F487636
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 991 | 418 | 1982 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10000123|Ga0213875_1000012342 |
| Length | 222 |
| Sequence | MSPDNPHRPEDMAPYRGYQPAQNLDSSPCGEHRGAGDGLYRGEIASVLVTEEQIQRRIAEIAQQVAADFQAEHGDGDLLLVGVLKGAVMFMTDFARALPIPVQLEFMAVSSYGSATSSSGVVRILKDLDRDITGRHVLVVEDIIDSGLTLSWLLRNLLTRRPATLEVCTLLRKPDAVQIDVPVRYVGFDIPQEFVVGYGLDYGERYRDLPYIGTLAPEVYAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 199 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 241 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 244 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 247 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 251 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 254 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 255 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 256 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 257 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 347 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 348 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 349 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 353 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 354 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 402 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 403 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 405 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 407 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 408 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 409 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 410 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 411 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 412 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 413 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 414 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 415 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 416 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 417 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 418 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 0.4 |
| Isolates | 1.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 5.65 |
| Rhizosphere | 91.12 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 0.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213875_10000123 | 3300021388 | Bacteria | 86889 |
| 2 | JGI24749J21850_1033324 | 3300002076 | Bacteria | 743 |
| 3 | JGI25406J46586_10011537 | 3300003203 | Bacteria | 3873 |
| 4 | JGI25406J46586_10102001 | 3300003203 | Bacteria | 855 |
| 5 | Ga0070658_10113789 | 3300005327 | Bacteria | 2244 |
| 6 | Ga0070658_10705619 | 3300005327 | Bacteria | 876 |
| 7 | Ga0070658_10765590 | 3300005327 | Bacteria | 838 |
| 8 | Ga0070676_10085935 | 3300005328 | Bacteria | 1918 |
| 9 | Ga0070676_10158072 | 3300005328 | Bacteria | 1456 |
| 10 | Ga0070676_10192171 | 3300005328 | Bacteria | 1333 |
| 11 | Ga0070676_10287431 | 3300005328 | Bacteria | 1110 |
| 12 | Ga0070683_100318659 | 3300005329 | Bacteria | 1480 |
| 13 | Ga0070683_100697196 | 3300005329 | Bacteria | 972 |
| 14 | Ga0070690_100062094 | 3300005330 | Bacteria | 2409 |
| 15 | Ga0070670_100036082 | 3300005331 | Bacteria | 4255 |
| 16 | Ga0070670_100091437 | 3300005331 | Bacteria | 2616 |
| 17 | Ga0068869_100011051 | 3300005334 | Bacteria | 5913 |
| 18 | Ga0068869_100103621 | 3300005334 | Bacteria | 2156 |
| 19 | Ga0068869_100165826 | 3300005334 | Bacteria | 1723 |
| 20 | Ga0070680_100058990 | 3300005336 | Bacteria | 3139 |
| 21 | Ga0070680_100121827 | 3300005336 | Bacteria | 2178 |
| 22 | Ga0070682_100031698 | 3300005337 | Bacteria | 3198 |
| 23 | Ga0070682_100117502 | 3300005337 | Bacteria | 1780 |
| 24 | Ga0070682_100179800 | 3300005337 | Bacteria | 1476 |
| 25 | Ga0070682_100283395 | 3300005337 | Bacteria | 1209 |
| 26 | Ga0068868_100086462 | 3300005338 | Bacteria | 2520 |
| 27 | Ga0068868_100128000 | 3300005338 | Bacteria | 2076 |
| 28 | Ga0068868_100175130 | 3300005338 | Bacteria | 1778 |
| 29 | Ga0068868_100571686 | 3300005338 | Bacteria | 998 |
| 30 | Ga0068868_100589526 | 3300005338 | Bacteria | 984 |
| 31 | Ga0070660_100071829 | 3300005339 | Bacteria | 2703 |
| 32 | Ga0070660_100282530 | 3300005339 | Bacteria | 1358 |
| 33 | Ga0070660_100898744 | 3300005339 | Bacteria | 747 |
| 34 | Ga0070689_100042156 | 3300005340 | Bacteria | 3504 |
| 35 | Ga0070689_100056311 | 3300005340 | Bacteria | 3048 |
| 36 | Ga0070689_100168645 | 3300005340 | Bacteria | 1773 |
| 37 | Ga0070687_100025521 | 3300005343 | Bacteria | 2836 |
| 38 | Ga0070661_100106480 | 3300005344 | Bacteria | 2091 |
| 39 | Ga0070661_100224945 | 3300005344 | Bacteria | 1440 |
| 40 | Ga0070661_100610713 | 3300005344 | Bacteria | 882 |
| 41 | Ga0070692_10030140 | 3300005345 | Bacteria | 2711 |
| 42 | Ga0070692_10067746 | 3300005345 | Bacteria | 1895 |
| 43 | Ga0070692_10247970 | 3300005345 | Bacteria | 1065 |
| 44 | Ga0070692_10386316 | 3300005345 | Bacteria | 880 |
| 45 | Ga0070668_100458209 | 3300005347 | Bacteria | 1097 |
| 46 | Ga0070668_101368581 | 3300005347 | Bacteria | 645 |
| 47 | Ga0070669_100058538 | 3300005353 | Bacteria | 2828 |
| 48 | Ga0070669_100229784 | 3300005353 | Bacteria | 1470 |
| 49 | Ga0070675_100046688 | 3300005354 | Bacteria | 3547 |
| 50 | Ga0070675_100509109 | 3300005354 | Bacteria | 1085 |
| 51 | Ga0070671_100000909 | 3300005355 | Bacteria | 21598 |
| 52 | Ga0070671_100112451 | 3300005355 | Bacteria | 2287 |
| 53 | Ga0070671_100223289 | 3300005355 | Bacteria | 1598 |
| 54 | Ga0070674_100004141 | 3300005356 | Bacteria | 8233 |
| 55 | Ga0070674_100046405 | 3300005356 | Bacteria | 2972 |
| 56 | Ga0070674_100112001 | 3300005356 | Bacteria | 2005 |
| 57 | Ga0070673_100133831 | 3300005364 | Bacteria | 2084 |
| 58 | Ga0070673_100315050 | 3300005364 | Bacteria | 1381 |
| 59 | Ga0070673_100767627 | 3300005364 | Bacteria | 888 |
| 60 | Ga0070688_100045177 | 3300005365 | Bacteria | 2720 |
| 61 | Ga0070659_100023252 | 3300005366 | Bacteria | 4740 |
| 62 | Ga0070659_100140300 | 3300005366 | Bacteria | 1967 |
| 63 | Ga0070667_100410934 | 3300005367 | Bacteria | 1233 |
| 64 | Ga0070709_10137992 | 3300005434 | Bacteria | 1672 |
| 65 | Ga0070714_100019347 | 3300005435 | Bacteria | 5545 |
| 66 | Ga0070714_100200985 | 3300005435 | Bacteria | 1823 |
| 67 | Ga0070713_100149421 | 3300005436 | Bacteria | 2076 |
| 68 | Ga0070713_100377331 | 3300005436 | Bacteria | 1320 |
| 69 | Ga0070713_100599429 | 3300005436 | Bacteria | 1046 |
| 70 | Ga0070710_10019601 | 3300005437 | Bacteria | 3498 |
| 71 | Ga0070710_10297154 | 3300005437 | Bacteria | 1053 |
| 72 | Ga0070701_10055849 | 3300005438 | Bacteria | 2064 |
| 73 | Ga0070701_10105654 | 3300005438 | Bacteria | 1566 |
| 74 | Ga0070711_100007611 | 3300005439 | Bacteria | 6593 |
| 75 | Ga0070711_100018745 | 3300005439 | Bacteria | 4425 |
| 76 | Ga0070705_100412682 | 3300005440 | Bacteria | 1003 |
| 77 | Ga0070705_100720412 | 3300005440 | Bacteria | 786 |
| 78 | Ga0070700_100005670 | 3300005441 | Bacteria | 6624 |
| 79 | Ga0070700_100177527 | 3300005441 | Bacteria | 1479 |
| 80 | Ga0070700_100269229 | 3300005441 | Bacteria | 1230 |
| 81 | Ga0070694_100105417 | 3300005444 | Bacteria | 2000 |
| 82 | Ga0070708_100002519 | 3300005445 | Bacteria | 14145 |
| 83 | Ga0070708_100004229 | 3300005445 | Bacteria | 11275 |
| 84 | Ga0070708_100006320 | 3300005445 | Bacteria | 9429 |
| 85 | Ga0070708_100018330 | 3300005445 | Bacteria | 5859 |
| 86 | Ga0070708_100028347 | 3300005445 | Bacteria | 4819 |
| 87 | Ga0070708_100218068 | 3300005445 | Bacteria | 1789 |
| 88 | Ga0070708_101190058 | 3300005445 | Bacteria | 713 |
| 89 | Ga0070663_100055023 | 3300005455 | Bacteria | 2847 |
| 90 | Ga0070663_100106788 | 3300005455 | Bacteria | 2098 |
| 91 | Ga0070663_100788369 | 3300005455 | Bacteria | 814 |
| 92 | Ga0070663_101073570 | 3300005455 | Bacteria | 703 |
| 93 | Ga0070678_100476598 | 3300005456 | Bacteria | 1097 |
| 94 | Ga0070678_100777028 | 3300005456 | Bacteria | 868 |
| 95 | Ga0070662_100112744 | 3300005457 | Bacteria | 2074 |
| 96 | Ga0070662_100313560 | 3300005457 | Bacteria | 1277 |
| 97 | Ga0068867_100014962 | 3300005459 | Bacteria | 5499 |
| 98 | Ga0068867_100045227 | 3300005459 | Bacteria | 3227 |
| 99 | Ga0068867_100047900 | 3300005459 | Bacteria | 3143 |
| 100 | Ga0068867_100077307 | 3300005459 | Bacteria | 2501 |
| 101 | Ga0070685_10036710 | 3300005466 | Bacteria | 2771 |
| 102 | Ga0070685_10067551 | 3300005466 | Bacteria | 2109 |
| 103 | Ga0070685_10153208 | 3300005466 | Bacteria | 1462 |
| 104 | Ga0070706_100113840 | 3300005467 | Bacteria | 2519 |
| 105 | Ga0070706_100465706 | 3300005467 | Bacteria | 1176 |
| 106 | Ga0070707_100208962 | 3300005468 | Bacteria | 1903 |
| 107 | Ga0070698_100082845 | 3300005471 | Bacteria | 3199 |
| 108 | Ga0070698_100210864 | 3300005471 | Bacteria | 1877 |
| 109 | Ga0070698_100227835 | 3300005471 | Bacteria | 1797 |
| 110 | Ga0070699_100103363 | 3300005518 | Bacteria | 2498 |
| 111 | Ga0070699_100377253 | 3300005518 | Bacteria | 1280 |
| 112 | Ga0070699_100514497 | 3300005518 | Unclassified | 1088 |
| 113 | Ga0070699_100963448 | 3300005518 | Bacteria | 782 |
| 114 | Ga0070679_100046068 | 3300005530 | Bacteria | 4346 |
| 115 | Ga0070679_100188025 | 3300005530 | Bacteria | 2035 |
| 116 | Ga0070679_100781864 | 3300005530 | Bacteria | 898 |
| 117 | Ga0070684_100236983 | 3300005535 | Bacteria | 1667 |
| 118 | Ga0070684_100857000 | 3300005535 | Bacteria | 850 |
| 119 | Ga0070697_100175129 | 3300005536 | Bacteria | 1817 |
| 120 | Ga0070697_100285060 | 3300005536 | Unclassified | 1418 |
| 121 | Ga0068853_100326373 | 3300005539 | Bacteria | 1423 |
| 122 | Ga0070672_100082630 | 3300005543 | Bacteria | 2577 |
| 123 | Ga0070672_100112170 | 3300005543 | Bacteria | 2224 |
| 124 | Ga0070672_100397570 | 3300005543 | Bacteria | 1181 |
| 125 | Ga0070686_100129005 | 3300005544 | Bacteria | 1746 |
| 126 | Ga0070686_100160794 | 3300005544 | Bacteria | 1581 |
| 127 | Ga0070695_100039249 | 3300005545 | Bacteria | 2992 |
| 128 | Ga0070696_100016150 | 3300005546 | Bacteria | 5022 |
| 129 | Ga0070696_100434994 | 3300005546 | Bacteria | 1033 |
| 130 | Ga0070665_100017820 | 3300005548 | Bacteria | 7129 |
| 131 | Ga0070665_101284555 | 3300005548 | Bacteria | 742 |
| 132 | Ga0070704_100048830 | 3300005549 | Bacteria | 2964 |
| 133 | Ga0070704_100330679 | 3300005549 | Bacteria | 1280 |
| 134 | Ga0068855_100265953 | 3300005563 | Bacteria | 1909 |
| 135 | Ga0070664_100046066 | 3300005564 | Bacteria | 3683 |
| 136 | Ga0070664_100053204 | 3300005564 | Bacteria | 3431 |
| 137 | Ga0070664_100445503 | 3300005564 | Bacteria | 1188 |
| 138 | Ga0070664_100568585 | 3300005564 | Bacteria | 1049 |
| 139 | Ga0068857_100165450 | 3300005577 | Bacteria | 2008 |
| 140 | Ga0068857_100276675 | 3300005577 | Bacteria | 1543 |
| 141 | Ga0068857_100939470 | 3300005577 | Bacteria | 830 |
| 142 | Ga0068854_100025334 | 3300005578 | Bacteria | 4069 |
| 143 | Ga0068854_100649705 | 3300005578 | Bacteria | 905 |
| 144 | Ga0070702_100045882 | 3300005615 | Bacteria | 2474 |
| 145 | Ga0070702_100070552 | 3300005615 | Bacteria | 2063 |
| 146 | Ga0070702_100089256 | 3300005615 | Bacteria | 1866 |
| 147 | Ga0070702_101049800 | 3300005615 | Bacteria | 648 |
| 148 | Ga0068852_100046759 | 3300005616 | Bacteria | 3688 |
| 149 | Ga0068852_101069579 | 3300005616 | Bacteria | 826 |
| 150 | Ga0068859_100042477 | 3300005617 | Bacteria | 4567 |
| 151 | Ga0068859_100170744 | 3300005617 | Bacteria | 2255 |
| 152 | Ga0068864_100171764 | 3300005618 | Bacteria | 1977 |
| 153 | Ga0068864_100382783 | 3300005618 | Bacteria | 1333 |
| 154 | Ga0068864_100447552 | 3300005618 | Bacteria | 1235 |
| 155 | Ga0068864_100496525 | 3300005618 | Bacteria | 1173 |
| 156 | Ga0068864_100502149 | 3300005618 | Bacteria | 1167 |
| 157 | Ga0068864_100813957 | 3300005618 | Bacteria | 919 |
| 158 | Ga0068864_100917461 | 3300005618 | Bacteria | 865 |
| 159 | Ga0068866_10237745 | 3300005718 | Bacteria | 1108 |
| 160 | Ga0068866_10247692 | 3300005718 | Bacteria | 1089 |
| 161 | Ga0068861_100028598 | 3300005719 | Bacteria | 4068 |
| 162 | Ga0068851_10197224 | 3300005834 | Bacteria | 1122 |
| 163 | Ga0068851_10271013 | 3300005834 | Bacteria | 968 |
| 164 | Ga0068870_10036661 | 3300005840 | Bacteria | 2523 |
| 165 | Ga0068870_10203101 | 3300005840 | Bacteria | 1203 |
| 166 | Ga0068870_10213639 | 3300005840 | Bacteria | 1176 |
| 167 | Ga0068870_10401790 | 3300005840 | Bacteria | 892 |
| 168 | Ga0068863_100108828 | 3300005841 | Bacteria | 2638 |
| 169 | Ga0068863_100119077 | 3300005841 | Bacteria | 2517 |
| 170 | Ga0068863_100180777 | 3300005841 | Bacteria | 2024 |
| 171 | Ga0068863_100924510 | 3300005841 | Bacteria | 873 |
| 172 | Ga0068858_100202044 | 3300005842 | Bacteria | 1879 |
| 173 | Ga0068858_100573039 | 3300005842 | Bacteria | 1094 |
| 174 | Ga0068858_100819174 | 3300005842 | Bacteria | 908 |
| 175 | Ga0068860_100068836 | 3300005843 | Bacteria | 3363 |
| 176 | Ga0068860_100684879 | 3300005843 | Bacteria | 1034 |
| 177 | Ga0068862_100027688 | 3300005844 | Bacteria | 4771 |
| 178 | Ga0081455_10000064 | 3300005937 | Bacteria | 115735 |
| 179 | Ga0081455_10011325 | 3300005937 | Bacteria | 8971 |
| 180 | Ga0081455_10167856 | 3300005937 | Bacteria | 1675 |
| 181 | Ga0081538_10090242 | 3300005981 | Bacteria | 1587 |
| 182 | Ga0081539_10000027 | 3300005985 | Bacteria | 328691 |
| 183 | Ga0081539_10010730 | 3300005985 | Bacteria | 7383 |
| 184 | Ga0081539_10061633 | 3300005985 | Bacteria | 2054 |
| 185 | Ga0081539_10078331 | 3300005985 | Bacteria | 1745 |
| 186 | Ga0070717_10206337 | 3300006028 | Bacteria | 1723 |
| 187 | Ga0075365_10256401 | 3300006038 | Bacteria | 1229 |
| 188 | Ga0075432_10160791 | 3300006058 | Bacteria | 868 |
| 189 | Ga0070715_10032314 | 3300006163 | Bacteria | 2131 |
| 190 | Ga0070716_100044955 | 3300006173 | Bacteria | 2476 |
| 191 | Ga0070716_100244155 | 3300006173 | Bacteria | 1219 |
| 192 | Ga0070712_100004574 | 3300006175 | Bacteria | 8544 |
| 193 | Ga0070712_100005842 | 3300006175 | Bacteria | 7618 |
| 194 | Ga0097621_100556372 | 3300006237 | Bacteria | 1044 |
| 195 | Ga0068871_100375711 | 3300006358 | Bacteria | 1262 |
| 196 | Ga0068871_101066139 | 3300006358 | Bacteria | 755 |
| 197 | Ga0075428_100091210 | 3300006844 | Bacteria | 3323 |
| 198 | Ga0075428_101390060 | 3300006844 | Bacteria | 737 |
| 199 | Ga0075431_100136254 | 3300006847 | Bacteria | 2531 |
| 200 | Ga0075431_100331987 | 3300006847 | Bacteria | 1531 |
| 201 | Ga0075433_10330066 | 3300006852 | Bacteria | 1349 |
| 202 | Ga0075434_100040568 | 3300006871 | Bacteria | 4609 |
| 203 | Ga0075429_100540583 | 3300006880 | Bacteria | 1021 |
| 204 | Ga0068865_100010490 | 3300006881 | Bacteria | 5767 |
| 205 | Ga0068865_100081146 | 3300006881 | Bacteria | 2328 |
| 206 | Ga0068865_100110799 | 3300006881 | Bacteria | 2025 |
| 207 | Ga0068865_100262803 | 3300006881 | Bacteria | 1367 |
| 208 | Ga0068865_100609256 | 3300006881 | Bacteria | 924 |
| 209 | Ga0075436_100542769 | 3300006914 | Bacteria | 853 |
| 210 | Ga0097620_100042475 | 3300006931 | Bacteria | 4567 |
| 211 | Ga0097620_100170743 | 3300006931 | Bacteria | 2255 |
| 212 | Ga0097620_101265541 | 3300006931 | Bacteria | 813 |
| 213 | Ga0075435_100029282 | 3300007076 | Bacteria | 4321 |
| 214 | Ga0075435_100670184 | 3300007076 | Bacteria | 901 |
| 215 | Ga0105251_10122080 | 3300009011 | Bacteria | 1183 |
| 216 | Ga0111539_10181236 | 3300009094 | Bacteria | 2460 |
| 217 | Ga0111539_11627068 | 3300009094 | Unclassified | 749 |
| 218 | Ga0105245_10045364 | 3300009098 | Bacteria | 3926 |
| 219 | Ga0105245_10429754 | 3300009098 | Bacteria | 1325 |
| 220 | Ga0105245_10447169 | 3300009098 | Bacteria | 1300 |
| 221 | Ga0105245_10750902 | 3300009098 | Bacteria | 1011 |
| 222 | Ga0105245_10952497 | 3300009098 | Bacteria | 901 |
| 223 | Ga0105247_10195155 | 3300009101 | Bacteria | 1357 |
| 224 | Ga0105247_10317636 | 3300009101 | Bacteria | 1086 |
| 225 | Ga0114129_10002142 | 3300009147 | Bacteria | 27213 |
| 226 | Ga0114129_10060554 | 3300009147 | Bacteria | 5293 |
| 227 | Ga0114129_10170159 | 3300009147 | Bacteria | 2971 |
| 228 | Ga0114129_10233938 | 3300009147 | Bacteria | 2474 |
| 229 | Ga0114129_10264916 | 3300009147 | Bacteria | 2301 |
| 230 | Ga0114129_10334996 | 3300009147 | Bacteria | 2008 |
| 231 | Ga0114129_10575091 | 3300009147 | Bacteria | 1463 |
| 232 | Ga0114129_10818138 | 3300009147 | Bacteria | 1187 |
| 233 | Ga0114129_10872494 | 3300009147 | Bacteria | 1142 |
| 234 | Ga0114129_11232738 | 3300009147 | Bacteria | 930 |
| 235 | Ga0114129_12111616 | 3300009147 | Bacteria | 679 |
| 236 | Ga0114129_12180386 | 3300009147 | Bacteria | 667 |
| 237 | Ga0105243_10006714 | 3300009148 | Bacteria | 8876 |
| 238 | Ga0105243_10013163 | 3300009148 | Bacteria | 6253 |
| 239 | Ga0105241_10202804 | 3300009174 | Bacteria | 1658 |
| 240 | Ga0105242_10007179 | 3300009176 | Bacteria | 8590 |
| 241 | Ga0105242_10035288 | 3300009176 | Bacteria | 4010 |
| 242 | Ga0105242_10043688 | 3300009176 | Bacteria | 3626 |
| 243 | Ga0105242_10229052 | 3300009176 | Bacteria | 1665 |
| 244 | Ga0105248_10003799 | 3300009177 | Bacteria | 16740 |
| 245 | Ga0105248_10037658 | 3300009177 | Bacteria | 5412 |
| 246 | Ga0105248_10082283 | 3300009177 | Bacteria | 3620 |
| 247 | Ga0105238_10049338 | 3300009551 | Bacteria | 4240 |
| 248 | Ga0105238_10153840 | 3300009551 | Bacteria | 2275 |
| 249 | Ga0105238_10192367 | 3300009551 | Bacteria | 2016 |
| 250 | Ga0105238_10286614 | 3300009551 | Bacteria | 1629 |
| 251 | Ga0105238_10702551 | 3300009551 | Bacteria | 1023 |
| 252 | Ga0105238_11113799 | 3300009551 | Bacteria | 812 |
| 253 | Ga0105238_11874059 | 3300009551 | Bacteria | 632 |
| 254 | Ga0105249_10029348 | 3300009553 | Bacteria | 4967 |
| 255 | Ga0105249_10346407 | 3300009553 | Bacteria | 1504 |
| 256 | Ga0105249_10855334 | 3300009553 | Bacteria | 975 |
| 257 | Ga0099796_10081000 | 3300010159 | Bacteria | 1190 |
| 258 | Ga0105239_10052554 | 3300010375 | Bacteria | 4468 |
| 259 | Ga0105246_10007131 | 3300011119 | Bacteria | 6843 |
| 260 | Ga0105246_10052516 | 3300011119 | Bacteria | 2802 |
| 261 | Ga0105246_10190640 | 3300011119 | Bacteria | 1586 |
| 262 | Ga0157344_1002768 | 3300012476 | Bacteria | 949 |
| 263 | Ga0157371_10181200 | 3300013102 | Bacteria | 1507 |
| 264 | Ga0157369_10296239 | 3300013105 | Bacteria | 1683 |
| 265 | Ga0157369_10342344 | 3300013105 | Bacteria | 1553 |
| 266 | Ga0157369_10914925 | 3300013105 | Bacteria | 899 |
| 267 | Ga0157374_10614616 | 3300013296 | Bacteria | 1097 |
| 268 | Ga0157378_10006283 | 3300013297 | Bacteria | 10405 |
| 269 | Ga0157378_10114578 | 3300013297 | Bacteria | 2476 |
| 270 | Ga0157378_11095949 | 3300013297 | Bacteria | 833 |
| 271 | Ga0163162_10283558 | 3300013306 | Bacteria | 1788 |
| 272 | Ga0163162_10852856 | 3300013306 | Bacteria | 1026 |
| 273 | Ga0163162_11757645 | 3300013306 | Bacteria | 709 |
| 274 | Ga0157372_10256292 | 3300013307 | Bacteria | 2031 |
| 275 | Ga0157375_10012047 | 3300013308 | Bacteria | 7657 |
| 276 | Ga0157375_10075795 | 3300013308 | Bacteria | 3389 |
| 277 | Ga0157375_10162242 | 3300013308 | Bacteria | 2378 |
| 278 | Ga0157375_10219546 | 3300013308 | Bacteria | 2059 |
| 279 | Ga0157375_10546234 | 3300013308 | Bacteria | 1321 |
| 280 | Ga0163163_10015258 | 3300014325 | Bacteria | 7099 |
| 281 | Ga0163163_10065378 | 3300014325 | Bacteria | 3610 |
| 282 | Ga0163163_10086411 | 3300014325 | Bacteria | 3146 |
| 283 | Ga0163163_10312446 | 3300014325 | Bacteria | 1625 |
| 284 | Ga0157380_10091196 | 3300014326 | Bacteria | 2515 |
| 285 | Ga0157380_10213134 | 3300014326 | Bacteria | 1723 |
| 286 | Ga0157380_10519424 | 3300014326 | Bacteria | 1161 |
| 287 | Ga0157380_10528303 | 3300014326 | Bacteria | 1152 |
| 288 | Ga0157380_10823826 | 3300014326 | Bacteria | 947 |
| 289 | Ga0157377_10015839 | 3300014745 | Bacteria | 3865 |
| 290 | Ga0157377_10122790 | 3300014745 | Bacteria | 1576 |
| 291 | Ga0157377_10568104 | 3300014745 | Bacteria | 804 |
| 292 | Ga0157379_10000747 | 3300014968 | Bacteria | 26266 |
| 293 | Ga0157379_10062646 | 3300014968 | Bacteria | 3326 |
| 294 | Ga0157379_10135803 | 3300014968 | Bacteria | 2216 |
| 295 | Ga0157379_10735669 | 3300014968 | Bacteria | 928 |
| 296 | Ga0157376_10071714 | 3300014969 | Bacteria | 2945 |
| 297 | Ga0163161_10158113 | 3300017792 | Bacteria | 1727 |
| 298 | Ga0206354_10031289 | 3300020081 | Bacteria | 1579 |
| 299 | Ga0206353_10857764 | 3300020082 | Bacteria | 3691 |
| 300 | Ga0154015_1043079 | 3300020610 | Bacteria | 694 |
| 301 | Ga0213876_10022268 | 3300021384 | Bacteria | 3352 |
| 302 | Ga0213875_10002214 | 3300021388 | Bacteria | 11832 |
| 303 | Ga0207656_10237159 | 3300025321 | Bacteria | 890 |
| 304 | Ga0207656_10340778 | 3300025321 | Bacteria | 747 |
| 305 | Ga0207713_1198414 | 3300025735 | Bacteria | 617 |
| 306 | Ga0207692_10321175 | 3300025898 | Bacteria | 947 |
| 307 | Ga0207642_10125015 | 3300025899 | Bacteria | 1333 |
| 308 | Ga0207642_10209501 | 3300025899 | Bacteria | 1082 |
| 309 | Ga0207642_10464204 | 3300025899 | Bacteria | 769 |
| 310 | Ga0207710_10041428 | 3300025900 | Bacteria | 2043 |
| 311 | Ga0207688_10004405 | 3300025901 | Bacteria | 7664 |
| 312 | Ga0207688_10008032 | 3300025901 | Bacteria | 5743 |
| 313 | Ga0207688_10013485 | 3300025901 | Bacteria | 4442 |
| 314 | Ga0207688_10174047 | 3300025901 | Bacteria | 1281 |
| 315 | Ga0207688_10298593 | 3300025901 | Bacteria | 984 |
| 316 | Ga0207688_10410484 | 3300025901 | Bacteria | 841 |
| 317 | Ga0207680_10239962 | 3300025903 | Bacteria | 1249 |
| 318 | Ga0207647_10123534 | 3300025904 | Bacteria | 1525 |
| 319 | Ga0207647_10342849 | 3300025904 | Bacteria | 847 |
| 320 | Ga0207699_10109545 | 3300025906 | Bacteria | 1767 |
| 321 | Ga0207699_10606765 | 3300025906 | Bacteria | 797 |
| 322 | Ga0207645_10123722 | 3300025907 | Bacteria | 1680 |
| 323 | Ga0207645_10159715 | 3300025907 | Bacteria | 1474 |
| 324 | Ga0207645_10264514 | 3300025907 | Bacteria | 1140 |
| 325 | Ga0207643_10038100 | 3300025908 | Bacteria | 2699 |
| 326 | Ga0207643_10492494 | 3300025908 | Bacteria | 783 |
| 327 | Ga0207643_10587022 | 3300025908 | Bacteria | 716 |
| 328 | Ga0207705_10074008 | 3300025909 | Bacteria | 2472 |
| 329 | Ga0207684_10143174 | 3300025910 | Bacteria | 2056 |
| 330 | Ga0207684_10212134 | 3300025910 | Bacteria | 1670 |
| 331 | Ga0207684_10378923 | 3300025910 | Bacteria | 1217 |
| 332 | Ga0207671_10108617 | 3300025914 | Bacteria | 2109 |
| 333 | Ga0207671_10306870 | 3300025914 | Bacteria | 1254 |
| 334 | Ga0207693_10001022 | 3300025915 | Bacteria | 25047 |
| 335 | Ga0207693_10026075 | 3300025915 | Bacteria | 4629 |
| 336 | Ga0207663_10062846 | 3300025916 | Bacteria | 2362 |
| 337 | Ga0207663_10115760 | 3300025916 | Bacteria | 1827 |
| 338 | Ga0207660_10061780 | 3300025917 | Bacteria | 2697 |
| 339 | Ga0207660_10268763 | 3300025917 | Bacteria | 1350 |
| 340 | Ga0207662_10005211 | 3300025918 | Bacteria | 6899 |
| 341 | Ga0207662_10125066 | 3300025918 | Bacteria | 1616 |
| 342 | Ga0207662_10569393 | 3300025918 | Bacteria | 786 |
| 343 | Ga0207657_10095336 | 3300025919 | Bacteria | 2476 |
| 344 | Ga0207657_10120433 | 3300025919 | Bacteria | 2159 |
| 345 | Ga0207649_10606631 | 3300025920 | Bacteria | 842 |
| 346 | Ga0207652_10114992 | 3300025921 | Bacteria | 2390 |
| 347 | Ga0207646_10055386 | 3300025922 | Bacteria | 3545 |
| 348 | Ga0207646_10128027 | 3300025922 | Bacteria | 2284 |
| 349 | Ga0207646_10159032 | 3300025922 | Bacteria | 2038 |
| 350 | Ga0207646_10880644 | 3300025922 | Bacteria | 795 |
| 351 | Ga0207681_10241914 | 3300025923 | Bacteria | 1405 |
| 352 | Ga0207694_10359993 | 3300025924 | Bacteria | 1205 |
| 353 | Ga0207694_10463887 | 3300025924 | Bacteria | 1058 |
| 354 | Ga0207694_10552909 | 3300025924 | Bacteria | 966 |
| 355 | Ga0207659_10155385 | 3300025926 | Bacteria | 1790 |
| 356 | Ga0207659_10754098 | 3300025926 | Bacteria | 835 |
| 357 | Ga0207687_10012505 | 3300025927 | Bacteria | 5545 |
| 358 | Ga0207687_10155106 | 3300025927 | Bacteria | 1751 |
| 359 | Ga0207687_10168128 | 3300025927 | Bacteria | 1689 |
| 360 | Ga0207687_10184684 | 3300025927 | Bacteria | 1618 |
| 361 | Ga0207687_10203230 | 3300025927 | Bacteria | 1550 |
| 362 | Ga0207687_10324153 | 3300025927 | Bacteria | 1248 |
| 363 | Ga0207700_10126144 | 3300025928 | Bacteria | 2083 |
| 364 | Ga0207664_10023494 | 3300025929 | Bacteria | 4621 |
| 365 | Ga0207664_10149292 | 3300025929 | Bacteria | 1984 |
| 366 | Ga0207664_10568105 | 3300025929 | Bacteria | 1018 |
| 367 | Ga0207644_10000893 | 3300025931 | Bacteria | 18858 |
| 368 | Ga0207644_10065801 | 3300025931 | Bacteria | 2637 |
| 369 | Ga0207644_10263420 | 3300025931 | Bacteria | 1379 |
| 370 | Ga0207690_10339507 | 3300025932 | Bacteria | 1185 |
| 371 | Ga0207690_10364502 | 3300025932 | Bacteria | 1145 |
| 372 | Ga0207706_10079155 | 3300025933 | Bacteria | 2891 |
| 373 | Ga0207706_10195946 | 3300025933 | Bacteria | 1772 |
| 374 | Ga0207686_10006485 | 3300025934 | Bacteria | 6300 |
| 375 | Ga0207686_10139775 | 3300025934 | Bacteria | 1672 |
| 376 | Ga0207686_10712271 | 3300025934 | Bacteria | 799 |
| 377 | Ga0207709_10015943 | 3300025935 | Bacteria | 4170 |
| 378 | Ga0207709_10164242 | 3300025935 | Bacteria | 1552 |
| 379 | Ga0207670_10438466 | 3300025936 | Bacteria | 1051 |
| 380 | Ga0207669_10014636 | 3300025937 | Bacteria | 3937 |
| 381 | Ga0207669_10018292 | 3300025937 | Bacteria | 3619 |
| 382 | Ga0207669_10218932 | 3300025937 | Bacteria | 1396 |
| 383 | Ga0207669_10279807 | 3300025937 | Bacteria | 1258 |
| 384 | Ga0207704_10028464 | 3300025938 | Bacteria | 3101 |
| 385 | Ga0207704_10076020 | 3300025938 | Bacteria | 2150 |
| 386 | Ga0207704_10197135 | 3300025938 | Bacteria | 1470 |
| 387 | Ga0207665_10035972 | 3300025939 | Bacteria | 3290 |
| 388 | Ga0207665_10050178 | 3300025939 | Bacteria | 2805 |
| 389 | Ga0207691_10092961 | 3300025940 | Bacteria | 2701 |
| 390 | Ga0207691_10144709 | 3300025940 | Bacteria | 2093 |
| 391 | Ga0207691_10386720 | 3300025940 | Bacteria | 1194 |
| 392 | Ga0207691_10618024 | 3300025940 | Bacteria | 917 |
| 393 | Ga0207711_10000355 | 3300025941 | Bacteria | 48706 |
| 394 | Ga0207711_10592496 | 3300025941 | Bacteria | 1034 |
| 395 | Ga0207689_10042665 | 3300025942 | Bacteria | 3750 |
| 396 | Ga0207689_10056340 | 3300025942 | Bacteria | 3234 |
| 397 | Ga0207689_10086688 | 3300025942 | Bacteria | 2573 |
| 398 | Ga0207689_10533115 | 3300025942 | Bacteria | 985 |
| 399 | Ga0207661_10218049 | 3300025944 | Bacteria | 1685 |
| 400 | Ga0207679_10187835 | 3300025945 | Bacteria | 1715 |
| 401 | Ga0207679_10498686 | 3300025945 | Bacteria | 1086 |
| 402 | Ga0207651_10161278 | 3300025960 | Bacteria | 1758 |
| 403 | Ga0207712_10145042 | 3300025961 | Bacteria | 1827 |
| 404 | Ga0207712_10757548 | 3300025961 | Bacteria | 851 |
| 405 | Ga0207712_10972949 | 3300025961 | Bacteria | 752 |
| 406 | Ga0207668_10043874 | 3300025972 | Bacteria | 3038 |
| 407 | Ga0207668_10674354 | 3300025972 | Bacteria | 907 |
| 408 | Ga0207640_10066893 | 3300025981 | Bacteria | 2402 |
| 409 | Ga0207640_10279656 | 3300025981 | Bacteria | 1310 |
| 410 | Ga0207640_10782437 | 3300025981 | Bacteria | 825 |
| 411 | Ga0207658_10369128 | 3300025986 | Bacteria | 1254 |
| 412 | Ga0207677_10122020 | 3300026023 | Bacteria | 1962 |
| 413 | Ga0207677_10653891 | 3300026023 | Bacteria | 928 |
| 414 | Ga0207677_10945014 | 3300026023 | Bacteria | 779 |
| 415 | Ga0207703_10000007 | 3300026035 | Bacteria | 418220 |
| 416 | Ga0207703_10133238 | 3300026035 | Bacteria | 2148 |
| 417 | Ga0207703_10458030 | 3300026035 | Bacteria | 1192 |
| 418 | Ga0207639_10629565 | 3300026041 | Bacteria | 991 |
| 419 | Ga0207678_10090823 | 3300026067 | Bacteria | 2610 |
| 420 | Ga0207678_10108053 | 3300026067 | Bacteria | 2373 |
| 421 | Ga0207678_10322281 | 3300026067 | Bacteria | 1330 |
| 422 | Ga0207678_10355524 | 3300026067 | Bacteria | 1264 |
| 423 | Ga0207678_10628102 | 3300026067 | Bacteria | 943 |
| 424 | Ga0207708_10006895 | 3300026075 | Bacteria | 8405 |
| 425 | Ga0207708_10035980 | 3300026075 | Bacteria | 3767 |
| 426 | Ga0207708_10051363 | 3300026075 | Bacteria | 3138 |
| 427 | Ga0207708_10894284 | 3300026075 | Bacteria | 768 |
| 428 | Ga0207702_10604439 | 3300026078 | Bacteria | 1076 |
| 429 | Ga0207641_10087457 | 3300026088 | Bacteria | 2719 |
| 430 | Ga0207641_10105793 | 3300026088 | Bacteria | 2486 |
| 431 | Ga0207641_10148745 | 3300026088 | Bacteria | 2120 |
| 432 | Ga0207641_10309725 | 3300026088 | Bacteria | 1494 |
| 433 | Ga0207641_10335787 | 3300026088 | Bacteria | 1437 |
| 434 | Ga0207648_10005074 | 3300026089 | Bacteria | 13348 |
| 435 | Ga0207648_10013201 | 3300026089 | Bacteria | 7697 |
| 436 | Ga0207648_10073304 | 3300026089 | Bacteria | 2984 |
| 437 | Ga0207648_10089067 | 3300026089 | Bacteria | 2695 |
| 438 | Ga0207648_10111292 | 3300026089 | Bacteria | 2404 |
| 439 | Ga0207676_10590754 | 3300026095 | Bacteria | 1065 |
| 440 | Ga0207676_10771600 | 3300026095 | Bacteria | 936 |
| 441 | Ga0207674_10070523 | 3300026116 | Bacteria | 3514 |
| 442 | Ga0207674_10756866 | 3300026116 | Bacteria | 938 |
| 443 | Ga0207674_10865679 | 3300026116 | Bacteria | 871 |
| 444 | Ga0207675_100011101 | 3300026118 | Bacteria | 8439 |
| 445 | Ga0207675_100027801 | 3300026118 | Bacteria | 5269 |
| 446 | Ga0207683_10005936 | 3300026121 | Bacteria | 10467 |
| 447 | Ga0207683_10017236 | 3300026121 | Bacteria | 6151 |
| 448 | Ga0207683_10024495 | 3300026121 | Bacteria | 5199 |
| 449 | Ga0207683_10050942 | 3300026121 | Bacteria | 3627 |
| 450 | Ga0207698_10023042 | 3300026142 | Bacteria | 4343 |
| 451 | Ga0207698_10061607 | 3300026142 | Bacteria | 2925 |
| 452 | Ga0207698_10147558 | 3300026142 | Bacteria | 2036 |
| 453 | Ga0209974_10172217 | 3300027876 | Unclassified | 790 |
| 454 | Ga0207428_10009205 | 3300027907 | Bacteria | 8872 |
| 455 | Ga0268266_10152452 | 3300028379 | Bacteria | 2084 |
| 456 | Ga0268266_10178355 | 3300028379 | Bacteria | 1933 |
| 457 | Ga0268266_10368575 | 3300028379 | Bacteria | 1352 |
| 458 | Ga0268266_10532863 | 3300028379 | Bacteria | 1124 |
| 459 | Ga0268266_10667145 | 3300028379 | Bacteria | 1001 |
| 460 | Ga0268265_10127833 | 3300028380 | Bacteria | 2106 |
| 461 | Ga0268264_10074958 | 3300028381 | Bacteria | 2876 |
| 462 | Ga0268264_10377237 | 3300028381 | Bacteria | 1357 |
| 463 | Ga0268264_10661922 | 3300028381 | Bacteria | 1034 |
| 464 | Ga0265322_10024482 | 3300028654 | Bacteria | 1727 |
| 465 | Ga0307517_10153010 | 3300028786 | Bacteria | 1576 |
| 466 | Ga0307515_10205378 | 3300028794 | Bacteria | 1832 |
| 467 | Ga0307511_10003508 | 3300030521 | Bacteria | 16123 |
| 468 | Ga0307512_10042450 | 3300030522 | Bacteria | 3765 |
| 469 | Ga0265327_10136653 | 3300031251 | Bacteria | 1149 |
| 470 | Ga0307513_10010554 | 3300031456 | Bacteria | 11563 |
| 471 | Ga0307513_10237393 | 3300031456 | Bacteria | 1631 |
| 472 | Ga0307408_100995673 | 3300031548 | Bacteria | 772 |
| 473 | Ga0265342_10140282 | 3300031712 | Bacteria | 1349 |
| 474 | Ga0316576_10002704 | 3300031727 | Bacteria | 10143 |
| 475 | Ga0316578_10110110 | 3300031728 | Bacteria | 1654 |
| 476 | Ga0307405_10041987 | 3300031731 | Bacteria | 2781 |
| 477 | Ga0307413_10086147 | 3300031824 | Bacteria | 2030 |
| 478 | Ga0307413_10151778 | 3300031824 | Bacteria | 1615 |
| 479 | Ga0307413_10298867 | 3300031824 | Bacteria | 1220 |
| 480 | Ga0307410_10329948 | 3300031852 | Bacteria | 1213 |
| 481 | Ga0307410_10363292 | 3300031852 | Bacteria | 1160 |
| 482 | Ga0307410_10422827 | 3300031852 | Bacteria | 1081 |
| 483 | Ga0307410_10496504 | 3300031852 | Bacteria | 1003 |
| 484 | Ga0307410_11190230 | 3300031852 | Bacteria | 663 |
| 485 | Ga0326468_10006296 | 3300031889 | Bacteria | 1095 |
| 486 | Ga0307406_10044774 | 3300031901 | Bacteria | 2774 |
| 487 | Ga0307406_10657683 | 3300031901 | Bacteria | 870 |
| 488 | Ga0307407_10101946 | 3300031903 | Bacteria | 1784 |
| 489 | Ga0307407_10141912 | 3300031903 | Bacteria | 1550 |
| 490 | Ga0307407_10154407 | 3300031903 | Bacteria | 1495 |
| 491 | Ga0307407_10494867 | 3300031903 | Bacteria | 895 |
| 492 | Ga0307412_10207956 | 3300031911 | Bacteria | 1491 |
| 493 | Ga0307409_100076025 | 3300031995 | Bacteria | 2691 |
| 494 | Ga0307409_100151639 | 3300031995 | Bacteria | 2013 |
| 495 | Ga0307409_100191407 | 3300031995 | Bacteria | 1821 |
| 496 | Ga0307409_100292871 | 3300031995 | Bacteria | 1510 |
| 497 | Ga0307409_100325820 | 3300031995 | Bacteria | 1439 |
| 498 | Ga0307409_100603375 | 3300031995 | Bacteria | 1085 |
| 499 | Ga0307416_100044898 | 3300032002 | Bacteria | 3474 |
| 500 | Ga0307416_100064661 | 3300032002 | Bacteria | 3002 |
| 501 | Ga0307416_100068464 | 3300032002 | Bacteria | 2933 |
| 502 | Ga0307416_100326358 | 3300032002 | Bacteria | 1540 |
| 503 | Ga0307416_100485598 | 3300032002 | Bacteria | 1296 |
| 504 | Ga0307416_100641630 | 3300032002 | Bacteria | 1146 |
| 505 | Ga0307416_100824475 | 3300032002 | Bacteria | 1024 |
| 506 | Ga0307416_101094146 | 3300032002 | Bacteria | 901 |
| 507 | Ga0307416_101146767 | 3300032002 | Bacteria | 882 |
| 508 | Ga0307414_10113632 | 3300032004 | Bacteria | 2067 |
| 509 | Ga0307414_10173687 | 3300032004 | Bacteria | 1726 |
| 510 | Ga0307414_10237248 | 3300032004 | Bacteria | 1507 |
| 511 | Ga0307414_10352544 | 3300032004 | Bacteria | 1264 |
| 512 | Ga0307411_10098203 | 3300032005 | Bacteria | 2063 |
| 513 | Ga0307411_10287024 | 3300032005 | Bacteria | 1313 |
| 514 | Ga0307411_10833293 | 3300032005 | Bacteria | 815 |
| 515 | Ga0307415_100130228 | 3300032126 | Bacteria | 1903 |
| 516 | Ga0307415_100152283 | 3300032126 | Bacteria | 1781 |
| 517 | Ga0307415_100284489 | 3300032126 | Bacteria | 1361 |
| 518 | Ga0307415_100301997 | 3300032126 | Bacteria | 1326 |
| 519 | Ga0307415_100920495 | 3300032126 | Bacteria | 807 |
| 520 | Ga0373926_0001444 | 3300035083 | Bacteria | 7237 |
| 521 | Ga0373944_0000040 | 3300035089 | Bacteria | 21506 |
| 522 | Ga0373923_0036897 | 3300035111 | Bacteria | 1997 |
| 523 | Ga0373936_0000099 | 3300035113 | Bacteria | 31337 |
| 524 | Ga0373936_0191180 | 3300035113 | Bacteria | 901 |
| 525 | Ga0373945_0001163 | 3300035116 | Bacteria | 7985 |
| 526 | Ga0373953_0023798 | 3300035117 | Bacteria | 2322 |
| 527 | Ga0373956_0115642 | 3300035119 | Bacteria | 1251 |
| 528 | Ga0373943_0006625 | 3300035170 | Bacteria | 5192 |
| 529 | Ga0373946_0000479 | 3300035171 | Bacteria | 13216 |
| 530 | Ga0373955_0170935 | 3300035172 | Bacteria | 1286 |
| 531 | Ga0373961_0135790 | 3300035241 | Bacteria | 827 |
| 532 | Ga0316574_0032238 | 3300035398 | Bacteria | 3183 |
| 533 | Ga0316574_0063993 | 3300035398 | Bacteria | 2314 |
| 534 | Ga0373924_0003505 | 3300035410 | Bacteria | 5406 |
| 535 | Ga0373931_0012989 | 3300035691 | Bacteria | 4045 |
| 536 | Ga0373931_0029579 | 3300035691 | Bacteria | 2814 |
| 537 | Ga0373935_0000216 | 3300035692 | Bacteria | 27725 |
| 538 | Ga0373927_0013647 | 3300035695 | Bacteria | 5394 |
| 539 | Ga0373933_0049820 | 3300035724 | Bacteria | 2498 |
| 540 | Ga0373947_0000710 | 3300035725 | Bacteria | 19822 |
| 541 | Ga0373947_0399954 | 3300035725 | Bacteria | 926 |
| 542 | Ga0373937_0081083 | 3300036401 | Bacteria | 3001 |
| 543 | Ga0373937_0288133 | 3300036401 | Bacteria | 1551 |
| 544 | Ga0373937_1041924 | 3300036401 | Bacteria | 767 |
| 545 | Ga0373937_1129707 | 3300036401 | Bacteria | 732 |
| 546 | Ga0373925_0016392 | 3300037068 | Bacteria | 5367 |
| 547 | Ga0395899_0502492 | 3300037312 | Bacteria | 786 |
| 548 | Ga0395900_0072237 | 3300037418 | Bacteria | 3548 |
| 549 | Ga0395900_0191300 | 3300037418 | Bacteria | 2075 |
| 550 | Ga0395898_0025468 | 3300037466 | Bacteria | 5961 |
| 551 | Ga0395898_0378987 | 3300037466 | Bacteria | 1349 |
| 552 | Ga0436364_0207977 | 3300037853 | Bacteria | 46460 |
| 553 | Ga0436364_0661798 | 3300037853 | Bacteria | 86818 |
| 554 | Ga0395901_0124443 | 3300038443 | Bacteria | 2709 |
| 555 | Ga0395901_0211773 | 3300038443 | Bacteria | 2028 |
| 556 | Ga0400483_039556 | 3300039062 | Bacteria | 10415 |
| 557 | Ga0436365_0453742 | 3300039437 | Bacteria | 5307 |
| 558 | Ga0436365_0999081 | 3300039437 | Bacteria | 1652 |
| 559 | Ga0436365_1097230 | 3300039437 | Bacteria | 3373 |
| 560 | Ga0436365_1701092 | 3300039437 | Bacteria | 4818 |
| 561 | Ga0436362_0380707 | 3300039453 | Bacteria | 30204 |
| 562 | Ga0439466_0052417 | 3300041411 | Bacteria | 1334 |
| 563 | Ga0439431_0041032 | 3300041997 | Bacteria | 1179 |
| 564 | Ga0451577_0000011 | 3300042876 | Bacteria | 597389 |
| 565 | Ga0451577_0101171 | 3300042876 | Bacteria | 2575 |
| 566 | Ga0451577_0198491 | 3300042876 | Bacteria | 1811 |
| 567 | Ga0451577_0299264 | 3300042876 | Bacteria | 1458 |
| 568 | Ga0439440_0094905 | 3300042993 | Bacteria | 805 |
| 569 | Ga0466969_0016772 | 3300044656 | Bacteria | 3829 |
| 570 | Ga0466972_0058612 | 3300044658 | Bacteria | 1848 |
| 571 | Ga0466972_0212377 | 3300044658 | Bacteria | 906 |
| 572 | Ga0466972_0233306 | 3300044658 | Bacteria | 861 |
| 573 | Ga0453683_0000024 | 3300044673 | Bacteria | 263554 |
| 574 | Ga0453683_0000802 | 3300044673 | Bacteria | 30766 |
| 575 | Ga0453683_0178759 | 3300044673 | Bacteria | 1345 |
| 576 | Ga0466965_0074512 | 3300044683 | Bacteria | 1710 |
| 577 | Ga0466965_0186178 | 3300044683 | Bacteria | 1097 |
| 578 | Ga0466966_0000310 | 3300044684 | Bacteria | 31446 |
| 579 | Ga0466966_0045170 | 3300044684 | Bacteria | 2817 |
| 580 | Ga0466966_0074908 | 3300044684 | Bacteria | 2115 |
| 581 | Ga0466961_0005736 | 3300044693 | Bacteria | 7855 |
| 582 | Ga0466961_0039169 | 3300044693 | Bacteria | 3039 |
| 583 | Ga0466961_0041927 | 3300044693 | Bacteria | 2934 |
| 584 | Ga0466961_0078215 | 3300044693 | Bacteria | 2095 |
| 585 | Ga0466961_0179060 | 3300044693 | Bacteria | 1317 |
| 586 | Ga0466961_0314599 | 3300044693 | Bacteria | 955 |
| 587 | Ga0466961_0314693 | 3300044693 | Bacteria | 955 |
| 588 | Ga0466961_0509884 | 3300044693 | Bacteria | 726 |
| 589 | Ga0466963_0054699 | 3300044694 | Bacteria | 2653 |
| 590 | Ga0466963_0093919 | 3300044694 | Bacteria | 2045 |
| 591 | Ga0466964_0333871 | 3300044706 | Bacteria | 774 |
| 592 | Ga0466964_0379168 | 3300044706 | Bacteria | 734 |
| 593 | Ga0453684_0000087 | 3300044712 | Bacteria | 395597 |
| 594 | Ga0453684_0003702 | 3300044712 | Bacteria | 33878 |
| 595 | Ga0453684_0007361 | 3300044712 | Bacteria | 20308 |
| 596 | Ga0453684_0037887 | 3300044712 | Bacteria | 6609 |
| 597 | Ga0453684_0142853 | 3300044712 | Bacteria | 2855 |
| 598 | Ga0453684_0304850 | 3300044712 | Bacteria | 1809 |
| 599 | Ga0453684_0945354 | 3300044712 | Bacteria | 920 |
| 600 | Ga0466971_0005194 | 3300044719 | Bacteria | 5636 |
| 601 | Ga0466971_0024329 | 3300044719 | Bacteria | 2702 |
| 602 | Ga0466971_0104882 | 3300044719 | Bacteria | 1301 |
| 603 | Ga0466968_0000525 | 3300044735 | Bacteria | 13009 |
| 604 | Ga0466968_0180225 | 3300044735 | Bacteria | 982 |
| 605 | Ga0466970_0009971 | 3300044765 | Bacteria | 4811 |
| 606 | Ga0466970_0055005 | 3300044765 | Bacteria | 2125 |
| 607 | Ga0466970_0095122 | 3300044765 | Bacteria | 1619 |
| 608 | Ga0466970_0098601 | 3300044765 | Bacteria | 1590 |
| 609 | Ga0466970_0291487 | 3300044765 | Bacteria | 919 |
| 610 | Ga0466957_0016044 | 3300044842 | Bacteria | 4379 |
| 611 | Ga0466957_0129676 | 3300044842 | Bacteria | 1614 |
| 612 | Ga0466957_0138454 | 3300044842 | Bacteria | 1566 |
| 613 | Ga0466957_0152271 | 3300044842 | Bacteria | 1496 |
| 614 | Ga0466957_0166690 | 3300044842 | Bacteria | 1433 |
| 615 | Ga0466957_0496663 | 3300044842 | Bacteria | 845 |
| 616 | Ga0466957_1003280 | 3300044842 | Bacteria | 600 |
| 617 | Ga0466960_0000156 | 3300044901 | Bacteria | 23100 |
| 618 | Ga0466960_0038232 | 3300044901 | Bacteria | 2255 |
| 619 | Ga0466960_0107309 | 3300044901 | Bacteria | 1446 |
| 620 | Ga0466960_0126270 | 3300044901 | Bacteria | 1345 |
| 621 | Ga0466959_0011879 | 3300045049 | Bacteria | 6272 |
| 622 | Ga0466959_0030589 | 3300045049 | Bacteria | 3987 |
| 623 | Ga0466959_0067923 | 3300045049 | Bacteria | 2583 |
| 624 | Ga0466959_0370468 | 3300045049 | Bacteria | 975 |
| 625 | Ga0466959_0453333 | 3300045049 | Bacteria | 869 |
| 626 | Ga0466959_0466303 | 3300045049 | Bacteria | 855 |
| 627 | Ga0451576_0002579 | 3300045051 | Bacteria | 26664 |
| 628 | Ga0451576_0047433 | 3300045051 | Bacteria | 4517 |
| 629 | Ga0451576_0762313 | 3300045051 | Unclassified | 1016 |
| 630 | Ga0466958_0000800 | 3300045836 | Bacteria | 13882 |
| 631 | Ga0466958_0090518 | 3300045836 | Bacteria | 1893 |
| 632 | Ga0466958_0111451 | 3300045836 | Bacteria | 1708 |
| 633 | Ga0466958_0233558 | 3300045836 | Bacteria | 1174 |
| 634 | Ga0466958_0250701 | 3300045836 | Bacteria | 1132 |
| 635 | Ga0466958_0336281 | 3300045836 | Bacteria | 971 |
| 636 | Ga0466958_0409002 | 3300045836 | Bacteria | 876 |
| 637 | Ga0466958_0430493 | 3300045836 | Bacteria | 853 |
| 638 | Ga0466958_0635988 | 3300045836 | Bacteria | 694 |
| 639 | Ga0466958_0695541 | 3300045836 | Bacteria | 662 |
| 640 | Ga0466967_0010347 | 3300045976 | Bacteria | 6992 |
| 641 | Ga0466967_0010732 | 3300045976 | Bacteria | 6887 |
| 642 | Ga0466967_0058287 | 3300045976 | Bacteria | 3413 |
| 643 | Ga0466967_0114985 | 3300045976 | Bacteria | 2477 |
| 644 | Ga0466967_0149625 | 3300045976 | Bacteria | 2181 |
| 645 | Ga0466967_0151240 | 3300045976 | Bacteria | 2169 |
| 646 | Ga0466967_0202071 | 3300045976 | Bacteria | 1883 |
| 647 | Ga0466967_0216216 | 3300045976 | Bacteria | 1819 |
| 648 | Ga0466967_0268082 | 3300045976 | Bacteria | 1635 |
| 649 | Ga0466967_0411042 | 3300045976 | Bacteria | 1318 |
| 650 | Ga0466967_0515986 | 3300045976 | Bacteria | 1174 |
| 651 | Ga0466967_0625435 | 3300045976 | Bacteria | 1063 |
| 652 | Ga0466967_0838471 | 3300045976 | Bacteria | 913 |
| 653 | Ga0466967_0964870 | 3300045976 | Bacteria | 848 |
| 654 | Ga0466967_1484649 | 3300045976 | Bacteria | 675 |
| 655 | Ga0495592_0011127 | 3300046454 | Bacteria | 6795 |
| 656 | Ga0495592_0104861 | 3300046454 | Bacteria | 2009 |
| 657 | Ga0495603_0001320 | 3300046455 | Bacteria | 14379 |
| 658 | Ga0495603_0008054 | 3300046455 | Bacteria | 6368 |
| 659 | Ga0495591_052977 | 3300046458 | Bacteria | 1102 |
| 660 | Ga0495629_0000652 | 3300046459 | Bacteria | 28021 |
| 661 | Ga0495641_0000703 | 3300046461 | Bacteria | 28342 |
| 662 | Ga0495641_0006618 | 3300046461 | Bacteria | 7462 |
| 663 | Ga0495651_0000079 | 3300046462 | Bacteria | 71581 |
| 664 | Ga0495651_0028764 | 3300046462 | Bacteria | 4331 |
| 665 | Ga0495653_0133671 | 3300046463 | Bacteria | 1752 |
| 666 | Ga0495653_0302284 | 3300046463 | Bacteria | 1043 |
| 667 | Ga0495582_0013092 | 3300046473 | Bacteria | 4567 |
| 668 | Ga0495582_0169731 | 3300046473 | Bacteria | 1242 |
| 669 | Ga0495605_0032201 | 3300046474 | Bacteria | 2671 |
| 670 | Ga0495639_0000408 | 3300046475 | Bacteria | 20445 |
| 671 | Ga0495662_0006922 | 3300046476 | Bacteria | 5632 |
| 672 | Ga0495664_0097664 | 3300046477 | Bacteria | 1768 |
| 673 | Ga0495584_0032815 | 3300046491 | Bacteria | 2627 |
| 674 | Ga0495585_0105679 | 3300046492 | Bacteria | 1501 |
| 675 | Ga0495594_0044943 | 3300046499 | Bacteria | 2424 |
| 676 | Ga0495594_0105482 | 3300046499 | Bacteria | 1587 |
| 677 | Ga0495596_0214653 | 3300046500 | Bacteria | 747 |
| 678 | Ga0495608_0009712 | 3300046511 | Bacteria | 6715 |
| 679 | Ga0495616_0303077 | 3300046513 | Bacteria | 674 |
| 680 | Ga0495618_0019442 | 3300046514 | Bacteria | 4179 |
| 681 | Ga0495618_0168039 | 3300046514 | Bacteria | 1396 |
| 682 | Ga0495618_0589550 | 3300046514 | Bacteria | 662 |
| 683 | Ga0495620_0284165 | 3300046515 | Bacteria | 629 |
| 684 | Ga0495628_0046644 | 3300046516 | Bacteria | 3441 |
| 685 | Ga0495630_0007948 | 3300046517 | Bacteria | 7611 |
| 686 | Ga0495630_0470840 | 3300046517 | Bacteria | 963 |
| 687 | Ga0495637_0048957 | 3300046520 | Bacteria | 1778 |
| 688 | Ga0495644_0002314 | 3300046523 | Bacteria | 7623 |
| 689 | Ga0495644_0107997 | 3300046523 | Bacteria | 1055 |
| 690 | Ga0495663_0084347 | 3300046525 | Bacteria | 1027 |
| 691 | Ga0495666_0000781 | 3300046526 | Bacteria | 14720 |
| 692 | Ga0495642_0166033 | 3300046528 | Bacteria | 958 |
| 693 | Ga0495652_0014199 | 3300046529 | Bacteria | 7154 |
| 694 | Ga0495652_0087582 | 3300046529 | Bacteria | 2554 |
| 695 | Ga0495665_0000516 | 3300046531 | Bacteria | 19552 |
| 696 | Ga0495640_0015955 | 3300046533 | Bacteria | 5636 |
| 697 | Ga0495640_0030512 | 3300046533 | Bacteria | 3858 |
| 698 | Ga0495586_0004434 | 3300046535 | Bacteria | 7498 |
| 699 | Ga0495586_0039827 | 3300046535 | Bacteria | 2527 |
| 700 | Ga0495586_0657703 | 3300046535 | Bacteria | 605 |
| 701 | Ga0495587_0013791 | 3300046536 | Bacteria | 5079 |
| 702 | Ga0495598_0000360 | 3300046537 | Bacteria | 8161 |
| 703 | Ga0495598_0054149 | 3300046537 | Bacteria | 1217 |
| 704 | Ga0495609_0042331 | 3300046538 | Bacteria | 2045 |
| 705 | Ga0495645_0014632 | 3300046543 | Bacteria | 5569 |
| 706 | Ga0495645_0445209 | 3300046543 | Bacteria | 818 |
| 707 | Ga0495633_0140484 | 3300046558 | Bacteria | 1117 |
| 708 | Ga0495667_0043633 | 3300046559 | Bacteria | 2971 |
| 709 | Ga0495667_0055694 | 3300046559 | Bacteria | 2600 |
| 710 | Ga0495667_0374235 | 3300046559 | Bacteria | 899 |
| 711 | Ga0495656_0000659 | 3300046615 | Bacteria | 11037 |
| 712 | Ga0495656_0035906 | 3300046615 | Bacteria | 2039 |
| 713 | Ga0495668_0101751 | 3300046616 | Bacteria | 1572 |
| 714 | Ga0495668_0298502 | 3300046616 | Bacteria | 883 |
| 715 | Ga0495634_0000699 | 3300046642 | Bacteria | 32576 |
| 716 | Ga0495634_0053466 | 3300046642 | Bacteria | 2705 |
| 717 | Ga0495634_0277235 | 3300046642 | Bacteria | 1019 |
| 718 | Ga0495635_0006319 | 3300046663 | Bacteria | 8256 |
| 719 | Ga0495635_0006541 | 3300046663 | Bacteria | 8133 |
| 720 | Ga0495635_0012916 | 3300046663 | Bacteria | 5847 |
| 721 | Ga0495659_0008450 | 3300046664 | Bacteria | 3277 |
| 722 | Ga0495661_0031524 | 3300046665 | Bacteria | 3362 |
| 723 | Ga0495588_0000837 | 3300046674 | Bacteria | 13641 |
| 724 | Ga0495657_0068610 | 3300046675 | Bacteria | 2322 |
| 725 | Ga0495599_0080327 | 3300046678 | Bacteria | 2036 |
| 726 | Ga0495623_0094873 | 3300046679 | Bacteria | 1824 |
| 727 | Ga0495646_0003687 | 3300046680 | Bacteria | 9559 |
| 728 | Ga0495646_0050105 | 3300046680 | Bacteria | 2532 |
| 729 | Ga0495647_0000056 | 3300046681 | Bacteria | 28117 |
| 730 | Ga0495658_0000118 | 3300046683 | Bacteria | 42690 |
| 731 | Ga0495613_0003794 | 3300046689 | Bacteria | 11328 |
| 732 | Ga0495613_0084003 | 3300046689 | Bacteria | 2312 |
| 733 | Ga0495613_0358218 | 3300046689 | Bacteria | 1001 |
| 734 | Ga0495624_0000683 | 3300046690 | Bacteria | 26555 |
| 735 | Ga0495671_0120572 | 3300046692 | Bacteria | 1280 |
| 736 | Ga0495589_0028936 | 3300046794 | Bacteria | 2794 |
| 737 | Ga0495600_0008499 | 3300046809 | Bacteria | 6309 |
| 738 | Ga0495600_0133071 | 3300046809 | Bacteria | 1616 |
| 739 | Ga0495581_0002405 | 3300047315 | Bacteria | 10577 |
| 740 | Ga0495581_0121710 | 3300047315 | Bacteria | 1519 |
| 741 | Ga0495636_0020791 | 3300047318 | Bacteria | 2646 |
| 742 | Ga0495674_0007525 | 3300047319 | Bacteria | 10401 |
| 743 | Ga0495674_0030199 | 3300047319 | Bacteria | 4930 |
| 744 | Ga0495674_0526698 | 3300047319 | Bacteria | 943 |
| 745 | Ga0495676_0027302 | 3300047321 | Bacteria | 4896 |
| 746 | Ga0495676_0442008 | 3300047321 | Bacteria | 859 |
| 747 | Ga0495680_0000698 | 3300047322 | Bacteria | 37653 |
| 748 | Ga0495680_0006170 | 3300047322 | Bacteria | 11179 |
| 749 | Ga0495683_0305116 | 3300047323 | Bacteria | 683 |
| 750 | Ga0495675_0126191 | 3300047444 | Bacteria | 1592 |
| 751 | Ga0495677_0041073 | 3300047445 | Bacteria | 1692 |
| 752 | Ga0495684_0061019 | 3300047471 | Bacteria | 2869 |
| 753 | Ga0495593_0015952 | 3300047673 | Bacteria | 4242 |
| 754 | Ga0495602_0115413 | 3300048088 | Bacteria | 2172 |
| 755 | Ga0495614_0012341 | 3300048089 | Bacteria | 3749 |
| 756 | Ga0495615_0029386 | 3300048090 | Bacteria | 1304 |
| 757 | Ga0495615_0042775 | 3300048090 | Bacteria | 1137 |
| 758 | Ga0496100_0032892 | 3300048903 | Bacteria | 3239 |
| 759 | Ga0496100_0471235 | 3300048903 | Bacteria | 965 |
| 760 | Ga0496101_0061737 | 3300048904 | Bacteria | 2722 |
| 761 | Ga0496101_0239022 | 3300048904 | Bacteria | 1413 |
| 762 | Ga0496102_0002120 | 3300048905 | Bacteria | 17065 |
| 763 | Ga0496102_0146583 | 3300048905 | Bacteria | 2216 |
| 764 | Ga0496102_0815496 | 3300048905 | Bacteria | 855 |
| 765 | Ga0496102_1122213 | 3300048905 | Bacteria | 706 |
| 766 | Ga0496102_1588567 | 3300048905 | Bacteria | 572 |
| 767 | Ga0496103_0036423 | 3300048906 | Bacteria | 3013 |
| 768 | Ga0496104_0052045 | 3300048907 | Bacteria | 3867 |
| 769 | Ga0496104_0088642 | 3300048907 | Bacteria | 2956 |
| 770 | Ga0496104_0297403 | 3300048907 | Bacteria | 1526 |
| 771 | Ga0496104_0313711 | 3300048907 | Bacteria | 1481 |
| 772 | Ga0496104_0548189 | 3300048907 | Bacteria | 1067 |
| 773 | Ga0496104_0843500 | 3300048907 | Bacteria | 822 |
| 774 | Ga0496105_0127319 | 3300048908 | Bacteria | 2100 |
| 775 | Ga0496105_0439634 | 3300048908 | Bacteria | 1031 |
| 776 | Ga0496105_0489758 | 3300048908 | Bacteria | 966 |
| 777 | Ga0496106_0000632 | 3300048909 | Bacteria | 25223 |
| 778 | Ga0496106_0186295 | 3300048909 | Bacteria | 1649 |
| 779 | Ga0496106_0513619 | 3300048909 | Bacteria | 962 |
| 780 | Ga0496107_0295143 | 3300048910 | Bacteria | 1206 |
| 781 | Ga0496108_0000018 | 3300048911 | Bacteria | 234917 |
| 782 | Ga0496108_0011820 | 3300048911 | Bacteria | 7102 |
| 783 | Ga0496108_0023835 | 3300048911 | Bacteria | 5037 |
| 784 | Ga0496108_0029999 | 3300048911 | Bacteria | 4507 |
| 785 | Ga0496108_0096698 | 3300048911 | Bacteria | 2516 |
| 786 | Ga0496108_0476455 | 3300048911 | Bacteria | 1091 |
| 787 | Ga0496108_0510328 | 3300048911 | Bacteria | 1050 |
| 788 | Ga0496108_0694851 | 3300048911 | Bacteria | 882 |
| 789 | Ga0496109_0029420 | 3300048912 | Bacteria | 4919 |
| 790 | Ga0496109_0053838 | 3300048912 | Bacteria | 3671 |
| 791 | Ga0496109_0314511 | 3300048912 | Bacteria | 1477 |
| 792 | Ga0496109_0943913 | 3300048912 | Bacteria | 800 |
| 793 | Ga0496110_0027938 | 3300048913 | Bacteria | 4840 |
| 794 | Ga0496110_0029823 | 3300048913 | Bacteria | 4700 |
| 795 | Ga0496110_0050270 | 3300048913 | Bacteria | 3660 |
| 796 | Ga0496111_0024685 | 3300048914 | Bacteria | 4237 |
| 797 | Ga0496111_0057308 | 3300048914 | Bacteria | 2821 |
| 798 | Ga0496111_0118802 | 3300048914 | Bacteria | 1952 |
| 799 | Ga0496111_0158593 | 3300048914 | Bacteria | 1679 |
| 800 | Ga0496111_0295988 | 3300048914 | Bacteria | 1200 |
| 801 | Ga0496112_0038187 | 3300048915 | Bacteria | 4689 |
| 802 | Ga0496112_0053393 | 3300048915 | Bacteria | 3969 |
| 803 | Ga0496112_0138074 | 3300048915 | Bacteria | 2408 |
| 804 | Ga0496112_1203625 | 3300048915 | Bacteria | 674 |
| 805 | Ga0496113_0038680 | 3300048916 | Bacteria | 3508 |
| 806 | Ga0496113_0073689 | 3300048916 | Bacteria | 2602 |
| 807 | Ga0496113_0219688 | 3300048916 | Bacteria | 1514 |
| 808 | Ga0496113_0560580 | 3300048916 | Bacteria | 916 |
| 809 | Ga0496114_0017063 | 3300048917 | Bacteria | 5856 |
| 810 | Ga0496114_0100527 | 3300048917 | Bacteria | 2468 |
| 811 | Ga0496115_0135231 | 3300048918 | Bacteria | 2032 |
| 812 | Ga0496115_0565590 | 3300048918 | Bacteria | 907 |
| 813 | Ga0496115_0764156 | 3300048918 | Bacteria | 755 |
| 814 | Ga0496116_0045085 | 3300048919 | Bacteria | 2988 |
| 815 | Ga0496117_0030433 | 3300048920 | Bacteria | 4143 |
| 816 | Ga0496119_0001521 | 3300048922 | Bacteria | 27725 |
| 817 | Ga0496120_0001525 | 3300048923 | Bacteria | 27277 |
| 818 | Ga0496122_0042166 | 3300048925 | Bacteria | 3594 |
| 819 | Ga0496122_0084576 | 3300048925 | Bacteria | 2193 |
| 820 | Ga0496124_0000542 | 3300048927 | Bacteria | 64211 |
| 821 | Ga0496126_0001205 | 3300048929 | Bacteria | 42144 |
| 822 | Ga0496126_0001917 | 3300048929 | Bacteria | 29832 |
| 823 | Ga0496126_0069612 | 3300048929 | Bacteria | 3138 |
| 824 | Ga0501298_037448 | 3300049521 | Bacteria | 974 |
| 825 | Ga0501318_004734 | 3300049534 | Bacteria | 1319 |
| 826 | Ga0501031_0015731 | 3300049568 | Bacteria | 4910 |
| 827 | Ga0501031_0033843 | 3300049568 | Bacteria | 3335 |
| 828 | Ga0501031_0512277 | 3300049568 | Bacteria | 774 |
| 829 | Ga0501031_0612357 | 3300049568 | Bacteria | 700 |
| 830 | Ga0501032_0006296 | 3300049569 | Bacteria | 8743 |
| 831 | Ga0501033_0013749 | 3300049570 | Bacteria | 6156 |
| 832 | Ga0501033_0104874 | 3300049570 | Bacteria | 2061 |
| 833 | Ga0501033_0130933 | 3300049570 | Bacteria | 1817 |
| 834 | Ga0501034_0202941 | 3300049571 | Bacteria | 1940 |
| 835 | Ga0501034_0896110 | 3300049571 | Bacteria | 775 |
| 836 | Ga0501036_0053301 | 3300049572 | Bacteria | 3425 |
| 837 | Ga0501036_0126028 | 3300049572 | Bacteria | 2163 |
| 838 | Ga0501036_0313703 | 3300049572 | Bacteria | 1311 |
| 839 | Ga0501037_0002416 | 3300049573 | Bacteria | 13500 |
| 840 | Ga0501037_0003569 | 3300049573 | Bacteria | 11284 |
| 841 | Ga0501038_0015173 | 3300049574 | Bacteria | 7008 |
| 842 | Ga0501038_0016532 | 3300049574 | Bacteria | 6687 |
| 843 | Ga0501038_0251188 | 3300049574 | Bacteria | 1401 |
| 844 | Ga0501038_0493085 | 3300049574 | Bacteria | 937 |
| 845 | Ga0501039_0069171 | 3300049575 | Bacteria | 2741 |
| 846 | Ga0501039_0136030 | 3300049575 | Bacteria | 1929 |
| 847 | Ga0501039_0442603 | 3300049575 | Bacteria | 1020 |
| 848 | Ga0501040_0010354 | 3300049576 | Bacteria | 6095 |
| 849 | Ga0501040_0021154 | 3300049576 | Bacteria | 4339 |
| 850 | Ga0501040_0035784 | 3300049576 | Bacteria | 3368 |
| 851 | Ga0501040_0356980 | 3300049576 | Bacteria | 1047 |
| 852 | Ga0501040_0629179 | 3300049576 | Bacteria | 775 |
| 853 | Ga0501041_0105846 | 3300049577 | Bacteria | 1743 |
| 854 | Ga0501042_0075035 | 3300049578 | Bacteria | 2419 |
| 855 | Ga0501043_0003176 | 3300049579 | Bacteria | 13592 |
| 856 | Ga0501043_0004360 | 3300049579 | Bacteria | 11514 |
| 857 | Ga0501043_0096804 | 3300049579 | Bacteria | 2320 |
| 858 | Ga0501043_0250677 | 3300049579 | Bacteria | 1364 |
| 859 | Ga0501043_0401113 | 3300049579 | Bacteria | 1036 |
| 860 | Ga0501046_0067141 | 3300049580 | Bacteria | 2793 |
| 861 | Ga0501046_0105544 | 3300049580 | Bacteria | 2157 |
| 862 | Ga0501047_0112038 | 3300049581 | Bacteria | 2611 |
| 863 | Ga0501048_0024791 | 3300049582 | Bacteria | 4375 |
| 864 | Ga0501048_0088159 | 3300049582 | Bacteria | 2188 |
| 865 | Ga0501048_0641424 | 3300049582 | Bacteria | 762 |
| 866 | Ga0501048_0945224 | 3300049582 | Bacteria | 620 |
| 867 | Ga0501067_0031570 | 3300049583 | Bacteria | 2939 |
| 868 | Ga0501068_0003054 | 3300049584 | Bacteria | 8935 |
| 869 | Ga0501068_0077176 | 3300049584 | Bacteria | 2040 |
| 870 | Ga0501068_0116968 | 3300049584 | Bacteria | 1660 |
| 871 | Ga0501068_0131899 | 3300049584 | Bacteria | 1563 |
| 872 | Ga0501068_0354505 | 3300049584 | Bacteria | 943 |
| 873 | Ga0501069_0030265 | 3300049585 | Bacteria | 2972 |
| 874 | Ga0501070_0021366 | 3300049586 | Bacteria | 5430 |
| 875 | Ga0501070_0299345 | 3300049586 | Bacteria | 1310 |
| 876 | Ga0501071_0011761 | 3300049587 | Bacteria | 5906 |
| 877 | Ga0501071_0087584 | 3300049587 | Bacteria | 2284 |
| 878 | Ga0501071_0173241 | 3300049587 | Bacteria | 1616 |
| 879 | Ga0501071_0557162 | 3300049587 | Bacteria | 880 |
| 880 | Ga0501072_0034193 | 3300049588 | Bacteria | 3983 |
| 881 | Ga0501072_0071127 | 3300049588 | Bacteria | 2748 |
| 882 | Ga0501072_0508921 | 3300049588 | Bacteria | 952 |
| 883 | Ga0501073_0016095 | 3300049589 | Bacteria | 5422 |
| 884 | Ga0501073_0077723 | 3300049589 | Bacteria | 2309 |
| 885 | Ga0501074_0015182 | 3300049590 | Bacteria | 5599 |
| 886 | Ga0501074_0072257 | 3300049590 | Bacteria | 2478 |
| 887 | Ga0501074_0101069 | 3300049590 | Bacteria | 2064 |
| 888 | Ga0501075_0016652 | 3300049591 | Bacteria | 5300 |
| 889 | Ga0501075_0036049 | 3300049591 | Bacteria | 3690 |
| 890 | Ga0501075_0054999 | 3300049591 | Bacteria | 2994 |
| 891 | Ga0501075_0281617 | 3300049591 | Bacteria | 1267 |
| 892 | Ga0501075_0329467 | 3300049591 | Bacteria | 1164 |
| 893 | Ga0501075_0467857 | 3300049591 | Bacteria | 961 |
| 894 | Ga0501076_0003206 | 3300049592 | Bacteria | 11418 |
| 895 | Ga0501076_0019371 | 3300049592 | Bacteria | 5201 |
| 896 | Ga0501076_0080098 | 3300049592 | Bacteria | 2621 |
| 897 | Ga0501076_0385430 | 3300049592 | Bacteria | 1152 |
| 898 | Ga0501077_0010639 | 3300049593 | Bacteria | 5729 |
| 899 | Ga0501077_0015144 | 3300049593 | Bacteria | 4848 |
| 900 | Ga0501077_0058883 | 3300049593 | Bacteria | 2439 |
| 901 | Ga0501077_0116202 | 3300049593 | Bacteria | 1696 |
| 902 | Ga0501077_0276308 | 3300049593 | Bacteria | 1069 |
| 903 | Ga0501077_0353544 | 3300049593 | Bacteria | 938 |
| 904 | Ga0501253_109589 | 3300049683 | Bacteria | 657 |
| 905 | Ga0501079_0009708 | 3300049741 | Bacteria | 7296 |
| 906 | Ga0501079_0036553 | 3300049741 | Bacteria | 3783 |
| 907 | Ga0501079_0668699 | 3300049741 | Bacteria | 817 |
| 908 | Ga0501080_0017241 | 3300049742 | Bacteria | 6673 |
| 909 | Ga0501080_0031418 | 3300049742 | Bacteria | 4948 |
| 910 | Ga0501080_0449466 | 3300049742 | Bacteria | 1155 |
| 911 | Ga0501080_0696196 | 3300049742 | Bacteria | 896 |
| 912 | Ga0501080_0717553 | 3300049742 | Bacteria | 881 |
| 913 | Ga0501081_0008906 | 3300049743 | Bacteria | 6519 |
| 914 | Ga0501081_0014467 | 3300049743 | Bacteria | 5204 |
| 915 | Ga0501081_0499945 | 3300049743 | Bacteria | 906 |
| 916 | Ga0501083_0022959 | 3300049744 | Bacteria | 4329 |
| 917 | Ga0501083_0038256 | 3300049744 | Bacteria | 3262 |
| 918 | Ga0501083_0066068 | 3300049744 | Bacteria | 2409 |
| 919 | Ga0501035_0071187 | 3300049822 | Bacteria | 3079 |
| 920 | Ga0501035_0074372 | 3300049822 | Bacteria | 3006 |
| 921 | Ga0501035_0309396 | 3300049822 | Bacteria | 1329 |
| 922 | Ga0501044_0005084 | 3300049823 | Bacteria | 14671 |
| 923 | Ga0501044_0010145 | 3300049823 | Bacteria | 10237 |
| 924 | Ga0501044_0187354 | 3300049823 | Bacteria | 2033 |
| 925 | Ga0501044_0805097 | 3300049823 | Bacteria | 819 |
| 926 | Ga0501045_0099160 | 3300049824 | Bacteria | 2155 |
| 927 | Ga0501045_0116735 | 3300049824 | Bacteria | 1981 |
| 928 | Ga0501045_0194924 | 3300049824 | Bacteria | 1510 |
| 929 | Ga0501045_0401640 | 3300049824 | Bacteria | 1020 |
| 930 | nmdc:mga05p37_1322812_c1 | 3300050507 | Bacteria | 733 |
| 931 | nmdc:mga05p37_36435_c1 | 3300050507 | Bacteria | 6035 |
| 932 | nmdc:mga05p37_370336_c1 | 3300050507 | Bacteria | 1681 |
| 933 | nmdc:mga05p37_611200_c1 | 3300050507 | Bacteria | 1228 |
| 934 | nmdc:mga05p37_66787_c2 | 3300050507 | Bacteria | 2868 |
| 935 | nmdc:mga05p37_7439_c1 | 3300050507 | Bacteria | 12914 |
| 936 | nmdc:mga05p37_752672_c1 | 3300050507 | Bacteria | 1074 |
| 937 | nmdc:mga09592_223466_c1 | 3300050508 | Bacteria | 1631 |
| 938 | nmdc:mga09592_502223_c1 | 3300050508 | Bacteria | 1044 |
| 939 | nmdc:mga09592_521683_c1 | 3300050508 | Bacteria | 1022 |
| 940 | nmdc:mga06r32_141_c7 | 3300050510 | Bacteria | 12743 |
| 941 | nmdc:mga06r32_870614_c1 | 3300050510 | Bacteria | 859 |
| 942 | nmdc:mga08y16_19182_c1 | 3300050511 | Bacteria | 7205 |
| 943 | nmdc:mga08y16_527869_c1 | 3300050511 | Bacteria | 1197 |
| 944 | nmdc:mga0n895_15482_c1 | 3300050512 | Bacteria | 6955 |
| 945 | nmdc:mga0rr50_836884_c1 | 3300050513 | Bacteria | 785 |
| 946 | nmdc:mga0rr50_9709_c1 | 3300050513 | Bacteria | 6069 |
| 947 | nmdc:mga0a205_114554_c1 | 3300050515 | Bacteria | 2595 |
| 948 | Ga0495601_0004034 | 3300053077 | Bacteria | 8459 |
| 949 | Ga0495601_0060188 | 3300053077 | Bacteria | 2409 |
| 950 | Ga0495612_0002970 | 3300053078 | Bacteria | 7039 |
| 951 | Ga0495612_0026655 | 3300053078 | Bacteria | 2322 |
| 952 | Ga0495612_0040647 | 3300053078 | Bacteria | 1895 |
| 953 | Ga0495655_0005422 | 3300053083 | Bacteria | 2251 |
| 954 | Ga0495655_0061606 | 3300053083 | Bacteria | 1025 |
| 955 | Ga0495595_0031659 | 3300053084 | Bacteria | 2378 |
| 956 | Ga0495619_0002469 | 3300053085 | Bacteria | 12095 |
| 957 | Ga0495619_0007996 | 3300053085 | Bacteria | 6693 |
| 958 | Ga0495619_0070251 | 3300053085 | Bacteria | 2341 |
| 959 | Ga0500559_0004191 | 3300053136 | Bacteria | 6912 |
| 960 | Ga0500616_0038644 | 3300053153 | Bacteria | 2577 |
| 961 | Ga0501084_0023413 | 3300054114 | Bacteria | 5154 |
| 962 | Ga0501084_0095375 | 3300054114 | Bacteria | 2498 |
| 963 | Ga0501084_0190143 | 3300054114 | Bacteria | 1732 |
| 964 | Ga0501084_0195338 | 3300054114 | Bacteria | 1707 |
| 965 | Ga0590075_051065 | 3300059424 | Bacteria | 1061 |
| 966 | Ga0501082_0027993 | 3300060353 | Bacteria | 4854 |
| 967 | Ga0501082_0068293 | 3300060353 | Bacteria | 3061 |
| 968 | Ga0501082_0329377 | 3300060353 | Bacteria | 1330 |
| 969 | Ga0501082_0610630 | 3300060353 | Bacteria | 954 |
| 970 | Ga0466962_0001664 | 3300061719 | Bacteria | 10426 |
| 971 | Ga0466962_0059383 | 3300061719 | Bacteria | 1825 |
| 972 | Ga0466962_0078777 | 3300061719 | Bacteria | 1575 |
| 973 | Ga0466962_0082782 | 3300061719 | Bacteria | 1535 |
| 974 | Ga0466962_0083532 | 3300061719 | Bacteria | 1528 |
| 975 | Ga0466962_0161316 | 3300061719 | Bacteria | 1090 |
| 976 | Ga0530510_0011756 | 3300061734 | Bacteria | 6142 |
| 977 | Ga0530510_0132308 | 3300061734 | Bacteria | 1835 |
| 978 | Ga0530510_0208838 | 3300061734 | Bacteria | 1451 |
| 979 | Ga0530510_0306137 | 3300061734 | Bacteria | 1190 |
| 980 | Ga0530510_0409020 | 3300061734 | Bacteria | 1023 |
| 981 | 2559427603 | 2558860280 | Bacteria | 11429938 |
| 982 | 2623499314 | 2622736605 | Bacteria | 4992138 |
| 983 | 2776375197 | 2775506925 | Bacteria | 7237746 |
| 984 | 2791916869 | 2791354901 | Bacteria | 8322202 |
| 985 | 2795780397 | 2795385470 | Bacteria | 8317180 |
| 986 | 2795793826 | 2795385472 | Bacteria | 6627535 |
| 987 | 2863069479 | 2863067949 | Bacteria | 8541735 |
| 988 | 2866612508 | 2866612099 | Bacteria | 7543886 |
| 989 | 2899374560 | 2899370129 | Bacteria | 6781179 |
| 990 | 8054473679 | 8054472261 | Bacteria | 7464355 |
| 991 | 8056209741 | 8056207758 | Bacteria | 8639239 |
| 992 | Ga0213875_10000123 | |||
| 993 | JGI24749J21850_1033324 | |||
| 994 | JGI25406J46586_10011537 | |||
| 995 | JGI25406J46586_10102001 | |||
| 996 | Ga0070658_10113789 | |||
| 997 | Ga0070658_10705619 | |||
| 998 | Ga0070658_10765590 | |||
| 999 | Ga0070676_10085935 | |||
| 1000 | Ga0070676_10158072 | |||
| 1001 | Ga0070676_10192171 | |||
| 1002 | Ga0070676_10287431 | |||
| 1003 | Ga0070683_100318659 | |||
| 1004 | Ga0070683_100697196 | |||
| 1005 | Ga0070690_100062094 | |||
| 1006 | Ga0070670_100036082 | |||
| 1007 | Ga0070670_100091437 | |||
| 1008 | Ga0068869_100011051 | |||
| 1009 | Ga0068869_100103621 | |||
| 1010 | Ga0068869_100165826 | |||
| 1011 | Ga0070680_100058990 | |||
| 1012 | Ga0070680_100121827 | |||
| 1013 | Ga0070682_100031698 | |||
| 1014 | Ga0070682_100117502 | |||
| 1015 | Ga0070682_100179800 | |||
| 1016 | Ga0070682_100283395 | |||
| 1017 | Ga0068868_100086462 | |||
| 1018 | Ga0068868_100128000 | |||
| 1019 | Ga0068868_100175130 | |||
| 1020 | Ga0068868_100571686 | |||
| 1021 | Ga0068868_100589526 | |||
| 1022 | Ga0070660_100071829 | |||
| 1023 | Ga0070660_100282530 | |||
| 1024 | Ga0070660_100898744 | |||
| 1025 | Ga0070689_100042156 | |||
| 1026 | Ga0070689_100056311 | |||
| 1027 | Ga0070689_100168645 | |||
| 1028 | Ga0070687_100025521 | |||
| 1029 | Ga0070661_100106480 | |||
| 1030 | Ga0070661_100224945 | |||
| 1031 | Ga0070661_100610713 | |||
| 1032 | Ga0070692_10030140 | |||
| 1033 | Ga0070692_10067746 | |||
| 1034 | Ga0070692_10247970 | |||
| 1035 | Ga0070692_10386316 | |||
| 1036 | Ga0070668_100458209 | |||
| 1037 | Ga0070668_101368581 | |||
| 1038 | Ga0070669_100058538 | |||
| 1039 | Ga0070669_100229784 | |||
| 1040 | Ga0070675_100046688 | |||
| 1041 | Ga0070675_100509109 | |||
| 1042 | Ga0070671_100000909 | |||
| 1043 | Ga0070671_100112451 | |||
| 1044 | Ga0070671_100223289 | |||
| 1045 | Ga0070674_100004141 | |||
| 1046 | Ga0070674_100046405 | |||
| 1047 | Ga0070674_100112001 | |||
| 1048 | Ga0070673_100133831 | |||
| 1049 | Ga0070673_100315050 | |||
| 1050 | Ga0070673_100767627 | |||
| 1051 | Ga0070688_100045177 | |||
| 1052 | Ga0070659_100023252 | |||
| 1053 | Ga0070659_100140300 | |||
| 1054 | Ga0070667_100410934 | |||
| 1055 | Ga0070709_10137992 | |||
| 1056 | Ga0070714_100019347 | |||
| 1057 | Ga0070714_100200985 | |||
| 1058 | Ga0070713_100149421 | |||
| 1059 | Ga0070713_100377331 | |||
| 1060 | Ga0070713_100599429 | |||
| 1061 | Ga0070710_10019601 | |||
| 1062 | Ga0070710_10297154 | |||
| 1063 | Ga0070701_10055849 | |||
| 1064 | Ga0070701_10105654 | |||
| 1065 | Ga0070711_100007611 | |||
| 1066 | Ga0070711_100018745 | |||
| 1067 | Ga0070705_100412682 | |||
| 1068 | Ga0070705_100720412 | |||
| 1069 | Ga0070700_100005670 | |||
| 1070 | Ga0070700_100177527 | |||
| 1071 | Ga0070700_100269229 | |||
| 1072 | Ga0070694_100105417 | |||
| 1073 | Ga0070708_100002519 | |||
| 1074 | Ga0070708_100004229 | |||
| 1075 | Ga0070708_100006320 | |||
| 1076 | Ga0070708_100018330 | |||
| 1077 | Ga0070708_100028347 | |||
| 1078 | Ga0070708_100218068 | |||
| 1079 | Ga0070708_101190058 | |||
| 1080 | Ga0070663_100055023 | |||
| 1081 | Ga0070663_100106788 | |||
| 1082 | Ga0070663_100788369 | |||
| 1083 | Ga0070663_101073570 | |||
| 1084 | Ga0070678_100476598 | |||
| 1085 | Ga0070678_100777028 | |||
| 1086 | Ga0070662_100112744 | |||
| 1087 | Ga0070662_100313560 | |||
| 1088 | Ga0068867_100014962 | |||
| 1089 | Ga0068867_100045227 | |||
| 1090 | Ga0068867_100047900 | |||
| 1091 | Ga0068867_100077307 | |||
| 1092 | Ga0070685_10036710 | |||
| 1093 | Ga0070685_10067551 | |||
| 1094 | Ga0070685_10153208 | |||
| 1095 | Ga0070706_100113840 | |||
| 1096 | Ga0070706_100465706 | |||
| 1097 | Ga0070707_100208962 | |||
| 1098 | Ga0070698_100082845 | |||
| 1099 | Ga0070698_100210864 | |||
| 1100 | Ga0070698_100227835 | |||
| 1101 | Ga0070699_100103363 | |||
| 1102 | Ga0070699_100377253 | |||
| 1103 | Ga0070699_100514497 | |||
| 1104 | Ga0070699_100963448 | |||
| 1105 | Ga0070679_100046068 | |||
| 1106 | Ga0070679_100188025 | |||
| 1107 | Ga0070679_100781864 | |||
| 1108 | Ga0070684_100236983 | |||
| 1109 | Ga0070684_100857000 | |||
| 1110 | Ga0070697_100175129 | |||
| 1111 | Ga0070697_100285060 | |||
| 1112 | Ga0068853_100326373 | |||
| 1113 | Ga0070672_100082630 | |||
| 1114 | Ga0070672_100112170 | |||
| 1115 | Ga0070672_100397570 | |||
| 1116 | Ga0070686_100129005 | |||
| 1117 | Ga0070686_100160794 | |||
| 1118 | Ga0070695_100039249 | |||
| 1119 | Ga0070696_100016150 | |||
| 1120 | Ga0070696_100434994 | |||
| 1121 | Ga0070665_100017820 | |||
| 1122 | Ga0070665_101284555 | |||
| 1123 | Ga0070704_100048830 | |||
| 1124 | Ga0070704_100330679 | |||
| 1125 | Ga0068855_100265953 | |||
| 1126 | Ga0070664_100046066 | |||
| 1127 | Ga0070664_100053204 | |||
| 1128 | Ga0070664_100445503 | |||
| 1129 | Ga0070664_100568585 | |||
| 1130 | Ga0068857_100165450 | |||
| 1131 | Ga0068857_100276675 | |||
| 1132 | Ga0068857_100939470 | |||
| 1133 | Ga0068854_100025334 | |||
| 1134 | Ga0068854_100649705 | |||
| 1135 | Ga0070702_100045882 | |||
| 1136 | Ga0070702_100070552 | |||
| 1137 | Ga0070702_100089256 | |||
| 1138 | Ga0070702_101049800 | |||
| 1139 | Ga0068852_100046759 | |||
| 1140 | Ga0068852_101069579 | |||
| 1141 | Ga0068859_100042477 | |||
| 1142 | Ga0068859_100170744 | |||
| 1143 | Ga0068864_100171764 | |||
| 1144 | Ga0068864_100382783 | |||
| 1145 | Ga0068864_100447552 | |||
| 1146 | Ga0068864_100496525 | |||
| 1147 | Ga0068864_100502149 | |||
| 1148 | Ga0068864_100813957 | |||
| 1149 | Ga0068864_100917461 | |||
| 1150 | Ga0068866_10237745 | |||
| 1151 | Ga0068866_10247692 | |||
| 1152 | Ga0068861_100028598 | |||
| 1153 | Ga0068851_10197224 | |||
| 1154 | Ga0068851_10271013 | |||
| 1155 | Ga0068870_10036661 | |||
| 1156 | Ga0068870_10203101 | |||
| 1157 | Ga0068870_10213639 | |||
| 1158 | Ga0068870_10401790 | |||
| 1159 | Ga0068863_100108828 | |||
| 1160 | Ga0068863_100119077 | |||
| 1161 | Ga0068863_100180777 | |||
| 1162 | Ga0068863_100924510 | |||
| 1163 | Ga0068858_100202044 | |||
| 1164 | Ga0068858_100573039 | |||
| 1165 | Ga0068858_100819174 | |||
| 1166 | Ga0068860_100068836 | |||
| 1167 | Ga0068860_100684879 | |||
| 1168 | Ga0068862_100027688 | |||
| 1169 | Ga0081455_10000064 | |||
| 1170 | Ga0081455_10011325 | |||
| 1171 | Ga0081455_10167856 | |||
| 1172 | Ga0081538_10090242 | |||
| 1173 | Ga0081539_10000027 | |||
| 1174 | Ga0081539_10010730 | |||
| 1175 | Ga0081539_10061633 | |||
| 1176 | Ga0081539_10078331 | |||
| 1177 | Ga0070717_10206337 | |||
| 1178 | Ga0075365_10256401 | |||
| 1179 | Ga0075432_10160791 | |||
| 1180 | Ga0070715_10032314 | |||
| 1181 | Ga0070716_100044955 | |||
| 1182 | Ga0070716_100244155 | |||
| 1183 | Ga0070712_100004574 | |||
| 1184 | Ga0070712_100005842 | |||
| 1185 | Ga0097621_100556372 | |||
| 1186 | Ga0068871_100375711 | |||
| 1187 | Ga0068871_101066139 | |||
| 1188 | Ga0075428_100091210 | |||
| 1189 | Ga0075428_101390060 | |||
| 1190 | Ga0075431_100136254 | |||
| 1191 | Ga0075431_100331987 | |||
| 1192 | Ga0075433_10330066 | |||
| 1193 | Ga0075434_100040568 | |||
| 1194 | Ga0075429_100540583 | |||
| 1195 | Ga0068865_100010490 | |||
| 1196 | Ga0068865_100081146 | |||
| 1197 | Ga0068865_100110799 | |||
| 1198 | Ga0068865_100262803 | |||
| 1199 | Ga0068865_100609256 | |||
| 1200 | Ga0075436_100542769 | |||
| 1201 | Ga0097620_100042475 | |||
| 1202 | Ga0097620_100170743 | |||
| 1203 | Ga0097620_101265541 | |||
| 1204 | Ga0075435_100029282 | |||
| 1205 | Ga0075435_100670184 | |||
| 1206 | Ga0105251_10122080 | |||
| 1207 | Ga0111539_10181236 | |||
| 1208 | Ga0111539_11627068 | |||
| 1209 | Ga0105245_10045364 | |||
| 1210 | Ga0105245_10429754 | |||
| 1211 | Ga0105245_10447169 | |||
| 1212 | Ga0105245_10750902 | |||
| 1213 | Ga0105245_10952497 | |||
| 1214 | Ga0105247_10195155 | |||
| 1215 | Ga0105247_10317636 | |||
| 1216 | Ga0114129_10002142 | |||
| 1217 | Ga0114129_10060554 | |||
| 1218 | Ga0114129_10170159 | |||
| 1219 | Ga0114129_10233938 | |||
| 1220 | Ga0114129_10264916 | |||
| 1221 | Ga0114129_10334996 | |||
| 1222 | Ga0114129_10575091 | |||
| 1223 | Ga0114129_10818138 | |||
| 1224 | Ga0114129_10872494 | |||
| 1225 | Ga0114129_11232738 | |||
| 1226 | Ga0114129_12111616 | |||
| 1227 | Ga0114129_12180386 | |||
| 1228 | Ga0105243_10006714 | |||
| 1229 | Ga0105243_10013163 | |||
| 1230 | Ga0105241_10202804 | |||
| 1231 | Ga0105242_10007179 | |||
| 1232 | Ga0105242_10035288 | |||
| 1233 | Ga0105242_10043688 | |||
| 1234 | Ga0105242_10229052 | |||
| 1235 | Ga0105248_10003799 | |||
| 1236 | Ga0105248_10037658 | |||
| 1237 | Ga0105248_10082283 | |||
| 1238 | Ga0105238_10049338 | |||
| 1239 | Ga0105238_10153840 | |||
| 1240 | Ga0105238_10192367 | |||
| 1241 | Ga0105238_10286614 | |||
| 1242 | Ga0105238_10702551 | |||
| 1243 | Ga0105238_11113799 | |||
| 1244 | Ga0105238_11874059 | |||
| 1245 | Ga0105249_10029348 | |||
| 1246 | Ga0105249_10346407 | |||
| 1247 | Ga0105249_10855334 | |||
| 1248 | Ga0099796_10081000 | |||
| 1249 | Ga0105239_10052554 | |||
| 1250 | Ga0105246_10007131 | |||
| 1251 | Ga0105246_10052516 | |||
| 1252 | Ga0105246_10190640 | |||
| 1253 | Ga0157344_1002768 | |||
| 1254 | Ga0157371_10181200 | |||
| 1255 | Ga0157369_10296239 | |||
| 1256 | Ga0157369_10342344 | |||
| 1257 | Ga0157369_10914925 | |||
| 1258 | Ga0157374_10614616 | |||
| 1259 | Ga0157378_10006283 | |||
| 1260 | Ga0157378_10114578 | |||
| 1261 | Ga0157378_11095949 | |||
| 1262 | Ga0163162_10283558 | |||
| 1263 | Ga0163162_10852856 | |||
| 1264 | Ga0163162_11757645 | |||
| 1265 | Ga0157372_10256292 | |||
| 1266 | Ga0157375_10012047 | |||
| 1267 | Ga0157375_10075795 | |||
| 1268 | Ga0157375_10162242 | |||
| 1269 | Ga0157375_10219546 | |||
| 1270 | Ga0157375_10546234 | |||
| 1271 | Ga0163163_10015258 | |||
| 1272 | Ga0163163_10065378 | |||
| 1273 | Ga0163163_10086411 | |||
| 1274 | Ga0163163_10312446 | |||
| 1275 | Ga0157380_10091196 | |||
| 1276 | Ga0157380_10213134 | |||
| 1277 | Ga0157380_10519424 | |||
| 1278 | Ga0157380_10528303 | |||
| 1279 | Ga0157380_10823826 | |||
| 1280 | Ga0157377_10015839 | |||
| 1281 | Ga0157377_10122790 | |||
| 1282 | Ga0157377_10568104 | |||
| 1283 | Ga0157379_10000747 | |||
| 1284 | Ga0157379_10062646 | |||
| 1285 | Ga0157379_10135803 | |||
| 1286 | Ga0157379_10735669 | |||
| 1287 | Ga0157376_10071714 | |||
| 1288 | Ga0163161_10158113 | |||
| 1289 | Ga0206354_10031289 | |||
| 1290 | Ga0206353_10857764 | |||
| 1291 | Ga0154015_1043079 | |||
| 1292 | Ga0213876_10022268 | |||
| 1293 | Ga0213875_10002214 | |||
| 1294 | Ga0207656_10237159 | |||
| 1295 | Ga0207656_10340778 | |||
| 1296 | Ga0207713_1198414 | |||
| 1297 | Ga0207692_10321175 | |||
| 1298 | Ga0207642_10125015 | |||
| 1299 | Ga0207642_10209501 | |||
| 1300 | Ga0207642_10464204 | |||
| 1301 | Ga0207710_10041428 | |||
| 1302 | Ga0207688_10004405 | |||
| 1303 | Ga0207688_10008032 | |||
| 1304 | Ga0207688_10013485 | |||
| 1305 | Ga0207688_10174047 | |||
| 1306 | Ga0207688_10298593 | |||
| 1307 | Ga0207688_10410484 | |||
| 1308 | Ga0207680_10239962 | |||
| 1309 | Ga0207647_10123534 | |||
| 1310 | Ga0207647_10342849 | |||
| 1311 | Ga0207699_10109545 | |||
| 1312 | Ga0207699_10606765 | |||
| 1313 | Ga0207645_10123722 | |||
| 1314 | Ga0207645_10159715 | |||
| 1315 | Ga0207645_10264514 | |||
| 1316 | Ga0207643_10038100 | |||
| 1317 | Ga0207643_10492494 | |||
| 1318 | Ga0207643_10587022 | |||
| 1319 | Ga0207705_10074008 | |||
| 1320 | Ga0207684_10143174 | |||
| 1321 | Ga0207684_10212134 | |||
| 1322 | Ga0207684_10378923 | |||
| 1323 | Ga0207671_10108617 | |||
| 1324 | Ga0207671_10306870 | |||
| 1325 | Ga0207693_10001022 | |||
| 1326 | Ga0207693_10026075 | |||
| 1327 | Ga0207663_10062846 | |||
| 1328 | Ga0207663_10115760 | |||
| 1329 | Ga0207660_10061780 | |||
| 1330 | Ga0207660_10268763 | |||
| 1331 | Ga0207662_10005211 | |||
| 1332 | Ga0207662_10125066 | |||
| 1333 | Ga0207662_10569393 | |||
| 1334 | Ga0207657_10095336 | |||
| 1335 | Ga0207657_10120433 | |||
| 1336 | Ga0207649_10606631 | |||
| 1337 | Ga0207652_10114992 | |||
| 1338 | Ga0207646_10055386 | |||
| 1339 | Ga0207646_10128027 | |||
| 1340 | Ga0207646_10159032 | |||
| 1341 | Ga0207646_10880644 | |||
| 1342 | Ga0207681_10241914 | |||
| 1343 | Ga0207694_10359993 | |||
| 1344 | Ga0207694_10463887 | |||
| 1345 | Ga0207694_10552909 | |||
| 1346 | Ga0207659_10155385 | |||
| 1347 | Ga0207659_10754098 | |||
| 1348 | Ga0207687_10012505 | |||
| 1349 | Ga0207687_10155106 | |||
| 1350 | Ga0207687_10168128 | |||
| 1351 | Ga0207687_10184684 | |||
| 1352 | Ga0207687_10203230 | |||
| 1353 | Ga0207687_10324153 | |||
| 1354 | Ga0207700_10126144 | |||
| 1355 | Ga0207664_10023494 | |||
| 1356 | Ga0207664_10149292 | |||
| 1357 | Ga0207664_10568105 | |||
| 1358 | Ga0207644_10000893 | |||
| 1359 | Ga0207644_10065801 | |||
| 1360 | Ga0207644_10263420 | |||
| 1361 | Ga0207690_10339507 | |||
| 1362 | Ga0207690_10364502 | |||
| 1363 | Ga0207706_10079155 | |||
| 1364 | Ga0207706_10195946 | |||
| 1365 | Ga0207686_10006485 | |||
| 1366 | Ga0207686_10139775 | |||
| 1367 | Ga0207686_10712271 | |||
| 1368 | Ga0207709_10015943 | |||
| 1369 | Ga0207709_10164242 | |||
| 1370 | Ga0207670_10438466 | |||
| 1371 | Ga0207669_10014636 | |||
| 1372 | Ga0207669_10018292 | |||
| 1373 | Ga0207669_10218932 | |||
| 1374 | Ga0207669_10279807 | |||
| 1375 | Ga0207704_10028464 | |||
| 1376 | Ga0207704_10076020 | |||
| 1377 | Ga0207704_10197135 | |||
| 1378 | Ga0207665_10035972 | |||
| 1379 | Ga0207665_10050178 | |||
| 1380 | Ga0207691_10092961 | |||
| 1381 | Ga0207691_10144709 | |||
| 1382 | Ga0207691_10386720 | |||
| 1383 | Ga0207691_10618024 | |||
| 1384 | Ga0207711_10000355 | |||
| 1385 | Ga0207711_10592496 | |||
| 1386 | Ga0207689_10042665 | |||
| 1387 | Ga0207689_10056340 | |||
| 1388 | Ga0207689_10086688 | |||
| 1389 | Ga0207689_10533115 | |||
| 1390 | Ga0207661_10218049 | |||
| 1391 | Ga0207679_10187835 | |||
| 1392 | Ga0207679_10498686 | |||
| 1393 | Ga0207651_10161278 | |||
| 1394 | Ga0207712_10145042 | |||
| 1395 | Ga0207712_10757548 | |||
| 1396 | Ga0207712_10972949 | |||
| 1397 | Ga0207668_10043874 | |||
| 1398 | Ga0207668_10674354 | |||
| 1399 | Ga0207640_10066893 | |||
| 1400 | Ga0207640_10279656 | |||
| 1401 | Ga0207640_10782437 | |||
| 1402 | Ga0207658_10369128 | |||
| 1403 | Ga0207677_10122020 | |||
| 1404 | Ga0207677_10653891 | |||
| 1405 | Ga0207677_10945014 | |||
| 1406 | Ga0207703_10000007 | |||
| 1407 | Ga0207703_10133238 | |||
| 1408 | Ga0207703_10458030 | |||
| 1409 | Ga0207639_10629565 | |||
| 1410 | Ga0207678_10090823 | |||
| 1411 | Ga0207678_10108053 | |||
| 1412 | Ga0207678_10322281 | |||
| 1413 | Ga0207678_10355524 | |||
| 1414 | Ga0207678_10628102 | |||
| 1415 | Ga0207708_10006895 | |||
| 1416 | Ga0207708_10035980 | |||
| 1417 | Ga0207708_10051363 | |||
| 1418 | Ga0207708_10894284 | |||
| 1419 | Ga0207702_10604439 | |||
| 1420 | Ga0207641_10087457 | |||
| 1421 | Ga0207641_10105793 | |||
| 1422 | Ga0207641_10148745 | |||
| 1423 | Ga0207641_10309725 | |||
| 1424 | Ga0207641_10335787 | |||
| 1425 | Ga0207648_10005074 | |||
| 1426 | Ga0207648_10013201 | |||
| 1427 | Ga0207648_10073304 | |||
| 1428 | Ga0207648_10089067 | |||
| 1429 | Ga0207648_10111292 | |||
| 1430 | Ga0207676_10590754 | |||
| 1431 | Ga0207676_10771600 | |||
| 1432 | Ga0207674_10070523 | |||
| 1433 | Ga0207674_10756866 | |||
| 1434 | Ga0207674_10865679 | |||
| 1435 | Ga0207675_100011101 | |||
| 1436 | Ga0207675_100027801 | |||
| 1437 | Ga0207683_10005936 | |||
| 1438 | Ga0207683_10017236 | |||
| 1439 | Ga0207683_10024495 | |||
| 1440 | Ga0207683_10050942 | |||
| 1441 | Ga0207698_10023042 | |||
| 1442 | Ga0207698_10061607 | |||
| 1443 | Ga0207698_10147558 | |||
| 1444 | Ga0209974_10172217 | |||
| 1445 | Ga0207428_10009205 | |||
| 1446 | Ga0268266_10152452 | |||
| 1447 | Ga0268266_10178355 | |||
| 1448 | Ga0268266_10368575 | |||
| 1449 | Ga0268266_10532863 | |||
| 1450 | Ga0268266_10667145 | |||
| 1451 | Ga0268265_10127833 | |||
| 1452 | Ga0268264_10074958 | |||
| 1453 | Ga0268264_10377237 | |||
| 1454 | Ga0268264_10661922 | |||
| 1455 | Ga0265322_10024482 | |||
| 1456 | Ga0307517_10153010 | |||
| 1457 | Ga0307515_10205378 | |||
| 1458 | Ga0307511_10003508 | |||
| 1459 | Ga0307512_10042450 | |||
| 1460 | Ga0265327_10136653 | |||
| 1461 | Ga0307513_10010554 | |||
| 1462 | Ga0307513_10237393 | |||
| 1463 | Ga0307408_100995673 | |||
| 1464 | Ga0265342_10140282 | |||
| 1465 | Ga0316576_10002704 | |||
| 1466 | Ga0316578_10110110 | |||
| 1467 | Ga0307405_10041987 | |||
| 1468 | Ga0307413_10086147 | |||
| 1469 | Ga0307413_10151778 | |||
| 1470 | Ga0307413_10298867 | |||
| 1471 | Ga0307410_10329948 | |||
| 1472 | Ga0307410_10363292 | |||
| 1473 | Ga0307410_10422827 | |||
| 1474 | Ga0307410_10496504 | |||
| 1475 | Ga0307410_11190230 | |||
| 1476 | Ga0326468_10006296 | |||
| 1477 | Ga0307406_10044774 | |||
| 1478 | Ga0307406_10657683 | |||
| 1479 | Ga0307407_10101946 | |||
| 1480 | Ga0307407_10141912 | |||
| 1481 | Ga0307407_10154407 | |||
| 1482 | Ga0307407_10494867 | |||
| 1483 | Ga0307412_10207956 | |||
| 1484 | Ga0307409_100076025 | |||
| 1485 | Ga0307409_100151639 | |||
| 1486 | Ga0307409_100191407 | |||
| 1487 | Ga0307409_100292871 | |||
| 1488 | Ga0307409_100325820 | |||
| 1489 | Ga0307409_100603375 | |||
| 1490 | Ga0307416_100044898 | |||
| 1491 | Ga0307416_100064661 | |||
| 1492 | Ga0307416_100068464 | |||
| 1493 | Ga0307416_100326358 | |||
| 1494 | Ga0307416_100485598 | |||
| 1495 | Ga0307416_100641630 | |||
| 1496 | Ga0307416_100824475 | |||
| 1497 | Ga0307416_101094146 | |||
| 1498 | Ga0307416_101146767 | |||
| 1499 | Ga0307414_10113632 | |||
| 1500 | Ga0307414_10173687 | |||
| 1501 | Ga0307414_10237248 | |||
| 1502 | Ga0307414_10352544 | |||
| 1503 | Ga0307411_10098203 | |||
| 1504 | Ga0307411_10287024 | |||
| 1505 | Ga0307411_10833293 | |||
| 1506 | Ga0307415_100130228 | |||
| 1507 | Ga0307415_100152283 | |||
| 1508 | Ga0307415_100284489 | |||
| 1509 | Ga0307415_100301997 | |||
| 1510 | Ga0307415_100920495 | |||
| 1511 | Ga0373926_0001444 | |||
| 1512 | Ga0373944_0000040 | |||
| 1513 | Ga0373923_0036897 | |||
| 1514 | Ga0373936_0000099 | |||
| 1515 | Ga0373936_0191180 | |||
| 1516 | Ga0373945_0001163 | |||
| 1517 | Ga0373953_0023798 | |||
| 1518 | Ga0373956_0115642 | |||
| 1519 | Ga0373943_0006625 | |||
| 1520 | Ga0373946_0000479 | |||
| 1521 | Ga0373955_0170935 | |||
| 1522 | Ga0373961_0135790 | |||
| 1523 | Ga0316574_0032238 | |||
| 1524 | Ga0316574_0063993 | |||
| 1525 | Ga0373924_0003505 | |||
| 1526 | Ga0373931_0012989 | |||
| 1527 | Ga0373931_0029579 | |||
| 1528 | Ga0373935_0000216 | |||
| 1529 | Ga0373927_0013647 | |||
| 1530 | Ga0373933_0049820 | |||
| 1531 | Ga0373947_0000710 | |||
| 1532 | Ga0373947_0399954 | |||
| 1533 | Ga0373937_0081083 | |||
| 1534 | Ga0373937_0288133 | |||
| 1535 | Ga0373937_1041924 | |||
| 1536 | Ga0373937_1129707 | |||
| 1537 | Ga0373925_0016392 | |||
| 1538 | Ga0395899_0502492 | |||
| 1539 | Ga0395900_0072237 | |||
| 1540 | Ga0395900_0191300 | |||
| 1541 | Ga0395898_0025468 | |||
| 1542 | Ga0395898_0378987 | |||
| 1543 | Ga0436364_0207977 | |||
| 1544 | Ga0436364_0661798 | |||
| 1545 | Ga0395901_0124443 | |||
| 1546 | Ga0395901_0211773 | |||
| 1547 | Ga0400483_039556 | |||
| 1548 | Ga0436365_0453742 | |||
| 1549 | Ga0436365_0999081 | |||
| 1550 | Ga0436365_1097230 | |||
| 1551 | Ga0436365_1701092 | |||
| 1552 | Ga0436362_0380707 | |||
| 1553 | Ga0439466_0052417 | |||
| 1554 | Ga0439431_0041032 | |||
| 1555 | Ga0451577_0000011 | |||
| 1556 | Ga0451577_0101171 | |||
| 1557 | Ga0451577_0198491 | |||
| 1558 | Ga0451577_0299264 | |||
| 1559 | Ga0439440_0094905 | |||
| 1560 | Ga0466969_0016772 | |||
| 1561 | Ga0466972_0058612 | |||
| 1562 | Ga0466972_0212377 | |||
| 1563 | Ga0466972_0233306 | |||
| 1564 | Ga0453683_0000024 | |||
| 1565 | Ga0453683_0000802 | |||
| 1566 | Ga0453683_0178759 | |||
| 1567 | Ga0466965_0074512 | |||
| 1568 | Ga0466965_0186178 | |||
| 1569 | Ga0466966_0000310 | |||
| 1570 | Ga0466966_0045170 | |||
| 1571 | Ga0466966_0074908 | |||
| 1572 | Ga0466961_0005736 | |||
| 1573 | Ga0466961_0039169 | |||
| 1574 | Ga0466961_0041927 | |||
| 1575 | Ga0466961_0078215 | |||
| 1576 | Ga0466961_0179060 | |||
| 1577 | Ga0466961_0314599 | |||
| 1578 | Ga0466961_0314693 | |||
| 1579 | Ga0466961_0509884 | |||
| 1580 | Ga0466963_0054699 | |||
| 1581 | Ga0466963_0093919 | |||
| 1582 | Ga0466964_0333871 | |||
| 1583 | Ga0466964_0379168 | |||
| 1584 | Ga0453684_0000087 | |||
| 1585 | Ga0453684_0003702 | |||
| 1586 | Ga0453684_0007361 | |||
| 1587 | Ga0453684_0037887 | |||
| 1588 | Ga0453684_0142853 | |||
| 1589 | Ga0453684_0304850 | |||
| 1590 | Ga0453684_0945354 | |||
| 1591 | Ga0466971_0005194 | |||
| 1592 | Ga0466971_0024329 | |||
| 1593 | Ga0466971_0104882 | |||
| 1594 | Ga0466968_0000525 | |||
| 1595 | Ga0466968_0180225 | |||
| 1596 | Ga0466970_0009971 | |||
| 1597 | Ga0466970_0055005 | |||
| 1598 | Ga0466970_0095122 | |||
| 1599 | Ga0466970_0098601 | |||
| 1600 | Ga0466970_0291487 | |||
| 1601 | Ga0466957_0016044 | |||
| 1602 | Ga0466957_0129676 | |||
| 1603 | Ga0466957_0138454 | |||
| 1604 | Ga0466957_0152271 | |||
| 1605 | Ga0466957_0166690 | |||
| 1606 | Ga0466957_0496663 | |||
| 1607 | Ga0466957_1003280 | |||
| 1608 | Ga0466960_0000156 | |||
| 1609 | Ga0466960_0038232 | |||
| 1610 | Ga0466960_0107309 | |||
| 1611 | Ga0466960_0126270 | |||
| 1612 | Ga0466959_0011879 | |||
| 1613 | Ga0466959_0030589 | |||
| 1614 | Ga0466959_0067923 | |||
| 1615 | Ga0466959_0370468 | |||
| 1616 | Ga0466959_0453333 | |||
| 1617 | Ga0466959_0466303 | |||
| 1618 | Ga0451576_0002579 | |||
| 1619 | Ga0451576_0047433 | |||
| 1620 | Ga0451576_0762313 | |||
| 1621 | Ga0466958_0000800 | |||
| 1622 | Ga0466958_0090518 | |||
| 1623 | Ga0466958_0111451 | |||
| 1624 | Ga0466958_0233558 | |||
| 1625 | Ga0466958_0250701 | |||
| 1626 | Ga0466958_0336281 | |||
| 1627 | Ga0466958_0409002 | |||
| 1628 | Ga0466958_0430493 | |||
| 1629 | Ga0466958_0635988 | |||
| 1630 | Ga0466958_0695541 | |||
| 1631 | Ga0466967_0010347 | |||
| 1632 | Ga0466967_0010732 | |||
| 1633 | Ga0466967_0058287 | |||
| 1634 | Ga0466967_0114985 | |||
| 1635 | Ga0466967_0149625 | |||
| 1636 | Ga0466967_0151240 | |||
| 1637 | Ga0466967_0202071 | |||
| 1638 | Ga0466967_0216216 | |||
| 1639 | Ga0466967_0268082 | |||
| 1640 | Ga0466967_0411042 | |||
| 1641 | Ga0466967_0515986 | |||
| 1642 | Ga0466967_0625435 | |||
| 1643 | Ga0466967_0838471 | |||
| 1644 | Ga0466967_0964870 | |||
| 1645 | Ga0466967_1484649 | |||
| 1646 | Ga0495592_0011127 | |||
| 1647 | Ga0495592_0104861 | |||
| 1648 | Ga0495603_0001320 | |||
| 1649 | Ga0495603_0008054 | |||
| 1650 | Ga0495591_052977 | |||
| 1651 | Ga0495629_0000652 | |||
| 1652 | Ga0495641_0000703 | |||
| 1653 | Ga0495641_0006618 | |||
| 1654 | Ga0495651_0000079 | |||
| 1655 | Ga0495651_0028764 | |||
| 1656 | Ga0495653_0133671 | |||
| 1657 | Ga0495653_0302284 | |||
| 1658 | Ga0495582_0013092 | |||
| 1659 | Ga0495582_0169731 | |||
| 1660 | Ga0495605_0032201 | |||
| 1661 | Ga0495639_0000408 | |||
| 1662 | Ga0495662_0006922 | |||
| 1663 | Ga0495664_0097664 | |||
| 1664 | Ga0495584_0032815 | |||
| 1665 | Ga0495585_0105679 | |||
| 1666 | Ga0495594_0044943 | |||
| 1667 | Ga0495594_0105482 | |||
| 1668 | Ga0495596_0214653 | |||
| 1669 | Ga0495608_0009712 | |||
| 1670 | Ga0495616_0303077 | |||
| 1671 | Ga0495618_0019442 | |||
| 1672 | Ga0495618_0168039 | |||
| 1673 | Ga0495618_0589550 | |||
| 1674 | Ga0495620_0284165 | |||
| 1675 | Ga0495628_0046644 | |||
| 1676 | Ga0495630_0007948 | |||
| 1677 | Ga0495630_0470840 | |||
| 1678 | Ga0495637_0048957 | |||
| 1679 | Ga0495644_0002314 | |||
| 1680 | Ga0495644_0107997 | |||
| 1681 | Ga0495663_0084347 | |||
| 1682 | Ga0495666_0000781 | |||
| 1683 | Ga0495642_0166033 | |||
| 1684 | Ga0495652_0014199 | |||
| 1685 | Ga0495652_0087582 | |||
| 1686 | Ga0495665_0000516 | |||
| 1687 | Ga0495640_0015955 | |||
| 1688 | Ga0495640_0030512 | |||
| 1689 | Ga0495586_0004434 | |||
| 1690 | Ga0495586_0039827 | |||
| 1691 | Ga0495586_0657703 | |||
| 1692 | Ga0495587_0013791 | |||
| 1693 | Ga0495598_0000360 | |||
| 1694 | Ga0495598_0054149 | |||
| 1695 | Ga0495609_0042331 | |||
| 1696 | Ga0495645_0014632 | |||
| 1697 | Ga0495645_0445209 | |||
| 1698 | Ga0495633_0140484 | |||
| 1699 | Ga0495667_0043633 | |||
| 1700 | Ga0495667_0055694 | |||
| 1701 | Ga0495667_0374235 | |||
| 1702 | Ga0495656_0000659 | |||
| 1703 | Ga0495656_0035906 | |||
| 1704 | Ga0495668_0101751 | |||
| 1705 | Ga0495668_0298502 | |||
| 1706 | Ga0495634_0000699 | |||
| 1707 | Ga0495634_0053466 | |||
| 1708 | Ga0495634_0277235 | |||
| 1709 | Ga0495635_0006319 | |||
| 1710 | Ga0495635_0006541 | |||
| 1711 | Ga0495635_0012916 | |||
| 1712 | Ga0495659_0008450 | |||
| 1713 | Ga0495661_0031524 | |||
| 1714 | Ga0495588_0000837 | |||
| 1715 | Ga0495657_0068610 | |||
| 1716 | Ga0495599_0080327 | |||
| 1717 | Ga0495623_0094873 | |||
| 1718 | Ga0495646_0003687 | |||
| 1719 | Ga0495646_0050105 | |||
| 1720 | Ga0495647_0000056 | |||
| 1721 | Ga0495658_0000118 | |||
| 1722 | Ga0495613_0003794 | |||
| 1723 | Ga0495613_0084003 | |||
| 1724 | Ga0495613_0358218 | |||
| 1725 | Ga0495624_0000683 | |||
| 1726 | Ga0495671_0120572 | |||
| 1727 | Ga0495589_0028936 | |||
| 1728 | Ga0495600_0008499 | |||
| 1729 | Ga0495600_0133071 | |||
| 1730 | Ga0495581_0002405 | |||
| 1731 | Ga0495581_0121710 | |||
| 1732 | Ga0495636_0020791 | |||
| 1733 | Ga0495674_0007525 | |||
| 1734 | Ga0495674_0030199 | |||
| 1735 | Ga0495674_0526698 | |||
| 1736 | Ga0495676_0027302 | |||
| 1737 | Ga0495676_0442008 | |||
| 1738 | Ga0495680_0000698 | |||
| 1739 | Ga0495680_0006170 | |||
| 1740 | Ga0495683_0305116 | |||
| 1741 | Ga0495675_0126191 | |||
| 1742 | Ga0495677_0041073 | |||
| 1743 | Ga0495684_0061019 | |||
| 1744 | Ga0495593_0015952 | |||
| 1745 | Ga0495602_0115413 | |||
| 1746 | Ga0495614_0012341 | |||
| 1747 | Ga0495615_0029386 | |||
| 1748 | Ga0495615_0042775 | |||
| 1749 | Ga0496100_0032892 | |||
| 1750 | Ga0496100_0471235 | |||
| 1751 | Ga0496101_0061737 | |||
| 1752 | Ga0496101_0239022 | |||
| 1753 | Ga0496102_0002120 | |||
| 1754 | Ga0496102_0146583 | |||
| 1755 | Ga0496102_0815496 | |||
| 1756 | Ga0496102_1122213 | |||
| 1757 | Ga0496102_1588567 | |||
| 1758 | Ga0496103_0036423 | |||
| 1759 | Ga0496104_0052045 | |||
| 1760 | Ga0496104_0088642 | |||
| 1761 | Ga0496104_0297403 | |||
| 1762 | Ga0496104_0313711 | |||
| 1763 | Ga0496104_0548189 | |||
| 1764 | Ga0496104_0843500 | |||
| 1765 | Ga0496105_0127319 | |||
| 1766 | Ga0496105_0439634 | |||
| 1767 | Ga0496105_0489758 | |||
| 1768 | Ga0496106_0000632 | |||
| 1769 | Ga0496106_0186295 | |||
| 1770 | Ga0496106_0513619 | |||
| 1771 | Ga0496107_0295143 | |||
| 1772 | Ga0496108_0000018 | |||
| 1773 | Ga0496108_0011820 | |||
| 1774 | Ga0496108_0023835 | |||
| 1775 | Ga0496108_0029999 | |||
| 1776 | Ga0496108_0096698 | |||
| 1777 | Ga0496108_0476455 | |||
| 1778 | Ga0496108_0510328 | |||
| 1779 | Ga0496108_0694851 | |||
| 1780 | Ga0496109_0029420 | |||
| 1781 | Ga0496109_0053838 | |||
| 1782 | Ga0496109_0314511 | |||
| 1783 | Ga0496109_0943913 | |||
| 1784 | Ga0496110_0027938 | |||
| 1785 | Ga0496110_0029823 | |||
| 1786 | Ga0496110_0050270 | |||
| 1787 | Ga0496111_0024685 | |||
| 1788 | Ga0496111_0057308 | |||
| 1789 | Ga0496111_0118802 | |||
| 1790 | Ga0496111_0158593 | |||
| 1791 | Ga0496111_0295988 | |||
| 1792 | Ga0496112_0038187 | |||
| 1793 | Ga0496112_0053393 | |||
| 1794 | Ga0496112_0138074 | |||
| 1795 | Ga0496112_1203625 | |||
| 1796 | Ga0496113_0038680 | |||
| 1797 | Ga0496113_0073689 | |||
| 1798 | Ga0496113_0219688 | |||
| 1799 | Ga0496113_0560580 | |||
| 1800 | Ga0496114_0017063 | |||
| 1801 | Ga0496114_0100527 | |||
| 1802 | Ga0496115_0135231 | |||
| 1803 | Ga0496115_0565590 | |||
| 1804 | Ga0496115_0764156 | |||
| 1805 | Ga0496116_0045085 | |||
| 1806 | Ga0496117_0030433 | |||
| 1807 | Ga0496119_0001521 | |||
| 1808 | Ga0496120_0001525 | |||
| 1809 | Ga0496122_0042166 | |||
| 1810 | Ga0496122_0084576 | |||
| 1811 | Ga0496124_0000542 | |||
| 1812 | Ga0496126_0001205 | |||
| 1813 | Ga0496126_0001917 | |||
| 1814 | Ga0496126_0069612 | |||
| 1815 | Ga0501298_037448 | |||
| 1816 | Ga0501318_004734 | |||
| 1817 | Ga0501031_0015731 | |||
| 1818 | Ga0501031_0033843 | |||
| 1819 | Ga0501031_0512277 | |||
| 1820 | Ga0501031_0612357 | |||
| 1821 | Ga0501032_0006296 | |||
| 1822 | Ga0501033_0013749 | |||
| 1823 | Ga0501033_0104874 | |||
| 1824 | Ga0501033_0130933 | |||
| 1825 | Ga0501034_0202941 | |||
| 1826 | Ga0501034_0896110 | |||
| 1827 | Ga0501036_0053301 | |||
| 1828 | Ga0501036_0126028 | |||
| 1829 | Ga0501036_0313703 | |||
| 1830 | Ga0501037_0002416 | |||
| 1831 | Ga0501037_0003569 | |||
| 1832 | Ga0501038_0015173 | |||
| 1833 | Ga0501038_0016532 | |||
| 1834 | Ga0501038_0251188 | |||
| 1835 | Ga0501038_0493085 | |||
| 1836 | Ga0501039_0069171 | |||
| 1837 | Ga0501039_0136030 | |||
| 1838 | Ga0501039_0442603 | |||
| 1839 | Ga0501040_0010354 | |||
| 1840 | Ga0501040_0021154 | |||
| 1841 | Ga0501040_0035784 | |||
| 1842 | Ga0501040_0356980 | |||
| 1843 | Ga0501040_0629179 | |||
| 1844 | Ga0501041_0105846 | |||
| 1845 | Ga0501042_0075035 | |||
| 1846 | Ga0501043_0003176 | |||
| 1847 | Ga0501043_0004360 | |||
| 1848 | Ga0501043_0096804 | |||
| 1849 | Ga0501043_0250677 | |||
| 1850 | Ga0501043_0401113 | |||
| 1851 | Ga0501046_0067141 | |||
| 1852 | Ga0501046_0105544 | |||
| 1853 | Ga0501047_0112038 | |||
| 1854 | Ga0501048_0024791 | |||
| 1855 | Ga0501048_0088159 | |||
| 1856 | Ga0501048_0641424 | |||
| 1857 | Ga0501048_0945224 | |||
| 1858 | Ga0501067_0031570 | |||
| 1859 | Ga0501068_0003054 | |||
| 1860 | Ga0501068_0077176 | |||
| 1861 | Ga0501068_0116968 | |||
| 1862 | Ga0501068_0131899 | |||
| 1863 | Ga0501068_0354505 | |||
| 1864 | Ga0501069_0030265 | |||
| 1865 | Ga0501070_0021366 | |||
| 1866 | Ga0501070_0299345 | |||
| 1867 | Ga0501071_0011761 | |||
| 1868 | Ga0501071_0087584 | |||
| 1869 | Ga0501071_0173241 | |||
| 1870 | Ga0501071_0557162 | |||
| 1871 | Ga0501072_0034193 | |||
| 1872 | Ga0501072_0071127 | |||
| 1873 | Ga0501072_0508921 | |||
| 1874 | Ga0501073_0016095 | |||
| 1875 | Ga0501073_0077723 | |||
| 1876 | Ga0501074_0015182 | |||
| 1877 | Ga0501074_0072257 | |||
| 1878 | Ga0501074_0101069 | |||
| 1879 | Ga0501075_0016652 | |||
| 1880 | Ga0501075_0036049 | |||
| 1881 | Ga0501075_0054999 | |||
| 1882 | Ga0501075_0281617 | |||
| 1883 | Ga0501075_0329467 | |||
| 1884 | Ga0501075_0467857 | |||
| 1885 | Ga0501076_0003206 | |||
| 1886 | Ga0501076_0019371 | |||
| 1887 | Ga0501076_0080098 | |||
| 1888 | Ga0501076_0385430 | |||
| 1889 | Ga0501077_0010639 | |||
| 1890 | Ga0501077_0015144 | |||
| 1891 | Ga0501077_0058883 | |||
| 1892 | Ga0501077_0116202 | |||
| 1893 | Ga0501077_0276308 | |||
| 1894 | Ga0501077_0353544 | |||
| 1895 | Ga0501253_109589 | |||
| 1896 | Ga0501079_0009708 | |||
| 1897 | Ga0501079_0036553 | |||
| 1898 | Ga0501079_0668699 | |||
| 1899 | Ga0501080_0017241 | |||
| 1900 | Ga0501080_0031418 | |||
| 1901 | Ga0501080_0449466 | |||
| 1902 | Ga0501080_0696196 | |||
| 1903 | Ga0501080_0717553 | |||
| 1904 | Ga0501081_0008906 | |||
| 1905 | Ga0501081_0014467 | |||
| 1906 | Ga0501081_0499945 | |||
| 1907 | Ga0501083_0022959 | |||
| 1908 | Ga0501083_0038256 | |||
| 1909 | Ga0501083_0066068 | |||
| 1910 | Ga0501035_0071187 | |||
| 1911 | Ga0501035_0074372 | |||
| 1912 | Ga0501035_0309396 | |||
| 1913 | Ga0501044_0005084 | |||
| 1914 | Ga0501044_0010145 | |||
| 1915 | Ga0501044_0187354 | |||
| 1916 | Ga0501044_0805097 | |||
| 1917 | Ga0501045_0099160 | |||
| 1918 | Ga0501045_0116735 | |||
| 1919 | Ga0501045_0194924 | |||
| 1920 | Ga0501045_0401640 | |||
| 1921 | nmdc:mga05p37_1322812_c1 | |||
| 1922 | nmdc:mga05p37_36435_c1 | |||
| 1923 | nmdc:mga05p37_370336_c1 | |||
| 1924 | nmdc:mga05p37_611200_c1 | |||
| 1925 | nmdc:mga05p37_66787_c2 | |||
| 1926 | nmdc:mga05p37_7439_c1 | |||
| 1927 | nmdc:mga05p37_752672_c1 | |||
| 1928 | nmdc:mga09592_223466_c1 | |||
| 1929 | nmdc:mga09592_502223_c1 | |||
| 1930 | nmdc:mga09592_521683_c1 | |||
| 1931 | nmdc:mga06r32_141_c7 | |||
| 1932 | nmdc:mga06r32_870614_c1 | |||
| 1933 | nmdc:mga08y16_19182_c1 | |||
| 1934 | nmdc:mga08y16_527869_c1 | |||
| 1935 | nmdc:mga0n895_15482_c1 | |||
| 1936 | nmdc:mga0rr50_836884_c1 | |||
| 1937 | nmdc:mga0rr50_9709_c1 | |||
| 1938 | nmdc:mga0a205_114554_c1 | |||
| 1939 | Ga0495601_0004034 | |||
| 1940 | Ga0495601_0060188 | |||
| 1941 | Ga0495612_0002970 | |||
| 1942 | Ga0495612_0026655 | |||
| 1943 | Ga0495612_0040647 | |||
| 1944 | Ga0495655_0005422 | |||
| 1945 | Ga0495655_0061606 | |||
| 1946 | Ga0495595_0031659 | |||
| 1947 | Ga0495619_0002469 | |||
| 1948 | Ga0495619_0007996 | |||
| 1949 | Ga0495619_0070251 | |||
| 1950 | Ga0500559_0004191 | |||
| 1951 | Ga0500616_0038644 | |||
| 1952 | Ga0501084_0023413 | |||
| 1953 | Ga0501084_0095375 | |||
| 1954 | Ga0501084_0190143 | |||
| 1955 | Ga0501084_0195338 | |||
| 1956 | Ga0590075_051065 | |||
| 1957 | Ga0501082_0027993 | |||
| 1958 | Ga0501082_0068293 | |||
| 1959 | Ga0501082_0329377 | |||
| 1960 | Ga0501082_0610630 | |||
| 1961 | Ga0466962_0001664 | |||
| 1962 | Ga0466962_0059383 | |||
| 1963 | Ga0466962_0078777 | |||
| 1964 | Ga0466962_0082782 | |||
| 1965 | Ga0466962_0083532 | |||
| 1966 | Ga0466962_0161316 | |||
| 1967 | Ga0530510_0011756 | |||
| 1968 | Ga0530510_0132308 | |||
| 1969 | Ga0530510_0208838 | |||
| 1970 | Ga0530510_0306137 | |||
| 1971 | Ga0530510_0409020 | |||
| 1972 | 2559427603 | |||
| 1973 | 2623499314 | |||
| 1974 | 2776375197 | |||
| 1975 | 2791916869 | |||
| 1976 | 2795780397 | |||
| 1977 | 2795793826 | |||
| 1978 | 2863069479 | |||
| 1979 | 2866612508 | |||
| 1980 | 2899374560 | |||
| 1981 | 8054473679 | |||
| 1982 | 8056209741 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o7m-assembly1.cif.gz_D | 1.98 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' | 0.9797 | 12 | 181 |
| 3acc-assembly1.cif.gz_A-2 | crystal structure of hypoxanthine-guanine phosphoribosyltransferase with gmp from thermus thermophilus hb8 | 0.979 | 17 | 182 |
| 3ohp-assembly1.cif.gz_D | crystal structure of hgprt from vibrio cholerae | 0.9763 | 14 | 182 |
| 3ohp-assembly1.cif.gz_B | crystal structure of hgprt from vibrio cholerae | 0.9728 | 14 | 182 |
| 4rht-assembly2.cif.gz_B | crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease | 0.9726 | 11 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3acdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9637 | 17 | 182 | 3.40.50.2020 |
| 4rhtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9527 | 11 | 182 | 3.40.50.2020 |
| 4rhtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.947 | 11 | 182 | 3.40.50.2020 |
| 1hgxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9434 | 10 | 185 | 3.40.50.2020 |
| af_I1LDB6_1_185_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9342 | 9 | 185 | 3.40.50.2020 |