F487614

General Info

Members Datasets Scaffolds Average Seq Length
990 503 963 131

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0854883|Ga0436363_0854883_267_680
Length 137
Sequence VKESRISDNDPFGDMRARIRNAAMRKRGKVTSPGSSLRGRVLDVLQSEGYIRGYSTTEFDNGRTEFEIELKYFDNEPVIRRIDRVSKPGRRVYVAVDAMPRVANGLGVSILSTPKGVMADHDAREQNVGGEVLCTVF

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2643221733 Bosea sp. Root381 Isolate Unclassified
5 2643221734 Bosea sp. Root670 Isolate Unclassified
6 2643221736 Bosea sp. Root483D1 Isolate Unclassified
7 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
8 2773857925 Microvirga vignae BR3299 Isolate Unclassified
9 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
10 2818991467 Bosea vestrisii 3192 Isolate Unclassified
11 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
12 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
13 2841760612 Bosea sp. Tri-49 Isolate Nodule
14 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
15 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
16 2844104063 Bosea sp. Tri-39 Isolate Nodule
17 2851182111 Bosea sp. Tri-44 Isolate Nodule
18 2851246043 Bosea sp. Tri-54 Isolate Nodule
19 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
20 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
21 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
22 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
23 2909042592 Labrys sp. LIt4 Isolate Nodule
24 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
25 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
139 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
140 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
141 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
142 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
206 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
207 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
208 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
209 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
224 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
225 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
229 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
243 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
248 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
249 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
250 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
258 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
265 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
266 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
273 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
280 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
283 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
284 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
285 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
286 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
287 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
288 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
289 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
290 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
293 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
294 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
295 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
296 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
297 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
298 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
299 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
300 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
301 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
302 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
303 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
304 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
305 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
306 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
307 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
308 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
313 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
317 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
320 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
325 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
404 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
405 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
406 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
407 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
411 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
412 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
413 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
414 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
415 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
416 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
417 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
418 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
419 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
420 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
421 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
422 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
423 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
424 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
425 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
426 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
427 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
428 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
429 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
430 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
431 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
432 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
433 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
436 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
437 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
438 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
439 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
440 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
441 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
442 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
446 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
447 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
448 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
452 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
453 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
454 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
455 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
456 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
457 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
458 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
459 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
460 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
461 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
462 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
463 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
464 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
465 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
466 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
467 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
468 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
469 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
470 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
471 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
472 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
473 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
474 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
500 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
501 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
502 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
503 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.33
Metatranscriptomes 13.94
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.78
Nodule 1.31
Rhizoplane 4.95
Rhizosphere 79.39
Stem 0
Stem Tuber 0
Unclassified 6.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000038 3300003187 Bacteria 180430
2 JGI25151J46595_10029400 3300003187 Bacteria 2176
3 JGI25165J46597_1000961 3300003214 Bacteria 19619
4 Ga0007410J51695_1051312 3300003574 Bacteria 950
5 Ga0007409J51694_1066553 3300003575 Bacteria 1490
6 Ga0007409J51694_1099358 3300003575 Bacteria 877
7 Ga0007429J51699_1060640 3300003579 Bacteria 1671
8 JGI25404J52841_10003344 3300003659 Bacteria 3159
9 Ga0032354_1108669 3300003693 Bacteria 872
10 Ga0032354_1120138 3300003693 Bacteria 731
11 Ga0055526_1007926 3300003771 Bacteria 5404
12 Ga0055526_1011996 3300003771 Bacteria 3831
13 Ga0055526_1012008 3300003771 Bacteria 3828
14 Ga0055524_1006440 3300003775 Bacteria 5089
15 Ga0055524_1017171 3300003775 Bacteria 2563
16 Ga0065165_1000631 3300005262 Bacteria 51108
17 Ga0070658_10015385 3300005327 Bacteria 6123
18 Ga0070658_10025403 3300005327 Bacteria 4749
19 Ga0070658_10040606 3300005327 Bacteria 3754
20 Ga0070658_10543772 3300005327 Bacteria 1005
21 Ga0070658_10934740 3300005327 Bacteria 754
22 Ga0070676_10549892 3300005328 Bacteria 826
23 Ga0070670_100651452 3300005331 Bacteria 945
24 Ga0068869_100549502 3300005334 Bacteria 970
25 Ga0068868_100515613 3300005338 Bacteria 1049
26 Ga0070660_100004846 3300005339 Bacteria 9293
27 Ga0070660_100011745 3300005339 Bacteria 6236
28 Ga0070660_100062412 3300005339 Bacteria 2894
29 Ga0070660_100383367 3300005339 Bacteria 1161
30 Ga0070660_101904245 3300005339 Bacteria 507
31 Ga0070689_101171007 3300005340 Bacteria 689
32 Ga0070691_10182111 3300005341 Bacteria 1094
33 Ga0070687_100449453 3300005343 Bacteria 857
34 Ga0070661_100010348 3300005344 Bacteria 6484
35 Ga0070661_100021704 3300005344 Bacteria 4590
36 Ga0070692_10335754 3300005345 Bacteria 934
37 Ga0070668_100070464 3300005347 Bacteria 2722
38 Ga0070668_100267353 3300005347 Bacteria 1424
39 Ga0070668_100556489 3300005347 Bacteria 999
40 Ga0070668_100996861 3300005347 Bacteria 753
41 Ga0070669_100776251 3300005353 Bacteria 813
42 Ga0070671_100785994 3300005355 Bacteria 828
43 Ga0070674_100022024 3300005356 Bacteria 4104
44 Ga0070674_100814071 3300005356 Bacteria 807
45 Ga0070673_100171656 3300005364 Bacteria 1851
46 Ga0070673_100320084 3300005364 Bacteria 1370
47 Ga0070673_100366749 3300005364 Bacteria 1281
48 Ga0070659_100048719 3300005366 Bacteria 3329
49 Ga0070659_100774510 3300005366 Bacteria 833
50 Ga0070709_10641614 3300005434 Bacteria 821
51 Ga0070714_100109782 3300005435 Bacteria 2441
52 Ga0070714_100971260 3300005435 Bacteria 826
53 Ga0070714_101364993 3300005435 Bacteria 692
54 Ga0070711_100568848 3300005439 Bacteria 942
55 Ga0070711_100689944 3300005439 Bacteria 859
56 Ga0070705_100613714 3300005440 Bacteria 843
57 Ga0070700_100063876 3300005441 Bacteria 2330
58 Ga0070694_100392764 3300005444 Bacteria 1084
59 Ga0070663_100263402 3300005455 Bacteria 1368
60 Ga0070663_100519849 3300005455 Bacteria 991
61 Ga0070663_101416177 3300005455 Bacteria 616
62 Ga0070678_100462878 3300005456 Bacteria 1113
63 Ga0070678_100961738 3300005456 Bacteria 783
64 Ga0070662_100952996 3300005457 Bacteria 734
65 Ga0070681_11031567 3300005458 Bacteria 743
66 Ga0068867_100133734 3300005459 Bacteria 1930
67 Ga0068867_100254901 3300005459 Bacteria 1428
68 Ga0070679_100048764 3300005530 Bacteria 4218
69 Ga0070679_100590914 3300005530 Bacteria 1053
70 Ga0070684_100219672 3300005535 Bacteria 1734
71 Ga0070697_100005582 3300005536 Bacteria 9698
72 Ga0068853_101027538 3300005539 Bacteria 794
73 Ga0070672_100153763 3300005543 Bacteria 1904
74 Ga0070695_100007388 3300005545 Bacteria 6517
75 Ga0070693_100593988 3300005547 Bacteria 798
76 Ga0070665_100212441 3300005548 Bacteria 1935
77 Ga0070665_100421454 3300005548 Bacteria 1343
78 Ga0070665_100639456 3300005548 Bacteria 1077
79 Ga0070665_100936261 3300005548 Bacteria 879
80 Ga0068855_100018562 3300005563 Bacteria 8363
81 Ga0068855_100034672 3300005563 Bacteria 6015
82 Ga0070664_100181128 3300005564 Bacteria 1872
83 Ga0068857_100071599 3300005577 Bacteria 3088
84 Ga0068857_100547441 3300005577 Bacteria 1090
85 Ga0068854_100008442 3300005578 Bacteria 6621
86 Ga0068854_101588108 3300005578 Bacteria 596
87 Ga0068856_100068108 3300005614 Bacteria 3518
88 Ga0068856_100283714 3300005614 Bacteria 1673
89 Ga0068856_100384103 3300005614 Bacteria 1424
90 Ga0070702_100133794 3300005615 Bacteria 1570
91 Ga0068852_100009612 3300005616 Bacteria 7185
92 Ga0068852_100023465 3300005616 Bacteria 4966
93 Ga0068852_100984811 3300005616 Bacteria 862
94 Ga0068859_101925387 3300005617 Bacteria 653
95 Ga0068866_10304780 3300005718 Bacteria 996
96 Ga0068866_10470237 3300005718 Bacteria 826
97 Ga0068861_100214013 3300005719 Bacteria 1625
98 Ga0068851_10120448 3300005834 Bacteria 1410
99 Ga0068870_10529583 3300005840 Bacteria 790
100 Ga0068862_100691568 3300005844 Bacteria 987
101 Ga0081455_10001008 3300005937 Bacteria 35646
102 Ga0081538_10368833 3300005981 Bacteria 518
103 Ga0081540_1000645 3300005983 Bacteria 33098
104 Ga0075365_10442619 3300006038 Bacteria 918
105 Ga0075365_10662485 3300006038 Bacteria 738
106 Ga0075368_10066230 3300006042 Bacteria 1452
107 Ga0075363_100049305 3300006048 Bacteria 2242
108 Ga0075363_100387290 3300006048 Bacteria 820
109 Ga0075364_10299311 3300006051 Bacteria 1095
110 Ga0070716_100894376 3300006173 Bacteria 695
111 Ga0070712_100393545 3300006175 Bacteria 1143
112 Ga0075362_10244512 3300006177 Bacteria 882
113 Ga0075367_10075360 3300006178 Bacteria 2035
114 Ga0075369_10014440 3300006186 Bacteria 3154
115 Ga0075369_10194209 3300006186 Bacteria 936
116 Ga0075369_10234943 3300006186 Bacteria 850
117 Ga0075366_10132234 3300006195 Bacteria 1506
118 Ga0075366_10696681 3300006195 Bacteria 631
119 Ga0097621_100176251 3300006237 Bacteria 1845
120 Ga0075370_10277672 3300006353 Bacteria 995
121 Ga0068871_100584219 3300006358 Bacteria 1014
122 Ga0068871_100624673 3300006358 Bacteria 981
123 Ga0075428_100717334 3300006844 Bacteria 1065
124 Ga0075433_10001194 3300006852 Bacteria 18909
125 Ga0075434_100004950 3300006871 Bacteria 12081
126 Ga0075429_100661389 3300006880 Bacteria 915
127 Ga0068865_100185308 3300006881 Bacteria 1605
128 Ga0068865_101377807 3300006881 Bacteria 629
129 Ga0068865_101389042 3300006881 Bacteria 627
130 Ga0075436_100014756 3300006914 Bacteria 5354
131 Ga0075436_100997377 3300006914 Bacteria 628
132 Ga0097620_101925399 3300006931 Bacteria 653
133 Ga0075435_100018035 3300007076 Bacteria 5355
134 Ga0075435_100026460 3300007076 Bacteria 4526
135 Ga0105240_10038434 3300009093 Bacteria 6139
136 Ga0105240_10141214 3300009093 Bacteria 2879
137 Ga0105240_10662586 3300009093 Bacteria 1143
138 Ga0105240_12407093 3300009093 Bacteria 545
139 Ga0111539_10023484 3300009094 Bacteria 7576
140 Ga0111539_11073743 3300009094 Bacteria 936
141 Ga0105245_10243528 3300009098 Bacteria 1744
142 Ga0105247_11130999 3300009101 Bacteria 619
143 Ga0105243_10200032 3300009148 Bacteria 1751
144 Ga0105243_10996934 3300009148 Bacteria 840
145 Ga0105241_11196004 3300009174 Bacteria 720
146 Ga0105237_10268995 3300009545 Bacteria 1707
147 Ga0105238_10164963 3300009551 Bacteria 2190
148 Ga0105238_10224998 3300009551 Bacteria 1853
149 Ga0105238_10969946 3300009551 Bacteria 870
150 Ga0105238_11589277 3300009551 Bacteria 684
151 Ga0105249_10154860 3300009553 Bacteria 2209
152 Ga0105239_10067735 3300010375 Bacteria 3922
153 Ga0105239_10373217 3300010375 Bacteria 1612
154 Ga0105239_10484555 3300010375 Bacteria 1405
155 Ga0105239_10861177 3300010375 Bacteria 1039
156 Ga0157370_10089218 3300013104 Bacteria 2896
157 Ga0157370_10390973 3300013104 Bacteria 1280
158 Ga0157370_10667392 3300013104 Bacteria 950
159 Ga0157370_10955547 3300013104 Bacteria 777
160 Ga0157369_10038065 3300013105 Bacteria 5262
161 Ga0171462_1042 3300013250 Bacteria 66199
162 Ga0157374_10335720 3300013296 Bacteria 1500
163 Ga0157378_10621501 3300013297 Bacteria 1093
164 Ga0163162_10498696 3300013306 Bacteria 1348
165 Ga0157372_10692730 3300013307 Bacteria 1186
166 Ga0157372_10700197 3300013307 Bacteria 1179
167 Ga0157372_12249984 3300013307 Bacteria 626
168 Ga0157375_10285686 3300013308 Bacteria 1813
169 Ga0157375_13024890 3300013308 Bacteria 561
170 Ga0163163_13035012 3300014325 Bacteria 524
171 Ga0157380_10008515 3300014326 Bacteria 7329
172 Ga0182008_10552102 3300014497 Bacteria 640
173 Ga0182008_10769198 3300014497 Bacteria 556
174 Ga0157377_10105601 3300014745 Bacteria 1686
175 Ga0157379_10158245 3300014968 Bacteria 2044
176 Ga0206356_10625610 3300020070 Bacteria 979
177 Ga0213873_10042510 3300021358 Bacteria 1175
178 Ga0213872_10006909 3300021361 Bacteria 5647
179 Ga0213872_10012804 3300021361 Bacteria 3938
180 Ga0213872_10021018 3300021361 Bacteria 3005
181 Ga0213872_10077193 3300021361 Bacteria 1498
182 Ga0213872_10086084 3300021361 Bacteria 1408
183 Ga0213872_10111276 3300021361 Bacteria 1216
184 Ga0213872_10356256 3300021361 Bacteria 599
185 Ga0213874_10030386 3300021377 Bacteria 1556
186 Ga0213874_10089747 3300021377 Bacteria 1008
187 Ga0213876_10003867 3300021384 Bacteria 8462
188 Ga0213876_10016751 3300021384 Bacteria 3872
189 Ga0213876_10017136 3300021384 Bacteria 3825
190 Ga0213875_10008348 3300021388 Bacteria 5309
191 Ga0213871_10027257 3300021441 Bacteria 1466
192 Ga0213871_10102972 3300021441 Bacteria 837
193 Ga0256744_103834 3300023309 Bacteria 772
194 Ga0256743_116418 3300023436 Bacteria 615
195 Ga0256720_144321 3300023438 Bacteria 722
196 Ga0207427_105022 3300025231 Bacteria 1988
197 Ga0209233_1000293 3300025261 Bacteria 63470
198 Ga0209130_1001794 3300025284 Bacteria 12605
199 Ga0209675_1002527 3300025291 Bacteria 9311
200 Ga0209676_1111893 3300025292 Bacteria 562
201 Ga0209025_1000014 3300025294 Bacteria 865448
202 Ga0209025_1012375 3300025294 Bacteria 5477
203 Ga0209025_1083054 3300025294 Bacteria 1079
204 Ga0209564_1002872 3300025295 Bacteria 12632
205 Ga0209564_1003215 3300025295 Bacteria 11464
206 Ga0209256_1000108 3300025299 Bacteria 185884
207 Ga0209256_1000540 3300025299 Bacteria 54759
208 Ga0207426_1004654 3300025302 Bacteria 6596
209 Ga0209257_1025525 3300025304 Bacteria 2016
210 Ga0207656_10070969 3300025321 Bacteria 1547
211 Ga0207642_10228685 3300025899 Bacteria 1044
212 Ga0207688_10011717 3300025901 Bacteria 4770
213 Ga0207688_10177527 3300025901 Bacteria 1269
214 Ga0207688_10310436 3300025901 Bacteria 966
215 Ga0207647_10047848 3300025904 Bacteria 2658
216 Ga0207647_10121245 3300025904 Bacteria 1542
217 Ga0207645_10035969 3300025907 Bacteria 3179
218 Ga0207645_10291700 3300025907 Bacteria 1085
219 Ga0207643_10552321 3300025908 Bacteria 739
220 Ga0207643_10766157 3300025908 Bacteria 625
221 Ga0207705_10001453 3300025909 Bacteria 18913
222 Ga0207705_10070578 3300025909 Bacteria 2532
223 Ga0207705_10891694 3300025909 Bacteria 689
224 Ga0207684_10499689 3300025910 Bacteria 1042
225 Ga0207654_10179626 3300025911 Bacteria 1380
226 Ga0207654_10229343 3300025911 Bacteria 1236
227 Ga0207707_10877950 3300025912 Bacteria 743
228 Ga0207695_10002347 3300025913 Bacteria 28115
229 Ga0207695_10058589 3300025913 Bacteria 3997
230 Ga0207695_10125896 3300025913 Bacteria 2524
231 Ga0207671_10610727 3300025914 Bacteria 869
232 Ga0207671_11120025 3300025914 Bacteria 618
233 Ga0207663_11339655 3300025916 Unclassified 576
234 Ga0207657_10008060 3300025919 Bacteria 10742
235 Ga0207657_10043012 3300025919 Bacteria 3982
236 Ga0207657_10054867 3300025919 Bacteria 3444
237 Ga0207657_10887479 3300025919 Bacteria 687
238 Ga0207649_10057628 3300025920 Bacteria 2430
239 Ga0207649_10123886 3300025920 Bacteria 1746
240 Ga0207652_10485160 3300025921 Bacteria 1113
241 Ga0207694_10072325 3300025924 Bacteria 2696
242 Ga0207694_10161581 3300025924 Bacteria 1809
243 Ga0207694_10692700 3300025924 Bacteria 859
244 Ga0207694_11038132 3300025924 Bacteria 694
245 Ga0207650_10929033 3300025925 Bacteria 739
246 Ga0207659_10167580 3300025926 Bacteria 1730
247 Ga0207700_10618288 3300025928 Bacteria 965
248 Ga0207664_10073108 3300025929 Bacteria 2766
249 Ga0207664_10177988 3300025929 Bacteria 1825
250 Ga0207690_10039549 3300025932 Bacteria 3078
251 Ga0207690_10146492 3300025932 Bacteria 1746
252 Ga0207706_10017594 3300025933 Bacteria 6440
253 Ga0207706_10542975 3300025933 Bacteria 1001
254 Ga0207709_10362890 3300025935 Bacteria 1097
255 Ga0207670_10658740 3300025936 Bacteria 864
256 Ga0207669_10040699 3300025937 Bacteria 2698
257 Ga0207669_10618331 3300025937 Bacteria 882
258 Ga0207704_11029964 3300025938 Bacteria 697
259 Ga0207704_11094741 3300025938 Bacteria 677
260 Ga0207691_10003340 3300025940 Bacteria 15620
261 Ga0207691_10995317 3300025940 Bacteria 700
262 Ga0207689_10975916 3300025942 Bacteria 715
263 Ga0207689_11214199 3300025942 Bacteria 635
264 Ga0207679_10039615 3300025945 Bacteria 3367
265 Ga0207667_10000877 3300025949 Bacteria 38435
266 Ga0207667_10002756 3300025949 Bacteria 21724
267 Ga0207667_10019501 3300025949 Bacteria 7568
268 Ga0207651_10311804 3300025960 Bacteria 1312
269 Ga0207651_11069737 3300025960 Bacteria 722
270 Ga0207668_10546949 3300025972 Bacteria 1002
271 Ga0207668_10967315 3300025972 Bacteria 760
272 Ga0207668_11034164 3300025972 Bacteria 735
273 Ga0207640_10023318 3300025981 Bacteria 3717
274 Ga0207640_11395091 3300025981 Bacteria 627
275 Ga0207677_10468229 3300026023 Bacteria 1083
276 Ga0207677_11095957 3300026023 Bacteria 726
277 Ga0207703_11987339 3300026035 Bacteria 558
278 Ga0207639_10151732 3300026041 Bacteria 1941
279 Ga0207639_10196410 3300026041 Bacteria 1727
280 Ga0207678_10022593 3300026067 Bacteria 5509
281 Ga0207678_10298726 3300026067 Bacteria 1384
282 Ga0207678_10522609 3300026067 Bacteria 1036
283 Ga0207678_10693957 3300026067 Bacteria 896
284 Ga0207708_10112333 3300026075 Bacteria 2116
285 Ga0207702_10167468 3300026078 Bacteria 2011
286 Ga0207702_10193787 3300026078 Bacteria 1880
287 Ga0207648_10105542 3300026089 Bacteria 2472
288 Ga0207648_10299667 3300026089 Bacteria 1441
289 Ga0207674_10065457 3300026116 Bacteria 3663
290 Ga0207674_10955653 3300026116 Bacteria 825
291 Ga0207675_100229874 3300026118 Bacteria 1789
292 Ga0207675_100412225 3300026118 Bacteria 1333
293 Ga0207675_100951766 3300026118 Bacteria 876
294 Ga0207683_10359400 3300026121 Bacteria 1337
295 Ga0207683_10398170 3300026121 Bacteria 1266
296 Ga0207698_10009953 3300026142 Bacteria 6083
297 Ga0207698_10084824 3300026142 Bacteria 2569
298 Ga0207698_12272721 3300026142 Bacteria 554
299 Ga0209813_10088547 3300027866 Bacteria 1035
300 Ga0207428_10371812 3300027907 Bacteria 1050
301 Ga0268266_10085002 3300028379 Bacteria 2764
302 Ga0268266_10187330 3300028379 Bacteria 1888
303 Ga0268266_10519989 3300028379 Bacteria 1138
304 Ga0268266_10774341 3300028379 Bacteria 926
305 Ga0268265_10989906 3300028380 Bacteria 830
306 Ga0265318_10015702 3300028577 Bacteria 3142
307 Ga0265318_10102029 3300028577 Bacteria 1055
308 Ga0307517_10174085 3300028786 Bacteria 1407
309 Ga0307515_10099360 3300028794 Bacteria 3534
310 Ga0265338_10005387 3300028800 Bacteria 16717
311 Ga0265338_10069087 3300028800 Bacteria 3038
312 Ga0311000_107819 3300029272 Bacteria 758
313 Ga0311004_158584 3300029276 Bacteria 776
314 Ga0311001_1103890 3300029277 Bacteria 1796
315 Ga0310981_1004097 3300029285 Bacteria 1425
316 Ga0265762_1030167 3300030760 Bacteria 1028
317 Ga0265762_1115148 3300030760 Bacteria 610
318 Ga0265330_10006774 3300031235 Bacteria 5647
319 Ga0265330_10046222 3300031235 Bacteria 1918
320 Ga0265330_10149118 3300031235 Bacteria 994
321 Ga0265330_10156425 3300031235 Bacteria 968
322 Ga0265330_10179775 3300031235 Bacteria 896
323 Ga0265330_10180753 3300031235 Bacteria 893
324 Ga0265330_10211989 3300031235 Bacteria 818
325 Ga0265330_10280996 3300031235 Bacteria 701
326 Ga0265330_10348479 3300031235 Bacteria 625
327 Ga0265330_10350569 3300031235 Bacteria 623
328 Ga0265330_10354749 3300031235 Bacteria 619
329 Ga0265332_10012013 3300031238 Bacteria 3845
330 Ga0265332_10117030 3300031238 Bacteria 1120
331 Ga0265332_10270892 3300031238 Bacteria 702
332 Ga0265328_10000041 3300031239 Bacteria 89398
333 Ga0265328_10000129 3300031239 Bacteria 36422
334 Ga0265328_10002900 3300031239 Bacteria 7646
335 Ga0265328_10002943 3300031239 Bacteria 7603
336 Ga0265328_10021114 3300031239 Bacteria 2488
337 Ga0265328_10031155 3300031239 Bacteria 1983
338 Ga0265328_10031723 3300031239 Bacteria 1963
339 Ga0265328_10034301 3300031239 Bacteria 1879
340 Ga0265328_10047389 3300031239 Bacteria 1580
341 Ga0265325_10001732 3300031241 Bacteria 15146
342 Ga0265325_10045461 3300031241 Bacteria 2281
343 Ga0265325_10072848 3300031241 Bacteria 1721
344 Ga0265325_10079474 3300031241 Bacteria 1632
345 Ga0265325_10150945 3300031241 Bacteria 1099
346 Ga0265329_10125809 3300031242 Bacteria 823
347 Ga0265340_10001159 3300031247 Bacteria 15088
348 Ga0265340_10007526 3300031247 Bacteria 5912
349 Ga0265340_10010398 3300031247 Bacteria 4978
350 Ga0265340_10021947 3300031247 Bacteria 3269
351 Ga0265340_10092888 3300031247 Bacteria 1409
352 Ga0265340_10148320 3300031247 Bacteria 1070
353 Ga0265340_10166397 3300031247 Bacteria 1000
354 Ga0265339_10002105 3300031249 Bacteria 14517
355 Ga0265339_10008522 3300031249 Bacteria 6519
356 Ga0265339_10042300 3300031249 Bacteria 2522
357 Ga0265339_10057240 3300031249 Bacteria 2108
358 Ga0265339_10065467 3300031249 Bacteria 1948
359 Ga0265339_10081034 3300031249 Bacteria 1716
360 Ga0265339_10392194 3300031249 Bacteria 650
361 Ga0265339_10527566 3300031249 Bacteria 544
362 Ga0265331_10000090 3300031250 Bacteria 123628
363 Ga0265331_10000186 3300031250 Bacteria 76149
364 Ga0265331_10001125 3300031250 Bacteria 20459
365 Ga0265331_10016732 3300031250 Bacteria 3843
366 Ga0265331_10017155 3300031250 Bacteria 3782
367 Ga0265331_10056585 3300031250 Bacteria 1861
368 Ga0265331_10076846 3300031250 Bacteria 1556
369 Ga0265331_10418434 3300031250 Bacteria 601
370 Ga0265327_10000381 3300031251 Bacteria 83617
371 Ga0265327_10007046 3300031251 Bacteria 8808
372 Ga0265327_10028470 3300031251 Bacteria 3196
373 Ga0265327_10371914 3300031251 Bacteria 623
374 Ga0265316_10015933 3300031344 Bacteria 6544
375 Ga0265316_10039265 3300031344 Bacteria 3802
376 Ga0265316_10188596 3300031344 Bacteria 1532
377 Ga0265316_10507656 3300031344 Bacteria 861
378 Ga0265316_10711285 3300031344 Bacteria 707
379 Ga0265316_11116696 3300031344 Bacteria 546
380 Ga0265316_11279725 3300031344 Bacteria 507
381 Ga0307513_10110246 3300031456 Bacteria 2748
382 Ga0307513_10354100 3300031456 Bacteria 1215
383 Ga0307408_100011406 3300031548 Bacteria 5871
384 Ga0307408_100741874 3300031548 Bacteria 886
385 Ga0265313_10000031 3300031595 Bacteria 128981
386 Ga0265313_10004521 3300031595 Bacteria 10621
387 Ga0265313_10019748 3300031595 Bacteria 3739
388 Ga0265313_10053277 3300031595 Bacteria 1926
389 Ga0265313_10100614 3300031595 Bacteria 1284
390 Ga0265313_10124296 3300031595 Bacteria 1123
391 Ga0307508_10155372 3300031616 Bacteria 1891
392 Ga0307514_10098619 3300031649 Bacteria 2105
393 Ga0316575_10514375 3300031665 Bacteria 520
394 Ga0265314_10000963 3300031711 Bacteria 33816
395 Ga0265314_10008857 3300031711 Bacteria 8590
396 Ga0265314_10028299 3300031711 Bacteria 4180
397 Ga0265314_10072853 3300031711 Bacteria 2293
398 Ga0265314_10095028 3300031711 Bacteria 1930
399 Ga0265314_10107669 3300031711 Bacteria 1778
400 Ga0265314_10461989 3300031711 Bacteria 674
401 Ga0265342_10004137 3300031712 Bacteria 11550
402 Ga0265342_10006333 3300031712 Bacteria 8824
403 Ga0265342_10182071 3300031712 Bacteria 1150
404 Ga0265342_10598166 3300031712 Bacteria 556
405 Ga0316576_10114488 3300031727 Bacteria 2023
406 Ga0316578_10748690 3300031728 Bacteria 568
407 Ga0307405_10055833 3300031731 Bacteria 2474
408 Ga0307405_10104855 3300031731 Bacteria 1903
409 Ga0316577_10407604 3300031733 Bacteria 772
410 Ga0307413_10782991 3300031824 Bacteria 800
411 Ga0307410_10007156 3300031852 Bacteria 6085
412 Ga0307410_11051262 3300031852 Bacteria 704
413 Ga0307410_11084306 3300031852 Bacteria 694
414 Ga0326468_10002218 3300031889 Bacteria 1623
415 Ga0307406_10036624 3300031901 Bacteria 3024
416 Ga0307406_10090266 3300031901 Bacteria 2061
417 Ga0307406_11605471 3300031901 Bacteria 574
418 Ga0307407_10011518 3300031903 Bacteria 4213
419 Ga0307407_10820445 3300031903 Bacteria 709
420 Ga0307412_10053732 3300031911 Bacteria 2671
421 Ga0307412_10262248 3300031911 Bacteria 1348
422 Ga0307409_100004876 3300031995 Bacteria 7628
423 Ga0307409_100286660 3300031995 Bacteria 1525
424 Ga0307409_102919525 3300031995 Bacteria 505
425 Ga0307416_100047875 3300032002 Bacteria 3388
426 Ga0307416_100221340 3300032002 Bacteria 1815
427 Ga0307416_102381471 3300032002 Bacteria 629
428 Ga0307416_102510348 3300032002 Bacteria 614
429 Ga0307414_10075716 3300032004 Bacteria 2443
430 Ga0307414_10287420 3300032004 Bacteria 1385
431 Ga0307411_10091338 3300032005 Bacteria 2126
432 Ga0307411_10479497 3300032005 Bacteria 1047
433 Ga0307411_10995046 3300032005 Bacteria 750
434 Ga0307415_100010922 3300032126 Bacteria 5167
435 Ga0316593_10012327 3300032168 Bacteria 2507
436 Ga0316593_10315192 3300032168 Bacteria 594
437 Ga0307510_10114264 3300033180 Bacteria 2429
438 Ga0316592_1009885 3300033524 Bacteria 1914
439 Ga0316596_1006578 3300033541 Bacteria 2708
440 Ga0373948_0011793 3300034817 Bacteria 1552
441 Ga0373948_0160036 3300034817 Bacteria 567
442 Ga0373948_0170624 3300034817 Bacteria 553
443 Ga0373950_0054200 3300034818 Bacteria 793
444 Ga0373959_0121796 3300034820 Bacteria 638
445 Ga0373959_0142571 3300034820 Bacteria 601
446 Ga0373928_0005729 3300035084 Bacteria 2376
447 Ga0373928_0027736 3300035084 Bacteria 1234
448 Ga0373940_0027123 3300035088 Bacteria 1503
449 Ga0373944_0067559 3300035089 Bacteria 1158
450 Ga0373944_0345386 3300035089 Bacteria 565
451 Ga0373923_0415822 3300035111 Bacteria 649
452 Ga0373932_0084558 3300035112 Bacteria 1008
453 Ga0373936_0008097 3300035113 Bacteria 3952
454 Ga0373939_0068612 3300035114 Bacteria 1148
455 Ga0373939_0320690 3300035114 Bacteria 623
456 Ga0373941_0015050 3300035115 Bacteria 2078
457 Ga0373941_0137975 3300035115 Bacteria 884
458 Ga0373941_0420359 3300035115 Bacteria 556
459 Ga0373945_0006653 3300035116 Bacteria 3735
460 Ga0373960_0016768 3300035121 Bacteria 1889
461 Ga0373943_0007235 3300035170 Bacteria 4980
462 Ga0373943_0080948 3300035170 Bacteria 1665
463 Ga0373946_0602606 3300035171 Unclassified 570
464 Ga0373955_0036549 3300035172 Bacteria 2607
465 Ga0373955_0739722 3300035172 Bacteria 604
466 Ga0373955_0759412 3300035172 Bacteria 596
467 Ga0373942_0039087 3300035207 Bacteria 1289
468 Ga0373942_0106190 3300035207 Bacteria 863
469 Ga0373961_0002931 3300035241 Bacteria 4320
470 Ga0373961_0017564 3300035241 Bacteria 1858
471 Ga0373962_0004285 3300035242 Bacteria 3446
472 Ga0373962_0018033 3300035242 Bacteria 1833
473 Ga0373962_0141061 3300035242 Bacteria 783
474 Ga0316574_0164763 3300035398 Bacteria 1427
475 Ga0373931_0001781 3300035691 Bacteria 9363
476 Ga0373931_0037853 3300035691 Bacteria 2520
477 Ga0373931_0057013 3300035691 Bacteria 2094
478 Ga0373931_0437656 3300035691 Bacteria 834
479 Ga0373935_0003403 3300035692 Bacteria 9238
480 Ga0373935_0026109 3300035692 Bacteria 3602
481 Ga0373935_1341243 3300035692 Bacteria 534
482 Ga0373927_0000971 3300035695 Bacteria 21800
483 Ga0373927_0064151 3300035695 Bacteria 2376
484 Ga0373927_0167531 3300035695 Bacteria 1440
485 Ga0373933_0510491 3300035724 Bacteria 788
486 Ga0373947_0011709 3300035725 Bacteria 5027
487 Ga0373947_0124556 3300035725 Bacteria 1640
488 Ga0316582_0356473 3300036647 Bacteria 1006
489 Ga0316584_0029457 3300036712 Bacteria 4052
490 Ga0373925_0002443 3300037068 Bacteria 14891
491 Ga0373925_0002514 3300037068 Bacteria 14651
492 Ga0395905_0057227 3300037471 Bacteria 3647
493 Ga0395905_0816249 3300037471 Bacteria 836
494 Ga0436364_0438482 3300037853 Bacteria 1655
495 Ga0436364_0743164 3300037853 Bacteria 9802
496 Ga0436364_1420929 3300037853 Bacteria 1199
497 Ga0237816_04840 3300039145 Bacteria 922
498 Ga0436365_0047289 3300039437 Bacteria 7014
499 Ga0436365_0075962 3300039437 Bacteria 769
500 Ga0436365_1136540 3300039437 Bacteria 40433
501 Ga0436365_1253031 3300039437 Bacteria 47093
502 Ga0436365_1706336 3300039437 Bacteria 3761
503 Ga0436360_0051477 3300039438 Bacteria 587
504 Ga0436360_0140907 3300039438 Bacteria 1583
505 Ga0436360_0259420 3300039438 Bacteria 1483
506 Ga0436360_0321131 3300039438 Bacteria 1021
507 Ga0436360_0355448 3300039438 Bacteria 2358
508 Ga0436360_0454769 3300039438 Bacteria 2380
509 Ga0436360_0537617 3300039438 Bacteria 7493
510 Ga0436360_0773833 3300039438 Bacteria 748
511 Ga0436360_0820186 3300039438 Bacteria 854
512 Ga0436360_0900938 3300039438 Bacteria 595
513 Ga0436360_1057566 3300039438 Bacteria 1008
514 Ga0436360_1065206 3300039438 Bacteria 2112
515 Ga0436360_1154925 3300039438 Bacteria 775
516 Ga0436360_1290282 3300039438 Bacteria 1299
517 Ga0436361_0014203 3300039447 Bacteria 1592
518 Ga0436361_0016113 3300039447 Bacteria 2363
519 Ga0436361_0074846 3300039447 Bacteria 692
520 Ga0436361_0226768 3300039447 Bacteria 973
521 Ga0436361_0240768 3300039447 Bacteria 945
522 Ga0436361_0257678 3300039447 Bacteria 1959
523 Ga0436361_0291348 3300039447 Bacteria 1687
524 Ga0436361_0315369 3300039447 Bacteria 539
525 Ga0436361_0330189 3300039447 Bacteria 1200
526 Ga0436361_0381254 3300039447 Bacteria 562
527 Ga0436361_0415437 3300039447 Bacteria 1404
528 Ga0436361_0658663 3300039447 Bacteria 1210
529 Ga0436361_0710155 3300039447 Bacteria 505
530 Ga0436361_0714783 3300039447 Bacteria 615
531 Ga0436361_0765661 3300039447 Bacteria 1143
532 Ga0436361_0866004 3300039447 Bacteria 1371
533 Ga0436361_0878406 3300039447 Bacteria 2465
534 Ga0436361_0942051 3300039447 Bacteria 681
535 Ga0436361_1025029 3300039447 Bacteria 3243
536 Ga0436361_1184215 3300039447 Bacteria 1021
537 Ga0436363_0272908 3300039450 Bacteria 1128
538 Ga0436363_0323271 3300039450 Bacteria 5181
539 Ga0436363_0746062 3300039450 Bacteria 9943
540 Ga0436363_0854883 3300039450 Bacteria 828
541 Ga0436363_0858619 3300039450 Bacteria 1652
542 Ga0436363_0875430 3300039450 Bacteria 1677
543 Ga0436363_1182780 3300039450 Bacteria 947
544 Ga0436362_0006092 3300039453 Bacteria 689
545 Ga0436362_0133577 3300039453 Bacteria 1337
546 Ga0436362_0374465 3300039453 Bacteria 536
547 Ga0436362_0531292 3300039453 Bacteria 592
548 Ga0436362_0839400 3300039453 Bacteria 807
549 Ga0436362_0976116 3300039453 Bacteria 8152
550 Ga0436362_1087862 3300039453 Bacteria 1420
551 Ga0439436_0104056 3300041404 Bacteria 792
552 Ga0439453_0005235 3300041408 Bacteria 1968
553 Ga0439466_0111000 3300041411 Bacteria 851
554 Ga0439465_0027934 3300041413 Bacteria 1788
555 Ga0451789_0503154 3300041443 Bacteria 1003
556 Ga0451791_0574419 3300041451 Bacteria 973
557 Ga0451793_1391501 3300041452 Bacteria 735
558 Ga0451807_0874557 3300041486 Bacteria 555
559 Ga0451807_1450153 3300041486 Bacteria 641
560 Ga0451807_2360578 3300041486 Bacteria 703
561 Ga0451853_1126604 3300041512 Bacteria 630
562 Ga0439431_0026550 3300041997 Bacteria 1420
563 Ga0439431_0052962 3300041997 Bacteria 1056
564 Ga0439445_0033332 3300042004 Bacteria 1345
565 Ga0439445_0107527 3300042004 Bacteria 794
566 Ga0439432_101817 3300042006 Bacteria 858
567 Ga0439449_0340077 3300042007 Bacteria 568
568 Ga0439452_119086 3300042010 Bacteria 562
569 Ga0439454_035442 3300042011 Bacteria 799
570 Ga0439456_118164 3300042013 Bacteria 607
571 Ga0439446_0178018 3300042156 Bacteria 710
572 Ga0466972_0009543 3300044658 Bacteria 4874
573 Ga0466966_0064041 3300044684 Bacteria 2316
574 Ga0466966_0166692 3300044684 Bacteria 1340
575 Ga0466964_0912549 3300044706 Bacteria 503
576 Ga0466971_0032824 3300044719 Bacteria 2326
577 Ga0466957_0082727 3300044842 Bacteria 2001
578 Ga0466957_0101786 3300044842 Bacteria 1812
579 Ga0466957_0919939 3300044842 Bacteria 626
580 Ga0466960_0128857 3300044901 Bacteria 1333
581 Ga0466960_0214495 3300044901 Bacteria 1057
582 Ga0466959_0160457 3300045049 Bacteria 1581
583 Ga0466959_0416124 3300045049 Bacteria 913
584 Ga0466959_0985704 3300045049 Bacteria 561
585 Ga0451576_0168990 3300045051 Bacteria 2282
586 Ga0451576_0794393 3300045051 Bacteria 994
587 Ga0451576_1431832 3300045051 Bacteria 719
588 Ga0451576_2682197 3300045051 Bacteria 507
589 Ga0466958_0000676 3300045836 Bacteria 14782
590 Ga0495580_0003736 3300046472 Bacteria 12895
591 Ga0495580_0525162 3300046472 Bacteria 788
592 Ga0495582_0043074 3300046473 Bacteria 2486
593 Ga0495585_0493876 3300046492 Bacteria 582
594 Ga0495606_0540266 3300046507 Bacteria 582
595 Ga0495610_0018183 3300046512 Bacteria 3978
596 Ga0495620_0037558 3300046515 Bacteria 2156
597 Ga0495630_0245501 3300046517 Bacteria 1368
598 Ga0495643_0433413 3300046522 Bacteria 575
599 Ga0495586_0405127 3300046535 Bacteria 785
600 Ga0495587_0162159 3300046536 Bacteria 1272
601 Ga0495598_0115737 3300046537 Bacteria 904
602 Ga0495597_0179175 3300046542 Bacteria 857
603 Ga0495645_0086993 3300046543 Bacteria 2236
604 Ga0495645_0503183 3300046543 Bacteria 757
605 Ga0495622_0085278 3300046557 Bacteria 1453
606 Ga0495667_0950970 3300046559 Bacteria 525
607 Ga0495656_0088344 3300046615 Bacteria 1413
608 Ga0495656_0556043 3300046615 Bacteria 612
609 Ga0495668_0032584 3300046616 Bacteria 2931
610 Ga0495668_0112676 3300046616 Bacteria 1488
611 Ga0495625_0225794 3300046660 Bacteria 1225
612 Ga0495625_0315915 3300046660 Bacteria 996
613 Ga0495658_0001492 3300046683 Bacteria 12268
614 Ga0495613_0000576 3300046689 Bacteria 29823
615 Ga0495670_0145421 3300046691 Bacteria 1242
616 Ga0495670_0828002 3300046691 Bacteria 505
617 Ga0495671_0245556 3300046692 Bacteria 864
618 Ga0495589_0426502 3300046794 Bacteria 608
619 Ga0495581_0457221 3300047315 Bacteria 743
620 Ga0495685_119544 3300047447 Bacteria 865
621 Ga0496100_0070642 3300048903 Bacteria 2329
622 Ga0496100_0401356 3300048903 Bacteria 1044
623 Ga0496100_0959993 3300048903 Bacteria 672
624 Ga0496101_0031523 3300048904 Bacteria 3727
625 Ga0496101_0498506 3300048904 Bacteria 962
626 Ga0496102_0783859 3300048905 Bacteria 876
627 Ga0496102_0949578 3300048905 Bacteria 781
628 Ga0496102_1056612 3300048905 Bacteria 732
629 Ga0496102_1308374 3300048905 Bacteria 644
630 Ga0496103_0639786 3300048906 Bacteria 676
631 Ga0496104_0050054 3300048907 Bacteria 3942
632 Ga0496104_0070384 3300048907 Bacteria 3325
633 Ga0496104_0822420 3300048907 Bacteria 835
634 Ga0496104_0873644 3300048907 Bacteria 804
635 Ga0496104_1240668 3300048907 Bacteria 649
636 Ga0496105_0005504 3300048908 Bacteria 9611
637 Ga0496105_0360202 3300048908 Bacteria 1160
638 Ga0496105_0940634 3300048908 Bacteria 649
639 Ga0496106_0186897 3300048909 Bacteria 1646
640 Ga0496107_0632702 3300048910 Bacteria 789
641 Ga0496108_0137085 3300048911 Bacteria 2106
642 Ga0496108_0873310 3300048911 Bacteria 773
643 Ga0496108_1114354 3300048911 Bacteria 670
644 Ga0496108_1326975 3300048911 Bacteria 604
645 Ga0496109_1360813 3300048912 Bacteria 646
646 Ga0496110_0008141 3300048913 Bacteria 8422
647 Ga0496110_0213506 3300048913 Bacteria 1754
648 Ga0496110_0784872 3300048913 Bacteria 857
649 Ga0496110_1080030 3300048913 Bacteria 710
650 Ga0496111_0092518 3300048914 Bacteria 2217
651 Ga0496112_0034695 3300048915 Bacteria 4910
652 Ga0496112_0572117 3300048915 Bacteria 1063
653 Ga0496112_0850217 3300048915 Bacteria 836
654 Ga0496113_0004259 3300048916 Bacteria 8765
655 Ga0496114_0019003 3300048917 Bacteria 5566
656 Ga0496114_0108545 3300048917 Bacteria 2376
657 Ga0496114_0180419 3300048917 Bacteria 1844
658 Ga0496114_0447658 3300048917 Bacteria 1144
659 Ga0496115_0009751 3300048918 Bacteria 7152
660 Ga0496115_0189171 3300048918 Bacteria 1701
661 Ga0496115_0190979 3300048918 Bacteria 1692
662 Ga0496115_0361216 3300048918 Bacteria 1183
663 Ga0496115_0570404 3300048918 Bacteria 902
664 Ga0496116_0092732 3300048919 Bacteria 1831
665 Ga0496117_0085746 3300048920 Bacteria 2049
666 Ga0496117_0115792 3300048920 Bacteria 1658
667 Ga0496117_0487386 3300048920 Bacteria 601
668 Ga0496118_0101757 3300048921 Bacteria 1939
669 Ga0496118_0182585 3300048921 Bacteria 1266
670 Ga0496119_0004353 3300048922 Bacteria 14129
671 Ga0496119_0201215 3300048922 Bacteria 1031
672 Ga0496121_0082395 3300048924 Bacteria 2543
673 Ga0496121_0857690 3300048924 Bacteria 527
674 Ga0496122_0019871 3300048925 Bacteria 6109
675 Ga0496123_0008564 3300048926 Bacteria 9374
676 Ga0496123_0073670 3300048926 Bacteria 2117
677 Ga0496124_0378537 3300048927 Bacteria 991
678 Ga0496124_0536873 3300048927 Bacteria 775
679 Ga0496125_0017448 3300048928 Bacteria 6842
680 Ga0496125_0259025 3300048928 Bacteria 1091
681 Ga0496126_0036822 3300048929 Bacteria 4572
682 Ga0496126_0365140 3300048929 Bacteria 1178
683 Ga0496126_0492443 3300048929 Bacteria 981
684 Ga0496126_0496478 3300048929 Bacteria 976
685 Ga0496126_0567956 3300048929 Bacteria 898
686 Ga0496126_0667863 3300048929 Bacteria 811
687 Ga0496126_0895552 3300048929 Bacteria 673
688 Ga0496126_1203842 3300048929 Bacteria 557
689 Ga0501306_000743 3300049127 Bacteria 2709
690 Ga0501306_004507 3300049127 Bacteria 1563
691 Ga0501306_023656 3300049127 Bacteria 874
692 Ga0501306_033987 3300049127 Bacteria 769
693 Ga0501308_002370 3300049128 Bacteria 1648
694 Ga0501308_020408 3300049128 Bacteria 825
695 Ga0501308_023831 3300049128 Bacteria 783
696 Ga0501308_025413 3300049128 Bacteria 767
697 Ga0501309_000912 3300049129 Bacteria 2663
698 Ga0501310_001976 3300049130 Bacteria 1910
699 Ga0501310_007310 3300049130 Bacteria 1178
700 Ga0501310_039434 3300049130 Bacteria 653
701 Ga0501310_040407 3300049130 Bacteria 648
702 Ga0501343_005978 3300049132 Bacteria 943
703 Ga0501304_010671 3300049160 Bacteria 806
704 Ga0501305_000622 3300049161 Bacteria 3012
705 Ga0501305_003020 3300049161 Bacteria 1871
706 Ga0501305_003176 3300049161 Bacteria 1843
707 Ga0501305_033118 3300049161 Bacteria 814
708 Ga0501305_079125 3300049161 Bacteria 588
709 Ga0501307_007552 3300049162 Bacteria 1202
710 Ga0501307_017811 3300049162 Bacteria 898
711 Ga0501307_059868 3300049162 Bacteria 589
712 Ga0501307_094337 3300049162 Bacteria 503
713 Ga0501311_000194 3300049527 Bacteria 3556
714 Ga0501311_025983 3300049527 Bacteria 823
715 Ga0501312_014537 3300049528 Bacteria 1107
716 Ga0501312_042385 3300049528 Bacteria 747
717 Ga0501312_051210 3300049528 Bacteria 697
718 Ga0501312_059336 3300049528 Bacteria 660
719 Ga0501313_002464 3300049529 Bacteria 1757
720 Ga0501313_010854 3300049529 Bacteria 1044
721 Ga0501313_038902 3300049529 Bacteria 635
722 Ga0501314_004204 3300049530 Bacteria 1187
723 Ga0501314_007586 3300049530 Bacteria 965
724 Ga0501314_029389 3300049530 Bacteria 605
725 Ga0501315_004037 3300049531 Bacteria 1509
726 Ga0501315_006592 3300049531 Bacteria 1297
727 Ga0501315_017497 3300049531 Bacteria 938
728 Ga0501315_085083 3300049531 Bacteria 542
729 Ga0501316_001097 3300049532 Bacteria 2191
730 Ga0501316_032792 3300049532 Bacteria 701
731 Ga0501316_044798 3300049532 Bacteria 625
732 Ga0501316_047918 3300049532 Bacteria 609
733 Ga0501316_049401 3300049532 Bacteria 603
734 Ga0501317_000409 3300049533 Bacteria 2945
735 Ga0501317_026802 3300049533 Bacteria 815
736 Ga0501317_039867 3300049533 Bacteria 713
737 Ga0501317_065175 3300049533 Bacteria 605
738 Ga0501317_097195 3300049533 Bacteria 528
739 Ga0501318_000193 3300049534 Bacteria 3208
740 Ga0501318_012450 3300049534 Bacteria 975
741 Ga0501318_027008 3300049534 Bacteria 761
742 Ga0501318_041516 3300049534 Bacteria 659
743 Ga0501318_059951 3300049534 Bacteria 582
744 Ga0501318_060544 3300049534 Bacteria 580
745 Ga0501318_088202 3300049534 Bacteria 511
746 Ga0501319_004701 3300049535 Bacteria 957
747 Ga0501320_034956 3300049536 Bacteria 639
748 Ga0501320_067016 3300049536 Bacteria 514
749 Ga0501321_003508 3300049537 Bacteria 1441
750 Ga0501321_021272 3300049537 Bacteria 808
751 Ga0501322_000140 3300049538 Bacteria 2796
752 Ga0501323_001515 3300049539 Bacteria 2084
753 Ga0501323_003359 3300049539 Bacteria 1632
754 Ga0501323_006869 3300049539 Bacteria 1283
755 Ga0501323_039089 3300049539 Bacteria 690
756 Ga0501323_088333 3300049539 Bacteria 514
757 Ga0501324_046535 3300049540 Bacteria 506
758 Ga0501325_002382 3300049541 Bacteria 1279
759 Ga0501325_028200 3300049541 Bacteria 630
760 Ga0501325_030217 3300049541 Bacteria 617
761 Ga0501325_060190 3300049541 Bacteria 500
762 Ga0501328_08460 3300049544 Bacteria 560
763 Ga0501329_05604 3300049545 Bacteria 699
764 Ga0501329_13713 3300049545 Bacteria 536
765 Ga0501332_04824 3300049548 Bacteria 814
766 Ga0501332_06926 3300049548 Bacteria 716
767 Ga0501334_16931 3300049550 Bacteria 566
768 Ga0501338_03296 3300049554 Bacteria 950
769 Ga0501340_005181 3300049556 Bacteria 842
770 Ga0501031_0133346 3300049568 Bacteria 1623
771 Ga0501032_0287810 3300049569 Bacteria 1063
772 Ga0501032_0466394 3300049569 Bacteria 808
773 Ga0501033_0112292 3300049570 Bacteria 1982
774 Ga0501033_0438034 3300049570 Bacteria 909
775 Ga0501033_0442771 3300049570 Bacteria 903
776 Ga0501034_0014987 3300049571 Bacteria 7973
777 Ga0501034_0069393 3300049571 Bacteria 3535
778 Ga0501034_0162397 3300049571 Bacteria 2204
779 Ga0501034_0427362 3300049571 Bacteria 1245
780 Ga0501034_0432130 3300049571 Bacteria 1236
781 Ga0501034_0929568 3300049571 Bacteria 756
782 Ga0501034_0992470 3300049571 Bacteria 724
783 Ga0501034_1023422 3300049571 Bacteria 709
784 Ga0501034_1094454 3300049571 Bacteria 678
785 Ga0501036_0027081 3300049572 Bacteria 4844
786 Ga0501036_0134365 3300049572 Bacteria 2088
787 Ga0501036_0827783 3300049572 Bacteria 762
788 Ga0501037_0069329 3300049573 Bacteria 2567
789 Ga0501037_0140866 3300049573 Bacteria 1726
790 Ga0501037_0218316 3300049573 Bacteria 1342
791 Ga0501037_0267468 3300049573 Bacteria 1194
792 Ga0501038_0164752 3300049574 Bacteria 1799
793 Ga0501038_0250905 3300049574 Bacteria 1402
794 Ga0501038_0357450 3300049574 Bacteria 1136
795 Ga0501039_0388403 3300049575 Bacteria 1096
796 Ga0501041_0270794 3300049577 Bacteria 1068
797 Ga0501041_1057593 3300049577 Bacteria 523
798 Ga0501042_0069464 3300049578 Bacteria 2519
799 Ga0501042_0483421 3300049578 Bacteria 899
800 Ga0501043_0247928 3300049579 Bacteria 1372
801 Ga0501043_0292729 3300049579 Bacteria 1246
802 Ga0501043_0594668 3300049579 Bacteria 818
803 Ga0501043_0648365 3300049579 Bacteria 776
804 Ga0501046_0496547 3300049580 Bacteria 874
805 Ga0501047_0023054 3300049581 Bacteria 5976
806 Ga0501047_0120081 3300049581 Bacteria 2511
807 Ga0501047_0573237 3300049581 Bacteria 952
808 Ga0501047_0944058 3300049581 Bacteria 676
809 Ga0501047_1161746 3300049581 Bacteria 585
810 Ga0501048_0093666 3300049582 Bacteria 2119
811 Ga0501048_1103829 3300049582 Bacteria 571
812 Ga0501067_0017088 3300049583 Bacteria 4009
813 Ga0501067_0066298 3300049583 Bacteria 1998
814 Ga0501067_0561634 3300049583 Bacteria 639
815 Ga0501068_0012735 3300049584 Bacteria 4774
816 Ga0501069_0004928 3300049585 Bacteria 6923
817 Ga0501069_0742325 3300049585 Bacteria 593
818 Ga0501070_0017027 3300049586 Bacteria 6099
819 Ga0501070_0031071 3300049586 Bacteria 4473
820 Ga0501071_0136426 3300049587 Bacteria 1826
821 Ga0501073_0043526 3300049589 Bacteria 3166
822 Ga0501073_0069855 3300049589 Bacteria 2447
823 Ga0501073_0095338 3300049589 Bacteria 2066
824 Ga0501073_0663828 3300049589 Bacteria 719
825 Ga0501074_0057091 3300049590 Bacteria 2812
826 Ga0501074_0424223 3300049590 Bacteria 943
827 Ga0501076_0043955 3300049592 Bacteria 3522
828 Ga0501077_0270029 3300049593 Bacteria 1082
829 Ga0501077_0750432 3300049593 Bacteria 627
830 Ga0501077_0755255 3300049593 Bacteria 625
831 Ga0501206_081328 3300049653 Bacteria 563
832 Ga0501211_031963 3300049658 Bacteria 597
833 Ga0501216_077159 3300049660 Bacteria 699
834 Ga0501217_332455 3300049661 Bacteria 508
835 Ga0501238_016664 3300049671 Bacteria 1020
836 Ga0501242_011424 3300049674 Bacteria 1072
837 Ga0501249_079202 3300049679 Bacteria 772
838 Ga0501250_014795 3300049680 Bacteria 951
839 Ga0501252_051456 3300049682 Bacteria 622
840 Ga0501253_103672 3300049683 Bacteria 670
841 Ga0501258_030700 3300049687 Bacteria 678
842 Ga0501225_0077455 3300049705 Bacteria 951
843 Ga0501245_066611 3300049708 Bacteria 670
844 Ga0501079_0193013 3300049741 Bacteria 1590
845 Ga0501079_0378369 3300049741 Bacteria 1110
846 Ga0501079_0436045 3300049741 Bacteria 1029
847 Ga0501080_0009625 3300049742 Bacteria 8822
848 Ga0501081_0174979 3300049743 Bacteria 1551
849 Ga0501083_0086253 3300049744 Bacteria 2076
850 Ga0501083_0263204 3300049744 Bacteria 1122
851 Ga0501083_0842544 3300049744 Bacteria 597
852 Ga0501083_0900677 3300049744 Bacteria 576
853 Ga0501241_024401 3300049758 Bacteria 1123
854 Ga0501241_064591 3300049758 Bacteria 740
855 Ga0501265_076490 3300049762 Bacteria 575
856 Ga0501266_004246 3300049763 Bacteria 1773
857 Ga0501270_084109 3300049767 Bacteria 638
858 Ga0501035_0091548 3300049822 Bacteria 2676
859 Ga0501035_0216953 3300049822 Bacteria 1635
860 Ga0501044_0073393 3300049823 Bacteria 3478
861 Ga0501044_0220649 3300049823 Bacteria 1846
862 Ga0501044_0254098 3300049823 Bacteria 1697
863 Ga0501044_0852389 3300049823 Bacteria 788
864 Ga0501045_0528708 3300049824 Bacteria 875
865 nmdc:mga03683_134374_c1 3300050489 Bacteria 1109
866 nmdc:mga00v17_533473_c1 3300050491 Bacteria 759
867 nmdc:mga00v17_98396_c1 3300050491 Bacteria 1844
868 nmdc:mga0yw44_342159_c1 3300050492 Bacteria 1006
869 nmdc:mga0yw44_373623_c1 3300050492 Bacteria 962
870 nmdc:mga0k408_20070_c1 3300050493 Bacteria 3739
871 nmdc:mga0k408_404010_c1 3300050493 Bacteria 813
872 nmdc:mga06z11_8708_c1 3300050494 Bacteria 4247
873 nmdc:mga04h51_87027_c1 3300050495 Bacteria 1118
874 nmdc:mga07m45_111300_c1 3300050496 Bacteria 1577
875 nmdc:mga07m45_69479_c1 3300050496 Bacteria 2002
876 nmdc:mga09592_293602_c1 3300050508 Bacteria 1409
877 nmdc:mga08y16_200519_c1 3300050511 Bacteria 2068
878 nmdc:mga08y16_273468_c1 3300050511 Bacteria 1743
879 nmdc:mga08y16_56413_c1 3300050511 Bacteria 4106
880 nmdc:mga0n895_2833_c1 3300050512 Bacteria 13734
881 nmdc:mga0n895_954971_c1 3300050512 Bacteria 840
882 nmdc:mga0rr50_349300_c1 3300050513 Bacteria 1244
883 nmdc:mga0rr50_34938_c1 3300050513 Bacteria 3605
884 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
885 nmdc:mga08x19_853330_c1 3300050514 Bacteria 647
886 nmdc:mga0a205_2479_c1 3300050515 Bacteria 16274
887 nmdc:mga0sz30_13902_c1 3300050516 Bacteria 3160
888 nmdc:mga0sz30_217246_c1 3300050516 Bacteria 850
889 nmdc:mga0sz30_322906_c1 3300050516 Bacteria 689
890 nmdc:mga0sz30_49277_c1 3300050516 Bacteria 1784
891 nmdc:mga0sz30_513372_c1 3300050516 Bacteria 539
892 Ga0495601_0370475 3300053077 Bacteria 930
893 Ga0495601_0722566 3300053077 Bacteria 635
894 Ga0495655_0232202 3300053083 Bacteria 614
895 Ga0495619_0157287 3300053085 Bacteria 1569
896 Ga0500578_0201179 3300053086 Bacteria 1219
897 Ga0500651_0183418 3300053093 Bacteria 1242
898 Ga0500569_018737 3300053109 Bacteria 1792
899 Ga0500572_163444 3300053111 Bacteria 729
900 Ga0500594_0063508 3300053118 Bacteria 1070
901 Ga0500595_026114 3300053119 Bacteria 2016
902 Ga0500595_038381 3300053119 Bacteria 1557
903 Ga0500597_069668 3300053120 Bacteria 1520
904 Ga0500608_041046 3300053122 Bacteria 2218
905 Ga0500608_271920 3300053122 Bacteria 647
906 Ga0500608_341468 3300053122 Bacteria 535
907 Ga0500618_007381 3300053125 Bacteria 3141
908 Ga0500652_178320 3300053131 Bacteria 872
909 Ga0500559_0000113 3300053136 Bacteria 63512
910 Ga0500561_0022440 3300053137 Bacteria 1500
911 Ga0500568_0000001 3300053139 Bacteria 988705
912 Ga0500577_0040810 3300053142 Bacteria 1689
913 Ga0500588_0090884 3300053146 Bacteria 1037
914 Ga0500616_0192271 3300053153 Bacteria 910
915 Ga0500622_0041650 3300053156 Bacteria 2389
916 Ga0500627_0371094 3300053158 Bacteria 614
917 Ga0500634_0254815 3300053161 Bacteria 726
918 Ga0500636_0029625 3300053177 Bacteria 3234
919 Ga0501084_0039158 3300054114 Bacteria 3965
920 Ga0501084_0071192 3300054114 Bacteria 2912
921 Ga0587084_004230 3300059477 Bacteria 1631
922 Ga0587093_070248 3300059478 Bacteria 587
923 Ga0587066_032047 3300059490 Bacteria 943
924 Ga0587070_164868 3300059491 Bacteria 566
925 Ga0587070_195014 3300059491 Bacteria 535
926 Ga0587073_0066125 3300059492 Bacteria 861
927 Ga0587073_0098652 3300059492 Bacteria 755
928 Ga0587077_026408 3300059493 Bacteria 1072
929 Ga0587077_029785 3300059493 Bacteria 1031
930 Ga0587077_078087 3300059493 Bacteria 754
931 Ga0587080_175963 3300059503 Bacteria 510
932 Ga0587083_0040993 3300059505 Bacteria 970
933 Ga0587086_098783 3300059507 Bacteria 536
934 Ga0587088_006338 3300059508 Bacteria 1593
935 Ga0587094_075067 3300059513 Bacteria 616
936 Ga0587125_015896 3300059607 Bacteria 839
937 Ga0587109_062772 3300059624 Bacteria 786
938 Ga0587109_072081 3300059624 Bacteria 749
939 Ga0587067_100553 3300059640 Bacteria 669
940 Ga0587068_000630 3300059641 Bacteria 3390
941 Ga0587068_004293 3300059641 Bacteria 1877
942 Ga0587068_081954 3300059641 Bacteria 652
943 Ga0587069_011022 3300059642 Bacteria 1201
944 Ga0587069_052056 3300059642 Bacteria 732
945 Ga0587069_107552 3300059642 Bacteria 577
946 Ga0587072_115279 3300059643 Bacteria 617
947 Ga0587072_148066 3300059643 Bacteria 565
948 Ga0587075_026000 3300059644 Bacteria 903
949 Ga0587076_004307 3300059645 Bacteria 1768
950 Ga0587079_002261 3300059647 Bacteria 2329
951 Ga0587079_039403 3300059647 Bacteria 948
952 Ga0587102_064664 3300059649 Bacteria 516
953 Ga0587105_005731 3300059651 Bacteria 834
954 Ga0587107_076157 3300059652 Bacteria 622
955 Ga0587120_009008 3300059659 Bacteria 826
956 Ga0587111_0027932 3300060346 Bacteria 1133
957 Ga0587111_0153195 3300060346 Bacteria 621
958 Ga0501082_0169846 3300060353 Bacteria 1896
959 Ga0501082_0656848 3300060353 Bacteria 918
960 Ga0466962_0020301 3300061719 Bacteria 3193
961 Ga0466962_0527708 3300061719 Bacteria 599
962 Ga0466962_0742836 3300061719 Bacteria 505
963 Ga0530510_0283408 3300061734 Bacteria 1238

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0561634 Ga0501067_0561634_10_333 107
2 3300005539 Ga0068853_101027538 Ga0068853_1010275382 114
3 3300035089 Ga0373944_0345386 Ga0373944_0345386_192_536 114
4 3300039438 Ga0436360_0140907 Ga0436360_0140907_16_360 114
5 3300039447 Ga0436361_0240768 Ga0436361_0240768_26_370 114
6 3300039447 Ga0436361_0381254 Ga0436361_0381254_24_368 114
7 3300039453 Ga0436362_0839400 Ga0436362_0839400_443_787 114
8 3300044706 Ga0466964_0912549 Ga0466964_0912549_14_358 114
9 3300045049 Ga0466959_0416124 Ga0466959_0416124_23_367 114
10 3300049162 Ga0501307_094337 Ga0501307_094337_14_358 114
11 3300049533 Ga0501317_039867 Ga0501317_039867_11_355 114
12 3300049571 Ga0501034_1023422 Ga0501034_1023422_353_697 114
13 3300049658 Ga0501211_031963 Ga0501211_031963_235_579 114
14 3300050516 nmdc:mga0sz30_322906_c1 nmdc:mga0sz30_322906_c1_17_361 114
15 3300042013 Ga0439456_118164 Ga0439456_118164_27_395 122
16 3300045051 Ga0451576_0168990 Ga0451576_0168990_1206_1574 122
17 3300049589 Ga0501073_0663828 Ga0501073_0663828_333_701 122
18 3300035398 Ga0316574_0164763 Ga0316574_0164763_303_674 123
19 3300036712 Ga0316584_0029457 Ga0316584_0029457_2723_3094 123
20 3300039447 Ga0436361_0315369 Ga0436361_0315369_17_388 123
21 3300046512 Ga0495610_0018183 Ga0495610_0018183_1267_1638 123
22 3300046522 Ga0495643_0433413 Ga0495643_0433413_182_553 123
23 3300046542 Ga0495597_0179175 Ga0495597_0179175_39_410 123
24 3300046615 Ga0495656_0556043 Ga0495656_0556043_121_492 123
25 3300046616 Ga0495668_0112676 Ga0495668_0112676_1107_1478 123
26 3300046660 Ga0495625_0225794 Ga0495625_0225794_104_475 123
27 3300046691 Ga0495670_0145421 Ga0495670_0145421_387_758 123
28 3300046692 Ga0495671_0245556 Ga0495671_0245556_282_653 123
29 3300048905 Ga0496102_1308374 Ga0496102_1308374_261_632 123
30 3300048907 Ga0496104_1240668 Ga0496104_1240668_263_634 123
31 3300048918 Ga0496115_0189171 Ga0496115_0189171_11_382 123
32 3300048929 Ga0496126_0567956 Ga0496126_0567956_474_845 123
33 3300048929 Ga0496126_1203842 Ga0496126_1203842_12_383 123
34 3300049127 Ga0501306_000743 Ga0501306_000743_65_436 123
35 3300049128 Ga0501308_025413 Ga0501308_025413_336_707 123
36 3300049530 Ga0501314_029389 Ga0501314_029389_215_586 123
37 3300049531 Ga0501315_004037 Ga0501315_004037_695_1066 123
38 3300049539 Ga0501323_003359 Ga0501323_003359_1238_1609 123
39 3300049544 Ga0501328_08460 Ga0501328_08460_170_541 123
40 3300049545 Ga0501329_13713 Ga0501329_13713_148_519 123
41 3300049571 Ga0501034_0432130 Ga0501034_0432130_678_1049 123
42 3300049577 Ga0501041_1057593 Ga0501041_1057593_133_504 123
43 3300049581 Ga0501047_0944058 Ga0501047_0944058_91_462 123
44 3300049653 Ga0501206_081328 Ga0501206_081328_182_553 123
45 3300049671 Ga0501238_016664 Ga0501238_016664_257_628 123
46 3300049674 Ga0501242_011424 Ga0501242_011424_540_911 123
47 3300049682 Ga0501252_051456 Ga0501252_051456_198_569 123
48 3300049687 Ga0501258_030700 Ga0501258_030700_284_655 123
49 3300049705 Ga0501225_0077455 Ga0501225_0077455_130_501 123
50 3300049758 Ga0501241_064591 Ga0501241_064591_228_599 123
51 3300049763 Ga0501266_004246 Ga0501266_004246_1060_1431 123
52 3300050492 nmdc:mga0yw44_342159_c1 nmdc:mga0yw44_342159_c1_476_847 123
53 3300050516 nmdc:mga0sz30_49277_c1 nmdc:mga0sz30_49277_c1_1116_1487 123
54 3300053086 Ga0500578_0201179 Ga0500578_0201179_39_410 123
55 3300053093 Ga0500651_0183418 Ga0500651_0183418_373_744 123
56 3300053109 Ga0500569_018737 Ga0500569_018737_1229_1600 123
57 3300053111 Ga0500572_163444 Ga0500572_163444_242_613 123
58 3300053118 Ga0500594_0063508 Ga0500594_0063508_320_691 123
59 3300053122 Ga0500608_041046 Ga0500608_041046_803_1174 123
60 3300053131 Ga0500652_178320 Ga0500652_178320_102_473 123
61 3300053137 Ga0500561_0022440 Ga0500561_0022440_593_964 123
62 3300053142 Ga0500577_0040810 Ga0500577_0040810_758_1129 123
63 3300053146 Ga0500588_0090884 Ga0500588_0090884_11_382 123
64 3300053156 Ga0500622_0041650 Ga0500622_0041650_1787_2158 123
65 3300053158 Ga0500627_0371094 Ga0500627_0371094_188_559 123
66 3300053161 Ga0500634_0254815 Ga0500634_0254815_325_696 123
67 3300053177 Ga0500636_0029625 Ga0500636_0029625_522_893 123
68 iso_pu_bacteria 2508501050 2508735875 127
69 iso_pu_bacteria 2508501114 2509078199 127
70 iso_pu_bacteria 2671180139 2671694494 127
71 iso_pu_bacteria 2773857925 2774868367 127
72 iso_pu_bacteria 2775506901 2776259149 127
73 iso_pu_bacteria 2835312727 2835318461 127
74 iso_pu_bacteria 2882456835 2882459690 127
75 iso_pu_bacteria 2884298095 2884300440 127
76 iso_pu_bacteria 2894232714 2894240756 127
77 iso_pu_bacteria 2917554339 2917555113 127
78 3300048927 Ga0496124_0378537 Ga0496124_0378537_104_490 128
79 iso_pu_bacteria 2513237087 2513594038 128
80 iso_pu_bacteria 2643221733 2644729065 128
81 iso_pu_bacteria 2643221734 2644735421 128
82 iso_pu_bacteria 2643221736 2644747744 128
83 iso_pu_bacteria 2818991467 2819720934 128
84 iso_pu_bacteria 2828305725 2828310160 128
85 iso_pu_bacteria 2841760612 2841761390 128
86 iso_pu_bacteria 2841911363 2841913393 128
87 iso_pu_bacteria 2841917233 2841919140 128
88 iso_pu_bacteria 2844104063 2844104415 128
89 iso_pu_bacteria 2851182111 2851184462 128
90 iso_pu_bacteria 2851246043 2851247403 128
91 iso_pu_bacteria 2891088606 2891092903 128
92 iso_pu_bacteria 2909042592 2909043610 128
93 iso_pu_bacteria 2917699015 2917699279 128
94 iso_pu_bacteria 8002060224 8002061411 128
95 iso_pu_bacteria 8057529695 8057530427 128
96 3300003659 JGI25404J52841_10003344 JGI25404J52841_100033442 130
97 3300005343 Ga0070687_100449453 Ga0070687_1004494532 130
98 3300005455 Ga0070663_100263402 Ga0070663_1002634023 130
99 3300005547 Ga0070693_100593988 Ga0070693_1005939882 130
100 3300005937 Ga0081455_10001008 Ga0081455_1000100828 130
101 3300005983 Ga0081540_1000645 Ga0081540_100064517 130
102 3300006852 Ga0075433_10001194 Ga0075433_1000119415 130
103 3300006871 Ga0075434_100004950 Ga0075434_1000049509 130
104 3300007076 Ga0075435_100018035 Ga0075435_1000180357 130
105 3300009094 Ga0111539_10023484 Ga0111539_100234845 130
106 3300009094 Ga0111539_11073743 Ga0111539_110737432 130
107 3300009551 Ga0105238_11589277 Ga0105238_115892772 130
108 3300025924 Ga0207694_11038132 Ga0207694_110381322 130
109 3300026067 Ga0207678_10298726 Ga0207678_102987261 130
110 3300027907 Ga0207428_10371812 Ga0207428_103718122 130
111 3300034817 Ga0373948_0160036 Ga0373948_0160036_109_501 130
112 3300034817 Ga0373948_0170624 Ga0373948_0170624_146_538 130
113 3300034818 Ga0373950_0054200 Ga0373950_0054200_362_754 130
114 3300034820 Ga0373959_0142571 Ga0373959_0142571_11_403 130
115 3300035084 Ga0373928_0027736 Ga0373928_0027736_158_550 130
116 3300035088 Ga0373940_0027123 Ga0373940_0027123_973_1365 130
117 3300035114 Ga0373939_0068612 Ga0373939_0068612_16_408 130
118 3300035114 Ga0373939_0320690 Ga0373939_0320690_191_583 130
119 3300035115 Ga0373941_0015050 Ga0373941_0015050_261_653 130
120 3300035115 Ga0373941_0420359 Ga0373941_0420359_63_455 130
121 3300035207 Ga0373942_0106190 Ga0373942_0106190_64_456 130
122 3300035241 Ga0373961_0002931 Ga0373961_0002931_1971_2363 130
123 3300035241 Ga0373961_0017564 Ga0373961_0017564_339_731 130
124 3300035242 Ga0373962_0004285 Ga0373962_0004285_429_821 130
125 3300035242 Ga0373962_0018033 Ga0373962_0018033_396_788 130
126 3300035691 Ga0373931_0001781 Ga0373931_0001781_5862_6254 130
127 3300035691 Ga0373931_0037853 Ga0373931_0037853_532_924 130
128 3300039447 Ga0436361_0074846 Ga0436361_0074846_188_580 130
129 3300039447 Ga0436361_0714783 Ga0436361_0714783_53_445 130
130 3300045051 Ga0451576_0794393 Ga0451576_0794393_12_404 130
131 3300046557 Ga0495622_0085278 Ga0495622_0085278_663_1055 130
132 3300049593 Ga0501077_0755255 Ga0501077_0755255_88_480 130
133 3300049741 Ga0501079_0436045 Ga0501079_0436045_214_606 130
134 3300050493 nmdc:mga0k408_20070_c1 nmdc:mga0k408_20070_c1_1234_1626 130
135 3300050511 nmdc:mga08y16_200519_c1 nmdc:mga08y16_200519_c1_1501_1893 130
136 3300050511 nmdc:mga08y16_56413_c1 nmdc:mga08y16_56413_c1_486_878 130
137 3300050512 nmdc:mga0n895_2833_c1 nmdc:mga0n895_2833_c1_6814_7206 130
138 3300050512 nmdc:mga0n895_954971_c1 nmdc:mga0n895_954971_c1_55_447 130
139 3300050513 nmdc:mga0rr50_34938_c1 nmdc:mga0rr50_34938_c1_2437_2829 130
140 3300050515 nmdc:mga0a205_2479_c1 nmdc:mga0a205_2479_c1_9591_9983 130
141 3300003574 Ga0007410J51695_1051312 Ga0007410J51695_10513121 131
142 3300003575 Ga0007409J51694_1066553 Ga0007409J51694_10665531 131
143 3300003579 Ga0007429J51699_1060640 Ga0007429J51699_10606403 131
144 3300003693 Ga0032354_1108669 Ga0032354_11086691 131
145 3300003693 Ga0032354_1120138 Ga0032354_11201381 131
146 3300005338 Ga0068868_100515613 Ga0068868_1005156132 131
147 3300005339 Ga0070660_101904245 Ga0070660_1019042451 131
148 3300005345 Ga0070692_10335754 Ga0070692_103357542 131
149 3300005347 Ga0070668_100556489 Ga0070668_1005564893 131
150 3300005440 Ga0070705_100613714 Ga0070705_1006137141 131
151 3300005455 Ga0070663_100519849 Ga0070663_1005198492 131
152 3300005455 Ga0070663_101416177 Ga0070663_1014161771 131
153 3300005457 Ga0070662_100952996 Ga0070662_1009529962 131
154 3300005530 Ga0070679_100590914 Ga0070679_1005909141 131
155 3300005548 Ga0070665_100639456 Ga0070665_1006394563 131
156 3300005614 Ga0068856_100384103 Ga0068856_1003841033 131
157 3300005615 Ga0070702_100133794 Ga0070702_1001337943 131
158 3300005617 Ga0068859_101925387 Ga0068859_1019253872 131
159 3300005718 Ga0068866_10470237 Ga0068866_104702372 131
160 3300005840 Ga0068870_10529583 Ga0068870_105295831 131
161 3300006051 Ga0075364_10299311 Ga0075364_102993112 131
162 3300006186 Ga0075369_10014440 Ga0075369_100144404 131
163 3300006844 Ga0075428_100717334 Ga0075428_1007173342 131
164 3300006881 Ga0068865_101377807 Ga0068865_1013778072 131
165 3300006914 Ga0075436_100997377 Ga0075436_1009973772 131
166 3300006931 Ga0097620_101925399 Ga0097620_1019253992 131
167 3300009148 Ga0105243_10996934 Ga0105243_109969342 131
168 3300009553 Ga0105249_10154860 Ga0105249_101548604 131
169 3300010375 Ga0105239_10861177 Ga0105239_108611773 131
170 3300013104 Ga0157370_10955547 Ga0157370_109555472 131
171 3300013307 Ga0157372_12249984 Ga0157372_122499842 131
172 3300014326 Ga0157380_10008515 Ga0157380_1000851514 131
173 3300014968 Ga0157379_10158245 Ga0157379_101582455 131
174 3300021361 Ga0213872_10006909 Ga0213872_100069093 131
175 3300021361 Ga0213872_10012804 Ga0213872_100128048 131
176 3300021361 Ga0213872_10021018 Ga0213872_100210185 131
177 3300021361 Ga0213872_10086084 Ga0213872_100860843 131
178 3300021361 Ga0213872_10356256 Ga0213872_103562561 131
179 3300021441 Ga0213871_10027257 Ga0213871_100272572 131
180 3300023309 Ga0256744_103834 Ga0256744_1038342 131
181 3300023436 Ga0256743_116418 Ga0256743_1164182 131
182 3300023438 Ga0256720_144321 Ga0256720_1443212 131
183 3300025899 Ga0207642_10228685 Ga0207642_102286852 131
184 3300025901 Ga0207688_10177527 Ga0207688_101775272 131
185 3300025908 Ga0207643_10552321 Ga0207643_105523211 131
186 3300025908 Ga0207643_10766157 Ga0207643_107661572 131
187 3300025919 Ga0207657_10887479 Ga0207657_108874792 131
188 3300025925 Ga0207650_10929033 Ga0207650_109290332 131
189 3300025933 Ga0207706_10542975 Ga0207706_105429753 131
190 3300025936 Ga0207670_10658740 Ga0207670_106587402 131
191 3300026023 Ga0207677_11095957 Ga0207677_110959572 131
192 3300026035 Ga0207703_11987339 Ga0207703_119873392 131
193 3300026067 Ga0207678_10522609 Ga0207678_105226091 131
194 3300026067 Ga0207678_10693957 Ga0207678_106939573 131
195 3300026118 Ga0207675_100412225 Ga0207675_1004122252 131
196 3300026118 Ga0207675_100951766 Ga0207675_1009517662 131
197 3300026121 Ga0207683_10359400 Ga0207683_103594003 131
198 3300028794 Ga0307515_10099360 Ga0307515_100993607 131
199 3300028800 Ga0265338_10069087 Ga0265338_100690876 131
200 3300029272 Ga0311000_107819 Ga0311000_1078192 131
201 3300029276 Ga0311004_158584 Ga0311004_1585842 131
202 3300029277 Ga0311001_1103890 Ga0311001_11038902 131
203 3300029285 Ga0310981_1004097 Ga0310981_10040972 131
204 3300031235 Ga0265330_10280996 Ga0265330_102809962 131
205 3300031250 Ga0265331_10000186 Ga0265331_1000018640 131
206 3300031250 Ga0265331_10056585 Ga0265331_100565853 131
207 3300031250 Ga0265331_10418434 Ga0265331_104184341 131
208 3300031251 Ga0265327_10000381 Ga0265327_1000038163 131
209 3300031251 Ga0265327_10007046 Ga0265327_1000704617 131
210 3300031344 Ga0265316_10711285 Ga0265316_107112852 131
211 3300031344 Ga0265316_11279725 Ga0265316_112797251 131
212 3300031456 Ga0307513_10354100 Ga0307513_103541002 131
213 3300031548 Ga0307408_100011406 Ga0307408_1000114065 131
214 3300031595 Ga0265313_10004521 Ga0265313_1000452116 131
215 3300031595 Ga0265313_10124296 Ga0265313_101242963 131
216 3300031711 Ga0265314_10028299 Ga0265314_100282992 131
217 3300031711 Ga0265314_10072853 Ga0265314_100728534 131
218 3300031711 Ga0265314_10095028 Ga0265314_100950282 131
219 3300031711 Ga0265314_10107669 Ga0265314_101076693 131
220 3300031731 Ga0307405_10104855 Ga0307405_101048553 131
221 3300031852 Ga0307410_10007156 Ga0307410_100071568 131
222 3300031889 Ga0326468_10002218 Ga0326468_100022182 131
223 3300031901 Ga0307406_10036624 Ga0307406_100366245 131
224 3300031903 Ga0307407_10011518 Ga0307407_100115184 131
225 3300031911 Ga0307412_10053732 Ga0307412_100537326 131
226 3300031995 Ga0307409_100004876 Ga0307409_10000487614 131
227 3300032002 Ga0307416_100221340 Ga0307416_1002213404 131
228 3300032004 Ga0307414_10075716 Ga0307414_100757162 131
229 3300032005 Ga0307411_10091338 Ga0307411_100913382 131
230 3300032126 Ga0307415_100010922 Ga0307415_1000109228 131
231 3300035692 Ga0373935_1341243 Ga0373935_1341243_77_472 131
232 3300036647 Ga0316582_0356473 Ga0316582_0356473_215_610 131
233 3300037471 Ga0395905_0057227 Ga0395905_0057227_2978_3373 131
234 3300037471 Ga0395905_0816249 Ga0395905_0816249_281_676 131
235 3300039438 Ga0436360_0051477 Ga0436360_0051477_92_487 131
236 3300039438 Ga0436360_0259420 Ga0436360_0259420_604_999 131
237 3300039438 Ga0436360_1057566 Ga0436360_1057566_92_487 131
238 3300039438 Ga0436360_1065206 Ga0436360_1065206_524_919 131
239 3300039447 Ga0436361_0016113 Ga0436361_0016113_1491_1886 131
240 3300039447 Ga0436361_0291348 Ga0436361_0291348_971_1366 131
241 3300039447 Ga0436361_0330189 Ga0436361_0330189_80_475 131
242 3300039447 Ga0436361_0415437 Ga0436361_0415437_58_453 131
243 3300039447 Ga0436361_0658663 Ga0436361_0658663_723_1118 131
244 3300039447 Ga0436361_0710155 Ga0436361_0710155_42_437 131
245 3300039447 Ga0436361_0765661 Ga0436361_0765661_46_441 131
246 3300039447 Ga0436361_0878406 Ga0436361_0878406_1591_1986 131
247 3300039447 Ga0436361_1184215 Ga0436361_1184215_92_487 131
248 3300039450 Ga0436363_1182780 Ga0436363_1182780_309_704 131
249 3300041404 Ga0439436_0104056 Ga0439436_0104056_150_545 131
250 3300041408 Ga0439453_0005235 Ga0439453_0005235_1231_1626 131
251 3300041512 Ga0451853_1126604 Ga0451853_1126604_90_485 131
252 3300041997 Ga0439431_0052962 Ga0439431_0052962_176_571 131
253 3300042007 Ga0439449_0340077 Ga0439449_0340077_137_532 131
254 3300042011 Ga0439454_035442 Ga0439454_035442_74_469 131
255 3300044658 Ga0466972_0009543 Ga0466972_0009543_1230_1625 131
256 3300044684 Ga0466966_0064041 Ga0466966_0064041_1148_1543 131
257 3300044684 Ga0466966_0166692 Ga0466966_0166692_244_639 131
258 3300044719 Ga0466971_0032824 Ga0466971_0032824_398_793 131
259 3300044842 Ga0466957_0082727 Ga0466957_0082727_253_648 131
260 3300044842 Ga0466957_0919939 Ga0466957_0919939_206_601 131
261 3300044901 Ga0466960_0128857 Ga0466960_0128857_230_625 131
262 3300044901 Ga0466960_0214495 Ga0466960_0214495_316_711 131
263 3300045049 Ga0466959_0160457 Ga0466959_0160457_254_649 131
264 3300045836 Ga0466958_0000676 Ga0466958_0000676_1401_1796 131
265 3300046507 Ga0495606_0540266 Ga0495606_0540266_91_486 131
266 3300046536 Ga0495587_0162159 Ga0495587_0162159_842_1237 131
267 3300046615 Ga0495656_0088344 Ga0495656_0088344_411_806 131
268 3300046689 Ga0495613_0000576 Ga0495613_0000576_22335_22730 131
269 3300046691 Ga0495670_0828002 Ga0495670_0828002_99_494 131
270 3300048905 Ga0496102_0949578 Ga0496102_0949578_139_534 131
271 3300048917 Ga0496114_0180419 Ga0496114_0180419_1308_1703 131
272 3300048929 Ga0496126_0496478 Ga0496126_0496478_95_490 131
273 3300049127 Ga0501306_004507 Ga0501306_004507_637_1032 131
274 3300049127 Ga0501306_023656 Ga0501306_023656_213_608 131
275 3300049127 Ga0501306_033987 Ga0501306_033987_181_576 131
276 3300049128 Ga0501308_002370 Ga0501308_002370_666_1061 131
277 3300049128 Ga0501308_020408 Ga0501308_020408_47_442 131
278 3300049128 Ga0501308_023831 Ga0501308_023831_201_596 131
279 3300049129 Ga0501309_000912 Ga0501309_000912_624_1019 131
280 3300049130 Ga0501310_007310 Ga0501310_007310_253_648 131
281 3300049130 Ga0501310_039434 Ga0501310_039434_49_444 131
282 3300049130 Ga0501310_040407 Ga0501310_040407_227_622 131
283 3300049132 Ga0501343_005978 Ga0501343_005978_406_801 131
284 3300049160 Ga0501304_010671 Ga0501304_010671_27_422 131
285 3300049161 Ga0501305_003020 Ga0501305_003020_453_848 131
286 3300049161 Ga0501305_003176 Ga0501305_003176_1069_1464 131
287 3300049161 Ga0501305_033118 Ga0501305_033118_393_788 131
288 3300049161 Ga0501305_079125 Ga0501305_079125_166_561 131
289 3300049162 Ga0501307_007552 Ga0501307_007552_280_675 131
290 3300049162 Ga0501307_017811 Ga0501307_017811_81_476 131
291 3300049162 Ga0501307_059868 Ga0501307_059868_63_458 131
292 3300049527 Ga0501311_000194 Ga0501311_000194_14_409 131
293 3300049527 Ga0501311_025983 Ga0501311_025983_273_668 131
294 3300049528 Ga0501312_014537 Ga0501312_014537_357_752 131
295 3300049528 Ga0501312_042385 Ga0501312_042385_53_448 131
296 3300049528 Ga0501312_051210 Ga0501312_051210_79_474 131
297 3300049529 Ga0501313_002464 Ga0501313_002464_1044_1439 131
298 3300049529 Ga0501313_010854 Ga0501313_010854_432_827 131
299 3300049529 Ga0501313_038902 Ga0501313_038902_78_473 131
300 3300049530 Ga0501314_007586 Ga0501314_007586_180_575 131
301 3300049531 Ga0501315_006592 Ga0501315_006592_560_955 131
302 3300049531 Ga0501315_017497 Ga0501315_017497_308_703 131
303 3300049531 Ga0501315_085083 Ga0501315_085083_116_511 131
304 3300049532 Ga0501316_001097 Ga0501316_001097_1461_1856 131
305 3300049532 Ga0501316_032792 Ga0501316_032792_279_674 131
306 3300049532 Ga0501316_044798 Ga0501316_044798_203_598 131
307 3300049532 Ga0501316_047918 Ga0501316_047918_68_463 131
308 3300049532 Ga0501316_049401 Ga0501316_049401_141_536 131
309 3300049533 Ga0501317_000409 Ga0501317_000409_686_1081 131
310 3300049533 Ga0501317_026802 Ga0501317_026802_25_420 131
311 3300049533 Ga0501317_065175 Ga0501317_065175_132_527 131
312 3300049533 Ga0501317_097195 Ga0501317_097195_25_420 131
313 3300049534 Ga0501318_000193 Ga0501318_000193_2294_2689 131
314 3300049534 Ga0501318_012450 Ga0501318_012450_436_831 131
315 3300049534 Ga0501318_027008 Ga0501318_027008_25_420 131
316 3300049534 Ga0501318_041516 Ga0501318_041516_64_459 131
317 3300049534 Ga0501318_059951 Ga0501318_059951_27_422 131
318 3300049534 Ga0501318_088202 Ga0501318_088202_83_478 131
319 3300049535 Ga0501319_004701 Ga0501319_004701_14_409 131
320 3300049536 Ga0501320_034956 Ga0501320_034956_72_467 131
321 3300049536 Ga0501320_067016 Ga0501320_067016_81_476 131
322 3300049537 Ga0501321_003508 Ga0501321_003508_512_907 131
323 3300049537 Ga0501321_021272 Ga0501321_021272_28_423 131
324 3300049538 Ga0501322_000140 Ga0501322_000140_198_593 131
325 3300049539 Ga0501323_001515 Ga0501323_001515_377_772 131
326 3300049539 Ga0501323_006869 Ga0501323_006869_785_1180 131
327 3300049539 Ga0501323_039089 Ga0501323_039089_174_569 131
328 3300049539 Ga0501323_088333 Ga0501323_088333_108_503 131
329 3300049540 Ga0501324_046535 Ga0501324_046535_62_457 131
330 3300049541 Ga0501325_002382 Ga0501325_002382_576_971 131
331 3300049541 Ga0501325_028200 Ga0501325_028200_13_408 131
332 3300049541 Ga0501325_030217 Ga0501325_030217_43_438 131
333 3300049541 Ga0501325_060190 Ga0501325_060190_79_474 131
334 3300049545 Ga0501329_05604 Ga0501329_05604_163_558 131
335 3300049548 Ga0501332_04824 Ga0501332_04824_15_410 131
336 3300049548 Ga0501332_06926 Ga0501332_06926_200_595 131
337 3300049550 Ga0501334_16931 Ga0501334_16931_24_419 131
338 3300049554 Ga0501338_03296 Ga0501338_03296_62_457 131
339 3300049556 Ga0501340_005181 Ga0501340_005181_44_439 131
340 3300049569 Ga0501032_0287810 Ga0501032_0287810_512_907 131
341 3300049570 Ga0501033_0442771 Ga0501033_0442771_175_570 131
342 3300049571 Ga0501034_0014987 Ga0501034_0014987_6236_6631 131
343 3300049571 Ga0501034_0427362 Ga0501034_0427362_559_954 131
344 3300049571 Ga0501034_1094454 Ga0501034_1094454_17_412 131
345 3300049572 Ga0501036_0134365 Ga0501036_0134365_1216_1611 131
346 3300049573 Ga0501037_0140866 Ga0501037_0140866_654_1049 131
347 3300049574 Ga0501038_0357450 Ga0501038_0357450_77_472 131
348 3300049579 Ga0501043_0292729 Ga0501043_0292729_619_1014 131
349 3300049581 Ga0501047_0023054 Ga0501047_0023054_2964_3359 131
350 3300049582 Ga0501048_1103829 Ga0501048_1103829_124_519 131
351 3300049583 Ga0501067_0066298 Ga0501067_0066298_1085_1480 131
352 3300049584 Ga0501068_0012735 Ga0501068_0012735_1742_2137 131
353 3300049585 Ga0501069_0004928 Ga0501069_0004928_2724_3119 131
354 3300049586 Ga0501070_0017027 Ga0501070_0017027_3983_4378 131
355 3300049589 Ga0501073_0043526 Ga0501073_0043526_1427_1822 131
356 3300049590 Ga0501074_0057091 Ga0501074_0057091_2137_2532 131
357 3300049660 Ga0501216_077159 Ga0501216_077159_185_580 131
358 3300049661 Ga0501217_332455 Ga0501217_332455_52_447 131
359 3300049679 Ga0501249_079202 Ga0501249_079202_216_611 131
360 3300049680 Ga0501250_014795 Ga0501250_014795_275_670 131
361 3300049683 Ga0501253_103672 Ga0501253_103672_26_421 131
362 3300049741 Ga0501079_0193013 Ga0501079_0193013_381_776 131
363 3300049742 Ga0501080_0009625 Ga0501080_0009625_5006_5401 131
364 3300049744 Ga0501083_0086253 Ga0501083_0086253_232_627 131
365 3300049758 Ga0501241_024401 Ga0501241_024401_363_758 131
366 3300049762 Ga0501265_076490 Ga0501265_076490_46_441 131
367 3300049767 Ga0501270_084109 Ga0501270_084109_31_426 131
368 3300049822 Ga0501035_0091548 Ga0501035_0091548_1279_1674 131
369 3300049823 Ga0501044_0220649 Ga0501044_0220649_997_1392 131
370 3300050491 nmdc:mga00v17_98396_c1 nmdc:mga00v17_98396_c1_510_905 131
371 3300050492 nmdc:mga0yw44_373623_c1 nmdc:mga0yw44_373623_c1_76_471 131
372 3300050514 nmdc:mga08x19_853330_c1 nmdc:mga08x19_853330_c1_155_550 131
373 3300053119 Ga0500595_038381 Ga0500595_038381_309_704 131
374 3300053136 Ga0500559_0000113 Ga0500559_0000113_52637_53032 131
375 3300053153 Ga0500616_0192271 Ga0500616_0192271_78_473 131
376 3300054114 Ga0501084_0039158 Ga0501084_0039158_2290_2685 131
377 3300059491 Ga0587070_164868 Ga0587070_164868_98_493 131
378 3300061719 Ga0466962_0020301 Ga0466962_0020301_389_784 131
379 3300061719 Ga0466962_0742836 Ga0466962_0742836_76_471 131
380 3300003187 JGI25151J46595_10000038 JGI25151J46595_1000003817 132
381 3300003187 JGI25151J46595_10029400 JGI25151J46595_100294003 132
382 3300003214 JGI25165J46597_1000961 JGI25165J46597_100096114 132
383 3300003575 Ga0007409J51694_1099358 Ga0007409J51694_10993582 132
384 3300003771 Ga0055526_1007926 Ga0055526_10079268 132
385 3300003771 Ga0055526_1011996 Ga0055526_10119965 132
386 3300003771 Ga0055526_1012008 Ga0055526_10120085 132
387 3300003775 Ga0055524_1006440 Ga0055524_10064405 132
388 3300003775 Ga0055524_1017171 Ga0055524_10171712 132
389 3300005262 Ga0065165_1000631 Ga0065165_100063117 132
390 3300005327 Ga0070658_10015385 Ga0070658_100153857 132
391 3300005327 Ga0070658_10025403 Ga0070658_100254035 132
392 3300005327 Ga0070658_10040606 Ga0070658_100406066 132
393 3300005327 Ga0070658_10543772 Ga0070658_105437721 132
394 3300005327 Ga0070658_10934740 Ga0070658_109347402 132
395 3300005328 Ga0070676_10549892 Ga0070676_105498922 132
396 3300005331 Ga0070670_100651452 Ga0070670_1006514522 132
397 3300005334 Ga0068869_100549502 Ga0068869_1005495022 132
398 3300005339 Ga0070660_100004846 Ga0070660_10000484612 132
399 3300005339 Ga0070660_100011745 Ga0070660_10001174510 132
400 3300005339 Ga0070660_100062412 Ga0070660_1000624124 132
401 3300005339 Ga0070660_100383367 Ga0070660_1003833672 132
402 3300005340 Ga0070689_101171007 Ga0070689_1011710071 132
403 3300005341 Ga0070691_10182111 Ga0070691_101821112 132
404 3300005344 Ga0070661_100010348 Ga0070661_1000103484 132
405 3300005344 Ga0070661_100021704 Ga0070661_1000217043 132
406 3300005347 Ga0070668_100070464 Ga0070668_1000704644 132
407 3300005347 Ga0070668_100267353 Ga0070668_1002673532 132
408 3300005347 Ga0070668_100996861 Ga0070668_1009968612 132
409 3300005353 Ga0070669_100776251 Ga0070669_1007762512 132
410 3300005355 Ga0070671_100785994 Ga0070671_1007859942 132
411 3300005356 Ga0070674_100022024 Ga0070674_1000220244 132
412 3300005356 Ga0070674_100814071 Ga0070674_1008140711 132
413 3300005364 Ga0070673_100171656 Ga0070673_1001716562 132
414 3300005364 Ga0070673_100320084 Ga0070673_1003200841 132
415 3300005364 Ga0070673_100366749 Ga0070673_1003667492 132
416 3300005366 Ga0070659_100048719 Ga0070659_1000487191 132
417 3300005366 Ga0070659_100774510 Ga0070659_1007745102 132
418 3300005434 Ga0070709_10641614 Ga0070709_106416142 132
419 3300005435 Ga0070714_100109782 Ga0070714_1001097822 132
420 3300005435 Ga0070714_100971260 Ga0070714_1009712602 132
421 3300005435 Ga0070714_101364993 Ga0070714_1013649932 132
422 3300005439 Ga0070711_100568848 Ga0070711_1005688481 132
423 3300005439 Ga0070711_100689944 Ga0070711_1006899442 132
424 3300005441 Ga0070700_100063876 Ga0070700_1000638762 132
425 3300005444 Ga0070694_100392764 Ga0070694_1003927642 132
426 3300005456 Ga0070678_100462878 Ga0070678_1004628782 132
427 3300005456 Ga0070678_100961738 Ga0070678_1009617382 132
428 3300005458 Ga0070681_11031567 Ga0070681_110315671 132
429 3300005459 Ga0068867_100133734 Ga0068867_1001337344 132
430 3300005459 Ga0068867_100254901 Ga0068867_1002549012 132
431 3300005530 Ga0070679_100048764 Ga0070679_1000487649 132
432 3300005535 Ga0070684_100219672 Ga0070684_1002196722 132
433 3300005536 Ga0070697_100005582 Ga0070697_1000055825 132
434 3300005543 Ga0070672_100153763 Ga0070672_1001537633 132
435 3300005545 Ga0070695_100007388 Ga0070695_1000073883 132
436 3300005548 Ga0070665_100212441 Ga0070665_1002124413 132
437 3300005548 Ga0070665_100421454 Ga0070665_1004214543 132
438 3300005548 Ga0070665_100936261 Ga0070665_1009362611 132
439 3300005563 Ga0068855_100018562 Ga0068855_1000185629 132
440 3300005563 Ga0068855_100034672 Ga0068855_1000346723 132
441 3300005564 Ga0070664_100181128 Ga0070664_1001811282 132
442 3300005577 Ga0068857_100071599 Ga0068857_1000715993 132
443 3300005577 Ga0068857_100547441 Ga0068857_1005474412 132
444 3300005578 Ga0068854_100008442 Ga0068854_1000084429 132
445 3300005578 Ga0068854_101588108 Ga0068854_1015881081 132
446 3300005614 Ga0068856_100068108 Ga0068856_1000681084 132
447 3300005614 Ga0068856_100283714 Ga0068856_1002837142 132
448 3300005616 Ga0068852_100009612 Ga0068852_1000096127 132
449 3300005616 Ga0068852_100023465 Ga0068852_1000234658 132
450 3300005616 Ga0068852_100984811 Ga0068852_1009848112 132
451 3300005718 Ga0068866_10304780 Ga0068866_103047802 132
452 3300005719 Ga0068861_100214013 Ga0068861_1002140133 132
453 3300005834 Ga0068851_10120448 Ga0068851_101204483 132
454 3300005844 Ga0068862_100691568 Ga0068862_1006915682 132
455 3300005981 Ga0081538_10368833 Ga0081538_103688331 132
456 3300006038 Ga0075365_10442619 Ga0075365_104426192 132
457 3300006038 Ga0075365_10662485 Ga0075365_106624851 132
458 3300006042 Ga0075368_10066230 Ga0075368_100662303 132
459 3300006048 Ga0075363_100049305 Ga0075363_1000493052 132
460 3300006048 Ga0075363_100387290 Ga0075363_1003872902 132
461 3300006173 Ga0070716_100894376 Ga0070716_1008943762 132
462 3300006175 Ga0070712_100393545 Ga0070712_1003935453 132
463 3300006177 Ga0075362_10244512 Ga0075362_102445122 132
464 3300006178 Ga0075367_10075360 Ga0075367_100753604 132
465 3300006186 Ga0075369_10194209 Ga0075369_101942091 132
466 3300006186 Ga0075369_10234943 Ga0075369_102349432 132
467 3300006195 Ga0075366_10132234 Ga0075366_101322341 132
468 3300006195 Ga0075366_10696681 Ga0075366_106966812 132
469 3300006237 Ga0097621_100176251 Ga0097621_1001762514 132
470 3300006353 Ga0075370_10277672 Ga0075370_102776722 132
471 3300006358 Ga0068871_100584219 Ga0068871_1005842192 132
472 3300006358 Ga0068871_100624673 Ga0068871_1006246733 132
473 3300006880 Ga0075429_100661389 Ga0075429_1006613892 132
474 3300006881 Ga0068865_100185308 Ga0068865_1001853082 132
475 3300006881 Ga0068865_101389042 Ga0068865_1013890421 132
476 3300006914 Ga0075436_100014756 Ga0075436_10001475610 132
477 3300007076 Ga0075435_100026460 Ga0075435_1000264603 132
478 3300009093 Ga0105240_10038434 Ga0105240_100384347 132
479 3300009093 Ga0105240_10141214 Ga0105240_101412148 132
480 3300009093 Ga0105240_10662586 Ga0105240_106625861 132
481 3300009093 Ga0105240_12407093 Ga0105240_124070931 132
482 3300009098 Ga0105245_10243528 Ga0105245_102435283 132
483 3300009101 Ga0105247_11130999 Ga0105247_111309991 132
484 3300009148 Ga0105243_10200032 Ga0105243_102000322 132
485 3300009174 Ga0105241_11196004 Ga0105241_111960042 132
486 3300009545 Ga0105237_10268995 Ga0105237_102689953 132
487 3300009551 Ga0105238_10164963 Ga0105238_101649633 132
488 3300009551 Ga0105238_10224998 Ga0105238_102249984 132
489 3300009551 Ga0105238_10969946 Ga0105238_109699462 132
490 3300010375 Ga0105239_10067735 Ga0105239_100677352 132
491 3300010375 Ga0105239_10373217 Ga0105239_103732173 132
492 3300010375 Ga0105239_10484555 Ga0105239_104845552 132
493 3300013104 Ga0157370_10089218 Ga0157370_100892188 132
494 3300013104 Ga0157370_10390973 Ga0157370_103909733 132
495 3300013104 Ga0157370_10667392 Ga0157370_106673922 132
496 3300013105 Ga0157369_10038065 Ga0157369_100380659 132
497 3300013250 Ga0171462_1042 Ga0171462_104259 132
498 3300013296 Ga0157374_10335720 Ga0157374_103357202 132
499 3300013297 Ga0157378_10621501 Ga0157378_106215013 132
500 3300013306 Ga0163162_10498696 Ga0163162_104986962 132
501 3300013307 Ga0157372_10692730 Ga0157372_106927303 132
502 3300013307 Ga0157372_10700197 Ga0157372_107001973 132
503 3300013308 Ga0157375_10285686 Ga0157375_102856861 132
504 3300013308 Ga0157375_13024890 Ga0157375_130248902 132
505 3300014325 Ga0163163_13035012 Ga0163163_130350121 132
506 3300014497 Ga0182008_10552102 Ga0182008_105521022 132
507 3300014497 Ga0182008_10769198 Ga0182008_107691981 132
508 3300014745 Ga0157377_10105601 Ga0157377_101056013 132
509 3300020070 Ga0206356_10625610 Ga0206356_106256102 132
510 3300021358 Ga0213873_10042510 Ga0213873_100425102 132
511 3300021361 Ga0213872_10077193 Ga0213872_100771933 132
512 3300021361 Ga0213872_10111276 Ga0213872_101112763 132
513 3300021377 Ga0213874_10030386 Ga0213874_100303863 132
514 3300021377 Ga0213874_10089747 Ga0213874_100897471 132
515 3300021384 Ga0213876_10003867 Ga0213876_100038673 132
516 3300021384 Ga0213876_10016751 Ga0213876_100167519 132
517 3300021384 Ga0213876_10017136 Ga0213876_100171363 132
518 3300021388 Ga0213875_10008348 Ga0213875_100083483 132
519 3300021441 Ga0213871_10102972 Ga0213871_101029721 132
520 3300025231 Ga0207427_105022 Ga0207427_1050224 132
521 3300025261 Ga0209233_1000293 Ga0209233_100029322 132
522 3300025284 Ga0209130_1001794 Ga0209130_100179412 132
523 3300025291 Ga0209675_1002527 Ga0209675_100252714 132
524 3300025292 Ga0209676_1111893 Ga0209676_11118931 132
525 3300025294 Ga0209025_1000014 Ga0209025_100001411 132
526 3300025294 Ga0209025_1012375 Ga0209025_10123757 132
527 3300025294 Ga0209025_1083054 Ga0209025_10830541 132
528 3300025295 Ga0209564_1002872 Ga0209564_100287212 132
529 3300025295 Ga0209564_1003215 Ga0209564_10032158 132
530 3300025299 Ga0209256_1000108 Ga0209256_1000108185 132
531 3300025299 Ga0209256_1000540 Ga0209256_100054054 132
532 3300025302 Ga0207426_1004654 Ga0207426_10046549 132
533 3300025304 Ga0209257_1025525 Ga0209257_10255252 132
534 3300025321 Ga0207656_10070969 Ga0207656_100709692 132
535 3300025901 Ga0207688_10011717 Ga0207688_100117174 132
536 3300025901 Ga0207688_10310436 Ga0207688_103104363 132
537 3300025904 Ga0207647_10047848 Ga0207647_100478484 132
538 3300025904 Ga0207647_10121245 Ga0207647_101212454 132
539 3300025907 Ga0207645_10035969 Ga0207645_100359693 132
540 3300025907 Ga0207645_10291700 Ga0207645_102917002 132
541 3300025909 Ga0207705_10001453 Ga0207705_1000145324 132
542 3300025909 Ga0207705_10070578 Ga0207705_100705782 132
543 3300025909 Ga0207705_10891694 Ga0207705_108916941 132
544 3300025910 Ga0207684_10499689 Ga0207684_104996893 132
545 3300025911 Ga0207654_10179626 Ga0207654_101796263 132
546 3300025911 Ga0207654_10229343 Ga0207654_102293432 132
547 3300025912 Ga0207707_10877950 Ga0207707_108779502 132
548 3300025913 Ga0207695_10002347 Ga0207695_100023477 132
549 3300025913 Ga0207695_10058589 Ga0207695_100585892 132
550 3300025913 Ga0207695_10125896 Ga0207695_101258963 132
551 3300025914 Ga0207671_10610727 Ga0207671_106107272 132
552 3300025914 Ga0207671_11120025 Ga0207671_111200252 132
553 3300025916 Ga0207663_11339655 Ga0207663_113396552 132
554 3300025919 Ga0207657_10008060 Ga0207657_1000806012 132
555 3300025919 Ga0207657_10043012 Ga0207657_100430125 132
556 3300025919 Ga0207657_10054867 Ga0207657_100548679 132
557 3300025920 Ga0207649_10057628 Ga0207649_100576284 132
558 3300025920 Ga0207649_10123886 Ga0207649_101238862 132
559 3300025921 Ga0207652_10485160 Ga0207652_104851602 132
560 3300025924 Ga0207694_10072325 Ga0207694_100723251 132
561 3300025924 Ga0207694_10161581 Ga0207694_101615813 132
562 3300025924 Ga0207694_10692700 Ga0207694_106927002 132
563 3300025926 Ga0207659_10167580 Ga0207659_101675802 132
564 3300025928 Ga0207700_10618288 Ga0207700_106182882 132
565 3300025929 Ga0207664_10073108 Ga0207664_100731086 132
566 3300025929 Ga0207664_10177988 Ga0207664_101779884 132
567 3300025932 Ga0207690_10039549 Ga0207690_100395494 132
568 3300025932 Ga0207690_10146492 Ga0207690_101464923 132
569 3300025933 Ga0207706_10017594 Ga0207706_100175944 132
570 3300025935 Ga0207709_10362890 Ga0207709_103628903 132
571 3300025937 Ga0207669_10040699 Ga0207669_100406993 132
572 3300025937 Ga0207669_10618331 Ga0207669_106183312 132
573 3300025938 Ga0207704_11029964 Ga0207704_110299641 132
574 3300025938 Ga0207704_11094741 Ga0207704_110947412 132
575 3300025940 Ga0207691_10003340 Ga0207691_1000334018 132
576 3300025940 Ga0207691_10995317 Ga0207691_109953172 132
577 3300025942 Ga0207689_10975916 Ga0207689_109759162 132
578 3300025942 Ga0207689_11214199 Ga0207689_112141992 132
579 3300025945 Ga0207679_10039615 Ga0207679_100396158 132
580 3300025949 Ga0207667_10000877 Ga0207667_1000087716 132
581 3300025949 Ga0207667_10002756 Ga0207667_1000275618 132
582 3300025949 Ga0207667_10019501 Ga0207667_100195014 132
583 3300025960 Ga0207651_10311804 Ga0207651_103118042 132
584 3300025960 Ga0207651_11069737 Ga0207651_110697372 132
585 3300025972 Ga0207668_10546949 Ga0207668_105469491 132
586 3300025972 Ga0207668_10967315 Ga0207668_109673152 132
587 3300025972 Ga0207668_11034164 Ga0207668_110341641 132
588 3300025981 Ga0207640_10023318 Ga0207640_100233189 132
589 3300025981 Ga0207640_11395091 Ga0207640_113950911 132
590 3300026023 Ga0207677_10468229 Ga0207677_104682292 132
591 3300026041 Ga0207639_10151732 Ga0207639_101517324 132
592 3300026041 Ga0207639_10196410 Ga0207639_101964103 132
593 3300026067 Ga0207678_10022593 Ga0207678_100225933 132
594 3300026075 Ga0207708_10112333 Ga0207708_101123332 132
595 3300026078 Ga0207702_10167468 Ga0207702_101674681 132
596 3300026078 Ga0207702_10193787 Ga0207702_101937872 132
597 3300026089 Ga0207648_10105542 Ga0207648_101055424 132
598 3300026089 Ga0207648_10299667 Ga0207648_102996673 132
599 3300026116 Ga0207674_10065457 Ga0207674_100654573 132
600 3300026116 Ga0207674_10955653 Ga0207674_109556532 132
601 3300026118 Ga0207675_100229874 Ga0207675_1002298742 132
602 3300026121 Ga0207683_10398170 Ga0207683_103981702 132
603 3300026142 Ga0207698_10009953 Ga0207698_100099538 132
604 3300026142 Ga0207698_10084824 Ga0207698_100848243 132
605 3300026142 Ga0207698_12272721 Ga0207698_122727211 132
606 3300027866 Ga0209813_10088547 Ga0209813_100885471 132
607 3300028379 Ga0268266_10085002 Ga0268266_100850024 132
608 3300028379 Ga0268266_10187330 Ga0268266_101873303 132
609 3300028379 Ga0268266_10519989 Ga0268266_105199891 132
610 3300028379 Ga0268266_10774341 Ga0268266_107743413 132
611 3300028380 Ga0268265_10989906 Ga0268265_109899062 132
612 3300028577 Ga0265318_10015702 Ga0265318_100157022 132
613 3300028577 Ga0265318_10102029 Ga0265318_101020292 132
614 3300028786 Ga0307517_10174085 Ga0307517_101740852 132
615 3300028800 Ga0265338_10005387 Ga0265338_1000538717 132
616 3300030760 Ga0265762_1030167 Ga0265762_10301672 132
617 3300030760 Ga0265762_1115148 Ga0265762_11151481 132
618 3300031235 Ga0265330_10006774 Ga0265330_100067743 132
619 3300031235 Ga0265330_10046222 Ga0265330_100462223 132
620 3300031235 Ga0265330_10149118 Ga0265330_101491182 132
621 3300031235 Ga0265330_10156425 Ga0265330_101564252 132
622 3300031235 Ga0265330_10179775 Ga0265330_101797752 132
623 3300031235 Ga0265330_10180753 Ga0265330_101807532 132
624 3300031235 Ga0265330_10211989 Ga0265330_102119892 132
625 3300031235 Ga0265330_10348479 Ga0265330_103484791 132
626 3300031235 Ga0265330_10350569 Ga0265330_103505691 132
627 3300031235 Ga0265330_10354749 Ga0265330_103547491 132
628 3300031238 Ga0265332_10012013 Ga0265332_100120132 132
629 3300031238 Ga0265332_10117030 Ga0265332_101170303 132
630 3300031238 Ga0265332_10270892 Ga0265332_102708921 132
631 3300031239 Ga0265328_10000041 Ga0265328_1000004182 132
632 3300031239 Ga0265328_10000129 Ga0265328_1000012917 132
633 3300031239 Ga0265328_10002900 Ga0265328_100029007 132
634 3300031239 Ga0265328_10002943 Ga0265328_100029431 132
635 3300031239 Ga0265328_10021114 Ga0265328_100211142 132
636 3300031239 Ga0265328_10031155 Ga0265328_100311552 132
637 3300031239 Ga0265328_10031723 Ga0265328_100317233 132
638 3300031239 Ga0265328_10034301 Ga0265328_100343013 132
639 3300031239 Ga0265328_10047389 Ga0265328_100473892 132
640 3300031241 Ga0265325_10001732 Ga0265325_1000173219 132
641 3300031241 Ga0265325_10045461 Ga0265325_100454612 132
642 3300031241 Ga0265325_10072848 Ga0265325_100728481 132
643 3300031241 Ga0265325_10079474 Ga0265325_100794743 132
644 3300031241 Ga0265325_10150945 Ga0265325_101509453 132
645 3300031242 Ga0265329_10125809 Ga0265329_101258092 132
646 3300031247 Ga0265340_10001159 Ga0265340_100011592 132
647 3300031247 Ga0265340_10007526 Ga0265340_1000752611 132
648 3300031247 Ga0265340_10010398 Ga0265340_100103987 132
649 3300031247 Ga0265340_10021947 Ga0265340_100219478 132
650 3300031247 Ga0265340_10092888 Ga0265340_100928883 132
651 3300031247 Ga0265340_10148320 Ga0265340_101483202 132
652 3300031247 Ga0265340_10166397 Ga0265340_101663972 132
653 3300031249 Ga0265339_10002105 Ga0265339_1000210515 132
654 3300031249 Ga0265339_10008522 Ga0265339_100085225 132
655 3300031249 Ga0265339_10042300 Ga0265339_100423001 132
656 3300031249 Ga0265339_10057240 Ga0265339_100572403 132
657 3300031249 Ga0265339_10065467 Ga0265339_100654672 132
658 3300031249 Ga0265339_10081034 Ga0265339_100810343 132
659 3300031249 Ga0265339_10392194 Ga0265339_103921942 132
660 3300031249 Ga0265339_10527566 Ga0265339_105275661 132
661 3300031250 Ga0265331_10000090 Ga0265331_1000009017 132
662 3300031250 Ga0265331_10001125 Ga0265331_100011259 132
663 3300031250 Ga0265331_10016732 Ga0265331_100167327 132
664 3300031250 Ga0265331_10017155 Ga0265331_100171552 132
665 3300031250 Ga0265331_10076846 Ga0265331_100768463 132
666 3300031251 Ga0265327_10028470 Ga0265327_100284702 132
667 3300031251 Ga0265327_10371914 Ga0265327_103719142 132
668 3300031344 Ga0265316_10015933 Ga0265316_100159334 132
669 3300031344 Ga0265316_10039265 Ga0265316_100392657 132
670 3300031344 Ga0265316_10188596 Ga0265316_101885962 132
671 3300031344 Ga0265316_10507656 Ga0265316_105076562 132
672 3300031344 Ga0265316_11116696 Ga0265316_111166961 132
673 3300031456 Ga0307513_10110246 Ga0307513_101102466 132
674 3300031548 Ga0307408_100741874 Ga0307408_1007418742 132
675 3300031595 Ga0265313_10000031 Ga0265313_1000003193 132
676 3300031595 Ga0265313_10019748 Ga0265313_100197483 132
677 3300031595 Ga0265313_10053277 Ga0265313_100532774 132
678 3300031595 Ga0265313_10100614 Ga0265313_101006142 132
679 3300031616 Ga0307508_10155372 Ga0307508_101553724 132
680 3300031649 Ga0307514_10098619 Ga0307514_100986195 132
681 3300031665 Ga0316575_10514375 Ga0316575_105143751 132
682 3300031711 Ga0265314_10000963 Ga0265314_100009631 132
683 3300031711 Ga0265314_10008857 Ga0265314_1000885712 132
684 3300031711 Ga0265314_10461989 Ga0265314_104619892 132
685 3300031712 Ga0265342_10004137 Ga0265342_1000413717 132
686 3300031712 Ga0265342_10006333 Ga0265342_100063335 132
687 3300031712 Ga0265342_10182071 Ga0265342_101820711 132
688 3300031712 Ga0265342_10598166 Ga0265342_105981661 132
689 3300031727 Ga0316576_10114488 Ga0316576_101144882 132
690 3300031728 Ga0316578_10748690 Ga0316578_107486901 132
691 3300031731 Ga0307405_10055833 Ga0307405_100558333 132
692 3300031733 Ga0316577_10407604 Ga0316577_104076042 132
693 3300031824 Ga0307413_10782991 Ga0307413_107829912 132
694 3300031852 Ga0307410_11051262 Ga0307410_110512622 132
695 3300031852 Ga0307410_11084306 Ga0307410_110843062 132
696 3300031901 Ga0307406_10090266 Ga0307406_100902663 132
697 3300031901 Ga0307406_11605471 Ga0307406_116054712 132
698 3300031903 Ga0307407_10820445 Ga0307407_108204452 132
699 3300031911 Ga0307412_10262248 Ga0307412_102622482 132
700 3300031995 Ga0307409_100286660 Ga0307409_1002866603 132
701 3300031995 Ga0307409_102919525 Ga0307409_1029195251 132
702 3300032002 Ga0307416_100047875 Ga0307416_1000478754 132
703 3300032002 Ga0307416_102381471 Ga0307416_1023814711 132
704 3300032002 Ga0307416_102510348 Ga0307416_1025103481 132
705 3300032004 Ga0307414_10287420 Ga0307414_102874201 132
706 3300032005 Ga0307411_10479497 Ga0307411_104794972 132
707 3300032005 Ga0307411_10995046 Ga0307411_109950462 132
708 3300032168 Ga0316593_10012327 Ga0316593_100123275 132
709 3300032168 Ga0316593_10315192 Ga0316593_103151922 132
710 3300033180 Ga0307510_10114264 Ga0307510_101142644 132
711 3300033524 Ga0316592_1009885 Ga0316592_10098853 132
712 3300033541 Ga0316596_1006578 Ga0316596_10065785 132
713 3300034817 Ga0373948_0011793 Ga0373948_0011793_902_1300 132
714 3300034820 Ga0373959_0121796 Ga0373959_0121796_175_573 132
715 3300035084 Ga0373928_0005729 Ga0373928_0005729_596_994 132
716 3300035089 Ga0373944_0067559 Ga0373944_0067559_171_569 132
717 3300035111 Ga0373923_0415822 Ga0373923_0415822_152_550 132
718 3300035112 Ga0373932_0084558 Ga0373932_0084558_176_574 132
719 3300035113 Ga0373936_0008097 Ga0373936_0008097_376_774 132
720 3300035115 Ga0373941_0137975 Ga0373941_0137975_359_757 132
721 3300035116 Ga0373945_0006653 Ga0373945_0006653_2293_2691 132
722 3300035121 Ga0373960_0016768 Ga0373960_0016768_69_467 132
723 3300035170 Ga0373943_0007235 Ga0373943_0007235_4303_4701 132
724 3300035170 Ga0373943_0080948 Ga0373943_0080948_614_1012 132
725 3300035171 Ga0373946_0602606 Ga0373946_0602606_20_418 132
726 3300035172 Ga0373955_0036549 Ga0373955_0036549_257_655 132
727 3300035172 Ga0373955_0739722 Ga0373955_0739722_91_489 132
728 3300035172 Ga0373955_0759412 Ga0373955_0759412_73_471 132
729 3300035207 Ga0373942_0039087 Ga0373942_0039087_689_1087 132
730 3300035242 Ga0373962_0141061 Ga0373962_0141061_144_542 132
731 3300035691 Ga0373931_0057013 Ga0373931_0057013_659_1057 132
732 3300035691 Ga0373931_0437656 Ga0373931_0437656_114_512 132
733 3300035692 Ga0373935_0003403 Ga0373935_0003403_6673_7071 132
734 3300035692 Ga0373935_0026109 Ga0373935_0026109_2235_2633 132
735 3300035695 Ga0373927_0000971 Ga0373927_0000971_14128_14526 132
736 3300035695 Ga0373927_0064151 Ga0373927_0064151_1941_2339 132
737 3300035695 Ga0373927_0167531 Ga0373927_0167531_202_600 132
738 3300035724 Ga0373933_0510491 Ga0373933_0510491_88_486 132
739 3300035725 Ga0373947_0011709 Ga0373947_0011709_3302_3700 132
740 3300035725 Ga0373947_0124556 Ga0373947_0124556_333_731 132
741 3300037068 Ga0373925_0002443 Ga0373925_0002443_689_1087 132
742 3300037068 Ga0373925_0002514 Ga0373925_0002514_8593_8991 132
743 3300037853 Ga0436364_0438482 Ga0436364_0438482_677_1075 132
744 3300037853 Ga0436364_0743164 Ga0436364_0743164_768_1166 132
745 3300037853 Ga0436364_1420929 Ga0436364_1420929_33_431 132
746 3300039145 Ga0237816_04840 Ga0237816_04840_56_454 132
747 3300039437 Ga0436365_0047289 Ga0436365_0047289_2059_2457 132
748 3300039437 Ga0436365_0075962 Ga0436365_0075962_303_701 132
749 3300039437 Ga0436365_1136540 Ga0436365_1136540_14179_14577 132
750 3300039437 Ga0436365_1253031 Ga0436365_1253031_36344_36742 132
751 3300039437 Ga0436365_1706336 Ga0436365_1706336_1445_1843 132
752 3300039438 Ga0436360_0321131 Ga0436360_0321131_374_772 132
753 3300039438 Ga0436360_0355448 Ga0436360_0355448_1409_1807 132
754 3300039438 Ga0436360_0454769 Ga0436360_0454769_236_634 132
755 3300039438 Ga0436360_0537617 Ga0436360_0537617_3398_3796 132
756 3300039438 Ga0436360_0773833 Ga0436360_0773833_308_706 132
757 3300039438 Ga0436360_0820186 Ga0436360_0820186_34_432 132
758 3300039438 Ga0436360_0900938 Ga0436360_0900938_49_447 132
759 3300039438 Ga0436360_1154925 Ga0436360_1154925_289_687 132
760 3300039438 Ga0436360_1290282 Ga0436360_1290282_267_665 132
761 3300039447 Ga0436361_0014203 Ga0436361_0014203_829_1227 132
762 3300039447 Ga0436361_0226768 Ga0436361_0226768_191_589 132
763 3300039447 Ga0436361_0257678 Ga0436361_0257678_1490_1888 132
764 3300039447 Ga0436361_0866004 Ga0436361_0866004_764_1162 132
765 3300039447 Ga0436361_0942051 Ga0436361_0942051_201_599 132
766 3300039447 Ga0436361_1025029 Ga0436361_1025029_520_918 132
767 3300039450 Ga0436363_0272908 Ga0436363_0272908_666_1064 132
768 3300039450 Ga0436363_0323271 Ga0436363_0323271_1375_1773 132
769 3300039450 Ga0436363_0746062 Ga0436363_0746062_7190_7588 132
770 3300039450 Ga0436363_0854883 Ga0436363_0854883_267_680 132
771 3300039450 Ga0436363_0858619 Ga0436363_0858619_1154_1552 132
772 3300039450 Ga0436363_0875430 Ga0436363_0875430_563_961 132
773 3300039453 Ga0436362_0006092 Ga0436362_0006092_182_580 132
774 3300039453 Ga0436362_0133577 Ga0436362_0133577_732_1130 132
775 3300039453 Ga0436362_0374465 Ga0436362_0374465_46_444 132
776 3300039453 Ga0436362_0531292 Ga0436362_0531292_158_556 132
777 3300039453 Ga0436362_0976116 Ga0436362_0976116_7706_8104 132
778 3300039453 Ga0436362_1087862 Ga0436362_1087862_483_881 132
779 3300041411 Ga0439466_0111000 Ga0439466_0111000_368_766 132
780 3300041413 Ga0439465_0027934 Ga0439465_0027934_670_1068 132
781 3300041443 Ga0451789_0503154 Ga0451789_0503154_542_940 132
782 3300041451 Ga0451791_0574419 Ga0451791_0574419_258_656 132
783 3300041452 Ga0451793_1391501 Ga0451793_1391501_186_584 132
784 3300041486 Ga0451807_0874557 Ga0451807_0874557_40_438 132
785 3300041486 Ga0451807_1450153 Ga0451807_1450153_20_418 132
786 3300041486 Ga0451807_2360578 Ga0451807_2360578_249_647 132
787 3300041997 Ga0439431_0026550 Ga0439431_0026550_126_524 132
788 3300042004 Ga0439445_0033332 Ga0439445_0033332_806_1204 132
789 3300042004 Ga0439445_0107527 Ga0439445_0107527_318_716 132
790 3300042006 Ga0439432_101817 Ga0439432_101817_136_534 132
791 3300042010 Ga0439452_119086 Ga0439452_119086_94_492 132
792 3300042156 Ga0439446_0178018 Ga0439446_0178018_129_527 132
793 3300044842 Ga0466957_0101786 Ga0466957_0101786_616_1014 132
794 3300045049 Ga0466959_0985704 Ga0466959_0985704_121_519 132
795 3300045051 Ga0451576_1431832 Ga0451576_1431832_276_674 132
796 3300045051 Ga0451576_2682197 Ga0451576_2682197_85_483 132
797 3300046472 Ga0495580_0003736 Ga0495580_0003736_4566_4964 132
798 3300046472 Ga0495580_0525162 Ga0495580_0525162_379_777 132
799 3300046473 Ga0495582_0043074 Ga0495582_0043074_583_981 132
800 3300046492 Ga0495585_0493876 Ga0495585_0493876_128_526 132
801 3300046515 Ga0495620_0037558 Ga0495620_0037558_1105_1503 132
802 3300046517 Ga0495630_0245501 Ga0495630_0245501_516_914 132
803 3300046535 Ga0495586_0405127 Ga0495586_0405127_325_723 132
804 3300046537 Ga0495598_0115737 Ga0495598_0115737_353_751 132
805 3300046543 Ga0495645_0086993 Ga0495645_0086993_1700_2098 132
806 3300046543 Ga0495645_0503183 Ga0495645_0503183_34_432 132
807 3300046559 Ga0495667_0950970 Ga0495667_0950970_12_410 132
808 3300046616 Ga0495668_0032584 Ga0495668_0032584_1217_1615 132
809 3300046660 Ga0495625_0315915 Ga0495625_0315915_433_831 132
810 3300046683 Ga0495658_0001492 Ga0495658_0001492_8545_8943 132
811 3300046794 Ga0495589_0426502 Ga0495589_0426502_94_492 132
812 3300047315 Ga0495581_0457221 Ga0495581_0457221_313_711 132
813 3300047447 Ga0495685_119544 Ga0495685_119544_372_770 132
814 3300048903 Ga0496100_0070642 Ga0496100_0070642_694_1092 132
815 3300048903 Ga0496100_0401356 Ga0496100_0401356_583_981 132
816 3300048903 Ga0496100_0959993 Ga0496100_0959993_79_477 132
817 3300048904 Ga0496101_0031523 Ga0496101_0031523_1503_1901 132
818 3300048904 Ga0496101_0498506 Ga0496101_0498506_303_701 132
819 3300048905 Ga0496102_0783859 Ga0496102_0783859_360_758 132
820 3300048905 Ga0496102_1056612 Ga0496102_1056612_272_670 132
821 3300048906 Ga0496103_0639786 Ga0496103_0639786_30_428 132
822 3300048907 Ga0496104_0050054 Ga0496104_0050054_416_814 132
823 3300048907 Ga0496104_0070384 Ga0496104_0070384_52_450 132
824 3300048907 Ga0496104_0822420 Ga0496104_0822420_377_775 132
825 3300048907 Ga0496104_0873644 Ga0496104_0873644_27_425 132
826 3300048908 Ga0496105_0005504 Ga0496105_0005504_1956_2354 132
827 3300048908 Ga0496105_0360202 Ga0496105_0360202_715_1113 132
828 3300048908 Ga0496105_0940634 Ga0496105_0940634_224_622 132
829 3300048909 Ga0496106_0186897 Ga0496106_0186897_1083_1481 132
830 3300048910 Ga0496107_0632702 Ga0496107_0632702_303_701 132
831 3300048911 Ga0496108_0137085 Ga0496108_0137085_576_974 132
832 3300048911 Ga0496108_0873310 Ga0496108_0873310_365_763 132
833 3300048911 Ga0496108_1114354 Ga0496108_1114354_115_513 132
834 3300048911 Ga0496108_1326975 Ga0496108_1326975_40_438 132
835 3300048912 Ga0496109_1360813 Ga0496109_1360813_154_552 132
836 3300048913 Ga0496110_0008141 Ga0496110_0008141_3484_3882 132
837 3300048913 Ga0496110_0213506 Ga0496110_0213506_443_841 132
838 3300048913 Ga0496110_0784872 Ga0496110_0784872_284_682 132
839 3300048913 Ga0496110_1080030 Ga0496110_1080030_108_506 132
840 3300048914 Ga0496111_0092518 Ga0496111_0092518_147_545 132
841 3300048915 Ga0496112_0034695 Ga0496112_0034695_878_1276 132
842 3300048915 Ga0496112_0572117 Ga0496112_0572117_260_658 132
843 3300048915 Ga0496112_0850217 Ga0496112_0850217_58_456 132
844 3300048916 Ga0496113_0004259 Ga0496113_0004259_7291_7689 132
845 3300048917 Ga0496114_0019003 Ga0496114_0019003_1970_2368 132
846 3300048917 Ga0496114_0108545 Ga0496114_0108545_1436_1834 132
847 3300048917 Ga0496114_0447658 Ga0496114_0447658_139_537 132
848 3300048918 Ga0496115_0009751 Ga0496115_0009751_5540_5938 132
849 3300048918 Ga0496115_0190979 Ga0496115_0190979_1146_1544 132
850 3300048918 Ga0496115_0361216 Ga0496115_0361216_619_1017 132
851 3300048918 Ga0496115_0570404 Ga0496115_0570404_29_427 132
852 3300048919 Ga0496116_0092732 Ga0496116_0092732_697_1095 132
853 3300048920 Ga0496117_0085746 Ga0496117_0085746_1253_1651 132
854 3300048920 Ga0496117_0115792 Ga0496117_0115792_390_788 132
855 3300048920 Ga0496117_0487386 Ga0496117_0487386_64_462 132
856 3300048921 Ga0496118_0101757 Ga0496118_0101757_105_503 132
857 3300048921 Ga0496118_0182585 Ga0496118_0182585_204_602 132
858 3300048922 Ga0496119_0004353 Ga0496119_0004353_6474_6872 132
859 3300048922 Ga0496119_0201215 Ga0496119_0201215_597_995 132
860 3300048924 Ga0496121_0082395 Ga0496121_0082395_166_564 132
861 3300048924 Ga0496121_0857690 Ga0496121_0857690_106_504 132
862 3300048925 Ga0496122_0019871 Ga0496122_0019871_1321_1719 132
863 3300048926 Ga0496123_0008564 Ga0496123_0008564_7643_8041 132
864 3300048926 Ga0496123_0073670 Ga0496123_0073670_743_1141 132
865 3300048927 Ga0496124_0536873 Ga0496124_0536873_273_671 132
866 3300048928 Ga0496125_0017448 Ga0496125_0017448_196_594 132
867 3300048928 Ga0496125_0259025 Ga0496125_0259025_529_927 132
868 3300048929 Ga0496126_0036822 Ga0496126_0036822_3805_4203 132
869 3300048929 Ga0496126_0365140 Ga0496126_0365140_412_810 132
870 3300048929 Ga0496126_0492443 Ga0496126_0492443_97_495 132
871 3300048929 Ga0496126_0667863 Ga0496126_0667863_24_422 132
872 3300048929 Ga0496126_0895552 Ga0496126_0895552_39_437 132
873 3300049130 Ga0501310_001976 Ga0501310_001976_175_573 132
874 3300049161 Ga0501305_000622 Ga0501305_000622_2344_2742 132
875 3300049528 Ga0501312_059336 Ga0501312_059336_202_600 132
876 3300049530 Ga0501314_004204 Ga0501314_004204_713_1111 132
877 3300049534 Ga0501318_060544 Ga0501318_060544_153_551 132
878 3300049568 Ga0501031_0133346 Ga0501031_0133346_1084_1482 132
879 3300049569 Ga0501032_0466394 Ga0501032_0466394_397_795 132
880 3300049570 Ga0501033_0112292 Ga0501033_0112292_1040_1438 132
881 3300049570 Ga0501033_0438034 Ga0501033_0438034_465_863 132
882 3300049571 Ga0501034_0069393 Ga0501034_0069393_1880_2278 132
883 3300049571 Ga0501034_0162397 Ga0501034_0162397_1293_1691 132
884 3300049571 Ga0501034_0929568 Ga0501034_0929568_31_429 132
885 3300049571 Ga0501034_0992470 Ga0501034_0992470_186_584 132
886 3300049572 Ga0501036_0027081 Ga0501036_0027081_4211_4609 132
887 3300049572 Ga0501036_0827783 Ga0501036_0827783_11_409 132
888 3300049573 Ga0501037_0069329 Ga0501037_0069329_1507_1905 132
889 3300049573 Ga0501037_0218316 Ga0501037_0218316_631_1029 132
890 3300049573 Ga0501037_0267468 Ga0501037_0267468_94_492 132
891 3300049574 Ga0501038_0164752 Ga0501038_0164752_489_887 132
892 3300049574 Ga0501038_0250905 Ga0501038_0250905_875_1273 132
893 3300049575 Ga0501039_0388403 Ga0501039_0388403_371_769 132
894 3300049577 Ga0501041_0270794 Ga0501041_0270794_61_459 132
895 3300049578 Ga0501042_0069464 Ga0501042_0069464_1023_1421 132
896 3300049578 Ga0501042_0483421 Ga0501042_0483421_80_478 132
897 3300049579 Ga0501043_0247928 Ga0501043_0247928_277_675 132
898 3300049579 Ga0501043_0594668 Ga0501043_0594668_24_422 132
899 3300049579 Ga0501043_0648365 Ga0501043_0648365_216_614 132
900 3300049580 Ga0501046_0496547 Ga0501046_0496547_163_561 132
901 3300049581 Ga0501047_0120081 Ga0501047_0120081_966_1364 132
902 3300049581 Ga0501047_0573237 Ga0501047_0573237_311_709 132
903 3300049581 Ga0501047_1161746 Ga0501047_1161746_159_557 132
904 3300049582 Ga0501048_0093666 Ga0501048_0093666_194_592 132
905 3300049583 Ga0501067_0017088 Ga0501067_0017088_748_1146 132
906 3300049585 Ga0501069_0742325 Ga0501069_0742325_56_454 132
907 3300049586 Ga0501070_0031071 Ga0501070_0031071_3729_4127 132
908 3300049587 Ga0501071_0136426 Ga0501071_0136426_429_827 132
909 3300049589 Ga0501073_0069855 Ga0501073_0069855_1296_1694 132
910 3300049589 Ga0501073_0095338 Ga0501073_0095338_413_811 132
911 3300049590 Ga0501074_0424223 Ga0501074_0424223_449_847 132
912 3300049592 Ga0501076_0043955 Ga0501076_0043955_2273_2671 132
913 3300049593 Ga0501077_0270029 Ga0501077_0270029_573_971 132
914 3300049593 Ga0501077_0750432 Ga0501077_0750432_145_543 132
915 3300049708 Ga0501245_066611 Ga0501245_066611_113_511 132
916 3300049741 Ga0501079_0378369 Ga0501079_0378369_295_693 132
917 3300049743 Ga0501081_0174979 Ga0501081_0174979_814_1212 132
918 3300049744 Ga0501083_0263204 Ga0501083_0263204_617_1015 132
919 3300049744 Ga0501083_0842544 Ga0501083_0842544_155_553 132
920 3300049744 Ga0501083_0900677 Ga0501083_0900677_119_517 132
921 3300049822 Ga0501035_0216953 Ga0501035_0216953_278_676 132
922 3300049823 Ga0501044_0073393 Ga0501044_0073393_1302_1700 132
923 3300049823 Ga0501044_0254098 Ga0501044_0254098_511_909 132
924 3300049823 Ga0501044_0852389 Ga0501044_0852389_161_559 132
925 3300049824 Ga0501045_0528708 Ga0501045_0528708_298_696 132
926 3300050489 nmdc:mga03683_134374_c1 nmdc:mga03683_134374_c1_28_426 132
927 3300050491 nmdc:mga00v17_533473_c1 nmdc:mga00v17_533473_c1_184_582 132
928 3300050493 nmdc:mga0k408_404010_c1 nmdc:mga0k408_404010_c1_227_625 132
929 3300050494 nmdc:mga06z11_8708_c1 nmdc:mga06z11_8708_c1_2636_3034 132
930 3300050495 nmdc:mga04h51_87027_c1 nmdc:mga04h51_87027_c1_89_487 132
931 3300050496 nmdc:mga07m45_111300_c1 nmdc:mga07m45_111300_c1_383_781 132
932 3300050496 nmdc:mga07m45_69479_c1 nmdc:mga07m45_69479_c1_290_688 132
933 3300050508 nmdc:mga09592_293602_c1 nmdc:mga09592_293602_c1_402_800 132
934 3300050511 nmdc:mga08y16_273468_c1 nmdc:mga08y16_273468_c1_1181_1579 132
935 3300050513 nmdc:mga0rr50_349300_c1 nmdc:mga0rr50_349300_c1_286_684 132
936 3300050514 nmdc:mga08x19_23_c1 nmdc:mga08x19_23_c1_109308_109706 132
937 3300050516 nmdc:mga0sz30_13902_c1 nmdc:mga0sz30_13902_c1_673_1071 132
938 3300050516 nmdc:mga0sz30_217246_c1 nmdc:mga0sz30_217246_c1_399_797 132
939 3300050516 nmdc:mga0sz30_513372_c1 nmdc:mga0sz30_513372_c1_121_519 132
940 3300053077 Ga0495601_0370475 Ga0495601_0370475_73_471 132
941 3300053077 Ga0495601_0722566 Ga0495601_0722566_20_418 132
942 3300053083 Ga0495655_0232202 Ga0495655_0232202_134_532 132
943 3300053085 Ga0495619_0157287 Ga0495619_0157287_670_1068 132
944 3300053119 Ga0500595_026114 Ga0500595_026114_224_622 132
945 3300053120 Ga0500597_069668 Ga0500597_069668_995_1393 132
946 3300053122 Ga0500608_271920 Ga0500608_271920_229_627 132
947 3300053122 Ga0500608_341468 Ga0500608_341468_31_429 132
948 3300053125 Ga0500618_007381 Ga0500618_007381_639_1037 132
949 3300053139 Ga0500568_0000001 Ga0500568_0000001_7924_8322 132
950 3300054114 Ga0501084_0071192 Ga0501084_0071192_1914_2312 132
951 3300059477 Ga0587084_004230 Ga0587084_004230_532_930 132
952 3300059478 Ga0587093_070248 Ga0587093_070248_79_477 132
953 3300059490 Ga0587066_032047 Ga0587066_032047_230_628 132
954 3300059491 Ga0587070_195014 Ga0587070_195014_56_454 132
955 3300059492 Ga0587073_0066125 Ga0587073_0066125_308_706 132
956 3300059492 Ga0587073_0098652 Ga0587073_0098652_328_726 132
957 3300059493 Ga0587077_026408 Ga0587077_026408_594_992 132
958 3300059493 Ga0587077_029785 Ga0587077_029785_455_853 132
959 3300059493 Ga0587077_078087 Ga0587077_078087_285_683 132
960 3300059503 Ga0587080_175963 Ga0587080_175963_56_454 132
961 3300059505 Ga0587083_0040993 Ga0587083_0040993_435_833 132
962 3300059507 Ga0587086_098783 Ga0587086_098783_110_508 132
963 3300059508 Ga0587088_006338 Ga0587088_006338_293_691 132
964 3300059513 Ga0587094_075067 Ga0587094_075067_97_495 132
965 3300059607 Ga0587125_015896 Ga0587125_015896_176_574 132
966 3300059624 Ga0587109_062772 Ga0587109_062772_73_471 132
967 3300059624 Ga0587109_072081 Ga0587109_072081_59_457 132
968 3300059640 Ga0587067_100553 Ga0587067_100553_81_479 132
969 3300059641 Ga0587068_000630 Ga0587068_000630_911_1309 132
970 3300059641 Ga0587068_004293 Ga0587068_004293_1169_1567 132
971 3300059641 Ga0587068_081954 Ga0587068_081954_153_551 132
972 3300059642 Ga0587069_011022 Ga0587069_011022_766_1164 132
973 3300059642 Ga0587069_052056 Ga0587069_052056_103_501 132
974 3300059642 Ga0587069_107552 Ga0587069_107552_112_510 132
975 3300059643 Ga0587072_115279 Ga0587072_115279_121_519 132
976 3300059643 Ga0587072_148066 Ga0587072_148066_59_457 132
977 3300059644 Ga0587075_026000 Ga0587075_026000_430_828 132
978 3300059645 Ga0587076_004307 Ga0587076_004307_435_833 132
979 3300059647 Ga0587079_002261 Ga0587079_002261_609_1007 132
980 3300059647 Ga0587079_039403 Ga0587079_039403_388_786 132
981 3300059649 Ga0587102_064664 Ga0587102_064664_60_458 132
982 3300059651 Ga0587105_005731 Ga0587105_005731_290_688 132
983 3300059652 Ga0587107_076157 Ga0587107_076157_117_515 132
984 3300059659 Ga0587120_009008 Ga0587120_009008_113_511 132
985 3300060346 Ga0587111_0027932 Ga0587111_0027932_337_735 132
986 3300060346 Ga0587111_0153195 Ga0587111_0153195_39_437 132
987 3300060353 Ga0501082_0169846 Ga0501082_0169846_913_1311 132
988 3300060353 Ga0501082_0656848 Ga0501082_0656848_81_479 132
989 3300061719 Ga0466962_0527708 Ga0466962_0527708_131_529 132
990 3300061734 Ga0530510_0283408 Ga0530510_0283408_380_778 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00410

Ribosomal_S8

Ribosomal protein S8

10

137

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4u-assembly1.cif.gz_h a. baumannii ribosome-eravacycline complex: 30s 0.9751 2 132
7unu-assembly1.cif.gz_h pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9745 2 132
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.9722 4 132
7nhn-assembly1.cif.gz_i vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.969 5 132
5uyl-assembly1.cif.gz_H 70s ribosome bound with cognate ternary complex base-paired to a site codon (structure ii) 0.968 2 132
ID Description Score Start End Superfamily
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9794 75 132 3.30.1490.10
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9773 75 132 3.30.1490.10
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9632 75 132 3.30.1490.10
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9611 75 132 3.30.1490.10
3ofbH01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9486 5 73 3.30.1370.30
ID Description Score Start End GO Terms
AF-A0A0S3PYM4-F1-model_v4 Small ribosomal subunit protein uS8 1.002 5 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E3V9H6-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9993 63 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1Q6ZZ57-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9975 65 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3C1PTI8-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9956 64 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A435JWK2-F1-model_v4 deleted 0.9953 63 132

Feature Viewer

pLDDT pTM Quality
94.13 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map