4055
601 Ga0373925_0055069 3300037068 Bacteria 2976
602 Ga0373925_0194736 3300037068 Bacteria 1609
603 Ga0395899_0002961 3300037312 Bacteria 13589
604 Ga0395899_0008177 3300037312 Bacteria 8059
605 Ga0395900_0000131 3300037418 Bacteria 125554
606 Ga0395900_0000982 3300037418 Bacteria 37090
607 Ga0395900_0047295 3300037418 Bacteria 4429
608 Ga0395900_0084649 3300037418 Bacteria 3259
609 Ga0395898_0001654 3300037466 Bacteria 30082
610 Ga0395898_0005680 3300037466 Bacteria 13446
611 Ga0395898_0043585 3300037466 Bacteria 4420
612 Ga0395898_0080261 3300037466 Bacteria 3147
613 Ga0395898_0114645 3300037466 Bacteria 2582
614 Ga0395898_0338268 3300037466 Bacteria 1435
615 Ga0395905_0303430 3300037471 Bacteria 1484
616 Ga0395901_0023426 3300038443 Bacteria 6330
617 Ga0395901_0141068 3300038443 Bacteria 2532
618 Ga0395901_0297219 3300038443 Bacteria 1674
619 Ga0436365_0991864 3300039437 Bacteria 3609
620 Ga0436365_1309193 3300039437 Bacteria 1468
621 Ga0436365_1894950 3300039437 Bacteria 12272
622 Ga0436361_0180955 3300039447 Bacteria 14534
623 Ga0436361_0215868 3300039447 Bacteria 46672
624 Ga0436361_0614815 3300039447 Bacteria 45728
625 Ga0436361_0943220 3300039447 Bacteria 7109
626 Ga0436361_0948538 3300039447 Bacteria 4731
627 Ga0436363_0213439 3300039450 Bacteria 2050
628 Ga0436363_1197593 3300039450 Bacteria 11839
629 Ga0439465_0064194 3300041413 Bacteria 1221
630 Ga0451789_1263963 3300041443 Bacteria 2314
631 Ga0451793_0872760 3300041452 Bacteria 2395
632 Ga0451800_0633354 3300041459 Bacteria 1185
633 Ga0451802_1626057 3300041460 Bacteria 1921
634 Ga0451807_2332528 3300041486 Bacteria 2287
635 Ga0451853_2266638 3300041512 Bacteria 2031
636 Ga0439433_0051913 3300041999 Bacteria 968
637 Ga0439443_011331 3300042003 Bacteria 1305
638 Ga0450919_001662 3300042121 Bacteria 2912
639 Ga0450920_002898 3300042122 Bacteria 2951
640 Ga0450923_006873 3300042125 Bacteria 1903
641 Ga0450898_007755 3300042134 Bacteria 1678
642 Ga0439460_0032817 3300042461 Bacteria 1489
643 Ga0450918_001027 3300042531 Bacteria 5779
644 Ga0451577_0000142 3300042876 Bacteria 160598
645 Ga0451577_0063731 3300042876 Bacteria 3287
646 Ga0451577_0180178 3300042876 Bacteria 1905
647 Ga0466969_0008462 3300044656 Bacteria 5459
648 Ga0466972_0003819 3300044658 Bacteria 7493
649 Ga0466972_0177366 3300044658 Bacteria 999
650 Ga0466965_0105519 3300044683 Bacteria 1444
651 Ga0466966_0008896 3300044684 Bacteria 6650
652 Ga0466966_0105090 3300044684 Bacteria 1743
653 Ga0466961_0000124 3300044693 Bacteria 51384
654 Ga0466961_0007093 3300044693 Bacteria 7128
655 Ga0466963_0002329 3300044694 Bacteria 10589
656 Ga0453684_0000126 3300044712 Bacteria 336395
657 Ga0453684_0034602 3300044712 Bacteria 7009
658 Ga0453684_0043169 3300044712 Bacteria 6064
659 Ga0453684_0104673 3300044712 Bacteria 3454
660 Ga0466971_0039540 3300044719 Bacteria 2116
661 Ga0466971_0054286 3300044719 Bacteria 1806
662 Ga0466968_0026635 3300044735 Bacteria 2374
663 Ga0466968_0132589 3300044735 Bacteria 1135
664 Ga0466957_0121005 3300044842 Bacteria 1669
665 Ga0466960_0004443 3300044901 Bacteria 5482
666 Ga0466959_0001826 3300045049 Bacteria 13354
667 Ga0466959_0211308 3300045049 Bacteria 1348
668 Ga0451576_0003772 3300045051 Bacteria 20437
669 Ga0451576_0035037 3300045051 Bacteria 5327
670 Ga0451576_0388969 3300045051 Bacteria 1462
671 Ga0451576_0482518 3300045051 Bacteria 1302
672 Ga0451576_0804866 3300045051 Bacteria 987
673 Ga0466967_0224192 3300045976 Bacteria 1787
674 Ga0466967_0580460 3300045976 Bacteria 1105
675 Ga0495592_0045875 3300046454 Bacteria 3259
676 Ga0495592_0139244 3300046454 Bacteria 1690
677 Ga0495603_0008449 3300046455 Bacteria 6220
678 Ga0495590_0028408 3300046457 Bacteria 1962
679 Ga0495580_0114653 3300046472 Bacteria 1872
680 Ga0495639_0055695 3300046475 Bacteria 1804
681 Ga0495662_0010644 3300046476 Bacteria 4498
682 Ga0495585_0004013 3300046492 Bacteria 9690
683 Ga0495596_0068809 3300046500 Bacteria 1376
684 Ga0495606_0047629 3300046507 Bacteria 2824
685 Ga0495606_0146028 3300046507 Bacteria 1393
686 Ga0495608_0282424 3300046511 Bacteria 1030
687 Ga0495618_0273021 3300046514 Bacteria 1056
688 Ga0495628_0046729 3300046516 Bacteria 3437
689 Ga0495628_0163922 3300046516 Bacteria 1688
690 Ga0495630_0224862 3300046517 Bacteria 1433
691 Ga0495632_0002939 3300046519 Bacteria 12506
692 Ga0495632_0017590 3300046519 Bacteria 3941
693 Ga0495632_0026581 3300046519 Bacteria 3045
694 Ga0495643_0153402 3300046522 Bacteria 1139
695 Ga0495666_0089079 3300046526 Bacteria 1457
696 Ga0495652_0004960 3300046529 Bacteria 12614
697 Ga0495640_0027174 3300046533 Bacteria 4130
698 Ga0495640_0087969 3300046533 Bacteria 2054
699 Ga0495587_0010382 3300046536 Bacteria 5930
700 Ga0495598_0030562 3300046537 Bacteria 1510
701 Ga0495621_0000480 3300046539 Bacteria 9830
702 Ga0495645_0002795 3300046543 Bacteria 11841
703 Ga0495645_0159121 3300046543 Bacteria 1563
704 Ga0495622_0035337 3300046557 Bacteria 2330
705 Ga0495667_0013288 3300046559 Bacteria 5574
706 Ga0495668_0134277 3300046616 Bacteria 1354
707 Ga0495634_0016632 3300046642 Bacteria 5257
708 Ga0495611_0074975 3300046648 Bacteria 1550
709 Ga0495625_0010491 3300046660 Bacteria 7660
710 Ga0495625_0048827 3300046660 Bacteria 3045
711 Ga0495625_0067079 3300046660 Bacteria 2526
712 Ga0495635_0001963 3300046663 Bacteria 13979
713 Ga0495635_0064790 3300046663 Bacteria 2508
714 Ga0495659_0073171 3300046664 Bacteria 1288
715 Ga0495657_0012139 3300046675 Bacteria 6408
716 Ga0495657_0056016 3300046675 Bacteria 2628
717 Ga0495657_0087108 3300046675 Bacteria 2010
718 Ga0495657_0104275 3300046675 Bacteria 1803
719 Ga0495599_0007986 3300046678 Bacteria 6420
720 Ga0495623_0033039 3300046679 Bacteria 3321
721 Ga0495646_0103759 3300046680 Bacteria 1627
722 Ga0495647_0000141 3300046681 Bacteria 18379
723 Ga0495658_0004142 3300046683 Bacteria 7144
724 Ga0495624_0053140 3300046690 Bacteria 2558
725 Ga0495670_0111307 3300046691 Bacteria 1417
726 Ga0495671_0040374 3300046692 Bacteria 2353
727 Ga0495671_0101553 3300046692 Bacteria 1406
728 Ga0495649_0098717 3300046694 Bacteria 1553
729 Ga0495600_0108540 3300046809 Bacteria 1807
730 Ga0495604_0004395 3300047317 Bacteria 11160
731 Ga0495636_0116257 3300047318 Bacteria 1180
732 Ga0495674_0304702 3300047319 Bacteria 1301
733 Ga0495676_0055612 3300047321 Bacteria 3137
734 Ga0495676_0061088 3300047321 Bacteria 2949
735 Ga0495676_0069003 3300047321 Bacteria 2729
736 Ga0495680_0073740 3300047322 Bacteria 2593
737 Ga0495680_0125037 3300047322 Bacteria 1895
738 Ga0495675_0120526 3300047444 Bacteria 1634
739 Ga0495675_0172601 3300047444 Bacteria 1327
740 Ga0495684_0054957 3300047471 Bacteria 3037
741 Ga0495686_0004579 3300047472 Bacteria 11287
742 Ga0495686_0146755 3300047472 Bacteria 1388
743 Ga0495686_0300288 3300047472 Bacteria 886
744 Ga0495602_0100127 3300048088 Bacteria 2381
745 Ga0496101_0078932 3300048904 Bacteria 2429
746 Ga0496101_0103478 3300048904 Bacteria 2134
747 Ga0496101_0334937 3300048904 Bacteria 1188
748 Ga0496102_0008877 3300048905 Bacteria 8627
749 Ga0496102_0188078 3300048905 Bacteria 1946
750 Ga0496102_0853697 3300048905 Bacteria 833
751 Ga0496104_0013542 3300048907 Bacteria 7349
752 Ga0496104_0132350 3300048907 Bacteria 2396
753 Ga0496104_0321675 3300048907 Bacteria 1460
754 Ga0496105_0002701 3300048908 Bacteria 12930
755 Ga0496106_0029413 3300048909 Bacteria 4094
756 Ga0496107_0030805 3300048910 Bacteria 3825
757 Ga0496109_0000425 3300048912 Bacteria 37065
758 Ga0496110_0519033 3300048913 Bacteria 1084
759 Ga0496113_0107782 3300048916 Bacteria 2165
760 Ga0496114_0007954 3300048917 Bacteria 8390
761 Ga0496116_0231384 3300048919 Bacteria 937
762 Ga0496117_0220707 3300048920 Bacteria 1055
763 Ga0496118_0066928 3300048921 Bacteria 2620
764 Ga0496119_0048074 3300048922 Bacteria 2648
765 Ga0496120_0024245 3300048923 Bacteria 3786
766 Ga0496120_0041602 3300048923 Bacteria 2690
767 Ga0496124_0097279 3300048927 Bacteria 2390
768 Ga0496125_0027971 3300048928 Bacteria 5100
769 Ga0496125_0034396 3300048928 Bacteria 4468
770 Ga0496125_0157102 3300048928 Bacteria 1552
771 Ga0496126_0094113 3300048929 Bacteria 2630
772 Ga0496126_0097816 3300048929 Bacteria 2572
773 Ga0496126_0168128 3300048929 Bacteria 1870
774 Ga0496126_0311219 3300048929 Bacteria 1296
775 Ga0495682_0021333 3300049460 Bacteria 2427
776 Ga0501292_001000 3300049515 Bacteria 3440
777 Ga0501033_0026811 3300049570 Bacteria 4336
778 Ga0501034_0011876 3300049571 Bacteria 9010
779 Ga0501034_0041029 3300049571 Bacteria 4682
780 Ga0501034_0090124 3300049571 Bacteria 3065
781 Ga0501034_0093813 3300049571 Bacteria 2998
782 Ga0501036_0147145 3300049572 Bacteria 1987
783 Ga0501037_0350302 3300049573 Bacteria 1019
784 Ga0501039_0178582 3300049575 Bacteria 1670
785 Ga0501040_0060056 3300049576 Bacteria 2612
786 Ga0501041_0067641 3300049577 Bacteria 2190
787 Ga0501043_0000149 3300049579 Bacteria 65122
788 Ga0501043_0059236 3300049579 Bacteria 3005
789 Ga0501046_0000092 3300049580 Bacteria 97456
790 Ga0501047_0000028 3300049581 Bacteria 220279
791 Ga0501047_0169144 3300049581 Bacteria 2055
792 Ga0501047_0538127 3300049581 Bacteria 993
793 Ga0501048_0009579 3300049582 Bacteria 7271
794 Ga0501067_0038149 3300049583 Bacteria 2668
795 Ga0501068_0028769 3300049584 Bacteria 3289
796 Ga0501070_0145553 3300049586 Bacteria 1956
797 Ga0501070_0321865 3300049586 Bacteria 1258
798 Ga0501071_0473183 3300049587 Bacteria 960
799 Ga0501072_0094202 3300049588 Bacteria 2379
800 Ga0501072_0391455 3300049588 Bacteria 1103
801 Ga0501073_0242452 3300049589 Bacteria 1245
802 Ga0501075_0047834 3300049591 Bacteria 3214
803 Ga0501077_0006518 3300049593 Bacteria 7164
804 Ga0501077_0098628 3300049593 Bacteria 1852
805 Ga0501206_005673 3300049653 Bacteria 1610
806 Ga0501080_0224080 3300049742 Bacteria 1720
807 Ga0501081_0158627 3300049743 Bacteria 1629
808 Ga0501044_0058511 3300049823 Bacteria 3952
809 Ga0501044_0280470 3300049823 Bacteria 1600
810 Ga0501045_0000170 3300049824 Bacteria 35617
811 Ga0501045_0331268 3300049824 Bacteria 1133
812 Ga0501045_0393743 3300049824 Bacteria 1031
813 nmdc:mga03683_134843_c1 3300050489 Bacteria 1107
814 nmdc:mga03683_31585_c1 3300050489 Bacteria 2125
815 nmdc:mga0yw44_121576_c1 3300050492 Bacteria 1682
816 nmdc:mga0yw44_299724_c1 3300050492 Bacteria 1077
817 nmdc:mga0yw44_31618_c1 3300050492 Bacteria 3079
818 nmdc:mga0yw44_69975_c1 3300050492 Bacteria 2175
819 nmdc:mga0k408_13265_c2 3300050493 Bacteria 1243
820 nmdc:mga0k408_189928_c1 3300050493 Bacteria 1226
821 nmdc:mga0k408_34453_c1 3300050493 Bacteria 2898
822 nmdc:mga0k408_355_c1 3300050493 Bacteria 25188
823 nmdc:mga0k408_4782_c1 3300050493 Bacteria 7179
824 nmdc:mga0k408_8262_c1 3300050493 Bacteria 5584
825 nmdc:mga06z11_11455_c1 3300050494 Bacteria 3825
826 nmdc:mga06z11_25174_c1 3300050494 Bacteria 2817
827 nmdc:mga07m45_116092_c1 3300050496 Bacteria 1544
828 nmdc:mga07m45_126205_c1 3300050496 Bacteria 1479
829 nmdc:mga07m45_237741_c1 3300050496 Bacteria 1060
830 nmdc:mga07m45_4576_c1 3300050496 Bacteria 6776
831 nmdc:mga05p37_22621_c1 3300050507 Bacteria 7623
832 nmdc:mga05p37_834_c1 3300050507 Bacteria 34530
833 nmdc:mga05p37_91263_c1 3300050507 Bacteria 3754
834 nmdc:mga09592_12470_c1 3300050508 Bacteria 6925
835 nmdc:mga09592_37237_c1 3300050508 Bacteria 4081
836 nmdc:mga0qj67_193403_c1 3300050509 Bacteria 1653
837 nmdc:mga06r32_1647_c1 3300050510 Bacteria 20161
838 nmdc:mga08y16_343361_c1 3300050511 Bacteria 1535
839 nmdc:mga08y16_645_c1 3300050511 Bacteria 32765
840 nmdc:mga08y16_7771_c1 3300050511 Bacteria 11236
841 nmdc:mga0n895_1513_c1 3300050512 Bacteria 17434
842 nmdc:mga0n895_622072_c1 3300050512 Bacteria 1080
843 nmdc:mga0rr50_25095_c1 3300050513 Bacteria 4140
844 nmdc:mga0rr50_2997_c1 3300050513 Bacteria 9658
845 nmdc:mga08x19_10505_c1 3300050514 Bacteria 5560
846 nmdc:mga08x19_852_c1 3300050514 Bacteria 19371
847 nmdc:mga0a205_242_c2 3300050515 Bacteria 16279
848 nmdc:mga0a205_377315_c1 3300050515 Bacteria 1283
849 nmdc:mga0sz30_1099_c1 3300050516 Bacteria 9721
850 nmdc:mga0sz30_49105_c1 3300050516 Bacteria 1787
851 nmdc:mga0sz30_841_c1 3300050516 Bacteria 11086
852 Ga0495601_0010475 3300053077 Bacteria 5518
853 Ga0495601_0037945 3300053077 Bacteria 3011
854 Ga0495619_0014955 3300053085 Bacteria 4902
855 Ga0495619_0220893 3300053085 Bacteria 1312
856 Ga0500578_0000213 3300053086 Bacteria 71211
857 Ga0500643_000055 3300053087 Bacteria 134904
858 Ga0500646_0000779 3300053090 Bacteria 8971
859 Ga0500583_0094297 3300053092 Bacteria 1459
860 Ga0500641_0001086 3300053096 Bacteria 9689
861 Ga0500555_001672 3300053103 Bacteria 6686
862 Ga0500556_0000032 3300053104 Bacteria 150774
863 Ga0500556_0019261 3300053104 Bacteria 2166
864 Ga0500557_000017 3300053105 Bacteria 96699
865 Ga0500557_034886 3300053105 Bacteria 1547
866 Ga0500562_025173 3300053108 Bacteria 1556
867 Ga0500593_000309 3300053117 Bacteria 19752
868 Ga0500593_061130 3300053117 Bacteria 1655
869 Ga0500623_088515 3300053127 Bacteria 1452
870 Ga0500628_005522 3300053129 Bacteria 2112
871 Ga0500642_0018411 3300053130 Bacteria 2700
872 Ga0500642_0047489 3300053130 Bacteria 1881
873 Ga0500652_001388 3300053131 Bacteria 7550
874 Ga0500655_003264 3300053133 Bacteria 2936
875 Ga0500658_0027976 3300053134 Bacteria 2184
876 Ga0500658_0043576 3300053134 Bacteria 1807
877 Ga0500559_0102558 3300053136 Bacteria 1319
878 Ga0500568_0008237 3300053139 Bacteria 5046
879 Ga0500568_0033532 3300053139 Bacteria 2106
880 Ga0500577_0021015 3300053142 Bacteria 2145
881 Ga0500604_0005981 3300053151 Bacteria 3212
882 Ga0500604_0014598 3300053151 Bacteria 2140
883 Ga0500616_0005435 3300053153 Bacteria 8646
884 Ga0500616_0019385 3300053153 Bacteria 3835
885 Ga0500616_0038834 3300053153 Bacteria 2569
886 Ga0500619_028953 3300053154 Bacteria 1672
887 Ga0500622_0000631 3300053156 Bacteria 31645
888 Ga0500622_0113614 3300053156 Bacteria 1320
889 Ga0500622_0189560 3300053156 Bacteria 943
890 Ga0500627_0188393 3300053158 Bacteria 927
891 Ga0500633_0023017 3300053160 Bacteria 1917
892 Ga0500634_0032581 3300053161 Bacteria 2842
893 Ga0500636_0138733 3300053177 Bacteria 1348
894 Ga0500570_093605 3300053724 Bacteria 1297
895 Ga0500625_001288 3300053729 Bacteria 8408
896 Ga0500645_003651 3300053730 Bacteria 6154
897 Ga0500609_003054 3300053731 Bacteria 2377
898 Ga0500552_000330 3300053733 Bacteria 4364
899 Ga0500599_000707 3300053736 Bacteria 3608
900 Ga0500587_000100 3300053739 Bacteria 7588
901 Ga0590071_001924 3300059421 Bacteria 5316
902 Ga0587067_002283 3300059640 Bacteria 2240
903 Ga0587072_002611 3300059643 Bacteria 2430
904 Ga0501082_0339524 3300060353 Bacteria 1309
905 Ga0466962_0039672 3300061719 Bacteria 2254
906 Ga0530510_0113456 3300061734 Bacteria 1986
907 2508545047 2508501009 Bacteria 7784016
908 2508693793 2508501042 Bacteria 8719808
909 2513640872 2513237094 Bacteria 8789602
910 2513704437 2513237102 Bacteria 7703324
911 2514010422 2513237161 Bacteria 8871253
912 2545673124 2545555834 Bacteria 8130841
913 2587724866 2585428057 Bacteria 6737412
914 2587736727 2585428058 Bacteria 6853932
915 2587755607 2585428062 Bacteria 6842168
916 2588295337 2588253510 Bacteria 6901809
917 2597029873 2596583598 Bacteria 5251611
918 2599443728 2599185178 Bacteria 5365746
919 2643970209 2643221592 Bacteria 6608788
920 2643980913 2643221594 Bacteria 5811388
921 2644142393 2643221625 Bacteria 6512927
922 2644248236 2643221644 Bacteria 6865017
923 2644275141 2643221648 Bacteria 6521465
924 2644338796 2643221660 Bacteria 4208257
925 2809031761 2808606395 Bacteria 6020352
926 2824624012 2824617872 Bacteria 8814715
927 2824630273 2824626560 Bacteria 8813858
928 2824638067 2824635225 Bacteria 8785348
929 2824648073 2824644064 Bacteria 8743947
930 2824675260 2824671348 Bacteria 8369588
931 2824690111 2824687955 Bacteria 8360029
932 2824709578 2824704595 Bacteria 9667483
933 2824719362 2824714736 Bacteria 8717648
934 2824728208 2824723954 Bacteria 8758240
935 2824746074 2824746037 Bacteria 7911610
936 2824754472 2824753945 Bacteria 9787441
937 2824765482 2824763712 Bacteria 9792355
938 2838129079 2838122688 Bacteria 8803140
939 2841943403 2841941048 Bacteria 8688029
940 2841953868 2841949485 Bacteria 8680857
941 2841971416 2841966195 Bacteria 8673214
942 2841981215 2841974524 Bacteria 8931498
943 2841990378 2841983080 Bacteria 8395090
944 2844316681 2844315083 Bacteria 8138177
945 2874626278 2874620515 Bacteria 8290088
946 2881105183 2881101125 Bacteria 4590519
947 2881667412 2881665667 Bacteria 8175609
948 2903733589 2903727486 Bacteria 8281579
949 2904669296 2904666416 Bacteria 8226587
950 2904712622 2904711408 Bacteria 9771557
951 2906608080 2906602504 Bacteria 8295279
952 2908781827 2908775508 Bacteria 8092255
953 2919705179 2919704043 Bacteria 5560311
954 2922370898
955 2932796981 2932794094 Bacteria 7915132
956 2932807278 2932801729 Bacteria 7987968
957 2935650425 2935648319 Bacteria 8801166
958 2935658572 2935656913 Bacteria 8965014
959 2935774633 2935769743 Bacteria 7878163
960 2935781920 2935777560 Bacteria 8077691
961 2935789352 2935785616 Bacteria 7962367
962 2935797605 2935793552 Bacteria 8012592
963 2935884597 2935883170 Bacteria 7964738
964 2935912008 2935908558 Bacteria 8568796
965 2935961760 2935959822 Bacteria 7869783
966 2935986134 2935984226 Bacteria 8302647
967 2936013016 2936011229 Bacteria 8801034
968 2936021897 2936019824 Bacteria 8804134
969 2936030309 2936028420 Bacteria 8965941
970 2936048091 2936046547 Bacteria 8903709
971 2941533465 2941531003 Bacteria 7653939
972 3005511290 3005506211 Bacteria 6943378
973 3005596291 3005594810 Bacteria 8716512
974 3005712341 3005710791 Bacteria 7622528
975 3005719414 3005718088 Bacteria 8283608
976 641642272 641522639 Bacteria 7737025
977 8016524090 8016522445 Bacteria 8156687
978 8016537635 8016530956 Bacteria 8155261
979 8016541909 8016539877 Bacteria 8155419
980 8016551371 8016548790 Bacteria 8155074
981 8016559759 8016557553 Bacteria 8154380
982 8016567289 8016566248 Bacteria 8158151
983 8016580003 8016575299 Bacteria 8154085
984 8016597701 8016595262 Bacteria 8149947
985 8016604619 8016603502 Bacteria 8731218
986 8016620396 8016613128 Bacteria 8794220
987 8016629577 8016622563 Bacteria 7999408
988 8016637817 8016630954 Bacteria 9217207
989 8019537313 8019530166 Bacteria 8155624
990 8019539027 8019538911 Bacteria 7872763
991 8019548514 8019547302 Bacteria 7996444
992 8056973685 8056967851 Bacteria 9038162
993 Ga0436361_1018608
994 JGI24741J21665_1001359
995 JGI24740J21852_10000340
996 JGI25156J39149_1007929
997 JGI25165J46597_1002623
998 JGI25153J46596_10002073
999 rootL2_10103177
1000 rootH1_10079502
1001 JGI26128J50194_1001320
1002 JGI25404J52841_10008884
1003 Ga0055539_1000068
1004 Ga0055532_1000028
1005 Ga0055525_1000031
1006 Ga0055525_1000598
1007 Ga0055525_1000665
1008 Ga0055527_1000927
1009 Ga0055535_1000022
1010 Ga0055542_1008305
1011 Ga0055529_1000063
1012 Ga0055529_1000145
1013 Ga0055524_1000125
1014 Ga0055524_1025374
1015 Ga0055530_10009462
1016 Ga0055540_1000011
1017 Ga0055531_10002564
1018 Ga0055531_10015195
1019 Ga0055541_1002371
1020 Ga0055543_1002653
1021 Ga0065165_1000254
1022 Ga0065165_1000967
1023 Ga0065165_1001979
1024 Ga0065707_10118193
1025 Ga0070676_10049365
1026 Ga0070683_100137858
1027 Ga0070683_100556618
1028 Ga0070690_100018246
1029 Ga0070677_10019642
1030 Ga0070677_10060467
1031 Ga0068869_100000502
1032 Ga0068869_100012836
1033 Ga0068869_100024065
1034 Ga0068869_100056212
1035 Ga0070680_100000089
1036 Ga0070682_100002252
1037 Ga0068868_100063676
1038 Ga0068868_100123975
1039 Ga0068868_100252845
1040 Ga0068868_100556778
1041 Ga0070689_100002936
1042 Ga0070689_100084434
1043 Ga0070689_100259421
1044 Ga0070689_100547109
1045 Ga0070689_100575549
1046 Ga0070691_10000090
1047 Ga0070687_100001346
1048 Ga0070661_100000127
1049 Ga0070661_100005430
1050 Ga0070692_10014366
1051 Ga0070668_100052347
1052 Ga0070668_100139484
1053 Ga0070669_100002477
1054 Ga0070675_100004892
1055 Ga0070675_100022483
1056 Ga0070671_100001183
1057 Ga0070671_100007139
1058 Ga0070671_100133093
1059 Ga0070674_100005318
1060 Ga0070674_100018061
1061 Ga0070674_100222984
1062 Ga0070673_100042923
1063 Ga0070688_100030488
1064 Ga0070688_100073602
1065 Ga0070659_100011766
1066 Ga0070703_10018681
1067 Ga0070701_10000812
1068 Ga0070705_100021947
1069 Ga0070700_100001359
1070 Ga0070700_100007592
1071 Ga0070700_100031885
1072 Ga0070700_100206542
1073 Ga0070694_100038194
1074 Ga0070708_100045396
1075 Ga0070663_100000005
1076 Ga0070663_100027938
1077 Ga0070663_100155245
1078 Ga0070663_100227719
1079 Ga0070678_100007153
1080 Ga0070678_100355420
1081 Ga0070662_100004421
1082 Ga0070662_100021663
1083 Ga0070681_10000283
1084 Ga0070681_10208203
1085 Ga0068867_100001413
1086 Ga0068867_100003697
1087 Ga0068867_100005468
1088 Ga0068867_100063193
1089 Ga0068867_100069066
1090 Ga0068867_100098489
1091 Ga0068867_100252837
1092 Ga0068867_100267922
1093 Ga0070685_10051229
1094 Ga0070685_10064875
1095 Ga0070706_100110330
1096 Ga0070698_100024456
1097 Ga0070699_100142456
1098 Ga0070679_100066906
1099 Ga0070697_100011628
1100 Ga0070697_100017879
1101 Ga0070697_100026559
1102 Ga0068853_100029225
1103 Ga0068853_100073699
1104 Ga0070672_100030112
1105 Ga0070672_100030729
1106 Ga0070672_100036955
1107 Ga0070672_100089475
1108 Ga0070672_100089717
1109 Ga0070672_100102653
1110 Ga0070672_100225988
1111 Ga0070686_100105076
1112 Ga0070686_100274013
1113 Ga0070695_100002400
1114 Ga0070696_100002203
1115 Ga0070696_100007677
1116 Ga0070696_100010522
1117 Ga0070696_100086641
1118 Ga0070696_100264225
1119 Ga0070693_100000477
1120 Ga0070693_100146321
1121 Ga0070693_100301986
1122 Ga0070665_100009833
1123 Ga0070665_100036818
1124 Ga0070665_100042872
1125 Ga0070665_100483678
1126 Ga0070704_100000091
1127 Ga0070704_100153732
1128 Ga0068855_100006008
1129 Ga0068855_100220413
1130 Ga0070664_100000001
1131 Ga0068857_100015540
1132 Ga0068854_100000360
1133 Ga0068854_100200088
1134 Ga0068854_100228772
1135 Ga0068856_100000008
1136 Ga0068856_100235370
1137 Ga0068856_100551586
1138 Ga0070702_100099270
1139 Ga0068852_100055789
1140 Ga0068852_100068366
1141 Ga0068852_100232487
1142 Ga0068852_100741774
1143 Ga0068859_100056765
1144 Ga0068859_100098055
1145 Ga0068859_100133850
1146 Ga0068859_100150397
1147 Ga0068866_10000144
1148 Ga0068866_10267196
1149 Ga0068861_100002139
1150 Ga0068861_100002723
1151 Ga0068851_10068336
1152 Ga0068851_10103052
1153 Ga0068863_100246015
1154 Ga0068858_100025874
1155 Ga0068858_100375352
1156 Ga0068860_100168771
1157 Ga0068860_100263430
1158 Ga0068862_100003743
1159 Ga0068862_100038361
1160 Ga0068862_100065330
1161 Ga0068862_100287515
1162 Ga0068862_100475814
1163 Ga0081455_10000751
1164 Ga0081455_10001528
1165 Ga0081455_10011979
1166 Ga0081540_1019214
1167 Ga0081540_1032895
1168 Ga0081539_10003869
1169 Ga0081539_10011435
1170 Ga0075365_10028989
1171 Ga0075365_10045207
1172 Ga0075365_10088146
1173 Ga0075365_10248595
1174 Ga0075365_10272515
1175 Ga0075368_10129893
1176 Ga0075363_100105192
1177 Ga0075364_10147201
1178 Ga0075432_10095659
1179 Ga0075362_10003542
1180 Ga0075362_10005668
1181 Ga0075362_10006041
1182 Ga0075362_10010288
1183 Ga0075362_10055151
1184 Ga0075362_10063661
1185 Ga0075362_10130267
1186 Ga0075367_10022378
1187 Ga0075367_10043219
1188 Ga0075367_10119129
1189 Ga0075367_10167920
1190 Ga0075367_10181141
1191 Ga0075369_10000518
1192 Ga0075369_10004751
1193 Ga0075369_10039005
1194 Ga0075366_10003352
1195 Ga0075366_10004000
1196 Ga0075366_10012500
1197 Ga0075366_10015974
1198 Ga0075366_10310297
1199 Ga0097621_100018437
1200 Ga0097621_100050124
1201 Ga0097621_100059627
1202 Ga0097621_100288175
1203 Ga0075370_10016151
1204 Ga0075370_10088756
1205 Ga0068871_100000744
1206 Ga0068871_100030240
1207 Ga0068871_100040766
1208 Ga0068871_100125569
1209 Ga0075428_100001109
1210 Ga0075428_100181988
1211 Ga0075428_100317654
1212 Ga0075430_100163046
1213 Ga0075430_100363898
1214 Ga0075431_100002501
1215 Ga0075431_100119334
1216 Ga0075433_10001605
1217 Ga0075434_100000018
1218 Ga0075429_100000175
1219 Ga0075429_100001595
1220 Ga0068865_100000710
1221 Ga0075436_100000651
1222 Ga0075436_100003324
1223 Ga0097620_100056768
1224 Ga0097620_100098053
1225 Ga0097620_100133857
1226 Ga0097620_100150396
1227 Ga0099824_1019151
1228 Ga0099823_1000031
1229 Ga0079104_1000465
1230 Ga0075435_100003818
1231 Ga0099794_10141377
1232 Ga0105251_10022893
1233 Ga0105240_10219749
1234 Ga0105240_10482639
1235 Ga0111539_10042972
1236 Ga0111539_10090987
1237 Ga0105245_10015461
1238 Ga0105245_10139054
1239 Ga0114129_10002499
1240 Ga0114129_10167428
1241 Ga0114129_10336234
1242 Ga0114129_10348176
1243 Ga0114129_10592113
1244 Ga0114129_11098300
1245 Ga0105243_10004163
1246 Ga0105243_10024763
1247 Ga0105241_10008217
1248 Ga0105241_10051192
1249 Ga0105241_10071533
1250 Ga0105242_10001851
1251 Ga0105242_10004900
1252 Ga0105242_10034893
1253 Ga0105248_10124837
1254 Ga0105248_10148985
1255 Ga0105248_10161345
1256 Ga0105248_10229761
1257 Ga0105248_10472974
1258 Ga0105237_10057572
1259 Ga0105237_10242243
1260 Ga0105249_10000917
1261 Ga0105249_10010652
1262 Ga0105249_10150834
1263 Ga0105249_10664523
1264 Ga0099796_10014631
1265 Ga0105239_10046688
1266 Ga0105239_10101673
1267 Ga0105246_10319452
1268 Ga0157371_10000035
1269 Ga0157370_10000021
1270 Ga0157370_10055308
1271 Ga0157370_10465088
1272 Ga0157374_10010968
1273 Ga0157374_10050535
1274 Ga0157374_10379068
1275 Ga0157374_10392993
1276 Ga0157378_10003846
1277 Ga0157378_10411834
1278 Ga0163162_10035901
1279 Ga0163162_10193361
1280 Ga0163162_10381065
1281 Ga0163162_10881465
1282 Ga0157372_10000331
1283 Ga0157375_10015275
1284 Ga0157375_10016183
1285 Ga0157375_10643871
1286 Ga0163163_10030553
1287 Ga0157380_10140659
1288 Ga0157380_10263862
1289 Ga0157380_10338899
1290 Ga0157377_10154253
1291 Ga0157377_10205410
1292 Ga0157379_10010706
1293 Ga0157379_10151204
1294 Ga0157379_10156831
1295 Ga0157379_10259874
1296 Ga0157379_10496213
1297 Ga0157376_10004616
1298 Ga0157376_10051551
1299 Ga0157376_10113467
1300 Ga0157376_10182261
1301 Ga0182006_1000956
1302 Ga0163161_10216564
1303 Ga0206351_10374936
1304 Ga0206353_10735033
1305 Ga0154015_1042038
1306 Ga0214544_1000001
1307 Ga0214542_1000005
1308 Ga0214545_1000003
1309 Ga0214543_1000002
1310 Ga0213872_10000006
1311 Ga0213872_10000102
1312 Ga0213872_10019477
1313 Ga0213874_10008232
1314 Ga0213876_10007766
1315 Ga0213876_10081347
1316 Ga0209784_100014
1317 Ga0209566_100011
1318 Ga0209674_100032
1319 Ga0209672_100217
1320 Ga0209147_100002
1321 Ga0209563_100029
1322 Ga0209563_100044
1323 Ga0209563_109055
1324 Ga0209258_100002
1325 Ga0209677_100042
1326 Ga0209148_1000303
1327 Ga0209759_1001265
1328 Ga0209233_1015836
1329 Ga0209455_1000009
1330 Ga0209673_1002426
1331 Ga0209673_1013089
1332 Ga0209675_1006741
1333 Ga0209758_1009145
1334 Ga0209050_1000303
1335 Ga0209050_1000532
1336 Ga0209050_1002916
1337 Ga0209050_1013549
1338 Ga0209256_1000113
1339 Ga0209256_1001555
1340 Ga0207426_1000504
1341 Ga0207426_1018836
1342 Ga0207426_1023869
1343 Ga0209051_1000020
1344 Ga0209051_1002125
1345 Ga0209257_1000085
1346 Ga0209257_1002626
1347 Ga0207697_10022960
1348 Ga0207656_10050777
1349 Ga0207653_10054404
1350 Ga0207653_10075945
1351 Ga0207682_10011915
1352 Ga0207682_10063202
1353 Ga0207642_10003770
1354 Ga0207688_10034179
1355 Ga0207688_10082350
1356 Ga0207688_10153040
1357 Ga0207645_10004810
1358 Ga0207645_10022855
1359 Ga0207645_10036572
1360 Ga0207645_10058352
1361 Ga0207643_10023693
1362 Ga0207643_10087488
1363 Ga0207684_10090709
1364 Ga0207654_10047529
1365 Ga0207707_10000946
1366 Ga0207695_10002489
1367 Ga0207671_10010822
1368 Ga0207671_10108873
1369 Ga0207663_10383015
1370 Ga0207660_10009196
1371 Ga0207662_10001703
1372 Ga0207662_10147577
1373 Ga0207649_10000951
1374 Ga0207681_10000560
1375 Ga0207681_10009154
1376 Ga0207694_10373003
1377 Ga0207650_10013530
1378 Ga0207650_10229446
1379 Ga0207650_10495156
1380 Ga0207659_10001039
1381 Ga0207659_10012111
1382 Ga0207659_10027577
1383 Ga0207687_10032123
1384 Ga0207687_10093940
1385 Ga0207687_10451919
1386 Ga0207644_10000702
1387 Ga0207644_10006395
1388 Ga0207644_10137126
1389 Ga0207690_10161946
1390 Ga0207690_10180123
1391 Ga0207706_10071324
1392 Ga0207706_10219425
1393 Ga0207686_10025103
1394 Ga0207709_10001315
1395 Ga0207709_10003990
1396 Ga0207670_10058628
1397 Ga0207670_10079977
1398 Ga0207670_10237971
1399 Ga0207669_10014738
1400 Ga0207669_10042994
1401 Ga0207669_10085942
1402 Ga0207669_10200073
1403 Ga0207704_10000483
1404 Ga0207704_10009250
1405 Ga0207665_10228541
1406 Ga0207691_10011150
1407 Ga0207691_10041479
1408 Ga0207691_10067756
1409 Ga0207691_10092488
1410 Ga0207691_10214882
1411 Ga0207691_10226698
1412 Ga0207691_10236482
1413 Ga0207711_10410234
1414 Ga0207689_10000544
1415 Ga0207689_10003145
1416 Ga0207689_10018985
1417 Ga0207689_10020712
1418 Ga0207661_10121962
1419 Ga0207679_10000003
1420 Ga0207679_10002740
1421 Ga0207679_10030714
1422 Ga0207679_10177488
1423 Ga0207679_10283324
1424 Ga0207667_10008307
1425 Ga0207651_10091417
1426 Ga0207651_10164415
1427 Ga0207651_10634423
1428 Ga0207712_10071400
1429 Ga0207640_10001688
1430 Ga0207640_10195989
1431 Ga0207640_10203779
1432 Ga0207658_10297486
1433 Ga0207677_10003254
1434 Ga0207677_10450338
1435 Ga0207703_10018888
1436 Ga0207703_10147850
1437 Ga0207703_10190818
1438 Ga0207703_10296210
1439 Ga0207639_10029968
1440 Ga0207639_10364684
1441 Ga0207678_10000002
1442 Ga0207678_10194219
1443 Ga0207678_10344791
1444 Ga0207678_10533730
1445 Ga0207708_10000417
1446 Ga0207708_10001699
1447 Ga0207708_10085683
1448 Ga0207702_10187404
1449 Ga0207641_10017267
1450 Ga0207641_10035620
1451 Ga0207641_10167484
1452 Ga0207641_10183889
1453 Ga0207648_10000135
1454 Ga0207648_10015768
1455 Ga0207648_10030637
1456 Ga0207648_10042910
1457 Ga0207648_10309026
1458 Ga0207676_10074049
1459 Ga0207674_10004769
1460 Ga0207674_10060567
1461 Ga0207675_100000825
1462 Ga0207675_100004517
1463 Ga0207675_100004922
1464 Ga0207683_10008076
1465 Ga0207683_10010913
1466 Ga0207683_10189381
1467 Ga0207698_10072498
1468 Ga0207698_10195923
1469 Ga0207698_10781987
1470 Ga0209281_1000195
1471 Ga0209969_1010576
1472 Ga0209489_100105
1473 Ga0209996_1000738
1474 Ga0210000_1007955
1475 Ga0209968_1000109
1476 Ga0209970_1000101
1477 Ga0209966_1000074
1478 Ga0209974_10006416
1479 Ga0207428_10000265
1480 Ga0207428_10000836
1481 Ga0207428_10054857
1482 Ga0268266_10032817
1483 Ga0268266_10051142
1484 Ga0268265_10003452
1485 Ga0268265_10077386
1486 Ga0268265_10371746
1487 Ga0268264_10112365
1488 Ga0268264_10154193
1489 Ga0268264_10258073
1490 Ga0307517_10002354
1491 Ga0307515_10000090
1492 Ga0307515_10000889
1493 Ga0307515_10020693
1494 Ga0307515_10103312
1495 Ga0307515_10107740
1496 Ga0307515_10159127
1497 Ga0307515_10307039
1498 Ga0265338_10016868
1499 Ga0307512_10056274
1500 Ga0265325_10002473
1501 Ga0265339_10001421
1502 Ga0265331_10000240
1503 Ga0307509_10129304
1504 Ga0307509_10178407
1505 Ga0307408_100151497
1506 Ga0307408_100553016
1507 Ga0265313_10000232
1508 Ga0307508_10000007
1509 Ga0307508_10004454
1510 Ga0307514_10033870
1511 Ga0307514_10169149
1512 Ga0265314_10000324
1513 Ga0265342_10130378
1514 Ga0307516_10004597
1515 Ga0307516_10007334
1516 Ga0307516_10239909
1517 Ga0307405_10000256
1518 Ga0307405_10000317
1519 Ga0307413_10038225
1520 Ga0307410_10009377
1521 Ga0307410_10190831
1522 Ga0307410_10484449
1523 Ga0307406_10033622
1524 Ga0307406_10234044
1525 Ga0307407_10033554
1526 Ga0307412_10314058
1527 Ga0307409_100044659
1528 Ga0307416_100156973
1529 Ga0307416_100208489
1530 Ga0307414_10098951
1531 Ga0307411_10000283
1532 Ga0307411_10036738
1533 Ga0307507_10031222
1534 Ga0307510_10033672
1535 Ga0307510_10078585
1536 Ga0373938_0002656
1537 Ga0373928_0012773
1538 Ga0373929_0025057
1539 Ga0373934_0018376
1540 Ga0373940_0012338
1541 Ga0373944_0024059
1542 Ga0373951_0025750
1543 Ga0373952_0026336
1544 Ga0373923_0046420
1545 Ga0373923_0066977
1546 Ga0373932_0001394
1547 Ga0373936_0025459
1548 Ga0373939_0000406
1549 Ga0373941_0036774
1550 Ga0373941_0073198
1551 Ga0373945_0083346
1552 Ga0373953_0010816
1553 Ga0373954_0000002
1554 Ga0373954_0009550
1555 Ga0373954_0053837
1556 Ga0373957_0085145
1557 Ga0373960_0002546
1558 Ga0373960_0004307
1559 Ga0373943_0008194
1560 Ga0373943_0033692
1561 Ga0373946_0036790
1562 Ga0373955_0004737
1563 Ga0373955_0011704
1564 Ga0373955_0025766
1565 Ga0373942_0008825
1566 Ga0373942_0048776
1567 Ga0373961_0006144
1568 Ga0373961_0084546
1569 Ga0373962_0003364
1570 Ga0373924_0160968
1571 Ga0373931_0000878
1572 Ga0373931_0006926
1573 Ga0373931_0017131
1574 Ga0373931_0022447
1575 Ga0373931_0215910
1576 Ga0373935_0067260
1577 Ga0373935_0077485
1578 Ga0373927_0006363
1579 Ga0373927_0027536
1580 Ga0373927_0116608
1581 Ga0373933_0002915
1582 Ga0373933_0014814
1583 Ga0373947_0042799
1584 Ga0373937_0000775
1585 Ga0373937_0005397
1586 Ga0373937_0012387
1587 Ga0373937_0049472
1588 Ga0373937_0062381
1589 Ga0373937_0082710
1590 Ga0373937_0100512
1591 Ga0373937_0273523
1592 Ga0373925_0029060
1593 Ga0373925_0055069
1594 Ga0373925_0194736
1595 Ga0395899_0002961
1596 Ga0395899_0008177
1597 Ga0395900_0000131
1598 Ga0395900_0000982
1599 Ga0395900_0047295
1600 Ga0395900_0084649
1601 Ga0395898_0001654
1602 Ga0395898_0005680
1603 Ga0395898_0043585
1604 Ga0395898_0080261
1605 Ga0395898_0114645
1606 Ga0395898_0338268
1607 Ga0395905_0303430
1608 Ga0395901_0023426
1609 Ga0395901_0141068
1610 Ga0395901_0297219
1611 Ga0436365_0991864
1612 Ga0436365_1309193
1613 Ga0436365_1894950
1614 Ga0436361_0180955
1615 Ga0436361_0215868
1616 Ga0436361_0614815
1617 Ga0436361_0943220
1618 Ga0436361_0948538
1619 Ga0436363_0213439
1620 Ga0436363_1197593
1621 Ga0439465_0064194
1622 Ga0451789_1263963
1623 Ga0451793_0872760
1624 Ga0451800_0633354
1625 Ga0451802_1626057
1626 Ga0451807_2332528
1627 Ga0451853_2266638
1628 Ga0439433_0051913
1629 Ga0439443_011331
1630 Ga0450919_001662
1631 Ga0450920_002898
1632 Ga0450923_006873
1633 Ga0450898_007755
1634 Ga0439460_0032817
1635 Ga0450918_001027
1636 Ga0451577_0000142
1637 Ga0451577_0063731
1638 Ga0451577_0180178
1639 Ga0466969_0008462
1640 Ga0466972_0003819
1641 Ga0466972_0177366
1642 Ga0466965_0105519
1643 Ga0466966_0008896
1644 Ga0466966_0105090
1645 Ga0466961_0000124
1646 Ga0466961_0007093
1647 Ga0466963_0002329
1648 Ga0453684_0000126
1649 Ga0453684_0034602
1650 Ga0453684_0043169
1651 Ga0453684_0104673
1652 Ga0466971_0039540
1653 Ga0466971_0054286
1654 Ga0466968_0026635
1655 Ga0466968_0132589
1656 Ga0466957_0121005
1657 Ga0466960_0004443
1658 Ga0466959_0001826
1659 Ga0466959_0211308
1660 Ga0451576_0003772
1661 Ga0451576_0035037
1662 Ga0451576_0388969
1663 Ga0451576_0482518
1664 Ga0451576_0804866
1665 Ga0466967_0224192
1666 Ga0466967_0580460
1667 Ga0495592_0045875
1668 Ga0495592_0139244
1669 Ga0495603_0008449
1670 Ga0495590_0028408
1671 Ga0495580_0114653
1672 Ga0495639_0055695
1673 Ga0495662_0010644
1674 Ga0495585_0004013
1675 Ga0495596_0068809
1676 Ga0495606_0047629
1677 Ga0495606_0146028
1678 Ga0495608_0282424
1679 Ga0495618_0273021
1680 Ga0495628_0046729
1681 Ga0495628_0163922
1682 Ga0495630_0224862
1683 Ga0495632_0002939
1684 Ga0495632_0017590
1685 Ga0495632_0026581
1686 Ga0495643_0153402
1687 Ga0495666_0089079
1688 Ga0495652_0004960
1689 Ga0495640_0027174
1690 Ga0495640_0087969
1691 Ga0495587_0010382
1692 Ga0495598_0030562
1693 Ga0495621_0000480
1694 Ga0495645_0002795
1695 Ga0495645_0159121
1696 Ga0495622_0035337
1697 Ga0495667_0013288
1698 Ga0495668_0134277
1699 Ga0495634_0016632
1700 Ga0495611_0074975
1701 Ga0495625_0010491
1702 Ga0495625_0048827
1703 Ga0495625_0067079
1704 Ga0495635_0001963
1705 Ga0495635_0064790
1706 Ga0495659_0073171
1707 Ga0495657_0012139
1708 Ga0495657_0056016
1709 Ga0495657_0087108
1710 Ga0495657_0104275
1711 Ga0495599_0007986
1712 Ga0495623_0033039
1713 Ga0495646_0103759
1714 Ga0495647_0000141
1715 Ga0495658_0004142
1716 Ga0495624_0053140
1717 Ga0495670_0111307
1718 Ga0495671_0040374
1719 Ga0495671_0101553
1720 Ga0495649_0098717
1721 Ga0495600_0108540
1722 Ga0495604_0004395
1723 Ga0495636_0116257
1724 Ga0495674_0304702
1725 Ga0495676_0055612
1726 Ga0495676_0061088
1727 Ga0495676_0069003
1728 Ga0495680_0073740
1729 Ga0495680_0125037
1730 Ga0495675_0120526
1731 Ga0495675_0172601
1732 Ga0495684_0054957
1733 Ga0495686_0004579
1734 Ga0495686_0146755
1735 Ga0495686_0300288
1736 Ga0495602_0100127
1737 Ga0496101_0078932
1738 Ga0496101_0103478
1739 Ga0496101_0334937
1740 Ga0496102_0008877
1741 Ga0496102_0188078
1742 Ga0496102_0853697
1743 Ga0496104_0013542
1744 Ga0496104_0132350
1745 Ga0496104_0321675
1746 Ga0496105_0002701
1747 Ga0496106_0029413
1748 Ga0496107_0030805
1749 Ga0496109_0000425
1750 Ga0496110_0519033
1751 Ga0496113_0107782
1752 Ga0496114_0007954
1753 Ga0496116_0231384
1754 Ga0496117_0220707
1755 Ga0496118_0066928
1756 Ga0496119_0048074
1757 Ga0496120_0024245
1758 Ga0496120_0041602
1759 Ga0496124_0097279
1760 Ga0496125_0027971
1761 Ga0496125_0034396
1762 Ga0496125_0157102
1763 Ga0496126_0094113
1764 Ga0496126_0097816
1765 Ga0496126_0168128
1766 Ga0496126_0311219
1767 Ga0495682_0021333
1768 Ga0501292_001000
1769 Ga0501033_0026811
1770 Ga0501034_0011876
1771 Ga0501034_0041029
1772 Ga0501034_0090124
1773 Ga0501034_0093813
1774 Ga0501036_0147145
1775 Ga0501037_0350302
1776 Ga0501039_0178582
1777 Ga0501040_0060056
1778 Ga0501041_0067641
1779 Ga0501043_0000149
1780 Ga0501043_0059236
1781 Ga0501046_0000092
1782 Ga0501047_0000028
1783 Ga0501047_0169144
1784 Ga0501047_0538127
1785 Ga0501048_0009579
1786 Ga0501067_0038149
1787 Ga0501068_0028769
1788 Ga0501070_0145553
1789 Ga0501070_0321865
1790 Ga0501071_0473183
1791 Ga0501072_0094202
1792 Ga0501072_0391455
1793 Ga0501073_0242452
1794 Ga0501075_0047834
1795 Ga0501077_0006518
1796 Ga0501077_0098628
1797 Ga0501206_005673
1798 Ga0501080_0224080
1799 Ga0501081_0158627
1800 Ga0501044_0058511
1801 Ga0501044_0280470
1802 Ga0501045_0000170
1803 Ga0501045_0331268
1804 Ga0501045_0393743
1805 nmdc:mga03683_134843_c1
1806 nmdc:mga03683_31585_c1
1807 nmdc:mga0yw44_121576_c1
1808 nmdc:mga0yw44_299724_c1
1809 nmdc:mga0yw44_31618_c1
1810 nmdc:mga0yw44_69975_c1
1811 nmdc:mga0k408_13265_c2
1812 nmdc:mga0k408_189928_c1
1813 nmdc:mga0k408_34453_c1
1814 nmdc:mga0k408_355_c1
1815 nmdc:mga0k408_4782_c1
1816 nmdc:mga0k408_8262_c1
1817 nmdc:mga06z11_11455_c1
1818 nmdc:mga06z11_25174_c1
1819 nmdc:mga07m45_116092_c1
1820 nmdc:mga07m45_126205_c1
1821 nmdc:mga07m45_237741_c1
1822 nmdc:mga07m45_4576_c1
1823 nmdc:mga05p37_22621_c1
1824 nmdc:mga05p37_834_c1
1825 nmdc:mga05p37_91263_c1
1826 nmdc:mga09592_12470_c1
1827 nmdc:mga09592_37237_c1
1828 nmdc:mga0qj67_193403_c1
1829 nmdc:mga06r32_1647_c1
1830 nmdc:mga08y16_343361_c1
1831 nmdc:mga08y16_645_c1
1832 nmdc:mga08y16_7771_c1
1833 nmdc:mga0n895_1513_c1
1834 nmdc:mga0n895_622072_c1
1835 nmdc:mga0rr50_25095_c1
1836 nmdc:mga0rr50_2997_c1
1837 nmdc:mga08x19_10505_c1
1838 nmdc:mga08x19_852_c1
1839 nmdc:mga0a205_242_c2
1840 nmdc:mga0a205_377315_c1
1841 nmdc:mga0sz30_1099_c1
1842 nmdc:mga0sz30_49105_c1
1843 nmdc:mga0sz30_841_c1
1844 Ga0495601_0010475
1845 Ga0495601_0037945
1846 Ga0495619_0014955
1847 Ga0495619_0220893
1848 Ga0500578_0000213
1849 Ga0500643_000055
1850 Ga0500646_0000779
1851 Ga0500583_0094297
1852 Ga0500641_0001086
1853 Ga0500555_001672
1854 Ga0500556_0000032
1855 Ga0500556_0019261
1856 Ga0500557_000017
1857 Ga0500557_034886
1858 Ga0500562_025173
1859 Ga0500593_000309
1860 Ga0500593_061130
1861 Ga0500623_088515
1862 Ga0500628_005522
1863 Ga0500642_0018411
1864 Ga0500642_0047489
1865 Ga0500652_001388
1866 Ga0500655_003264
1867 Ga0500658_0027976
1868 Ga0500658_0043576
1869 Ga0500559_0102558
1870 Ga0500568_0008237
1871 Ga0500568_0033532
1872 Ga0500577_0021015
1873 Ga0500604_0005981
1874 Ga0500604_0014598
1875 Ga0500616_0005435
1876 Ga0500616_0019385
1877 Ga0500616_0038834
1878 Ga0500619_028953
1879 Ga0500622_0000631
1880 Ga0500622_0113614
1881 Ga0500622_0189560
1882 Ga0500627_0188393
1883 Ga0500633_0023017
1884 Ga0500634_0032581
1885 Ga0500636_0138733
1886 Ga0500570_093605
1887 Ga0500625_001288
1888 Ga0500645_003651
1889 Ga0500609_003054
1890 Ga0500552_000330
1891 Ga0500599_000707
1892 Ga0500587_000100
1893 Ga0590071_001924
1894 Ga0587067_002283
1895 Ga0587072_002611
1896 Ga0501082_0339524
1897 Ga0466962_0039672
1898 Ga0530510_0113456
1899 2508545047
1900 2508693793
1901 2513640872
1902 2513704437
1903 2514010422
1904 2545673124
1905 2587724866
1906 2587736727
1907 2587755607
1908 2588295337
1909 2597029873
1910 2599443728
1911 2643970209
1912 2643980913
1913 2644142393
1914 2644248236
1915 2644275141
1916 2644338796
1917 2809031761
1918 2824624012
1919 2824630273
1920 2824638067
1921 2824648073
1922 2824675260
1923 2824690111
1924 2824709578
1925 2824719362
1926 2824728208
1927 2824746074
1928 2824754472
1929 2824765482
1930 2838129079
1931 2841943403
1932 2841953868
1933 2841971416
1934 2841981215
1935 2841990378
1936 2844316681
1937 2874626278
1938 2881105183
1939 2881667412
1940 2903733589
1941 2904669296
1942 2904712622
1943 2906608080
1944 2908781827
1945 2919705179
1946 2922370898
1947 2932796981
1948 2932807278
1949 2935650425
1950 2935658572
1951 2935774633
1952 2935781920
1953 2935789352
1954 2935797605
1955 2935884597
1956 2935912008
1957 2935961760
1958 2935986134
1959 2936013016
1960 2936021897
1961 2936030309
1962 2936048091
1963 2941533465
1964 3005511290
1965 3005596291
1966 3005712341
1967 3005719414
1968 641642272
1969 8016524090
1970 8016537635
1971 8016541909
1972 8016551371
1973 8016559759
1974 8016567289
1975 8016580003
1976 8016597701
1977 8016604619
1978 8016620396
1979 8016629577
1980 8016637817
1981 8019537313
1982 8019539027
1983 8019548514
1984 8056973685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

91

317

0.96

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

87

224

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9799 47 287
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9678 47 287
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.8706 54 289
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8678 43 289
4u2e-assembly1.cif.gz_A crystal structure of dienelactone hydrolase s-3 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g, g211d and k234n) at 1.70 a resolution 0.865 49 288
ID Description Score Start End Superfamily
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9766 47 287 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9644 47 287 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8679 52 286 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8659 43 289 3.40.50.1820
af_Q8R1G2_23_244_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8641 52 288 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3A8HD05-F1-model_v4 Dienelactone hydrolase family protein 1.001 70 220 GO:0016787
AF-A0A3A8HD05-F1-model_v4 Dienelactone hydrolase family protein 0.994 70 220 GO:0016787
AF-A0A257P1I4-F1-model_v4 Carboxymethylenebutenolidase 0.9925 71 292 GO:0016787
AF-A0A259PF19-F1-model_v4 Carboxymethylenebutenolidase 0.991 94 292 GO:0016787
AF-A0A7W8WRI0-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.9879 83 292 GO:0008806

Map