F487636

General Info

Members Datasets Scaffolds Average Seq Length
991 418 1982 187

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000123|Ga0213875_1000012342
Length 222
Sequence MSPDNPHRPEDMAPYRGYQPAQNLDSSPCGEHRGAGDGLYRGEIASVLVTEEQIQRRIAEIAQQVAADFQAEHGDGDLLLVGVLKGAVMFMTDFARALPIPVQLEFMAVSSYGSATSSSGVVRILKDLDRDITGRHVLVVEDIIDSGLTLSWLLRNLLTRRPATLEVCTLLRKPDAVQIDVPVRYVGFDIPQEFVVGYGLDYGERYRDLPYIGTLAPEVYAD

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
241 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
244 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
254 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
255 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
295 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
319 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
349 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
354 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
371 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
372 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
385 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
396 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
397 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
398 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
408 2558860280 Kutzneria sp. 744 Isolate Unclassified
409 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
410 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
411 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
412 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
413 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
414 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
415 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
416 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
417 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
418 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0.4
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 5.65
Rhizosphere 91.12
Stem 0
Stem Tuber 0.1
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000123 3300021388 Bacteria 86889
2 JGI24749J21850_1033324 3300002076 Bacteria 743
3 JGI25406J46586_10011537 3300003203 Bacteria 3873
4 JGI25406J46586_10102001 3300003203 Bacteria 855
5 Ga0070658_10113789 3300005327 Bacteria 2244
6 Ga0070658_10705619 3300005327 Bacteria 876
7 Ga0070658_10765590 3300005327 Bacteria 838
8 Ga0070676_10085935 3300005328 Bacteria 1918
9 Ga0070676_10158072 3300005328 Bacteria 1456
10 Ga0070676_10192171 3300005328 Bacteria 1333
11 Ga0070676_10287431 3300005328 Bacteria 1110
12 Ga0070683_100318659 3300005329 Bacteria 1480
13 Ga0070683_100697196 3300005329 Bacteria 972
14 Ga0070690_100062094 3300005330 Bacteria 2409
15 Ga0070670_100036082 3300005331 Bacteria 4255
16 Ga0070670_100091437 3300005331 Bacteria 2616
17 Ga0068869_100011051 3300005334 Bacteria 5913
18 Ga0068869_100103621 3300005334 Bacteria 2156
19 Ga0068869_100165826 3300005334 Bacteria 1723
20 Ga0070680_100058990 3300005336 Bacteria 3139
21 Ga0070680_100121827 3300005336 Bacteria 2178
22 Ga0070682_100031698 3300005337 Bacteria 3198
23 Ga0070682_100117502 3300005337 Bacteria 1780
24 Ga0070682_100179800 3300005337 Bacteria 1476
25 Ga0070682_100283395 3300005337 Bacteria 1209
26 Ga0068868_100086462 3300005338 Bacteria 2520
27 Ga0068868_100128000 3300005338 Bacteria 2076
28 Ga0068868_100175130 3300005338 Bacteria 1778
29 Ga0068868_100571686 3300005338 Bacteria 998
30 Ga0068868_100589526 3300005338 Bacteria 984
31 Ga0070660_100071829 3300005339 Bacteria 2703
32 Ga0070660_100282530 3300005339 Bacteria 1358
33 Ga0070660_100898744 3300005339 Bacteria 747
34 Ga0070689_100042156 3300005340 Bacteria 3504
35 Ga0070689_100056311 3300005340 Bacteria 3048
36 Ga0070689_100168645 3300005340 Bacteria 1773
37 Ga0070687_100025521 3300005343 Bacteria 2836
38 Ga0070661_100106480 3300005344 Bacteria 2091
39 Ga0070661_100224945 3300005344 Bacteria 1440
40 Ga0070661_100610713 3300005344 Bacteria 882
41 Ga0070692_10030140 3300005345 Bacteria 2711
42 Ga0070692_10067746 3300005345 Bacteria 1895
43 Ga0070692_10247970 3300005345 Bacteria 1065
44 Ga0070692_10386316 3300005345 Bacteria 880
45 Ga0070668_100458209 3300005347 Bacteria 1097
46 Ga0070668_101368581 3300005347 Bacteria 645
47 Ga0070669_100058538 3300005353 Bacteria 2828
48 Ga0070669_100229784 3300005353 Bacteria 1470
49 Ga0070675_100046688 3300005354 Bacteria 3547
50 Ga0070675_100509109 3300005354 Bacteria 1085
51 Ga0070671_100000909 3300005355 Bacteria 21598
52 Ga0070671_100112451 3300005355 Bacteria 2287
53 Ga0070671_100223289 3300005355 Bacteria 1598
54 Ga0070674_100004141 3300005356 Bacteria 8233
55 Ga0070674_100046405 3300005356 Bacteria 2972
56 Ga0070674_100112001 3300005356 Bacteria 2005
57 Ga0070673_100133831 3300005364 Bacteria 2084
58 Ga0070673_100315050 3300005364 Bacteria 1381
59 Ga0070673_100767627 3300005364 Bacteria 888
60 Ga0070688_100045177 3300005365 Bacteria 2720
61 Ga0070659_100023252 3300005366 Bacteria 4740
62 Ga0070659_100140300 3300005366 Bacteria 1967
63 Ga0070667_100410934 3300005367 Bacteria 1233
64 Ga0070709_10137992 3300005434 Bacteria 1672
65 Ga0070714_100019347 3300005435 Bacteria 5545
66 Ga0070714_100200985 3300005435 Bacteria 1823
67 Ga0070713_100149421 3300005436 Bacteria 2076
68 Ga0070713_100377331 3300005436 Bacteria 1320
69 Ga0070713_100599429 3300005436 Bacteria 1046
70 Ga0070710_10019601 3300005437 Bacteria 3498
71 Ga0070710_10297154 3300005437 Bacteria 1053
72 Ga0070701_10055849 3300005438 Bacteria 2064
73 Ga0070701_10105654 3300005438 Bacteria 1566
74 Ga0070711_100007611 3300005439 Bacteria 6593
75 Ga0070711_100018745 3300005439 Bacteria 4425
76 Ga0070705_100412682 3300005440 Bacteria 1003
77 Ga0070705_100720412 3300005440 Bacteria 786
78 Ga0070700_100005670 3300005441 Bacteria 6624
79 Ga0070700_100177527 3300005441 Bacteria 1479
80 Ga0070700_100269229 3300005441 Bacteria 1230
81 Ga0070694_100105417 3300005444 Bacteria 2000
82 Ga0070708_100002519 3300005445 Bacteria 14145
83 Ga0070708_100004229 3300005445 Bacteria 11275
84 Ga0070708_100006320 3300005445 Bacteria 9429
85 Ga0070708_100018330 3300005445 Bacteria 5859
86 Ga0070708_100028347 3300005445 Bacteria 4819
87 Ga0070708_100218068 3300005445 Bacteria 1789
88 Ga0070708_101190058 3300005445 Bacteria 713
89 Ga0070663_100055023 3300005455 Bacteria 2847
90 Ga0070663_100106788 3300005455 Bacteria 2098
91 Ga0070663_100788369 3300005455 Bacteria 814
92 Ga0070663_101073570 3300005455 Bacteria 703
93 Ga0070678_100476598 3300005456 Bacteria 1097
94 Ga0070678_100777028 3300005456 Bacteria 868
95 Ga0070662_100112744 3300005457 Bacteria 2074
96 Ga0070662_100313560 3300005457 Bacteria 1277
97 Ga0068867_100014962 3300005459 Bacteria 5499
98 Ga0068867_100045227 3300005459 Bacteria 3227
99 Ga0068867_100047900 3300005459 Bacteria 3143
100 Ga0068867_100077307 3300005459 Bacteria 2501
101 Ga0070685_10036710 3300005466 Bacteria 2771
102 Ga0070685_10067551 3300005466 Bacteria 2109
103 Ga0070685_10153208 3300005466 Bacteria 1462
104 Ga0070706_100113840 3300005467 Bacteria 2519
105 Ga0070706_100465706 3300005467 Bacteria 1176
106 Ga0070707_100208962 3300005468 Bacteria 1903
107 Ga0070698_100082845 3300005471 Bacteria 3199
108 Ga0070698_100210864 3300005471 Bacteria 1877
109 Ga0070698_100227835 3300005471 Bacteria 1797
110 Ga0070699_100103363 3300005518 Bacteria 2498
111 Ga0070699_100377253 3300005518 Bacteria 1280
112 Ga0070699_100514497 3300005518 Unclassified 1088
113 Ga0070699_100963448 3300005518 Bacteria 782
114 Ga0070679_100046068 3300005530 Bacteria 4346
115 Ga0070679_100188025 3300005530 Bacteria 2035
116 Ga0070679_100781864 3300005530 Bacteria 898
117 Ga0070684_100236983 3300005535 Bacteria 1667
118 Ga0070684_100857000 3300005535 Bacteria 850
119 Ga0070697_100175129 3300005536 Bacteria 1817
120 Ga0070697_100285060 3300005536 Unclassified 1418
121 Ga0068853_100326373 3300005539 Bacteria 1423
122 Ga0070672_100082630 3300005543 Bacteria 2577
123 Ga0070672_100112170 3300005543 Bacteria 2224
124 Ga0070672_100397570 3300005543 Bacteria 1181
125 Ga0070686_100129005 3300005544 Bacteria 1746
126 Ga0070686_100160794 3300005544 Bacteria 1581
127 Ga0070695_100039249 3300005545 Bacteria 2992
128 Ga0070696_100016150 3300005546 Bacteria 5022
129 Ga0070696_100434994 3300005546 Bacteria 1033
130 Ga0070665_100017820 3300005548 Bacteria 7129
131 Ga0070665_101284555 3300005548 Bacteria 742
132 Ga0070704_100048830 3300005549 Bacteria 2964
133 Ga0070704_100330679 3300005549 Bacteria 1280
134 Ga0068855_100265953 3300005563 Bacteria 1909
135 Ga0070664_100046066 3300005564 Bacteria 3683
136 Ga0070664_100053204 3300005564 Bacteria 3431
137 Ga0070664_100445503 3300005564 Bacteria 1188
138 Ga0070664_100568585 3300005564 Bacteria 1049
139 Ga0068857_100165450 3300005577 Bacteria 2008
140 Ga0068857_100276675 3300005577 Bacteria 1543
141 Ga0068857_100939470 3300005577 Bacteria 830
142 Ga0068854_100025334 3300005578 Bacteria 4069
143 Ga0068854_100649705 3300005578 Bacteria 905
144 Ga0070702_100045882 3300005615 Bacteria 2474
145 Ga0070702_100070552 3300005615 Bacteria 2063
146 Ga0070702_100089256 3300005615 Bacteria 1866
147 Ga0070702_101049800 3300005615 Bacteria 648
148 Ga0068852_100046759 3300005616 Bacteria 3688
149 Ga0068852_101069579 3300005616 Bacteria 826
150 Ga0068859_100042477 3300005617 Bacteria 4567
151 Ga0068859_100170744 3300005617 Bacteria 2255
152 Ga0068864_100171764 3300005618 Bacteria 1977
153 Ga0068864_100382783 3300005618 Bacteria 1333
154 Ga0068864_100447552 3300005618 Bacteria 1235
155 Ga0068864_100496525 3300005618 Bacteria 1173
156 Ga0068864_100502149 3300005618 Bacteria 1167
157 Ga0068864_100813957 3300005618 Bacteria 919
158 Ga0068864_100917461 3300005618 Bacteria 865
159 Ga0068866_10237745 3300005718 Bacteria 1108
160 Ga0068866_10247692 3300005718 Bacteria 1089
161 Ga0068861_100028598 3300005719 Bacteria 4068
162 Ga0068851_10197224 3300005834 Bacteria 1122
163 Ga0068851_10271013 3300005834 Bacteria 968
164 Ga0068870_10036661 3300005840 Bacteria 2523
165 Ga0068870_10203101 3300005840 Bacteria 1203
166 Ga0068870_10213639 3300005840 Bacteria 1176
167 Ga0068870_10401790 3300005840 Bacteria 892
168 Ga0068863_100108828 3300005841 Bacteria 2638
169 Ga0068863_100119077 3300005841 Bacteria 2517
170 Ga0068863_100180777 3300005841 Bacteria 2024
171 Ga0068863_100924510 3300005841 Bacteria 873
172 Ga0068858_100202044 3300005842 Bacteria 1879
173 Ga0068858_100573039 3300005842 Bacteria 1094
174 Ga0068858_100819174 3300005842 Bacteria 908
175 Ga0068860_100068836 3300005843 Bacteria 3363
176 Ga0068860_100684879 3300005843 Bacteria 1034
177 Ga0068862_100027688 3300005844 Bacteria 4771
178 Ga0081455_10000064 3300005937 Bacteria 115735
179 Ga0081455_10011325 3300005937 Bacteria 8971
180 Ga0081455_10167856 3300005937 Bacteria 1675
181 Ga0081538_10090242 3300005981 Bacteria 1587
182 Ga0081539_10000027 3300005985 Bacteria 328691
183 Ga0081539_10010730 3300005985 Bacteria 7383
184 Ga0081539_10061633 3300005985 Bacteria 2054
185 Ga0081539_10078331 3300005985 Bacteria 1745
186 Ga0070717_10206337 3300006028 Bacteria 1723
187 Ga0075365_10256401 3300006038 Bacteria 1229
188 Ga0075432_10160791 3300006058 Bacteria 868
189 Ga0070715_10032314 3300006163 Bacteria 2131
190 Ga0070716_100044955 3300006173 Bacteria 2476
191 Ga0070716_100244155 3300006173 Bacteria 1219
192 Ga0070712_100004574 3300006175 Bacteria 8544
193 Ga0070712_100005842 3300006175 Bacteria 7618
194 Ga0097621_100556372 3300006237 Bacteria 1044
195 Ga0068871_100375711 3300006358 Bacteria 1262
196 Ga0068871_101066139 3300006358 Bacteria 755
197 Ga0075428_100091210 3300006844 Bacteria 3323
198 Ga0075428_101390060 3300006844 Bacteria 737
199 Ga0075431_100136254 3300006847 Bacteria 2531
200 Ga0075431_100331987 3300006847 Bacteria 1531
201 Ga0075433_10330066 3300006852 Bacteria 1349
202 Ga0075434_100040568 3300006871 Bacteria 4609
203 Ga0075429_100540583 3300006880 Bacteria 1021
204 Ga0068865_100010490 3300006881 Bacteria 5767
205 Ga0068865_100081146 3300006881 Bacteria 2328
206 Ga0068865_100110799 3300006881 Bacteria 2025
207 Ga0068865_100262803 3300006881 Bacteria 1367
208 Ga0068865_100609256 3300006881 Bacteria 924
209 Ga0075436_100542769 3300006914 Bacteria 853
210 Ga0097620_100042475 3300006931 Bacteria 4567
211 Ga0097620_100170743 3300006931 Bacteria 2255
212 Ga0097620_101265541 3300006931 Bacteria 813
213 Ga0075435_100029282 3300007076 Bacteria 4321
214 Ga0075435_100670184 3300007076 Bacteria 901
215 Ga0105251_10122080 3300009011 Bacteria 1183
216 Ga0111539_10181236 3300009094 Bacteria 2460
217 Ga0111539_11627068 3300009094 Unclassified 749
218 Ga0105245_10045364 3300009098 Bacteria 3926
219 Ga0105245_10429754 3300009098 Bacteria 1325
220 Ga0105245_10447169 3300009098 Bacteria 1300
221 Ga0105245_10750902 3300009098 Bacteria 1011
222 Ga0105245_10952497 3300009098 Bacteria 901
223 Ga0105247_10195155 3300009101 Bacteria 1357
224 Ga0105247_10317636 3300009101 Bacteria 1086
225 Ga0114129_10002142 3300009147 Bacteria 27213
226 Ga0114129_10060554 3300009147 Bacteria 5293
227 Ga0114129_10170159 3300009147 Bacteria 2971
228 Ga0114129_10233938 3300009147 Bacteria 2474
229 Ga0114129_10264916 3300009147 Bacteria 2301
230 Ga0114129_10334996 3300009147 Bacteria 2008
231 Ga0114129_10575091 3300009147 Bacteria 1463
232 Ga0114129_10818138 3300009147 Bacteria 1187
233 Ga0114129_10872494 3300009147 Bacteria 1142
234 Ga0114129_11232738 3300009147 Bacteria 930
235 Ga0114129_12111616 3300009147 Bacteria 679
236 Ga0114129_12180386 3300009147 Bacteria 667
237 Ga0105243_10006714 3300009148 Bacteria 8876
238 Ga0105243_10013163 3300009148 Bacteria 6253
239 Ga0105241_10202804 3300009174 Bacteria 1658
240 Ga0105242_10007179 3300009176 Bacteria 8590
241 Ga0105242_10035288 3300009176 Bacteria 4010
242 Ga0105242_10043688 3300009176 Bacteria 3626
243 Ga0105242_10229052 3300009176 Bacteria 1665
244 Ga0105248_10003799 3300009177 Bacteria 16740
245 Ga0105248_10037658 3300009177 Bacteria 5412
246 Ga0105248_10082283 3300009177 Bacteria 3620
247 Ga0105238_10049338 3300009551 Bacteria 4240
248 Ga0105238_10153840 3300009551 Bacteria 2275
249 Ga0105238_10192367 3300009551 Bacteria 2016
250 Ga0105238_10286614 3300009551 Bacteria 1629
251 Ga0105238_10702551 3300009551 Bacteria 1023
252 Ga0105238_11113799 3300009551 Bacteria 812
253 Ga0105238_11874059 3300009551 Bacteria 632
254 Ga0105249_10029348 3300009553 Bacteria 4967
255 Ga0105249_10346407 3300009553 Bacteria 1504
256 Ga0105249_10855334 3300009553 Bacteria 975
257 Ga0099796_10081000 3300010159 Bacteria 1190
258 Ga0105239_10052554 3300010375 Bacteria 4468
259 Ga0105246_10007131 3300011119 Bacteria 6843
260 Ga0105246_10052516 3300011119 Bacteria 2802
261 Ga0105246_10190640 3300011119 Bacteria 1586
262 Ga0157344_1002768 3300012476 Bacteria 949
263 Ga0157371_10181200 3300013102 Bacteria 1507
264 Ga0157369_10296239 3300013105 Bacteria 1683
265 Ga0157369_10342344 3300013105 Bacteria 1553
266 Ga0157369_10914925 3300013105 Bacteria 899
267 Ga0157374_10614616 3300013296 Bacteria 1097
268 Ga0157378_10006283 3300013297 Bacteria 10405
269 Ga0157378_10114578 3300013297 Bacteria 2476
270 Ga0157378_11095949 3300013297 Bacteria 833
271 Ga0163162_10283558 3300013306 Bacteria 1788
272 Ga0163162_10852856 3300013306 Bacteria 1026
273 Ga0163162_11757645 3300013306 Bacteria 709
274 Ga0157372_10256292 3300013307 Bacteria 2031
275 Ga0157375_10012047 3300013308 Bacteria 7657
276 Ga0157375_10075795 3300013308 Bacteria 3389
277 Ga0157375_10162242 3300013308 Bacteria 2378
278 Ga0157375_10219546 3300013308 Bacteria 2059
279 Ga0157375_10546234 3300013308 Bacteria 1321
280 Ga0163163_10015258 3300014325 Bacteria 7099
281 Ga0163163_10065378 3300014325 Bacteria 3610
282 Ga0163163_10086411 3300014325 Bacteria 3146
283 Ga0163163_10312446 3300014325 Bacteria 1625
284 Ga0157380_10091196 3300014326 Bacteria 2515
285 Ga0157380_10213134 3300014326 Bacteria 1723
286 Ga0157380_10519424 3300014326 Bacteria 1161
287 Ga0157380_10528303 3300014326 Bacteria 1152
288 Ga0157380_10823826 3300014326 Bacteria 947
289 Ga0157377_10015839 3300014745 Bacteria 3865
290 Ga0157377_10122790 3300014745 Bacteria 1576
291 Ga0157377_10568104 3300014745 Bacteria 804
292 Ga0157379_10000747 3300014968 Bacteria 26266
293 Ga0157379_10062646 3300014968 Bacteria 3326
294 Ga0157379_10135803 3300014968 Bacteria 2216
295 Ga0157379_10735669 3300014968 Bacteria 928
296 Ga0157376_10071714 3300014969 Bacteria 2945
297 Ga0163161_10158113 3300017792 Bacteria 1727
298 Ga0206354_10031289 3300020081 Bacteria 1579
299 Ga0206353_10857764 3300020082 Bacteria 3691
300 Ga0154015_1043079 3300020610 Bacteria 694
301 Ga0213876_10022268 3300021384 Bacteria 3352
302 Ga0213875_10002214 3300021388 Bacteria 11832
303 Ga0207656_10237159 3300025321 Bacteria 890
304 Ga0207656_10340778 3300025321 Bacteria 747
305 Ga0207713_1198414 3300025735 Bacteria 617
306 Ga0207692_10321175 3300025898 Bacteria 947
307 Ga0207642_10125015 3300025899 Bacteria 1333
308 Ga0207642_10209501 3300025899 Bacteria 1082
309 Ga0207642_10464204 3300025899 Bacteria 769
310 Ga0207710_10041428 3300025900 Bacteria 2043
311 Ga0207688_10004405 3300025901 Bacteria 7664
312 Ga0207688_10008032 3300025901 Bacteria 5743
313 Ga0207688_10013485 3300025901 Bacteria 4442
314 Ga0207688_10174047 3300025901 Bacteria 1281
315 Ga0207688_10298593 3300025901 Bacteria 984
316 Ga0207688_10410484 3300025901 Bacteria 841
317 Ga0207680_10239962 3300025903 Bacteria 1249
318 Ga0207647_10123534 3300025904 Bacteria 1525
319 Ga0207647_10342849 3300025904 Bacteria 847
320 Ga0207699_10109545 3300025906 Bacteria 1767
321 Ga0207699_10606765 3300025906 Bacteria 797
322 Ga0207645_10123722 3300025907 Bacteria 1680
323 Ga0207645_10159715 3300025907 Bacteria 1474
324 Ga0207645_10264514 3300025907 Bacteria 1140
325 Ga0207643_10038100 3300025908 Bacteria 2699
326 Ga0207643_10492494 3300025908 Bacteria 783
327 Ga0207643_10587022 3300025908 Bacteria 716
328 Ga0207705_10074008 3300025909 Bacteria 2472
329 Ga0207684_10143174 3300025910 Bacteria 2056
330 Ga0207684_10212134 3300025910 Bacteria 1670
331 Ga0207684_10378923 3300025910 Bacteria 1217
332 Ga0207671_10108617 3300025914 Bacteria 2109
333 Ga0207671_10306870 3300025914 Bacteria 1254
334 Ga0207693_10001022 3300025915 Bacteria 25047
335 Ga0207693_10026075 3300025915 Bacteria 4629
336 Ga0207663_10062846 3300025916 Bacteria 2362
337 Ga0207663_10115760 3300025916 Bacteria 1827
338 Ga0207660_10061780 3300025917 Bacteria 2697
339 Ga0207660_10268763 3300025917 Bacteria 1350
340 Ga0207662_10005211 3300025918 Bacteria 6899
341 Ga0207662_10125066 3300025918 Bacteria 1616
342 Ga0207662_10569393 3300025918 Bacteria 786
343 Ga0207657_10095336 3300025919 Bacteria 2476
344 Ga0207657_10120433 3300025919 Bacteria 2159
345 Ga0207649_10606631 3300025920 Bacteria 842
346 Ga0207652_10114992 3300025921 Bacteria 2390
347 Ga0207646_10055386 3300025922 Bacteria 3545
348 Ga0207646_10128027 3300025922 Bacteria 2284
349 Ga0207646_10159032 3300025922 Bacteria 2038
350 Ga0207646_10880644 3300025922 Bacteria 795
351 Ga0207681_10241914 3300025923 Bacteria 1405
352 Ga0207694_10359993 3300025924 Bacteria 1205
353 Ga0207694_10463887 3300025924 Bacteria 1058
354 Ga0207694_10552909 3300025924 Bacteria 966
355 Ga0207659_10155385 3300025926 Bacteria 1790
356 Ga0207659_10754098 3300025926 Bacteria 835
357 Ga0207687_10012505 3300025927 Bacteria 5545
358 Ga0207687_10155106 3300025927 Bacteria 1751
359 Ga0207687_10168128 3300025927 Bacteria 1689
360 Ga0207687_10184684 3300025927 Bacteria 1618
361 Ga0207687_10203230 3300025927 Bacteria 1550
362 Ga0207687_10324153 3300025927 Bacteria 1248
363 Ga0207700_10126144 3300025928 Bacteria 2083
364 Ga0207664_10023494 3300025929 Bacteria 4621
365 Ga0207664_10149292 3300025929 Bacteria 1984
366 Ga0207664_10568105 3300025929 Bacteria 1018
367 Ga0207644_10000893 3300025931 Bacteria 18858
368 Ga0207644_10065801 3300025931 Bacteria 2637
369 Ga0207644_10263420 3300025931 Bacteria 1379
370 Ga0207690_10339507 3300025932 Bacteria 1185
371 Ga0207690_10364502 3300025932 Bacteria 1145
372 Ga0207706_10079155 3300025933 Bacteria 2891
373 Ga0207706_10195946 3300025933 Bacteria 1772
374 Ga0207686_10006485 3300025934 Bacteria 6300
375 Ga0207686_10139775 3300025934 Bacteria 1672
376 Ga0207686_10712271 3300025934 Bacteria 799
377 Ga0207709_10015943 3300025935 Bacteria 4170
378 Ga0207709_10164242 3300025935 Bacteria 1552
379 Ga0207670_10438466 3300025936 Bacteria 1051
380 Ga0207669_10014636 3300025937 Bacteria 3937
381 Ga0207669_10018292 3300025937 Bacteria 3619
382 Ga0207669_10218932 3300025937 Bacteria 1396
383 Ga0207669_10279807 3300025937 Bacteria 1258
384 Ga0207704_10028464 3300025938 Bacteria 3101
385 Ga0207704_10076020 3300025938 Bacteria 2150
386 Ga0207704_10197135 3300025938 Bacteria 1470
387 Ga0207665_10035972 3300025939 Bacteria 3290
388 Ga0207665_10050178 3300025939 Bacteria 2805
389 Ga0207691_10092961 3300025940 Bacteria 2701
390 Ga0207691_10144709 3300025940 Bacteria 2093
391 Ga0207691_10386720 3300025940 Bacteria 1194
392 Ga0207691_10618024 3300025940 Bacteria 917
393 Ga0207711_10000355 3300025941 Bacteria 48706
394 Ga0207711_10592496 3300025941 Bacteria 1034
395 Ga0207689_10042665 3300025942 Bacteria 3750
396 Ga0207689_10056340 3300025942 Bacteria 3234
397 Ga0207689_10086688 3300025942 Bacteria 2573
398 Ga0207689_10533115 3300025942 Bacteria 985
399 Ga0207661_10218049 3300025944 Bacteria 1685
400 Ga0207679_10187835 3300025945 Bacteria 1715
401 Ga0207679_10498686 3300025945 Bacteria 1086
402 Ga0207651_10161278 3300025960 Bacteria 1758
403 Ga0207712_10145042 3300025961 Bacteria 1827
404 Ga0207712_10757548 3300025961 Bacteria 851
405 Ga0207712_10972949 3300025961 Bacteria 752
406 Ga0207668_10043874 3300025972 Bacteria 3038
407 Ga0207668_10674354 3300025972 Bacteria 907
408 Ga0207640_10066893 3300025981 Bacteria 2402
409 Ga0207640_10279656 3300025981 Bacteria 1310
410 Ga0207640_10782437 3300025981 Bacteria 825
411 Ga0207658_10369128 3300025986 Bacteria 1254
412 Ga0207677_10122020 3300026023 Bacteria 1962
413 Ga0207677_10653891 3300026023 Bacteria 928
414 Ga0207677_10945014 3300026023 Bacteria 779
415 Ga0207703_10000007 3300026035 Bacteria 418220
416 Ga0207703_10133238 3300026035 Bacteria 2148
417 Ga0207703_10458030 3300026035 Bacteria 1192
418 Ga0207639_10629565 3300026041 Bacteria 991
419 Ga0207678_10090823 3300026067 Bacteria 2610
420 Ga0207678_10108053 3300026067 Bacteria 2373
421 Ga0207678_10322281 3300026067 Bacteria 1330
422 Ga0207678_10355524 3300026067 Bacteria 1264
423 Ga0207678_10628102 3300026067 Bacteria 943
424 Ga0207708_10006895 3300026075 Bacteria 8405
425 Ga0207708_10035980 3300026075 Bacteria 3767
426 Ga0207708_10051363 3300026075 Bacteria 3138
427 Ga0207708_10894284 3300026075 Bacteria 768
428 Ga0207702_10604439 3300026078 Bacteria 1076
429 Ga0207641_10087457 3300026088 Bacteria 2719
430 Ga0207641_10105793 3300026088 Bacteria 2486
431 Ga0207641_10148745 3300026088 Bacteria 2120
432 Ga0207641_10309725 3300026088 Bacteria 1494
433 Ga0207641_10335787 3300026088 Bacteria 1437
434 Ga0207648_10005074 3300026089 Bacteria 13348
435 Ga0207648_10013201 3300026089 Bacteria 7697
436 Ga0207648_10073304 3300026089 Bacteria 2984
437 Ga0207648_10089067 3300026089 Bacteria 2695
438 Ga0207648_10111292 3300026089 Bacteria 2404
439 Ga0207676_10590754 3300026095 Bacteria 1065
440 Ga0207676_10771600 3300026095 Bacteria 936
441 Ga0207674_10070523 3300026116 Bacteria 3514
442 Ga0207674_10756866 3300026116 Bacteria 938
443 Ga0207674_10865679 3300026116 Bacteria 871
444 Ga0207675_100011101 3300026118 Bacteria 8439
445 Ga0207675_100027801 3300026118 Bacteria 5269
446 Ga0207683_10005936 3300026121 Bacteria 10467
447 Ga0207683_10017236 3300026121 Bacteria 6151
448 Ga0207683_10024495 3300026121 Bacteria 5199
449 Ga0207683_10050942 3300026121 Bacteria 3627
450 Ga0207698_10023042 3300026142 Bacteria 4343
451 Ga0207698_10061607 3300026142 Bacteria 2925
452 Ga0207698_10147558 3300026142 Bacteria 2036
453 Ga0209974_10172217 3300027876 Unclassified 790
454 Ga0207428_10009205 3300027907 Bacteria 8872
455 Ga0268266_10152452 3300028379 Bacteria 2084
456 Ga0268266_10178355 3300028379 Bacteria 1933
457 Ga0268266_10368575 3300028379 Bacteria 1352
458 Ga0268266_10532863 3300028379 Bacteria 1124
459 Ga0268266_10667145 3300028379 Bacteria 1001
460 Ga0268265_10127833 3300028380 Bacteria 2106
461 Ga0268264_10074958 3300028381 Bacteria 2876
462 Ga0268264_10377237 3300028381 Bacteria 1357
463 Ga0268264_10661922 3300028381 Bacteria 1034
464 Ga0265322_10024482 3300028654 Bacteria 1727
465 Ga0307517_10153010 3300028786 Bacteria 1576
466 Ga0307515_10205378 3300028794 Bacteria 1832
467 Ga0307511_10003508 3300030521 Bacteria 16123
468 Ga0307512_10042450 3300030522 Bacteria 3765
469 Ga0265327_10136653 3300031251 Bacteria 1149
470 Ga0307513_10010554 3300031456 Bacteria 11563
471 Ga0307513_10237393 3300031456 Bacteria 1631
472 Ga0307408_100995673 3300031548 Bacteria 772
473 Ga0265342_10140282 3300031712 Bacteria 1349
474 Ga0316576_10002704 3300031727 Bacteria 10143
475 Ga0316578_10110110 3300031728 Bacteria 1654
476 Ga0307405_10041987 3300031731 Bacteria 2781
477 Ga0307413_10086147 3300031824 Bacteria 2030
478 Ga0307413_10151778 3300031824 Bacteria 1615
479 Ga0307413_10298867 3300031824 Bacteria 1220
480 Ga0307410_10329948 3300031852 Bacteria 1213
481 Ga0307410_10363292 3300031852 Bacteria 1160
482 Ga0307410_10422827 3300031852 Bacteria 1081
483 Ga0307410_10496504 3300031852 Bacteria 1003
484 Ga0307410_11190230 3300031852 Bacteria 663
485 Ga0326468_10006296 3300031889 Bacteria 1095
486 Ga0307406_10044774 3300031901 Bacteria 2774
487 Ga0307406_10657683 3300031901 Bacteria 870
488 Ga0307407_10101946 3300031903 Bacteria 1784
489 Ga0307407_10141912 3300031903 Bacteria 1550
490 Ga0307407_10154407 3300031903 Bacteria 1495
491 Ga0307407_10494867 3300031903 Bacteria 895
492 Ga0307412_10207956 3300031911 Bacteria 1491
493 Ga0307409_100076025 3300031995 Bacteria 2691
494 Ga0307409_100151639 3300031995 Bacteria 2013
495 Ga0307409_100191407 3300031995 Bacteria 1821
496 Ga0307409_100292871 3300031995 Bacteria 1510
497 Ga0307409_100325820 3300031995 Bacteria 1439
498 Ga0307409_100603375 3300031995 Bacteria 1085
499 Ga0307416_100044898 3300032002 Bacteria 3474
500 Ga0307416_100064661 3300032002 Bacteria 3002
501 Ga0307416_100068464 3300032002 Bacteria 2933
502 Ga0307416_100326358 3300032002 Bacteria 1540
503 Ga0307416_100485598 3300032002 Bacteria 1296
504 Ga0307416_100641630 3300032002 Bacteria 1146
505 Ga0307416_100824475 3300032002 Bacteria 1024
506 Ga0307416_101094146 3300032002 Bacteria 901
507 Ga0307416_101146767 3300032002 Bacteria 882
508 Ga0307414_10113632 3300032004 Bacteria 2067
509 Ga0307414_10173687 3300032004 Bacteria 1726
510 Ga0307414_10237248 3300032004 Bacteria 1507
511 Ga0307414_10352544 3300032004 Bacteria 1264
512 Ga0307411_10098203 3300032005 Bacteria 2063
513 Ga0307411_10287024 3300032005 Bacteria 1313
514 Ga0307411_10833293 3300032005 Bacteria 815
515 Ga0307415_100130228 3300032126 Bacteria 1903
516 Ga0307415_100152283 3300032126 Bacteria 1781
517 Ga0307415_100284489 3300032126 Bacteria 1361
518 Ga0307415_100301997 3300032126 Bacteria 1326
519 Ga0307415_100920495 3300032126 Bacteria 807
520 Ga0373926_0001444 3300035083 Bacteria 7237
521 Ga0373944_0000040 3300035089 Bacteria 21506
522 Ga0373923_0036897 3300035111 Bacteria 1997
523 Ga0373936_0000099 3300035113 Bacteria 31337
524 Ga0373936_0191180 3300035113 Bacteria 901
525 Ga0373945_0001163 3300035116 Bacteria 7985
526 Ga0373953_0023798 3300035117 Bacteria 2322
527 Ga0373956_0115642 3300035119 Bacteria 1251
528 Ga0373943_0006625 3300035170 Bacteria 5192
529 Ga0373946_0000479 3300035171 Bacteria 13216
530 Ga0373955_0170935 3300035172 Bacteria 1286
531 Ga0373961_0135790 3300035241 Bacteria 827
532 Ga0316574_0032238 3300035398 Bacteria 3183
533 Ga0316574_0063993 3300035398 Bacteria 2314
534 Ga0373924_0003505 3300035410 Bacteria 5406
535 Ga0373931_0012989 3300035691 Bacteria 4045
536 Ga0373931_0029579 3300035691 Bacteria 2814
537 Ga0373935_0000216 3300035692 Bacteria 27725
538 Ga0373927_0013647 3300035695 Bacteria 5394
539 Ga0373933_0049820 3300035724 Bacteria 2498
540 Ga0373947_0000710 3300035725 Bacteria 19822
541 Ga0373947_0399954 3300035725 Bacteria 926
542 Ga0373937_0081083 3300036401 Bacteria 3001
543 Ga0373937_0288133 3300036401 Bacteria 1551
544 Ga0373937_1041924 3300036401 Bacteria 767
545 Ga0373937_1129707 3300036401 Bacteria 732
546 Ga0373925_0016392 3300037068 Bacteria 5367
547 Ga0395899_0502492 3300037312 Bacteria 786
548 Ga0395900_0072237 3300037418 Bacteria 3548
549 Ga0395900_0191300 3300037418 Bacteria 2075
550 Ga0395898_0025468 3300037466 Bacteria 5961
551 Ga0395898_0378987 3300037466 Bacteria 1349
552 Ga0436364_0207977 3300037853 Bacteria 46460
553 Ga0436364_0661798 3300037853 Bacteria 86818
554 Ga0395901_0124443 3300038443 Bacteria 2709
555 Ga0395901_0211773 3300038443 Bacteria 2028
556 Ga0400483_039556 3300039062 Bacteria 10415
557 Ga0436365_0453742 3300039437 Bacteria 5307
558 Ga0436365_0999081 3300039437 Bacteria 1652
559 Ga0436365_1097230 3300039437 Bacteria 3373
560 Ga0436365_1701092 3300039437 Bacteria 4818
561 Ga0436362_0380707 3300039453 Bacteria 30204
562 Ga0439466_0052417 3300041411 Bacteria 1334
563 Ga0439431_0041032 3300041997 Bacteria 1179
564 Ga0451577_0000011 3300042876 Bacteria 597389
565 Ga0451577_0101171 3300042876 Bacteria 2575
566 Ga0451577_0198491 3300042876 Bacteria 1811
567 Ga0451577_0299264 3300042876 Bacteria 1458
568 Ga0439440_0094905 3300042993 Bacteria 805
569 Ga0466969_0016772 3300044656 Bacteria 3829
570 Ga0466972_0058612 3300044658 Bacteria 1848
571 Ga0466972_0212377 3300044658 Bacteria 906
572 Ga0466972_0233306 3300044658 Bacteria 861
573 Ga0453683_0000024 3300044673 Bacteria 263554
574 Ga0453683_0000802 3300044673 Bacteria 30766
575 Ga0453683_0178759 3300044673 Bacteria 1345
576 Ga0466965_0074512 3300044683 Bacteria 1710
577 Ga0466965_0186178 3300044683 Bacteria 1097
578 Ga0466966_0000310 3300044684 Bacteria 31446
579 Ga0466966_0045170 3300044684 Bacteria 2817
580 Ga0466966_0074908 3300044684 Bacteria 2115
581 Ga0466961_0005736 3300044693 Bacteria 7855
582 Ga0466961_0039169 3300044693 Bacteria 3039
583 Ga0466961_0041927 3300044693 Bacteria 2934
584 Ga0466961_0078215 3300044693 Bacteria 2095
585 Ga0466961_0179060 3300044693 Bacteria 1317
586 Ga0466961_0314599 3300044693 Bacteria 955
587 Ga0466961_0314693 3300044693 Bacteria 955
588 Ga0466961_0509884 3300044693 Bacteria 726
589 Ga0466963_0054699 3300044694 Bacteria 2653
590 Ga0466963_0093919 3300044694 Bacteria 2045
591 Ga0466964_0333871 3300044706 Bacteria 774
592 Ga0466964_0379168 3300044706 Bacteria 734
593 Ga0453684_0000087 3300044712 Bacteria 395597
594 Ga0453684_0003702 3300044712 Bacteria 33878
595 Ga0453684_0007361 3300044712 Bacteria 20308
596 Ga0453684_0037887 3300044712 Bacteria 6609
597 Ga0453684_0142853 3300044712 Bacteria 2855
598 Ga0453684_0304850 3300044712 Bacteria 1809
599 Ga0453684_0945354 3300044712 Bacteria 920
600 Ga0466971_0005194 3300044719 Bacteria 5636
601 Ga0466971_0024329 3300044719 Bacteria 2702
602 Ga0466971_0104882 3300044719 Bacteria 1301
603 Ga0466968_0000525 3300044735 Bacteria 13009
604 Ga0466968_0180225 3300044735 Bacteria 982
605 Ga0466970_0009971 3300044765 Bacteria 4811
606 Ga0466970_0055005 3300044765 Bacteria 2125
607 Ga0466970_0095122 3300044765 Bacteria 1619
608 Ga0466970_0098601 3300044765 Bacteria 1590
609 Ga0466970_0291487 3300044765 Bacteria 919
610 Ga0466957_0016044 3300044842 Bacteria 4379
611 Ga0466957_0129676 3300044842 Bacteria 1614
612 Ga0466957_0138454 3300044842 Bacteria 1566
613 Ga0466957_0152271 3300044842 Bacteria 1496
614 Ga0466957_0166690 3300044842 Bacteria 1433
615 Ga0466957_0496663 3300044842 Bacteria 845
616 Ga0466957_1003280 3300044842 Bacteria 600
617 Ga0466960_0000156 3300044901 Bacteria 23100
618 Ga0466960_0038232 3300044901 Bacteria 2255
619 Ga0466960_0107309 3300044901 Bacteria 1446
620 Ga0466960_0126270 3300044901 Bacteria 1345
621 Ga0466959_0011879 3300045049 Bacteria 6272
622 Ga0466959_0030589 3300045049 Bacteria 3987
623 Ga0466959_0067923 3300045049 Bacteria 2583
624 Ga0466959_0370468 3300045049 Bacteria 975
625 Ga0466959_0453333 3300045049 Bacteria 869
626 Ga0466959_0466303 3300045049 Bacteria 855
627 Ga0451576_0002579 3300045051 Bacteria 26664
628 Ga0451576_0047433 3300045051 Bacteria 4517
629 Ga0451576_0762313 3300045051 Unclassified 1016
630 Ga0466958_0000800 3300045836 Bacteria 13882
631 Ga0466958_0090518 3300045836 Bacteria 1893
632 Ga0466958_0111451 3300045836 Bacteria 1708
633 Ga0466958_0233558 3300045836 Bacteria 1174
634 Ga0466958_0250701 3300045836 Bacteria 1132
635 Ga0466958_0336281 3300045836 Bacteria 971
636 Ga0466958_0409002 3300045836 Bacteria 876
637 Ga0466958_0430493 3300045836 Bacteria 853
638 Ga0466958_0635988 3300045836 Bacteria 694
639 Ga0466958_0695541 3300045836 Bacteria 662
640 Ga0466967_0010347 3300045976 Bacteria 6992
641 Ga0466967_0010732 3300045976 Bacteria 6887
642 Ga0466967_0058287 3300045976 Bacteria 3413
643 Ga0466967_0114985 3300045976 Bacteria 2477
644 Ga0466967_0149625 3300045976 Bacteria 2181
645 Ga0466967_0151240 3300045976 Bacteria 2169
646 Ga0466967_0202071 3300045976 Bacteria 1883
647 Ga0466967_0216216 3300045976 Bacteria 1819
648 Ga0466967_0268082 3300045976 Bacteria 1635
649 Ga0466967_0411042 3300045976 Bacteria 1318
650 Ga0466967_0515986 3300045976 Bacteria 1174
651 Ga0466967_0625435 3300045976 Bacteria 1063
652 Ga0466967_0838471 3300045976 Bacteria 913
653 Ga0466967_0964870 3300045976 Bacteria 848
654 Ga0466967_1484649 3300045976 Bacteria 675
655 Ga0495592_0011127 3300046454 Bacteria 6795
656 Ga0495592_0104861 3300046454 Bacteria 2009
657 Ga0495603_0001320 3300046455 Bacteria 14379
658 Ga0495603_0008054 3300046455 Bacteria 6368
659 Ga0495591_052977 3300046458 Bacteria 1102
660 Ga0495629_0000652 3300046459 Bacteria 28021
661 Ga0495641_0000703 3300046461 Bacteria 28342
662 Ga0495641_0006618 3300046461 Bacteria 7462
663 Ga0495651_0000079 3300046462 Bacteria 71581
664 Ga0495651_0028764 3300046462 Bacteria 4331
665 Ga0495653_0133671 3300046463 Bacteria 1752
666 Ga0495653_0302284 3300046463 Bacteria 1043
667 Ga0495582_0013092 3300046473 Bacteria 4567
668 Ga0495582_0169731 3300046473 Bacteria 1242
669 Ga0495605_0032201 3300046474 Bacteria 2671
670 Ga0495639_0000408 3300046475 Bacteria 20445
671 Ga0495662_0006922 3300046476 Bacteria 5632
672 Ga0495664_0097664 3300046477 Bacteria 1768
673 Ga0495584_0032815 3300046491 Bacteria 2627
674 Ga0495585_0105679 3300046492 Bacteria 1501
675 Ga0495594_0044943 3300046499 Bacteria 2424
676 Ga0495594_0105482 3300046499 Bacteria 1587
677 Ga0495596_0214653 3300046500 Bacteria 747
678 Ga0495608_0009712 3300046511 Bacteria 6715
679 Ga0495616_0303077 3300046513 Bacteria 674
680 Ga0495618_0019442 3300046514 Bacteria 4179
681 Ga0495618_0168039 3300046514 Bacteria 1396
682 Ga0495618_0589550 3300046514 Bacteria 662
683 Ga0495620_0284165 3300046515 Bacteria 629
684 Ga0495628_0046644 3300046516 Bacteria 3441
685 Ga0495630_0007948 3300046517 Bacteria 7611
686 Ga0495630_0470840 3300046517 Bacteria 963
687 Ga0495637_0048957 3300046520 Bacteria 1778
688 Ga0495644_0002314 3300046523 Bacteria 7623
689 Ga0495644_0107997 3300046523 Bacteria 1055
690 Ga0495663_0084347 3300046525 Bacteria 1027
691 Ga0495666_0000781 3300046526 Bacteria 14720
692 Ga0495642_0166033 3300046528 Bacteria 958
693 Ga0495652_0014199 3300046529 Bacteria 7154
694 Ga0495652_0087582 3300046529 Bacteria 2554
695 Ga0495665_0000516 3300046531 Bacteria 19552
696 Ga0495640_0015955 3300046533 Bacteria 5636
697 Ga0495640_0030512 3300046533 Bacteria 3858
698 Ga0495586_0004434 3300046535 Bacteria 7498
699 Ga0495586_0039827 3300046535 Bacteria 2527
700 Ga0495586_0657703 3300046535 Bacteria 605
701 Ga0495587_0013791 3300046536 Bacteria 5079
702 Ga0495598_0000360 3300046537 Bacteria 8161
703 Ga0495598_0054149 3300046537 Bacteria 1217
704 Ga0495609_0042331 3300046538 Bacteria 2045
705 Ga0495645_0014632 3300046543 Bacteria 5569
706 Ga0495645_0445209 3300046543 Bacteria 818
707 Ga0495633_0140484 3300046558 Bacteria 1117
708 Ga0495667_0043633 3300046559 Bacteria 2971
709 Ga0495667_0055694 3300046559 Bacteria 2600
710 Ga0495667_0374235 3300046559 Bacteria 899
711 Ga0495656_0000659 3300046615 Bacteria 11037
712 Ga0495656_0035906 3300046615 Bacteria 2039
713 Ga0495668_0101751 3300046616 Bacteria 1572
714 Ga0495668_0298502 3300046616 Bacteria 883
715 Ga0495634_0000699 3300046642 Bacteria 32576
716 Ga0495634_0053466 3300046642 Bacteria 2705
717 Ga0495634_0277235 3300046642 Bacteria 1019
718 Ga0495635_0006319 3300046663 Bacteria 8256
719 Ga0495635_0006541 3300046663 Bacteria 8133
720 Ga0495635_0012916 3300046663 Bacteria 5847
721 Ga0495659_0008450 3300046664 Bacteria 3277
722 Ga0495661_0031524 3300046665 Bacteria 3362
723 Ga0495588_0000837 3300046674 Bacteria 13641
724 Ga0495657_0068610 3300046675 Bacteria 2322
725 Ga0495599_0080327 3300046678 Bacteria 2036
726 Ga0495623_0094873 3300046679 Bacteria 1824
727 Ga0495646_0003687 3300046680 Bacteria 9559
728 Ga0495646_0050105 3300046680 Bacteria 2532
729 Ga0495647_0000056 3300046681 Bacteria 28117
730 Ga0495658_0000118 3300046683 Bacteria 42690
731 Ga0495613_0003794 3300046689 Bacteria 11328
732 Ga0495613_0084003 3300046689 Bacteria 2312
733 Ga0495613_0358218 3300046689 Bacteria 1001
734 Ga0495624_0000683 3300046690 Bacteria 26555
735 Ga0495671_0120572 3300046692 Bacteria 1280
736 Ga0495589_0028936 3300046794 Bacteria 2794
737 Ga0495600_0008499 3300046809 Bacteria 6309
738 Ga0495600_0133071 3300046809 Bacteria 1616
739 Ga0495581_0002405 3300047315 Bacteria 10577
740 Ga0495581_0121710 3300047315 Bacteria 1519
741 Ga0495636_0020791 3300047318 Bacteria 2646
742 Ga0495674_0007525 3300047319 Bacteria 10401
743 Ga0495674_0030199 3300047319 Bacteria 4930
744 Ga0495674_0526698 3300047319 Bacteria 943
745 Ga0495676_0027302 3300047321 Bacteria 4896
746 Ga0495676_0442008 3300047321 Bacteria 859
747 Ga0495680_0000698 3300047322 Bacteria 37653
748 Ga0495680_0006170 3300047322 Bacteria 11179
749 Ga0495683_0305116 3300047323 Bacteria 683
750 Ga0495675_0126191 3300047444 Bacteria 1592
751 Ga0495677_0041073 3300047445 Bacteria 1692
752 Ga0495684_0061019 3300047471 Bacteria 2869
753 Ga0495593_0015952 3300047673 Bacteria 4242
754 Ga0495602_0115413 3300048088 Bacteria 2172
755 Ga0495614_0012341 3300048089 Bacteria 3749
756 Ga0495615_0029386 3300048090 Bacteria 1304
757 Ga0495615_0042775 3300048090 Bacteria 1137
758 Ga0496100_0032892 3300048903 Bacteria 3239
759 Ga0496100_0471235 3300048903 Bacteria 965
760 Ga0496101_0061737 3300048904 Bacteria 2722
761 Ga0496101_0239022 3300048904 Bacteria 1413
762 Ga0496102_0002120 3300048905 Bacteria 17065
763 Ga0496102_0146583 3300048905 Bacteria 2216
764 Ga0496102_0815496 3300048905 Bacteria 855
765 Ga0496102_1122213 3300048905 Bacteria 706
766 Ga0496102_1588567 3300048905 Bacteria 572
767 Ga0496103_0036423 3300048906 Bacteria 3013
768 Ga0496104_0052045 3300048907 Bacteria 3867
769 Ga0496104_0088642 3300048907 Bacteria 2956
770 Ga0496104_0297403 3300048907 Bacteria 1526
771 Ga0496104_0313711 3300048907 Bacteria 1481
772 Ga0496104_0548189 3300048907 Bacteria 1067
773 Ga0496104_0843500 3300048907 Bacteria 822
774 Ga0496105_0127319 3300048908 Bacteria 2100
775 Ga0496105_0439634 3300048908 Bacteria 1031
776 Ga0496105_0489758 3300048908 Bacteria 966
777 Ga0496106_0000632 3300048909 Bacteria 25223
778 Ga0496106_0186295 3300048909 Bacteria 1649
779 Ga0496106_0513619 3300048909 Bacteria 962
780 Ga0496107_0295143 3300048910 Bacteria 1206
781 Ga0496108_0000018 3300048911 Bacteria 234917
782 Ga0496108_0011820 3300048911 Bacteria 7102
783 Ga0496108_0023835 3300048911 Bacteria 5037
784 Ga0496108_0029999 3300048911 Bacteria 4507
785 Ga0496108_0096698 3300048911 Bacteria 2516
786 Ga0496108_0476455 3300048911 Bacteria 1091
787 Ga0496108_0510328 3300048911 Bacteria 1050
788 Ga0496108_0694851 3300048911 Bacteria 882
789 Ga0496109_0029420 3300048912 Bacteria 4919
790 Ga0496109_0053838 3300048912 Bacteria 3671
791 Ga0496109_0314511 3300048912 Bacteria 1477
792 Ga0496109_0943913 3300048912 Bacteria 800
793 Ga0496110_0027938 3300048913 Bacteria 4840
794 Ga0496110_0029823 3300048913 Bacteria 4700
795 Ga0496110_0050270 3300048913 Bacteria 3660
796 Ga0496111_0024685 3300048914 Bacteria 4237
797 Ga0496111_0057308 3300048914 Bacteria 2821
798 Ga0496111_0118802 3300048914 Bacteria 1952
799 Ga0496111_0158593 3300048914 Bacteria 1679
800 Ga0496111_0295988 3300048914 Bacteria 1200
801 Ga0496112_0038187 3300048915 Bacteria 4689
802 Ga0496112_0053393 3300048915 Bacteria 3969
803 Ga0496112_0138074 3300048915 Bacteria 2408
804 Ga0496112_1203625 3300048915 Bacteria 674
805 Ga0496113_0038680 3300048916 Bacteria 3508
806 Ga0496113_0073689 3300048916 Bacteria 2602
807 Ga0496113_0219688 3300048916 Bacteria 1514
808 Ga0496113_0560580 3300048916 Bacteria 916
809 Ga0496114_0017063 3300048917 Bacteria 5856
810 Ga0496114_0100527 3300048917 Bacteria 2468
811 Ga0496115_0135231 3300048918 Bacteria 2032
812 Ga0496115_0565590 3300048918 Bacteria 907
813 Ga0496115_0764156 3300048918 Bacteria 755
814 Ga0496116_0045085 3300048919 Bacteria 2988
815 Ga0496117_0030433 3300048920 Bacteria 4143
816 Ga0496119_0001521 3300048922 Bacteria 27725
817 Ga0496120_0001525 3300048923 Bacteria 27277
818 Ga0496122_0042166 3300048925 Bacteria 3594
819 Ga0496122_0084576 3300048925 Bacteria 2193
820 Ga0496124_0000542 3300048927 Bacteria 64211
821 Ga0496126_0001205 3300048929 Bacteria 42144
822 Ga0496126_0001917 3300048929 Bacteria 29832
823 Ga0496126_0069612 3300048929 Bacteria 3138
824 Ga0501298_037448 3300049521 Bacteria 974
825 Ga0501318_004734 3300049534 Bacteria 1319
826 Ga0501031_0015731 3300049568 Bacteria 4910
827 Ga0501031_0033843 3300049568 Bacteria 3335
828 Ga0501031_0512277 3300049568 Bacteria 774
829 Ga0501031_0612357 3300049568 Bacteria 700
830 Ga0501032_0006296 3300049569 Bacteria 8743
831 Ga0501033_0013749 3300049570 Bacteria 6156
832 Ga0501033_0104874 3300049570 Bacteria 2061
833 Ga0501033_0130933 3300049570 Bacteria 1817
834 Ga0501034_0202941 3300049571 Bacteria 1940
835 Ga0501034_0896110 3300049571 Bacteria 775
836 Ga0501036_0053301 3300049572 Bacteria 3425
837 Ga0501036_0126028 3300049572 Bacteria 2163
838 Ga0501036_0313703 3300049572 Bacteria 1311
839 Ga0501037_0002416 3300049573 Bacteria 13500
840 Ga0501037_0003569 3300049573 Bacteria 11284
841 Ga0501038_0015173 3300049574 Bacteria 7008
842 Ga0501038_0016532 3300049574 Bacteria 6687
843 Ga0501038_0251188 3300049574 Bacteria 1401
844 Ga0501038_0493085 3300049574 Bacteria 937
845 Ga0501039_0069171 3300049575 Bacteria 2741
846 Ga0501039_0136030 3300049575 Bacteria 1929
847 Ga0501039_0442603 3300049575 Bacteria 1020
848 Ga0501040_0010354 3300049576 Bacteria 6095
849 Ga0501040_0021154 3300049576 Bacteria 4339
850 Ga0501040_0035784 3300049576 Bacteria 3368
851 Ga0501040_0356980 3300049576 Bacteria 1047
852 Ga0501040_0629179 3300049576 Bacteria 775
853 Ga0501041_0105846 3300049577 Bacteria 1743
854 Ga0501042_0075035 3300049578 Bacteria 2419
855 Ga0501043_0003176 3300049579 Bacteria 13592
856 Ga0501043_0004360 3300049579 Bacteria 11514
857 Ga0501043_0096804 3300049579 Bacteria 2320
858 Ga0501043_0250677 3300049579 Bacteria 1364
859 Ga0501043_0401113 3300049579 Bacteria 1036
860 Ga0501046_0067141 3300049580 Bacteria 2793
861 Ga0501046_0105544 3300049580 Bacteria 2157
862 Ga0501047_0112038 3300049581 Bacteria 2611
863 Ga0501048_0024791 3300049582 Bacteria 4375
864 Ga0501048_0088159 3300049582 Bacteria 2188
865 Ga0501048_0641424 3300049582 Bacteria 762
866 Ga0501048_0945224 3300049582 Bacteria 620
867 Ga0501067_0031570 3300049583 Bacteria 2939
868 Ga0501068_0003054 3300049584 Bacteria 8935
869 Ga0501068_0077176 3300049584 Bacteria 2040
870 Ga0501068_0116968 3300049584 Bacteria 1660
871 Ga0501068_0131899 3300049584 Bacteria 1563
872 Ga0501068_0354505 3300049584 Bacteria 943
873 Ga0501069_0030265 3300049585 Bacteria 2972
874 Ga0501070_0021366 3300049586 Bacteria 5430
875 Ga0501070_0299345 3300049586 Bacteria 1310
876 Ga0501071_0011761 3300049587 Bacteria 5906
877 Ga0501071_0087584 3300049587 Bacteria 2284
878 Ga0501071_0173241 3300049587 Bacteria 1616
879 Ga0501071_0557162 3300049587 Bacteria 880
880 Ga0501072_0034193 3300049588 Bacteria 3983
881 Ga0501072_0071127 3300049588 Bacteria 2748
882 Ga0501072_0508921 3300049588 Bacteria 952
883 Ga0501073_0016095 3300049589 Bacteria 5422
884 Ga0501073_0077723 3300049589 Bacteria 2309
885 Ga0501074_0015182 3300049590 Bacteria 5599
886 Ga0501074_0072257 3300049590 Bacteria 2478
887 Ga0501074_0101069 3300049590 Bacteria 2064
888 Ga0501075_0016652 3300049591 Bacteria 5300
889 Ga0501075_0036049 3300049591 Bacteria 3690
890 Ga0501075_0054999 3300049591 Bacteria 2994
891 Ga0501075_0281617 3300049591 Bacteria 1267
892 Ga0501075_0329467 3300049591 Bacteria 1164
893 Ga0501075_0467857 3300049591 Bacteria 961
894 Ga0501076_0003206 3300049592 Bacteria 11418
895 Ga0501076_0019371 3300049592 Bacteria 5201
896 Ga0501076_0080098 3300049592 Bacteria 2621
897 Ga0501076_0385430 3300049592 Bacteria 1152
898 Ga0501077_0010639 3300049593 Bacteria 5729
899 Ga0501077_0015144 3300049593 Bacteria 4848
900 Ga0501077_0058883 3300049593 Bacteria 2439
901 Ga0501077_0116202 3300049593 Bacteria 1696
902 Ga0501077_0276308 3300049593 Bacteria 1069
903 Ga0501077_0353544 3300049593 Bacteria 938
904 Ga0501253_109589 3300049683 Bacteria 657
905 Ga0501079_0009708 3300049741 Bacteria 7296
906 Ga0501079_0036553 3300049741 Bacteria 3783
907 Ga0501079_0668699 3300049741 Bacteria 817
908 Ga0501080_0017241 3300049742 Bacteria 6673
909 Ga0501080_0031418 3300049742 Bacteria 4948
910 Ga0501080_0449466 3300049742 Bacteria 1155
911 Ga0501080_0696196 3300049742 Bacteria 896
912 Ga0501080_0717553 3300049742 Bacteria 881
913 Ga0501081_0008906 3300049743 Bacteria 6519
914 Ga0501081_0014467 3300049743 Bacteria 5204
915 Ga0501081_0499945 3300049743 Bacteria 906
916 Ga0501083_0022959 3300049744 Bacteria 4329
917 Ga0501083_0038256 3300049744 Bacteria 3262
918 Ga0501083_0066068 3300049744 Bacteria 2409
919 Ga0501035_0071187 3300049822 Bacteria 3079
920 Ga0501035_0074372 3300049822 Bacteria 3006
921 Ga0501035_0309396 3300049822 Bacteria 1329
922 Ga0501044_0005084 3300049823 Bacteria 14671
923 Ga0501044_0010145 3300049823 Bacteria 10237
924 Ga0501044_0187354 3300049823 Bacteria 2033
925 Ga0501044_0805097 3300049823 Bacteria 819
926 Ga0501045_0099160 3300049824 Bacteria 2155
927 Ga0501045_0116735 3300049824 Bacteria 1981
928 Ga0501045_0194924 3300049824 Bacteria 1510
929 Ga0501045_0401640 3300049824 Bacteria 1020
930 nmdc:mga05p37_1322812_c1 3300050507 Bacteria 733
931 nmdc:mga05p37_36435_c1 3300050507 Bacteria 6035
932 nmdc:mga05p37_370336_c1 3300050507 Bacteria 1681
933 nmdc:mga05p37_611200_c1 3300050507 Bacteria 1228
934 nmdc:mga05p37_66787_c2 3300050507 Bacteria 2868
935 nmdc:mga05p37_7439_c1 3300050507 Bacteria 12914
936 nmdc:mga05p37_752672_c1 3300050507 Bacteria 1074
937 nmdc:mga09592_223466_c1 3300050508 Bacteria 1631
938 nmdc:mga09592_502223_c1 3300050508 Bacteria 1044
939 nmdc:mga09592_521683_c1 3300050508 Bacteria 1022
940 nmdc:mga06r32_141_c7 3300050510 Bacteria 12743
941 nmdc:mga06r32_870614_c1 3300050510 Bacteria 859
942 nmdc:mga08y16_19182_c1 3300050511 Bacteria 7205
943 nmdc:mga08y16_527869_c1 3300050511 Bacteria 1197
944 nmdc:mga0n895_15482_c1 3300050512 Bacteria 6955
945 nmdc:mga0rr50_836884_c1 3300050513 Bacteria 785
946 nmdc:mga0rr50_9709_c1 3300050513 Bacteria 6069
947 nmdc:mga0a205_114554_c1 3300050515 Bacteria 2595
948 Ga0495601_0004034 3300053077 Bacteria 8459
949 Ga0495601_0060188 3300053077 Bacteria 2409
950 Ga0495612_0002970 3300053078 Bacteria 7039
951 Ga0495612_0026655 3300053078 Bacteria 2322
952 Ga0495612_0040647 3300053078 Bacteria 1895
953 Ga0495655_0005422 3300053083 Bacteria 2251
954 Ga0495655_0061606 3300053083 Bacteria 1025
955 Ga0495595_0031659 3300053084 Bacteria 2378
956 Ga0495619_0002469 3300053085 Bacteria 12095
957 Ga0495619_0007996 3300053085 Bacteria 6693
958 Ga0495619_0070251 3300053085 Bacteria 2341
959 Ga0500559_0004191 3300053136 Bacteria 6912
960 Ga0500616_0038644 3300053153 Bacteria 2577
961 Ga0501084_0023413 3300054114 Bacteria 5154
962 Ga0501084_0095375 3300054114 Bacteria 2498
963 Ga0501084_0190143 3300054114 Bacteria 1732
964 Ga0501084_0195338 3300054114 Bacteria 1707
965 Ga0590075_051065 3300059424 Bacteria 1061
966 Ga0501082_0027993 3300060353 Bacteria 4854
967 Ga0501082_0068293 3300060353 Bacteria 3061
968 Ga0501082_0329377 3300060353 Bacteria 1330
969 Ga0501082_0610630 3300060353 Bacteria 954
970 Ga0466962_0001664 3300061719 Bacteria 10426
971 Ga0466962_0059383 3300061719 Bacteria 1825
972 Ga0466962_0078777 3300061719 Bacteria 1575
973 Ga0466962_0082782 3300061719 Bacteria 1535
974 Ga0466962_0083532 3300061719 Bacteria 1528
975 Ga0466962_0161316 3300061719 Bacteria 1090
976 Ga0530510_0011756 3300061734 Bacteria 6142
977 Ga0530510_0132308 3300061734 Bacteria 1835
978 Ga0530510_0208838 3300061734 Bacteria 1451
979 Ga0530510_0306137 3300061734 Bacteria 1190
980 Ga0530510_0409020 3300061734 Bacteria 1023
981 2559427603 2558860280 Bacteria 11429938
982 2623499314 2622736605 Bacteria 4992138
983 2776375197 2775506925 Bacteria 7237746
984 2791916869 2791354901 Bacteria 8322202
985 2795780397 2795385470 Bacteria 8317180
986 2795793826 2795385472 Bacteria 6627535
987 2863069479 2863067949 Bacteria 8541735
988 2866612508 2866612099 Bacteria 7543886
989 2899374560 2899370129 Bacteria 6781179
990 8054473679 8054472261 Bacteria 7464355
991 8056209741 8056207758 Bacteria 8639239
992 Ga0213875_10000123
993 JGI24749J21850_1033324
994 JGI25406J46586_10011537
995 JGI25406J46586_10102001
996 Ga0070658_10113789
997 Ga0070658_10705619
998 Ga0070658_10765590
999 Ga0070676_10085935
1000 Ga0070676_10158072
1001 Ga0070676_10192171
1002 Ga0070676_10287431
1003 Ga0070683_100318659
1004 Ga0070683_100697196
1005 Ga0070690_100062094
1006 Ga0070670_100036082
1007 Ga0070670_100091437
1008 Ga0068869_100011051
1009 Ga0068869_100103621
1010 Ga0068869_100165826
1011 Ga0070680_100058990
1012 Ga0070680_100121827
1013 Ga0070682_100031698
1014 Ga0070682_100117502
1015 Ga0070682_100179800
1016 Ga0070682_100283395
1017 Ga0068868_100086462
1018 Ga0068868_100128000
1019 Ga0068868_100175130
1020 Ga0068868_100571686
1021 Ga0068868_100589526
1022 Ga0070660_100071829
1023 Ga0070660_100282530
1024 Ga0070660_100898744
1025 Ga0070689_100042156
1026 Ga0070689_100056311
1027 Ga0070689_100168645
1028 Ga0070687_100025521
1029 Ga0070661_100106480
1030 Ga0070661_100224945
1031 Ga0070661_100610713
1032 Ga0070692_10030140
1033 Ga0070692_10067746
1034 Ga0070692_10247970
1035 Ga0070692_10386316
1036 Ga0070668_100458209
1037 Ga0070668_101368581
1038 Ga0070669_100058538
1039 Ga0070669_100229784
1040 Ga0070675_100046688
1041 Ga0070675_100509109
1042 Ga0070671_100000909
1043 Ga0070671_100112451
1044 Ga0070671_100223289
1045 Ga0070674_100004141
1046 Ga0070674_100046405
1047 Ga0070674_100112001
1048 Ga0070673_100133831
1049 Ga0070673_100315050
1050 Ga0070673_100767627
1051 Ga0070688_100045177
1052 Ga0070659_100023252
1053 Ga0070659_100140300
1054 Ga0070667_100410934
1055 Ga0070709_10137992
1056 Ga0070714_100019347
1057 Ga0070714_100200985
1058 Ga0070713_100149421
1059 Ga0070713_100377331
1060 Ga0070713_100599429
1061 Ga0070710_10019601
1062 Ga0070710_10297154
1063 Ga0070701_10055849
1064 Ga0070701_10105654
1065 Ga0070711_100007611
1066 Ga0070711_100018745
1067 Ga0070705_100412682
1068 Ga0070705_100720412
1069 Ga0070700_100005670
1070 Ga0070700_100177527
1071 Ga0070700_100269229
1072 Ga0070694_100105417
1073 Ga0070708_100002519
1074 Ga0070708_100004229
1075 Ga0070708_100006320
1076 Ga0070708_100018330
1077 Ga0070708_100028347
1078 Ga0070708_100218068
1079 Ga0070708_101190058
1080 Ga0070663_100055023
1081 Ga0070663_100106788
1082 Ga0070663_100788369
1083 Ga0070663_101073570
1084 Ga0070678_100476598
1085 Ga0070678_100777028
1086 Ga0070662_100112744
1087 Ga0070662_100313560
1088 Ga0068867_100014962
1089 Ga0068867_100045227
1090 Ga0068867_100047900
1091 Ga0068867_100077307
1092 Ga0070685_10036710
1093 Ga0070685_10067551
1094 Ga0070685_10153208
1095 Ga0070706_100113840
1096 Ga0070706_100465706
1097 Ga0070707_100208962
1098 Ga0070698_100082845
1099 Ga0070698_100210864
1100 Ga0070698_100227835
1101 Ga0070699_100103363
1102 Ga0070699_100377253
1103 Ga0070699_100514497
1104 Ga0070699_100963448
1105 Ga0070679_100046068
1106 Ga0070679_100188025
1107 Ga0070679_100781864
1108 Ga0070684_100236983
1109 Ga0070684_100857000
1110 Ga0070697_100175129
1111 Ga0070697_100285060
1112 Ga0068853_100326373
1113 Ga0070672_100082630
1114 Ga0070672_100112170
1115 Ga0070672_100397570
1116 Ga0070686_100129005
1117 Ga0070686_100160794
1118 Ga0070695_100039249
1119 Ga0070696_100016150
1120 Ga0070696_100434994
1121 Ga0070665_100017820
1122 Ga0070665_101284555
1123 Ga0070704_100048830
1124 Ga0070704_100330679
1125 Ga0068855_100265953
1126 Ga0070664_100046066
1127 Ga0070664_100053204
1128 Ga0070664_100445503
1129 Ga0070664_100568585
1130 Ga0068857_100165450
1131 Ga0068857_100276675
1132 Ga0068857_100939470
1133 Ga0068854_100025334
1134 Ga0068854_100649705
1135 Ga0070702_100045882
1136 Ga0070702_100070552
1137 Ga0070702_100089256
1138 Ga0070702_101049800
1139 Ga0068852_100046759
1140 Ga0068852_101069579
1141 Ga0068859_100042477
1142 Ga0068859_100170744
1143 Ga0068864_100171764
1144 Ga0068864_100382783
1145 Ga0068864_100447552
1146 Ga0068864_100496525
1147 Ga0068864_100502149
1148 Ga0068864_100813957
1149 Ga0068864_100917461
1150 Ga0068866_10237745
1151 Ga0068866_10247692
1152 Ga0068861_100028598
1153 Ga0068851_10197224
1154 Ga0068851_10271013
1155 Ga0068870_10036661
1156 Ga0068870_10203101
1157 Ga0068870_10213639
1158 Ga0068870_10401790
1159 Ga0068863_100108828
1160 Ga0068863_100119077
1161 Ga0068863_100180777
1162 Ga0068863_100924510
1163 Ga0068858_100202044
1164 Ga0068858_100573039
1165 Ga0068858_100819174
1166 Ga0068860_100068836
1167 Ga0068860_100684879
1168 Ga0068862_100027688
1169 Ga0081455_10000064
1170 Ga0081455_10011325
1171 Ga0081455_10167856
1172 Ga0081538_10090242
1173 Ga0081539_10000027
1174 Ga0081539_10010730
1175 Ga0081539_10061633
1176 Ga0081539_10078331
1177 Ga0070717_10206337
1178 Ga0075365_10256401
1179 Ga0075432_10160791
1180 Ga0070715_10032314
1181 Ga0070716_100044955
1182 Ga0070716_100244155
1183 Ga0070712_100004574
1184 Ga0070712_100005842
1185 Ga0097621_100556372
1186 Ga0068871_100375711
1187 Ga0068871_101066139
1188 Ga0075428_100091210
1189 Ga0075428_101390060
1190 Ga0075431_100136254
1191 Ga0075431_100331987
1192 Ga0075433_10330066
1193 Ga0075434_100040568
1194 Ga0075429_100540583
1195 Ga0068865_100010490
1196 Ga0068865_100081146
1197 Ga0068865_100110799
1198 Ga0068865_100262803
1199 Ga0068865_100609256
1200 Ga0075436_100542769
1201 Ga0097620_100042475
1202 Ga0097620_100170743
1203 Ga0097620_101265541
1204 Ga0075435_100029282
1205 Ga0075435_100670184
1206 Ga0105251_10122080
1207 Ga0111539_10181236
1208 Ga0111539_11627068
1209 Ga0105245_10045364
1210 Ga0105245_10429754
1211 Ga0105245_10447169
1212 Ga0105245_10750902
1213 Ga0105245_10952497
1214 Ga0105247_10195155
1215 Ga0105247_10317636
1216 Ga0114129_10002142
1217 Ga0114129_10060554
1218 Ga0114129_10170159
1219 Ga0114129_10233938
1220 Ga0114129_10264916
1221 Ga0114129_10334996
1222 Ga0114129_10575091
1223 Ga0114129_10818138
1224 Ga0114129_10872494
1225 Ga0114129_11232738
1226 Ga0114129_12111616
1227 Ga0114129_12180386
1228 Ga0105243_10006714
1229 Ga0105243_10013163
1230 Ga0105241_10202804
1231 Ga0105242_10007179
1232 Ga0105242_10035288
1233 Ga0105242_10043688
1234 Ga0105242_10229052
1235 Ga0105248_10003799
1236 Ga0105248_10037658
1237 Ga0105248_10082283
1238 Ga0105238_10049338
1239 Ga0105238_10153840
1240 Ga0105238_10192367
1241 Ga0105238_10286614
1242 Ga0105238_10702551
1243 Ga0105238_11113799
1244 Ga0105238_11874059
1245 Ga0105249_10029348
1246 Ga0105249_10346407
1247 Ga0105249_10855334
1248 Ga0099796_10081000
1249 Ga0105239_10052554
1250 Ga0105246_10007131
1251 Ga0105246_10052516
1252 Ga0105246_10190640
1253 Ga0157344_1002768
1254 Ga0157371_10181200
1255 Ga0157369_10296239
1256 Ga0157369_10342344
1257 Ga0157369_10914925
1258 Ga0157374_10614616
1259 Ga0157378_10006283
1260 Ga0157378_10114578
1261 Ga0157378_11095949
1262 Ga0163162_10283558
1263 Ga0163162_10852856
1264 Ga0163162_11757645
1265 Ga0157372_10256292
1266 Ga0157375_10012047
1267 Ga0157375_10075795
1268 Ga0157375_10162242
1269 Ga0157375_10219546
1270 Ga0157375_10546234
1271 Ga0163163_10015258
1272 Ga0163163_10065378
1273 Ga0163163_10086411
1274 Ga0163163_10312446
1275 Ga0157380_10091196
1276 Ga0157380_10213134
1277 Ga0157380_10519424
1278 Ga0157380_10528303
1279 Ga0157380_10823826
1280 Ga0157377_10015839
1281 Ga0157377_10122790
1282 Ga0157377_10568104
1283 Ga0157379_10000747
1284 Ga0157379_10062646
1285 Ga0157379_10135803
1286 Ga0157379_10735669
1287 Ga0157376_10071714
1288 Ga0163161_10158113
1289 Ga0206354_10031289
1290 Ga0206353_10857764
1291 Ga0154015_1043079
1292 Ga0213876_10022268
1293 Ga0213875_10002214
1294 Ga0207656_10237159
1295 Ga0207656_10340778
1296 Ga0207713_1198414
1297 Ga0207692_10321175
1298 Ga0207642_10125015
1299 Ga0207642_10209501
1300 Ga0207642_10464204
1301 Ga0207710_10041428
1302 Ga0207688_10004405
1303 Ga0207688_10008032
1304 Ga0207688_10013485
1305 Ga0207688_10174047
1306 Ga0207688_10298593
1307 Ga0207688_10410484
1308 Ga0207680_10239962
1309 Ga0207647_10123534
1310 Ga0207647_10342849
1311 Ga0207699_10109545
1312 Ga0207699_10606765
1313 Ga0207645_10123722
1314 Ga0207645_10159715
1315 Ga0207645_10264514
1316 Ga0207643_10038100
1317 Ga0207643_10492494
1318 Ga0207643_10587022
1319 Ga0207705_10074008
1320 Ga0207684_10143174
1321 Ga0207684_10212134
1322 Ga0207684_10378923
1323 Ga0207671_10108617
1324 Ga0207671_10306870
1325 Ga0207693_10001022
1326 Ga0207693_10026075
1327 Ga0207663_10062846
1328 Ga0207663_10115760
1329 Ga0207660_10061780
1330 Ga0207660_10268763
1331 Ga0207662_10005211
1332 Ga0207662_10125066
1333 Ga0207662_10569393
1334 Ga0207657_10095336
1335 Ga0207657_10120433
1336 Ga0207649_10606631
1337 Ga0207652_10114992
1338 Ga0207646_10055386
1339 Ga0207646_10128027
1340 Ga0207646_10159032
1341 Ga0207646_10880644
1342 Ga0207681_10241914
1343 Ga0207694_10359993
1344 Ga0207694_10463887
1345 Ga0207694_10552909
1346 Ga0207659_10155385
1347 Ga0207659_10754098
1348 Ga0207687_10012505
1349 Ga0207687_10155106
1350 Ga0207687_10168128
1351 Ga0207687_10184684
1352 Ga0207687_10203230
1353 Ga0207687_10324153
1354 Ga0207700_10126144
1355 Ga0207664_10023494
1356 Ga0207664_10149292
1357 Ga0207664_10568105
1358 Ga0207644_10000893
1359 Ga0207644_10065801
1360 Ga0207644_10263420
1361 Ga0207690_10339507
1362 Ga0207690_10364502
1363 Ga0207706_10079155
1364 Ga0207706_10195946
1365 Ga0207686_10006485
1366 Ga0207686_10139775
1367 Ga0207686_10712271
1368 Ga0207709_10015943
1369 Ga0207709_10164242
1370 Ga0207670_10438466
1371 Ga0207669_10014636
1372 Ga0207669_10018292
1373 Ga0207669_10218932
1374 Ga0207669_10279807
1375 Ga0207704_10028464
1376 Ga0207704_10076020
1377 Ga0207704_10197135
1378 Ga0207665_10035972
1379 Ga0207665_10050178
1380 Ga0207691_10092961
1381 Ga0207691_10144709
1382 Ga0207691_10386720
1383 Ga0207691_10618024
1384 Ga0207711_10000355
1385 Ga0207711_10592496
1386 Ga0207689_10042665
1387 Ga0207689_10056340
1388 Ga0207689_10086688
1389 Ga0207689_10533115
1390 Ga0207661_10218049
1391 Ga0207679_10187835
1392 Ga0207679_10498686
1393 Ga0207651_10161278
1394 Ga0207712_10145042
1395 Ga0207712_10757548
1396 Ga0207712_10972949
1397 Ga0207668_10043874
1398 Ga0207668_10674354
1399 Ga0207640_10066893
1400 Ga0207640_10279656
1401 Ga0207640_10782437
1402 Ga0207658_10369128
1403 Ga0207677_10122020
1404 Ga0207677_10653891
1405 Ga0207677_10945014
1406 Ga0207703_10000007
1407 Ga0207703_10133238
1408 Ga0207703_10458030
1409 Ga0207639_10629565
1410 Ga0207678_10090823
1411 Ga0207678_10108053
1412 Ga0207678_10322281
1413 Ga0207678_10355524
1414 Ga0207678_10628102
1415 Ga0207708_10006895
1416 Ga0207708_10035980
1417 Ga0207708_10051363
1418 Ga0207708_10894284
1419 Ga0207702_10604439
1420 Ga0207641_10087457
1421 Ga0207641_10105793
1422 Ga0207641_10148745
1423 Ga0207641_10309725
1424 Ga0207641_10335787
1425 Ga0207648_10005074
1426 Ga0207648_10013201
1427 Ga0207648_10073304
1428 Ga0207648_10089067
1429 Ga0207648_10111292
1430 Ga0207676_10590754
1431 Ga0207676_10771600
1432 Ga0207674_10070523
1433 Ga0207674_10756866
1434 Ga0207674_10865679
1435 Ga0207675_100011101
1436 Ga0207675_100027801
1437 Ga0207683_10005936
1438 Ga0207683_10017236
1439 Ga0207683_10024495
1440 Ga0207683_10050942
1441 Ga0207698_10023042
1442 Ga0207698_10061607
1443 Ga0207698_10147558
1444 Ga0209974_10172217
1445 Ga0207428_10009205
1446 Ga0268266_10152452
1447 Ga0268266_10178355
1448 Ga0268266_10368575
1449 Ga0268266_10532863
1450 Ga0268266_10667145
1451 Ga0268265_10127833
1452 Ga0268264_10074958
1453 Ga0268264_10377237
1454 Ga0268264_10661922
1455 Ga0265322_10024482
1456 Ga0307517_10153010
1457 Ga0307515_10205378
1458 Ga0307511_10003508
1459 Ga0307512_10042450
1460 Ga0265327_10136653
1461 Ga0307513_10010554
1462 Ga0307513_10237393
1463 Ga0307408_100995673
1464 Ga0265342_10140282
1465 Ga0316576_10002704
1466 Ga0316578_10110110
1467 Ga0307405_10041987
1468 Ga0307413_10086147
1469 Ga0307413_10151778
1470 Ga0307413_10298867
1471 Ga0307410_10329948
1472 Ga0307410_10363292
1473 Ga0307410_10422827
1474 Ga0307410_10496504
1475 Ga0307410_11190230
1476 Ga0326468_10006296
1477 Ga0307406_10044774
1478 Ga0307406_10657683
1479 Ga0307407_10101946
1480 Ga0307407_10141912
1481 Ga0307407_10154407
1482 Ga0307407_10494867
1483 Ga0307412_10207956
1484 Ga0307409_100076025
1485 Ga0307409_100151639
1486 Ga0307409_100191407
1487 Ga0307409_100292871
1488 Ga0307409_100325820
1489 Ga0307409_100603375
1490 Ga0307416_100044898
1491 Ga0307416_100064661
1492 Ga0307416_100068464
1493 Ga0307416_100326358
1494 Ga0307416_100485598
1495 Ga0307416_100641630
1496 Ga0307416_100824475
1497 Ga0307416_101094146
1498 Ga0307416_101146767
1499 Ga0307414_10113632
1500 Ga0307414_10173687
1501 Ga0307414_10237248
1502 Ga0307414_10352544
1503 Ga0307411_10098203
1504 Ga0307411_10287024
1505 Ga0307411_10833293
1506 Ga0307415_100130228
1507 Ga0307415_100152283
1508 Ga0307415_100284489
1509 Ga0307415_100301997
1510 Ga0307415_100920495
1511 Ga0373926_0001444
1512 Ga0373944_0000040
1513 Ga0373923_0036897
1514 Ga0373936_0000099
1515 Ga0373936_0191180
1516 Ga0373945_0001163
1517 Ga0373953_0023798
1518 Ga0373956_0115642
1519 Ga0373943_0006625
1520 Ga0373946_0000479
1521 Ga0373955_0170935
1522 Ga0373961_0135790
1523 Ga0316574_0032238
1524 Ga0316574_0063993
1525 Ga0373924_0003505
1526 Ga0373931_0012989
1527 Ga0373931_0029579
1528 Ga0373935_0000216
1529 Ga0373927_0013647
1530 Ga0373933_0049820
1531 Ga0373947_0000710
1532 Ga0373947_0399954
1533 Ga0373937_0081083
1534 Ga0373937_0288133
1535 Ga0373937_1041924
1536 Ga0373937_1129707
1537 Ga0373925_0016392
1538 Ga0395899_0502492
1539 Ga0395900_0072237
1540 Ga0395900_0191300
1541 Ga0395898_0025468
1542 Ga0395898_0378987
1543 Ga0436364_0207977
1544 Ga0436364_0661798
1545 Ga0395901_0124443
1546 Ga0395901_0211773
1547 Ga0400483_039556
1548 Ga0436365_0453742
1549 Ga0436365_0999081
1550 Ga0436365_1097230
1551 Ga0436365_1701092
1552 Ga0436362_0380707
1553 Ga0439466_0052417
1554 Ga0439431_0041032
1555 Ga0451577_0000011
1556 Ga0451577_0101171
1557 Ga0451577_0198491
1558 Ga0451577_0299264
1559 Ga0439440_0094905
1560 Ga0466969_0016772
1561 Ga0466972_0058612
1562 Ga0466972_0212377
1563 Ga0466972_0233306
1564 Ga0453683_0000024
1565 Ga0453683_0000802
1566 Ga0453683_0178759
1567 Ga0466965_0074512
1568 Ga0466965_0186178
1569 Ga0466966_0000310
1570 Ga0466966_0045170
1571 Ga0466966_0074908
1572 Ga0466961_0005736
1573 Ga0466961_0039169
1574 Ga0466961_0041927
1575 Ga0466961_0078215
1576 Ga0466961_0179060
1577 Ga0466961_0314599
1578 Ga0466961_0314693
1579 Ga0466961_0509884
1580 Ga0466963_0054699
1581 Ga0466963_0093919
1582 Ga0466964_0333871
1583 Ga0466964_0379168
1584 Ga0453684_0000087
1585 Ga0453684_0003702
1586 Ga0453684_0007361
1587 Ga0453684_0037887
1588 Ga0453684_0142853
1589 Ga0453684_0304850
1590 Ga0453684_0945354
1591 Ga0466971_0005194
1592 Ga0466971_0024329
1593 Ga0466971_0104882
1594 Ga0466968_0000525
1595 Ga0466968_0180225
1596 Ga0466970_0009971
1597 Ga0466970_0055005
1598 Ga0466970_0095122
1599 Ga0466970_0098601
1600 Ga0466970_0291487
1601 Ga0466957_0016044
1602 Ga0466957_0129676
1603 Ga0466957_0138454
1604 Ga0466957_0152271
1605 Ga0466957_0166690
1606 Ga0466957_0496663
1607 Ga0466957_1003280
1608 Ga0466960_0000156
1609 Ga0466960_0038232
1610 Ga0466960_0107309
1611 Ga0466960_0126270
1612 Ga0466959_0011879
1613 Ga0466959_0030589
1614 Ga0466959_0067923
1615 Ga0466959_0370468
1616 Ga0466959_0453333
1617 Ga0466959_0466303
1618 Ga0451576_0002579
1619 Ga0451576_0047433
1620 Ga0451576_0762313
1621 Ga0466958_0000800
1622 Ga0466958_0090518
1623 Ga0466958_0111451
1624 Ga0466958_0233558
1625 Ga0466958_0250701
1626 Ga0466958_0336281
1627 Ga0466958_0409002
1628 Ga0466958_0430493
1629 Ga0466958_0635988
1630 Ga0466958_0695541
1631 Ga0466967_0010347
1632 Ga0466967_0010732
1633 Ga0466967_0058287
1634 Ga0466967_0114985
1635 Ga0466967_0149625
1636 Ga0466967_0151240
1637 Ga0466967_0202071
1638 Ga0466967_0216216
1639 Ga0466967_0268082
1640 Ga0466967_0411042
1641 Ga0466967_0515986
1642 Ga0466967_0625435
1643 Ga0466967_0838471
1644 Ga0466967_0964870
1645 Ga0466967_1484649
1646 Ga0495592_0011127
1647 Ga0495592_0104861
1648 Ga0495603_0001320
1649 Ga0495603_0008054
1650 Ga0495591_052977
1651 Ga0495629_0000652
1652 Ga0495641_0000703
1653 Ga0495641_0006618
1654 Ga0495651_0000079
1655 Ga0495651_0028764
1656 Ga0495653_0133671
1657 Ga0495653_0302284
1658 Ga0495582_0013092
1659 Ga0495582_0169731
1660 Ga0495605_0032201
1661 Ga0495639_0000408
1662 Ga0495662_0006922
1663 Ga0495664_0097664
1664 Ga0495584_0032815
1665 Ga0495585_0105679
1666 Ga0495594_0044943
1667 Ga0495594_0105482
1668 Ga0495596_0214653
1669 Ga0495608_0009712
1670 Ga0495616_0303077
1671 Ga0495618_0019442
1672 Ga0495618_0168039
1673 Ga0495618_0589550
1674 Ga0495620_0284165
1675 Ga0495628_0046644
1676 Ga0495630_0007948
1677 Ga0495630_0470840
1678 Ga0495637_0048957
1679 Ga0495644_0002314
1680 Ga0495644_0107997
1681 Ga0495663_0084347
1682 Ga0495666_0000781
1683 Ga0495642_0166033
1684 Ga0495652_0014199
1685 Ga0495652_0087582
1686 Ga0495665_0000516
1687 Ga0495640_0015955
1688 Ga0495640_0030512
1689 Ga0495586_0004434
1690 Ga0495586_0039827
1691 Ga0495586_0657703
1692 Ga0495587_0013791
1693 Ga0495598_0000360
1694 Ga0495598_0054149
1695 Ga0495609_0042331
1696 Ga0495645_0014632
1697 Ga0495645_0445209
1698 Ga0495633_0140484
1699 Ga0495667_0043633
1700 Ga0495667_0055694
1701 Ga0495667_0374235
1702 Ga0495656_0000659
1703 Ga0495656_0035906
1704 Ga0495668_0101751
1705 Ga0495668_0298502
1706 Ga0495634_0000699
1707 Ga0495634_0053466
1708 Ga0495634_0277235
1709 Ga0495635_0006319
1710 Ga0495635_0006541
1711 Ga0495635_0012916
1712 Ga0495659_0008450
1713 Ga0495661_0031524
1714 Ga0495588_0000837
1715 Ga0495657_0068610
1716 Ga0495599_0080327
1717 Ga0495623_0094873
1718 Ga0495646_0003687
1719 Ga0495646_0050105
1720 Ga0495647_0000056
1721 Ga0495658_0000118
1722 Ga0495613_0003794
1723 Ga0495613_0084003
1724 Ga0495613_0358218
1725 Ga0495624_0000683
1726 Ga0495671_0120572
1727 Ga0495589_0028936
1728 Ga0495600_0008499
1729 Ga0495600_0133071
1730 Ga0495581_0002405
1731 Ga0495581_0121710
1732 Ga0495636_0020791
1733 Ga0495674_0007525
1734 Ga0495674_0030199
1735 Ga0495674_0526698
1736 Ga0495676_0027302
1737 Ga0495676_0442008
1738 Ga0495680_0000698
1739 Ga0495680_0006170
1740 Ga0495683_0305116
1741 Ga0495675_0126191
1742 Ga0495677_0041073
1743 Ga0495684_0061019
1744 Ga0495593_0015952
1745 Ga0495602_0115413
1746 Ga0495614_0012341
1747 Ga0495615_0029386
1748 Ga0495615_0042775
1749 Ga0496100_0032892
1750 Ga0496100_0471235
1751 Ga0496101_0061737
1752 Ga0496101_0239022
1753 Ga0496102_0002120
1754 Ga0496102_0146583
1755 Ga0496102_0815496
1756 Ga0496102_1122213
1757 Ga0496102_1588567
1758 Ga0496103_0036423
1759 Ga0496104_0052045
1760 Ga0496104_0088642
1761 Ga0496104_0297403
1762 Ga0496104_0313711
1763 Ga0496104_0548189
1764 Ga0496104_0843500
1765 Ga0496105_0127319
1766 Ga0496105_0439634
1767 Ga0496105_0489758
1768 Ga0496106_0000632
1769 Ga0496106_0186295
1770 Ga0496106_0513619
1771 Ga0496107_0295143
1772 Ga0496108_0000018
1773 Ga0496108_0011820
1774 Ga0496108_0023835
1775 Ga0496108_0029999
1776 Ga0496108_0096698
1777 Ga0496108_0476455
1778 Ga0496108_0510328
1779 Ga0496108_0694851
1780 Ga0496109_0029420
1781 Ga0496109_0053838
1782 Ga0496109_0314511
1783 Ga0496109_0943913
1784 Ga0496110_0027938
1785 Ga0496110_0029823
1786 Ga0496110_0050270
1787 Ga0496111_0024685
1788 Ga0496111_0057308
1789 Ga0496111_0118802
1790 Ga0496111_0158593
1791 Ga0496111_0295988
1792 Ga0496112_0038187
1793 Ga0496112_0053393
1794 Ga0496112_0138074
1795 Ga0496112_1203625
1796 Ga0496113_0038680
1797 Ga0496113_0073689
1798 Ga0496113_0219688
1799 Ga0496113_0560580
1800 Ga0496114_0017063
1801 Ga0496114_0100527
1802 Ga0496115_0135231
1803 Ga0496115_0565590
1804 Ga0496115_0764156
1805 Ga0496116_0045085
1806 Ga0496117_0030433
1807 Ga0496119_0001521
1808 Ga0496120_0001525
1809 Ga0496122_0042166
1810 Ga0496122_0084576
1811 Ga0496124_0000542
1812 Ga0496126_0001205
1813 Ga0496126_0001917
1814 Ga0496126_0069612
1815 Ga0501298_037448
1816 Ga0501318_004734
1817 Ga0501031_0015731
1818 Ga0501031_0033843
1819 Ga0501031_0512277
1820 Ga0501031_0612357
1821 Ga0501032_0006296
1822 Ga0501033_0013749
1823 Ga0501033_0104874
1824 Ga0501033_0130933
1825 Ga0501034_0202941
1826 Ga0501034_0896110
1827 Ga0501036_0053301
1828 Ga0501036_0126028
1829 Ga0501036_0313703
1830 Ga0501037_0002416
1831 Ga0501037_0003569
1832 Ga0501038_0015173
1833 Ga0501038_0016532
1834 Ga0501038_0251188
1835 Ga0501038_0493085
1836 Ga0501039_0069171
1837 Ga0501039_0136030
1838 Ga0501039_0442603
1839 Ga0501040_0010354
1840 Ga0501040_0021154
1841 Ga0501040_0035784
1842 Ga0501040_0356980
1843 Ga0501040_0629179
1844 Ga0501041_0105846
1845 Ga0501042_0075035
1846 Ga0501043_0003176
1847 Ga0501043_0004360
1848 Ga0501043_0096804
1849 Ga0501043_0250677
1850 Ga0501043_0401113
1851 Ga0501046_0067141
1852 Ga0501046_0105544
1853 Ga0501047_0112038
1854 Ga0501048_0024791
1855 Ga0501048_0088159
1856 Ga0501048_0641424
1857 Ga0501048_0945224
1858 Ga0501067_0031570
1859 Ga0501068_0003054
1860 Ga0501068_0077176
1861 Ga0501068_0116968
1862 Ga0501068_0131899
1863 Ga0501068_0354505
1864 Ga0501069_0030265
1865 Ga0501070_0021366
1866 Ga0501070_0299345
1867 Ga0501071_0011761
1868 Ga0501071_0087584
1869 Ga0501071_0173241
1870 Ga0501071_0557162
1871 Ga0501072_0034193
1872 Ga0501072_0071127
1873 Ga0501072_0508921
1874 Ga0501073_0016095
1875 Ga0501073_0077723
1876 Ga0501074_0015182
1877 Ga0501074_0072257
1878 Ga0501074_0101069
1879 Ga0501075_0016652
1880 Ga0501075_0036049
1881 Ga0501075_0054999
1882 Ga0501075_0281617
1883 Ga0501075_0329467
1884 Ga0501075_0467857
1885 Ga0501076_0003206
1886 Ga0501076_0019371
1887 Ga0501076_0080098
1888 Ga0501076_0385430
1889 Ga0501077_0010639
1890 Ga0501077_0015144
1891 Ga0501077_0058883
1892 Ga0501077_0116202
1893 Ga0501077_0276308
1894 Ga0501077_0353544
1895 Ga0501253_109589
1896 Ga0501079_0009708
1897 Ga0501079_0036553
1898 Ga0501079_0668699
1899 Ga0501080_0017241
1900 Ga0501080_0031418
1901 Ga0501080_0449466
1902 Ga0501080_0696196
1903 Ga0501080_0717553
1904 Ga0501081_0008906
1905 Ga0501081_0014467
1906 Ga0501081_0499945
1907 Ga0501083_0022959
1908 Ga0501083_0038256
1909 Ga0501083_0066068
1910 Ga0501035_0071187
1911 Ga0501035_0074372
1912 Ga0501035_0309396
1913 Ga0501044_0005084
1914 Ga0501044_0010145
1915 Ga0501044_0187354
1916 Ga0501044_0805097
1917 Ga0501045_0099160
1918 Ga0501045_0116735
1919 Ga0501045_0194924
1920 Ga0501045_0401640
1921 nmdc:mga05p37_1322812_c1
1922 nmdc:mga05p37_36435_c1
1923 nmdc:mga05p37_370336_c1
1924 nmdc:mga05p37_611200_c1
1925 nmdc:mga05p37_66787_c2
1926 nmdc:mga05p37_7439_c1
1927 nmdc:mga05p37_752672_c1
1928 nmdc:mga09592_223466_c1
1929 nmdc:mga09592_502223_c1
1930 nmdc:mga09592_521683_c1
1931 nmdc:mga06r32_141_c7
1932 nmdc:mga06r32_870614_c1
1933 nmdc:mga08y16_19182_c1
1934 nmdc:mga08y16_527869_c1
1935 nmdc:mga0n895_15482_c1
1936 nmdc:mga0rr50_836884_c1
1937 nmdc:mga0rr50_9709_c1
1938 nmdc:mga0a205_114554_c1
1939 Ga0495601_0004034
1940 Ga0495601_0060188
1941 Ga0495612_0002970
1942 Ga0495612_0026655
1943 Ga0495612_0040647
1944 Ga0495655_0005422
1945 Ga0495655_0061606
1946 Ga0495595_0031659
1947 Ga0495619_0002469
1948 Ga0495619_0007996
1949 Ga0495619_0070251
1950 Ga0500559_0004191
1951 Ga0500616_0038644
1952 Ga0501084_0023413
1953 Ga0501084_0095375
1954 Ga0501084_0190143
1955 Ga0501084_0195338
1956 Ga0590075_051065
1957 Ga0501082_0027993
1958 Ga0501082_0068293
1959 Ga0501082_0329377
1960 Ga0501082_0610630
1961 Ga0466962_0001664
1962 Ga0466962_0059383
1963 Ga0466962_0078777
1964 Ga0466962_0082782
1965 Ga0466962_0083532
1966 Ga0466962_0161316
1967 Ga0530510_0011756
1968 Ga0530510_0132308
1969 Ga0530510_0208838
1970 Ga0530510_0306137
1971 Ga0530510_0409020
1972 2559427603
1973 2623499314
1974 2776375197
1975 2791916869
1976 2795780397
1977 2795793826
1978 2863069479
1979 2866612508
1980 2899374560
1981 8054473679
1982 8056209741

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

47

203

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o7m-assembly1.cif.gz_D 1.98 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' 0.9797 12 181
3acc-assembly1.cif.gz_A-2 crystal structure of hypoxanthine-guanine phosphoribosyltransferase with gmp from thermus thermophilus hb8 0.979 17 182
3ohp-assembly1.cif.gz_D crystal structure of hgprt from vibrio cholerae 0.9763 14 182
3ohp-assembly1.cif.gz_B crystal structure of hgprt from vibrio cholerae 0.9728 14 182
4rht-assembly2.cif.gz_B crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease 0.9726 11 183
ID Description Score Start End Superfamily
3acdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9637 17 182 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9527 11 182 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.947 11 182 3.40.50.2020
1hgxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9434 10 185 3.40.50.2020
af_I1LDB6_1_185_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9342 9 185 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A0S8EHA9-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9829 10 185 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A536DM78-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9823 11 184 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A7C6T332-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9819 11 181 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A351AAS8-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9804 14 181 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A2E9CZJ7-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9803 12 181 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657

Map