F487614
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 990 | 503 | 963 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_0854883|Ga0436363_0854883_267_680 |
| Length | 137 |
| Sequence | VKESRISDNDPFGDMRARIRNAAMRKRGKVTSPGSSLRGRVLDVLQSEGYIRGYSTTEFDNGRTEFEIELKYFDNEPVIRRIDRVSKPGRRVYVAVDAMPRVANGLGVSILSTPKGVMADHDAREQNVGGEVLCTVF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 4 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 5 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 6 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 7 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 8 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 9 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 10 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 11 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 12 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 13 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 14 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 15 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 16 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 17 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 18 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 19 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 20 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 21 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 22 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 23 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 24 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 25 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 26 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 27 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 28 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 134 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 135 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 139 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 140 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 141 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 142 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300029272 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 | Metatranscriptome | Rhizosphere |
| 206 | 3300029276 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 207 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 208 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 209 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 224 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 225 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 229 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 243 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 273 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 274 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 276 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 277 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 278 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 279 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 280 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 281 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 282 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 283 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 284 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 285 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 286 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 287 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 292 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 293 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 294 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 295 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 296 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 297 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 298 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 299 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 300 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 301 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 302 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 303 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 304 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 305 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 306 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 307 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 308 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 351 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 352 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 353 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 356 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 413 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 414 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 415 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 416 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 417 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 418 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 419 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 420 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 421 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 422 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 423 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 424 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 425 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 430 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 431 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 432 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 433 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 437 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 438 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 439 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 440 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 441 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 442 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 443 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 454 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 455 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 456 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 457 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 458 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 459 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 461 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 463 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 464 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 465 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 466 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 467 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 468 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 469 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 470 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 472 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 473 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 501 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 502 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 503 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.33 |
| Metatranscriptomes | 13.94 |
| Isolates | 2.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.78 |
| Nodule | 1.31 |
| Rhizoplane | 4.95 |
| Rhizosphere | 79.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000038 | 3300003187 | Bacteria | 180430 |
| 2 | JGI25151J46595_10029400 | 3300003187 | Bacteria | 2176 |
| 3 | JGI25165J46597_1000961 | 3300003214 | Bacteria | 19619 |
| 4 | Ga0007410J51695_1051312 | 3300003574 | Bacteria | 950 |
| 5 | Ga0007409J51694_1066553 | 3300003575 | Bacteria | 1490 |
| 6 | Ga0007409J51694_1099358 | 3300003575 | Bacteria | 877 |
| 7 | Ga0007429J51699_1060640 | 3300003579 | Bacteria | 1671 |
| 8 | JGI25404J52841_10003344 | 3300003659 | Bacteria | 3159 |
| 9 | Ga0032354_1108669 | 3300003693 | Bacteria | 872 |
| 10 | Ga0032354_1120138 | 3300003693 | Bacteria | 731 |
| 11 | Ga0055526_1007926 | 3300003771 | Bacteria | 5404 |
| 12 | Ga0055526_1011996 | 3300003771 | Bacteria | 3831 |
| 13 | Ga0055526_1012008 | 3300003771 | Bacteria | 3828 |
| 14 | Ga0055524_1006440 | 3300003775 | Bacteria | 5089 |
| 15 | Ga0055524_1017171 | 3300003775 | Bacteria | 2563 |
| 16 | Ga0065165_1000631 | 3300005262 | Bacteria | 51108 |
| 17 | Ga0070658_10015385 | 3300005327 | Bacteria | 6123 |
| 18 | Ga0070658_10025403 | 3300005327 | Bacteria | 4749 |
| 19 | Ga0070658_10040606 | 3300005327 | Bacteria | 3754 |
| 20 | Ga0070658_10543772 | 3300005327 | Bacteria | 1005 |
| 21 | Ga0070658_10934740 | 3300005327 | Bacteria | 754 |
| 22 | Ga0070676_10549892 | 3300005328 | Bacteria | 826 |
| 23 | Ga0070670_100651452 | 3300005331 | Bacteria | 945 |
| 24 | Ga0068869_100549502 | 3300005334 | Bacteria | 970 |
| 25 | Ga0068868_100515613 | 3300005338 | Bacteria | 1049 |
| 26 | Ga0070660_100004846 | 3300005339 | Bacteria | 9293 |
| 27 | Ga0070660_100011745 | 3300005339 | Bacteria | 6236 |
| 28 | Ga0070660_100062412 | 3300005339 | Bacteria | 2894 |
| 29 | Ga0070660_100383367 | 3300005339 | Bacteria | 1161 |
| 30 | Ga0070660_101904245 | 3300005339 | Bacteria | 507 |
| 31 | Ga0070689_101171007 | 3300005340 | Bacteria | 689 |
| 32 | Ga0070691_10182111 | 3300005341 | Bacteria | 1094 |
| 33 | Ga0070687_100449453 | 3300005343 | Bacteria | 857 |
| 34 | Ga0070661_100010348 | 3300005344 | Bacteria | 6484 |
| 35 | Ga0070661_100021704 | 3300005344 | Bacteria | 4590 |
| 36 | Ga0070692_10335754 | 3300005345 | Bacteria | 934 |
| 37 | Ga0070668_100070464 | 3300005347 | Bacteria | 2722 |
| 38 | Ga0070668_100267353 | 3300005347 | Bacteria | 1424 |
| 39 | Ga0070668_100556489 | 3300005347 | Bacteria | 999 |
| 40 | Ga0070668_100996861 | 3300005347 | Bacteria | 753 |
| 41 | Ga0070669_100776251 | 3300005353 | Bacteria | 813 |
| 42 | Ga0070671_100785994 | 3300005355 | Bacteria | 828 |
| 43 | Ga0070674_100022024 | 3300005356 | Bacteria | 4104 |
| 44 | Ga0070674_100814071 | 3300005356 | Bacteria | 807 |
| 45 | Ga0070673_100171656 | 3300005364 | Bacteria | 1851 |
| 46 | Ga0070673_100320084 | 3300005364 | Bacteria | 1370 |
| 47 | Ga0070673_100366749 | 3300005364 | Bacteria | 1281 |
| 48 | Ga0070659_100048719 | 3300005366 | Bacteria | 3329 |
| 49 | Ga0070659_100774510 | 3300005366 | Bacteria | 833 |
| 50 | Ga0070709_10641614 | 3300005434 | Bacteria | 821 |
| 51 | Ga0070714_100109782 | 3300005435 | Bacteria | 2441 |
| 52 | Ga0070714_100971260 | 3300005435 | Bacteria | 826 |
| 53 | Ga0070714_101364993 | 3300005435 | Bacteria | 692 |
| 54 | Ga0070711_100568848 | 3300005439 | Bacteria | 942 |
| 55 | Ga0070711_100689944 | 3300005439 | Bacteria | 859 |
| 56 | Ga0070705_100613714 | 3300005440 | Bacteria | 843 |
| 57 | Ga0070700_100063876 | 3300005441 | Bacteria | 2330 |
| 58 | Ga0070694_100392764 | 3300005444 | Bacteria | 1084 |
| 59 | Ga0070663_100263402 | 3300005455 | Bacteria | 1368 |
| 60 | Ga0070663_100519849 | 3300005455 | Bacteria | 991 |
| 61 | Ga0070663_101416177 | 3300005455 | Bacteria | 616 |
| 62 | Ga0070678_100462878 | 3300005456 | Bacteria | 1113 |
| 63 | Ga0070678_100961738 | 3300005456 | Bacteria | 783 |
| 64 | Ga0070662_100952996 | 3300005457 | Bacteria | 734 |
| 65 | Ga0070681_11031567 | 3300005458 | Bacteria | 743 |
| 66 | Ga0068867_100133734 | 3300005459 | Bacteria | 1930 |
| 67 | Ga0068867_100254901 | 3300005459 | Bacteria | 1428 |
| 68 | Ga0070679_100048764 | 3300005530 | Bacteria | 4218 |
| 69 | Ga0070679_100590914 | 3300005530 | Bacteria | 1053 |
| 70 | Ga0070684_100219672 | 3300005535 | Bacteria | 1734 |
| 71 | Ga0070697_100005582 | 3300005536 | Bacteria | 9698 |
| 72 | Ga0068853_101027538 | 3300005539 | Bacteria | 794 |
| 73 | Ga0070672_100153763 | 3300005543 | Bacteria | 1904 |
| 74 | Ga0070695_100007388 | 3300005545 | Bacteria | 6517 |
| 75 | Ga0070693_100593988 | 3300005547 | Bacteria | 798 |
| 76 | Ga0070665_100212441 | 3300005548 | Bacteria | 1935 |
| 77 | Ga0070665_100421454 | 3300005548 | Bacteria | 1343 |
| 78 | Ga0070665_100639456 | 3300005548 | Bacteria | 1077 |
| 79 | Ga0070665_100936261 | 3300005548 | Bacteria | 879 |
| 80 | Ga0068855_100018562 | 3300005563 | Bacteria | 8363 |
| 81 | Ga0068855_100034672 | 3300005563 | Bacteria | 6015 |
| 82 | Ga0070664_100181128 | 3300005564 | Bacteria | 1872 |
| 83 | Ga0068857_100071599 | 3300005577 | Bacteria | 3088 |
| 84 | Ga0068857_100547441 | 3300005577 | Bacteria | 1090 |
| 85 | Ga0068854_100008442 | 3300005578 | Bacteria | 6621 |
| 86 | Ga0068854_101588108 | 3300005578 | Bacteria | 596 |
| 87 | Ga0068856_100068108 | 3300005614 | Bacteria | 3518 |
| 88 | Ga0068856_100283714 | 3300005614 | Bacteria | 1673 |
| 89 | Ga0068856_100384103 | 3300005614 | Bacteria | 1424 |
| 90 | Ga0070702_100133794 | 3300005615 | Bacteria | 1570 |
| 91 | Ga0068852_100009612 | 3300005616 | Bacteria | 7185 |
| 92 | Ga0068852_100023465 | 3300005616 | Bacteria | 4966 |
| 93 | Ga0068852_100984811 | 3300005616 | Bacteria | 862 |
| 94 | Ga0068859_101925387 | 3300005617 | Bacteria | 653 |
| 95 | Ga0068866_10304780 | 3300005718 | Bacteria | 996 |
| 96 | Ga0068866_10470237 | 3300005718 | Bacteria | 826 |
| 97 | Ga0068861_100214013 | 3300005719 | Bacteria | 1625 |
| 98 | Ga0068851_10120448 | 3300005834 | Bacteria | 1410 |
| 99 | Ga0068870_10529583 | 3300005840 | Bacteria | 790 |
| 100 | Ga0068862_100691568 | 3300005844 | Bacteria | 987 |
| 101 | Ga0081455_10001008 | 3300005937 | Bacteria | 35646 |
| 102 | Ga0081538_10368833 | 3300005981 | Bacteria | 518 |
| 103 | Ga0081540_1000645 | 3300005983 | Bacteria | 33098 |
| 104 | Ga0075365_10442619 | 3300006038 | Bacteria | 918 |
| 105 | Ga0075365_10662485 | 3300006038 | Bacteria | 738 |
| 106 | Ga0075368_10066230 | 3300006042 | Bacteria | 1452 |
| 107 | Ga0075363_100049305 | 3300006048 | Bacteria | 2242 |
| 108 | Ga0075363_100387290 | 3300006048 | Bacteria | 820 |
| 109 | Ga0075364_10299311 | 3300006051 | Bacteria | 1095 |
| 110 | Ga0070716_100894376 | 3300006173 | Bacteria | 695 |
| 111 | Ga0070712_100393545 | 3300006175 | Bacteria | 1143 |
| 112 | Ga0075362_10244512 | 3300006177 | Bacteria | 882 |
| 113 | Ga0075367_10075360 | 3300006178 | Bacteria | 2035 |
| 114 | Ga0075369_10014440 | 3300006186 | Bacteria | 3154 |
| 115 | Ga0075369_10194209 | 3300006186 | Bacteria | 936 |
| 116 | Ga0075369_10234943 | 3300006186 | Bacteria | 850 |
| 117 | Ga0075366_10132234 | 3300006195 | Bacteria | 1506 |
| 118 | Ga0075366_10696681 | 3300006195 | Bacteria | 631 |
| 119 | Ga0097621_100176251 | 3300006237 | Bacteria | 1845 |
| 120 | Ga0075370_10277672 | 3300006353 | Bacteria | 995 |
| 121 | Ga0068871_100584219 | 3300006358 | Bacteria | 1014 |
| 122 | Ga0068871_100624673 | 3300006358 | Bacteria | 981 |
| 123 | Ga0075428_100717334 | 3300006844 | Bacteria | 1065 |
| 124 | Ga0075433_10001194 | 3300006852 | Bacteria | 18909 |
| 125 | Ga0075434_100004950 | 3300006871 | Bacteria | 12081 |
| 126 | Ga0075429_100661389 | 3300006880 | Bacteria | 915 |
| 127 | Ga0068865_100185308 | 3300006881 | Bacteria | 1605 |
| 128 | Ga0068865_101377807 | 3300006881 | Bacteria | 629 |
| 129 | Ga0068865_101389042 | 3300006881 | Bacteria | 627 |
| 130 | Ga0075436_100014756 | 3300006914 | Bacteria | 5354 |
| 131 | Ga0075436_100997377 | 3300006914 | Bacteria | 628 |
| 132 | Ga0097620_101925399 | 3300006931 | Bacteria | 653 |
| 133 | Ga0075435_100018035 | 3300007076 | Bacteria | 5355 |
| 134 | Ga0075435_100026460 | 3300007076 | Bacteria | 4526 |
| 135 | Ga0105240_10038434 | 3300009093 | Bacteria | 6139 |
| 136 | Ga0105240_10141214 | 3300009093 | Bacteria | 2879 |
| 137 | Ga0105240_10662586 | 3300009093 | Bacteria | 1143 |
| 138 | Ga0105240_12407093 | 3300009093 | Bacteria | 545 |
| 139 | Ga0111539_10023484 | 3300009094 | Bacteria | 7576 |
| 140 | Ga0111539_11073743 | 3300009094 | Bacteria | 936 |
| 141 | Ga0105245_10243528 | 3300009098 | Bacteria | 1744 |
| 142 | Ga0105247_11130999 | 3300009101 | Bacteria | 619 |
| 143 | Ga0105243_10200032 | 3300009148 | Bacteria | 1751 |
| 144 | Ga0105243_10996934 | 3300009148 | Bacteria | 840 |
| 145 | Ga0105241_11196004 | 3300009174 | Bacteria | 720 |
| 146 | Ga0105237_10268995 | 3300009545 | Bacteria | 1707 |
| 147 | Ga0105238_10164963 | 3300009551 | Bacteria | 2190 |
| 148 | Ga0105238_10224998 | 3300009551 | Bacteria | 1853 |
| 149 | Ga0105238_10969946 | 3300009551 | Bacteria | 870 |
| 150 | Ga0105238_11589277 | 3300009551 | Bacteria | 684 |
| 151 | Ga0105249_10154860 | 3300009553 | Bacteria | 2209 |
| 152 | Ga0105239_10067735 | 3300010375 | Bacteria | 3922 |
| 153 | Ga0105239_10373217 | 3300010375 | Bacteria | 1612 |
| 154 | Ga0105239_10484555 | 3300010375 | Bacteria | 1405 |
| 155 | Ga0105239_10861177 | 3300010375 | Bacteria | 1039 |
| 156 | Ga0157370_10089218 | 3300013104 | Bacteria | 2896 |
| 157 | Ga0157370_10390973 | 3300013104 | Bacteria | 1280 |
| 158 | Ga0157370_10667392 | 3300013104 | Bacteria | 950 |
| 159 | Ga0157370_10955547 | 3300013104 | Bacteria | 777 |
| 160 | Ga0157369_10038065 | 3300013105 | Bacteria | 5262 |
| 161 | Ga0171462_1042 | 3300013250 | Bacteria | 66199 |
| 162 | Ga0157374_10335720 | 3300013296 | Bacteria | 1500 |
| 163 | Ga0157378_10621501 | 3300013297 | Bacteria | 1093 |
| 164 | Ga0163162_10498696 | 3300013306 | Bacteria | 1348 |
| 165 | Ga0157372_10692730 | 3300013307 | Bacteria | 1186 |
| 166 | Ga0157372_10700197 | 3300013307 | Bacteria | 1179 |
| 167 | Ga0157372_12249984 | 3300013307 | Bacteria | 626 |
| 168 | Ga0157375_10285686 | 3300013308 | Bacteria | 1813 |
| 169 | Ga0157375_13024890 | 3300013308 | Bacteria | 561 |
| 170 | Ga0163163_13035012 | 3300014325 | Bacteria | 524 |
| 171 | Ga0157380_10008515 | 3300014326 | Bacteria | 7329 |
| 172 | Ga0182008_10552102 | 3300014497 | Bacteria | 640 |
| 173 | Ga0182008_10769198 | 3300014497 | Bacteria | 556 |
| 174 | Ga0157377_10105601 | 3300014745 | Bacteria | 1686 |
| 175 | Ga0157379_10158245 | 3300014968 | Bacteria | 2044 |
| 176 | Ga0206356_10625610 | 3300020070 | Bacteria | 979 |
| 177 | Ga0213873_10042510 | 3300021358 | Bacteria | 1175 |
| 178 | Ga0213872_10006909 | 3300021361 | Bacteria | 5647 |
| 179 | Ga0213872_10012804 | 3300021361 | Bacteria | 3938 |
| 180 | Ga0213872_10021018 | 3300021361 | Bacteria | 3005 |
| 181 | Ga0213872_10077193 | 3300021361 | Bacteria | 1498 |
| 182 | Ga0213872_10086084 | 3300021361 | Bacteria | 1408 |
| 183 | Ga0213872_10111276 | 3300021361 | Bacteria | 1216 |
| 184 | Ga0213872_10356256 | 3300021361 | Bacteria | 599 |
| 185 | Ga0213874_10030386 | 3300021377 | Bacteria | 1556 |
| 186 | Ga0213874_10089747 | 3300021377 | Bacteria | 1008 |
| 187 | Ga0213876_10003867 | 3300021384 | Bacteria | 8462 |
| 188 | Ga0213876_10016751 | 3300021384 | Bacteria | 3872 |
| 189 | Ga0213876_10017136 | 3300021384 | Bacteria | 3825 |
| 190 | Ga0213875_10008348 | 3300021388 | Bacteria | 5309 |
| 191 | Ga0213871_10027257 | 3300021441 | Bacteria | 1466 |
| 192 | Ga0213871_10102972 | 3300021441 | Bacteria | 837 |
| 193 | Ga0256744_103834 | 3300023309 | Bacteria | 772 |
| 194 | Ga0256743_116418 | 3300023436 | Bacteria | 615 |
| 195 | Ga0256720_144321 | 3300023438 | Bacteria | 722 |
| 196 | Ga0207427_105022 | 3300025231 | Bacteria | 1988 |
| 197 | Ga0209233_1000293 | 3300025261 | Bacteria | 63470 |
| 198 | Ga0209130_1001794 | 3300025284 | Bacteria | 12605 |
| 199 | Ga0209675_1002527 | 3300025291 | Bacteria | 9311 |
| 200 | Ga0209676_1111893 | 3300025292 | Bacteria | 562 |
| 201 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 202 | Ga0209025_1012375 | 3300025294 | Bacteria | 5477 |
| 203 | Ga0209025_1083054 | 3300025294 | Bacteria | 1079 |
| 204 | Ga0209564_1002872 | 3300025295 | Bacteria | 12632 |
| 205 | Ga0209564_1003215 | 3300025295 | Bacteria | 11464 |
| 206 | Ga0209256_1000108 | 3300025299 | Bacteria | 185884 |
| 207 | Ga0209256_1000540 | 3300025299 | Bacteria | 54759 |
| 208 | Ga0207426_1004654 | 3300025302 | Bacteria | 6596 |
| 209 | Ga0209257_1025525 | 3300025304 | Bacteria | 2016 |
| 210 | Ga0207656_10070969 | 3300025321 | Bacteria | 1547 |
| 211 | Ga0207642_10228685 | 3300025899 | Bacteria | 1044 |
| 212 | Ga0207688_10011717 | 3300025901 | Bacteria | 4770 |
| 213 | Ga0207688_10177527 | 3300025901 | Bacteria | 1269 |
| 214 | Ga0207688_10310436 | 3300025901 | Bacteria | 966 |
| 215 | Ga0207647_10047848 | 3300025904 | Bacteria | 2658 |
| 216 | Ga0207647_10121245 | 3300025904 | Bacteria | 1542 |
| 217 | Ga0207645_10035969 | 3300025907 | Bacteria | 3179 |
| 218 | Ga0207645_10291700 | 3300025907 | Bacteria | 1085 |
| 219 | Ga0207643_10552321 | 3300025908 | Bacteria | 739 |
| 220 | Ga0207643_10766157 | 3300025908 | Bacteria | 625 |
| 221 | Ga0207705_10001453 | 3300025909 | Bacteria | 18913 |
| 222 | Ga0207705_10070578 | 3300025909 | Bacteria | 2532 |
| 223 | Ga0207705_10891694 | 3300025909 | Bacteria | 689 |
| 224 | Ga0207684_10499689 | 3300025910 | Bacteria | 1042 |
| 225 | Ga0207654_10179626 | 3300025911 | Bacteria | 1380 |
| 226 | Ga0207654_10229343 | 3300025911 | Bacteria | 1236 |
| 227 | Ga0207707_10877950 | 3300025912 | Bacteria | 743 |
| 228 | Ga0207695_10002347 | 3300025913 | Bacteria | 28115 |
| 229 | Ga0207695_10058589 | 3300025913 | Bacteria | 3997 |
| 230 | Ga0207695_10125896 | 3300025913 | Bacteria | 2524 |
| 231 | Ga0207671_10610727 | 3300025914 | Bacteria | 869 |
| 232 | Ga0207671_11120025 | 3300025914 | Bacteria | 618 |
| 233 | Ga0207663_11339655 | 3300025916 | Unclassified | 576 |
| 234 | Ga0207657_10008060 | 3300025919 | Bacteria | 10742 |
| 235 | Ga0207657_10043012 | 3300025919 | Bacteria | 3982 |
| 236 | Ga0207657_10054867 | 3300025919 | Bacteria | 3444 |
| 237 | Ga0207657_10887479 | 3300025919 | Bacteria | 687 |
| 238 | Ga0207649_10057628 | 3300025920 | Bacteria | 2430 |
| 239 | Ga0207649_10123886 | 3300025920 | Bacteria | 1746 |
| 240 | Ga0207652_10485160 | 3300025921 | Bacteria | 1113 |
| 241 | Ga0207694_10072325 | 3300025924 | Bacteria | 2696 |
| 242 | Ga0207694_10161581 | 3300025924 | Bacteria | 1809 |
| 243 | Ga0207694_10692700 | 3300025924 | Bacteria | 859 |
| 244 | Ga0207694_11038132 | 3300025924 | Bacteria | 694 |
| 245 | Ga0207650_10929033 | 3300025925 | Bacteria | 739 |
| 246 | Ga0207659_10167580 | 3300025926 | Bacteria | 1730 |
| 247 | Ga0207700_10618288 | 3300025928 | Bacteria | 965 |
| 248 | Ga0207664_10073108 | 3300025929 | Bacteria | 2766 |
| 249 | Ga0207664_10177988 | 3300025929 | Bacteria | 1825 |
| 250 | Ga0207690_10039549 | 3300025932 | Bacteria | 3078 |
| 251 | Ga0207690_10146492 | 3300025932 | Bacteria | 1746 |
| 252 | Ga0207706_10017594 | 3300025933 | Bacteria | 6440 |
| 253 | Ga0207706_10542975 | 3300025933 | Bacteria | 1001 |
| 254 | Ga0207709_10362890 | 3300025935 | Bacteria | 1097 |
| 255 | Ga0207670_10658740 | 3300025936 | Bacteria | 864 |
| 256 | Ga0207669_10040699 | 3300025937 | Bacteria | 2698 |
| 257 | Ga0207669_10618331 | 3300025937 | Bacteria | 882 |
| 258 | Ga0207704_11029964 | 3300025938 | Bacteria | 697 |
| 259 | Ga0207704_11094741 | 3300025938 | Bacteria | 677 |
| 260 | Ga0207691_10003340 | 3300025940 | Bacteria | 15620 |
| 261 | Ga0207691_10995317 | 3300025940 | Bacteria | 700 |
| 262 | Ga0207689_10975916 | 3300025942 | Bacteria | 715 |
| 263 | Ga0207689_11214199 | 3300025942 | Bacteria | 635 |
| 264 | Ga0207679_10039615 | 3300025945 | Bacteria | 3367 |
| 265 | Ga0207667_10000877 | 3300025949 | Bacteria | 38435 |
| 266 | Ga0207667_10002756 | 3300025949 | Bacteria | 21724 |
| 267 | Ga0207667_10019501 | 3300025949 | Bacteria | 7568 |
| 268 | Ga0207651_10311804 | 3300025960 | Bacteria | 1312 |
| 269 | Ga0207651_11069737 | 3300025960 | Bacteria | 722 |
| 270 | Ga0207668_10546949 | 3300025972 | Bacteria | 1002 |
| 271 | Ga0207668_10967315 | 3300025972 | Bacteria | 760 |
| 272 | Ga0207668_11034164 | 3300025972 | Bacteria | 735 |
| 273 | Ga0207640_10023318 | 3300025981 | Bacteria | 3717 |
| 274 | Ga0207640_11395091 | 3300025981 | Bacteria | 627 |
| 275 | Ga0207677_10468229 | 3300026023 | Bacteria | 1083 |
| 276 | Ga0207677_11095957 | 3300026023 | Bacteria | 726 |
| 277 | Ga0207703_11987339 | 3300026035 | Bacteria | 558 |
| 278 | Ga0207639_10151732 | 3300026041 | Bacteria | 1941 |
| 279 | Ga0207639_10196410 | 3300026041 | Bacteria | 1727 |
| 280 | Ga0207678_10022593 | 3300026067 | Bacteria | 5509 |
| 281 | Ga0207678_10298726 | 3300026067 | Bacteria | 1384 |
| 282 | Ga0207678_10522609 | 3300026067 | Bacteria | 1036 |
| 283 | Ga0207678_10693957 | 3300026067 | Bacteria | 896 |
| 284 | Ga0207708_10112333 | 3300026075 | Bacteria | 2116 |
| 285 | Ga0207702_10167468 | 3300026078 | Bacteria | 2011 |
| 286 | Ga0207702_10193787 | 3300026078 | Bacteria | 1880 |
| 287 | Ga0207648_10105542 | 3300026089 | Bacteria | 2472 |
| 288 | Ga0207648_10299667 | 3300026089 | Bacteria | 1441 |
| 289 | Ga0207674_10065457 | 3300026116 | Bacteria | 3663 |
| 290 | Ga0207674_10955653 | 3300026116 | Bacteria | 825 |
| 291 | Ga0207675_100229874 | 3300026118 | Bacteria | 1789 |
| 292 | Ga0207675_100412225 | 3300026118 | Bacteria | 1333 |
| 293 | Ga0207675_100951766 | 3300026118 | Bacteria | 876 |
| 294 | Ga0207683_10359400 | 3300026121 | Bacteria | 1337 |
| 295 | Ga0207683_10398170 | 3300026121 | Bacteria | 1266 |
| 296 | Ga0207698_10009953 | 3300026142 | Bacteria | 6083 |
| 297 | Ga0207698_10084824 | 3300026142 | Bacteria | 2569 |
| 298 | Ga0207698_12272721 | 3300026142 | Bacteria | 554 |
| 299 | Ga0209813_10088547 | 3300027866 | Bacteria | 1035 |
| 300 | Ga0207428_10371812 | 3300027907 | Bacteria | 1050 |
| 301 | Ga0268266_10085002 | 3300028379 | Bacteria | 2764 |
| 302 | Ga0268266_10187330 | 3300028379 | Bacteria | 1888 |
| 303 | Ga0268266_10519989 | 3300028379 | Bacteria | 1138 |
| 304 | Ga0268266_10774341 | 3300028379 | Bacteria | 926 |
| 305 | Ga0268265_10989906 | 3300028380 | Bacteria | 830 |
| 306 | Ga0265318_10015702 | 3300028577 | Bacteria | 3142 |
| 307 | Ga0265318_10102029 | 3300028577 | Bacteria | 1055 |
| 308 | Ga0307517_10174085 | 3300028786 | Bacteria | 1407 |
| 309 | Ga0307515_10099360 | 3300028794 | Bacteria | 3534 |
| 310 | Ga0265338_10005387 | 3300028800 | Bacteria | 16717 |
| 311 | Ga0265338_10069087 | 3300028800 | Bacteria | 3038 |
| 312 | Ga0311000_107819 | 3300029272 | Bacteria | 758 |
| 313 | Ga0311004_158584 | 3300029276 | Bacteria | 776 |
| 314 | Ga0311001_1103890 | 3300029277 | Bacteria | 1796 |
| 315 | Ga0310981_1004097 | 3300029285 | Bacteria | 1425 |
| 316 | Ga0265762_1030167 | 3300030760 | Bacteria | 1028 |
| 317 | Ga0265762_1115148 | 3300030760 | Bacteria | 610 |
| 318 | Ga0265330_10006774 | 3300031235 | Bacteria | 5647 |
| 319 | Ga0265330_10046222 | 3300031235 | Bacteria | 1918 |
| 320 | Ga0265330_10149118 | 3300031235 | Bacteria | 994 |
| 321 | Ga0265330_10156425 | 3300031235 | Bacteria | 968 |
| 322 | Ga0265330_10179775 | 3300031235 | Bacteria | 896 |
| 323 | Ga0265330_10180753 | 3300031235 | Bacteria | 893 |
| 324 | Ga0265330_10211989 | 3300031235 | Bacteria | 818 |
| 325 | Ga0265330_10280996 | 3300031235 | Bacteria | 701 |
| 326 | Ga0265330_10348479 | 3300031235 | Bacteria | 625 |
| 327 | Ga0265330_10350569 | 3300031235 | Bacteria | 623 |
| 328 | Ga0265330_10354749 | 3300031235 | Bacteria | 619 |
| 329 | Ga0265332_10012013 | 3300031238 | Bacteria | 3845 |
| 330 | Ga0265332_10117030 | 3300031238 | Bacteria | 1120 |
| 331 | Ga0265332_10270892 | 3300031238 | Bacteria | 702 |
| 332 | Ga0265328_10000041 | 3300031239 | Bacteria | 89398 |
| 333 | Ga0265328_10000129 | 3300031239 | Bacteria | 36422 |
| 334 | Ga0265328_10002900 | 3300031239 | Bacteria | 7646 |
| 335 | Ga0265328_10002943 | 3300031239 | Bacteria | 7603 |
| 336 | Ga0265328_10021114 | 3300031239 | Bacteria | 2488 |
| 337 | Ga0265328_10031155 | 3300031239 | Bacteria | 1983 |
| 338 | Ga0265328_10031723 | 3300031239 | Bacteria | 1963 |
| 339 | Ga0265328_10034301 | 3300031239 | Bacteria | 1879 |
| 340 | Ga0265328_10047389 | 3300031239 | Bacteria | 1580 |
| 341 | Ga0265325_10001732 | 3300031241 | Bacteria | 15146 |
| 342 | Ga0265325_10045461 | 3300031241 | Bacteria | 2281 |
| 343 | Ga0265325_10072848 | 3300031241 | Bacteria | 1721 |
| 344 | Ga0265325_10079474 | 3300031241 | Bacteria | 1632 |
| 345 | Ga0265325_10150945 | 3300031241 | Bacteria | 1099 |
| 346 | Ga0265329_10125809 | 3300031242 | Bacteria | 823 |
| 347 | Ga0265340_10001159 | 3300031247 | Bacteria | 15088 |
| 348 | Ga0265340_10007526 | 3300031247 | Bacteria | 5912 |
| 349 | Ga0265340_10010398 | 3300031247 | Bacteria | 4978 |
| 350 | Ga0265340_10021947 | 3300031247 | Bacteria | 3269 |
| 351 | Ga0265340_10092888 | 3300031247 | Bacteria | 1409 |
| 352 | Ga0265340_10148320 | 3300031247 | Bacteria | 1070 |
| 353 | Ga0265340_10166397 | 3300031247 | Bacteria | 1000 |
| 354 | Ga0265339_10002105 | 3300031249 | Bacteria | 14517 |
| 355 | Ga0265339_10008522 | 3300031249 | Bacteria | 6519 |
| 356 | Ga0265339_10042300 | 3300031249 | Bacteria | 2522 |
| 357 | Ga0265339_10057240 | 3300031249 | Bacteria | 2108 |
| 358 | Ga0265339_10065467 | 3300031249 | Bacteria | 1948 |
| 359 | Ga0265339_10081034 | 3300031249 | Bacteria | 1716 |
| 360 | Ga0265339_10392194 | 3300031249 | Bacteria | 650 |
| 361 | Ga0265339_10527566 | 3300031249 | Bacteria | 544 |
| 362 | Ga0265331_10000090 | 3300031250 | Bacteria | 123628 |
| 363 | Ga0265331_10000186 | 3300031250 | Bacteria | 76149 |
| 364 | Ga0265331_10001125 | 3300031250 | Bacteria | 20459 |
| 365 | Ga0265331_10016732 | 3300031250 | Bacteria | 3843 |
| 366 | Ga0265331_10017155 | 3300031250 | Bacteria | 3782 |
| 367 | Ga0265331_10056585 | 3300031250 | Bacteria | 1861 |
| 368 | Ga0265331_10076846 | 3300031250 | Bacteria | 1556 |
| 369 | Ga0265331_10418434 | 3300031250 | Bacteria | 601 |
| 370 | Ga0265327_10000381 | 3300031251 | Bacteria | 83617 |
| 371 | Ga0265327_10007046 | 3300031251 | Bacteria | 8808 |
| 372 | Ga0265327_10028470 | 3300031251 | Bacteria | 3196 |
| 373 | Ga0265327_10371914 | 3300031251 | Bacteria | 623 |
| 374 | Ga0265316_10015933 | 3300031344 | Bacteria | 6544 |
| 375 | Ga0265316_10039265 | 3300031344 | Bacteria | 3802 |
| 376 | Ga0265316_10188596 | 3300031344 | Bacteria | 1532 |
| 377 | Ga0265316_10507656 | 3300031344 | Bacteria | 861 |
| 378 | Ga0265316_10711285 | 3300031344 | Bacteria | 707 |
| 379 | Ga0265316_11116696 | 3300031344 | Bacteria | 546 |
| 380 | Ga0265316_11279725 | 3300031344 | Bacteria | 507 |
| 381 | Ga0307513_10110246 | 3300031456 | Bacteria | 2748 |
| 382 | Ga0307513_10354100 | 3300031456 | Bacteria | 1215 |
| 383 | Ga0307408_100011406 | 3300031548 | Bacteria | 5871 |
| 384 | Ga0307408_100741874 | 3300031548 | Bacteria | 886 |
| 385 | Ga0265313_10000031 | 3300031595 | Bacteria | 128981 |
| 386 | Ga0265313_10004521 | 3300031595 | Bacteria | 10621 |
| 387 | Ga0265313_10019748 | 3300031595 | Bacteria | 3739 |
| 388 | Ga0265313_10053277 | 3300031595 | Bacteria | 1926 |
| 389 | Ga0265313_10100614 | 3300031595 | Bacteria | 1284 |
| 390 | Ga0265313_10124296 | 3300031595 | Bacteria | 1123 |
| 391 | Ga0307508_10155372 | 3300031616 | Bacteria | 1891 |
| 392 | Ga0307514_10098619 | 3300031649 | Bacteria | 2105 |
| 393 | Ga0316575_10514375 | 3300031665 | Bacteria | 520 |
| 394 | Ga0265314_10000963 | 3300031711 | Bacteria | 33816 |
| 395 | Ga0265314_10008857 | 3300031711 | Bacteria | 8590 |
| 396 | Ga0265314_10028299 | 3300031711 | Bacteria | 4180 |
| 397 | Ga0265314_10072853 | 3300031711 | Bacteria | 2293 |
| 398 | Ga0265314_10095028 | 3300031711 | Bacteria | 1930 |
| 399 | Ga0265314_10107669 | 3300031711 | Bacteria | 1778 |
| 400 | Ga0265314_10461989 | 3300031711 | Bacteria | 674 |
| 401 | Ga0265342_10004137 | 3300031712 | Bacteria | 11550 |
| 402 | Ga0265342_10006333 | 3300031712 | Bacteria | 8824 |
| 403 | Ga0265342_10182071 | 3300031712 | Bacteria | 1150 |
| 404 | Ga0265342_10598166 | 3300031712 | Bacteria | 556 |
| 405 | Ga0316576_10114488 | 3300031727 | Bacteria | 2023 |
| 406 | Ga0316578_10748690 | 3300031728 | Bacteria | 568 |
| 407 | Ga0307405_10055833 | 3300031731 | Bacteria | 2474 |
| 408 | Ga0307405_10104855 | 3300031731 | Bacteria | 1903 |
| 409 | Ga0316577_10407604 | 3300031733 | Bacteria | 772 |
| 410 | Ga0307413_10782991 | 3300031824 | Bacteria | 800 |
| 411 | Ga0307410_10007156 | 3300031852 | Bacteria | 6085 |
| 412 | Ga0307410_11051262 | 3300031852 | Bacteria | 704 |
| 413 | Ga0307410_11084306 | 3300031852 | Bacteria | 694 |
| 414 | Ga0326468_10002218 | 3300031889 | Bacteria | 1623 |
| 415 | Ga0307406_10036624 | 3300031901 | Bacteria | 3024 |
| 416 | Ga0307406_10090266 | 3300031901 | Bacteria | 2061 |
| 417 | Ga0307406_11605471 | 3300031901 | Bacteria | 574 |
| 418 | Ga0307407_10011518 | 3300031903 | Bacteria | 4213 |
| 419 | Ga0307407_10820445 | 3300031903 | Bacteria | 709 |
| 420 | Ga0307412_10053732 | 3300031911 | Bacteria | 2671 |
| 421 | Ga0307412_10262248 | 3300031911 | Bacteria | 1348 |
| 422 | Ga0307409_100004876 | 3300031995 | Bacteria | 7628 |
| 423 | Ga0307409_100286660 | 3300031995 | Bacteria | 1525 |
| 424 | Ga0307409_102919525 | 3300031995 | Bacteria | 505 |
| 425 | Ga0307416_100047875 | 3300032002 | Bacteria | 3388 |
| 426 | Ga0307416_100221340 | 3300032002 | Bacteria | 1815 |
| 427 | Ga0307416_102381471 | 3300032002 | Bacteria | 629 |
| 428 | Ga0307416_102510348 | 3300032002 | Bacteria | 614 |
| 429 | Ga0307414_10075716 | 3300032004 | Bacteria | 2443 |
| 430 | Ga0307414_10287420 | 3300032004 | Bacteria | 1385 |
| 431 | Ga0307411_10091338 | 3300032005 | Bacteria | 2126 |
| 432 | Ga0307411_10479497 | 3300032005 | Bacteria | 1047 |
| 433 | Ga0307411_10995046 | 3300032005 | Bacteria | 750 |
| 434 | Ga0307415_100010922 | 3300032126 | Bacteria | 5167 |
| 435 | Ga0316593_10012327 | 3300032168 | Bacteria | 2507 |
| 436 | Ga0316593_10315192 | 3300032168 | Bacteria | 594 |
| 437 | Ga0307510_10114264 | 3300033180 | Bacteria | 2429 |
| 438 | Ga0316592_1009885 | 3300033524 | Bacteria | 1914 |
| 439 | Ga0316596_1006578 | 3300033541 | Bacteria | 2708 |
| 440 | Ga0373948_0011793 | 3300034817 | Bacteria | 1552 |
| 441 | Ga0373948_0160036 | 3300034817 | Bacteria | 567 |
| 442 | Ga0373948_0170624 | 3300034817 | Bacteria | 553 |
| 443 | Ga0373950_0054200 | 3300034818 | Bacteria | 793 |
| 444 | Ga0373959_0121796 | 3300034820 | Bacteria | 638 |
| 445 | Ga0373959_0142571 | 3300034820 | Bacteria | 601 |
| 446 | Ga0373928_0005729 | 3300035084 | Bacteria | 2376 |
| 447 | Ga0373928_0027736 | 3300035084 | Bacteria | 1234 |
| 448 | Ga0373940_0027123 | 3300035088 | Bacteria | 1503 |
| 449 | Ga0373944_0067559 | 3300035089 | Bacteria | 1158 |
| 450 | Ga0373944_0345386 | 3300035089 | Bacteria | 565 |
| 451 | Ga0373923_0415822 | 3300035111 | Bacteria | 649 |
| 452 | Ga0373932_0084558 | 3300035112 | Bacteria | 1008 |
| 453 | Ga0373936_0008097 | 3300035113 | Bacteria | 3952 |
| 454 | Ga0373939_0068612 | 3300035114 | Bacteria | 1148 |
| 455 | Ga0373939_0320690 | 3300035114 | Bacteria | 623 |
| 456 | Ga0373941_0015050 | 3300035115 | Bacteria | 2078 |
| 457 | Ga0373941_0137975 | 3300035115 | Bacteria | 884 |
| 458 | Ga0373941_0420359 | 3300035115 | Bacteria | 556 |
| 459 | Ga0373945_0006653 | 3300035116 | Bacteria | 3735 |
| 460 | Ga0373960_0016768 | 3300035121 | Bacteria | 1889 |
| 461 | Ga0373943_0007235 | 3300035170 | Bacteria | 4980 |
| 462 | Ga0373943_0080948 | 3300035170 | Bacteria | 1665 |
| 463 | Ga0373946_0602606 | 3300035171 | Unclassified | 570 |
| 464 | Ga0373955_0036549 | 3300035172 | Bacteria | 2607 |
| 465 | Ga0373955_0739722 | 3300035172 | Bacteria | 604 |
| 466 | Ga0373955_0759412 | 3300035172 | Bacteria | 596 |
| 467 | Ga0373942_0039087 | 3300035207 | Bacteria | 1289 |
| 468 | Ga0373942_0106190 | 3300035207 | Bacteria | 863 |
| 469 | Ga0373961_0002931 | 3300035241 | Bacteria | 4320 |
| 470 | Ga0373961_0017564 | 3300035241 | Bacteria | 1858 |
| 471 | Ga0373962_0004285 | 3300035242 | Bacteria | 3446 |
| 472 | Ga0373962_0018033 | 3300035242 | Bacteria | 1833 |
| 473 | Ga0373962_0141061 | 3300035242 | Bacteria | 783 |
| 474 | Ga0316574_0164763 | 3300035398 | Bacteria | 1427 |
| 475 | Ga0373931_0001781 | 3300035691 | Bacteria | 9363 |
| 476 | Ga0373931_0037853 | 3300035691 | Bacteria | 2520 |
| 477 | Ga0373931_0057013 | 3300035691 | Bacteria | 2094 |
| 478 | Ga0373931_0437656 | 3300035691 | Bacteria | 834 |
| 479 | Ga0373935_0003403 | 3300035692 | Bacteria | 9238 |
| 480 | Ga0373935_0026109 | 3300035692 | Bacteria | 3602 |
| 481 | Ga0373935_1341243 | 3300035692 | Bacteria | 534 |
| 482 | Ga0373927_0000971 | 3300035695 | Bacteria | 21800 |
| 483 | Ga0373927_0064151 | 3300035695 | Bacteria | 2376 |
| 484 | Ga0373927_0167531 | 3300035695 | Bacteria | 1440 |
| 485 | Ga0373933_0510491 | 3300035724 | Bacteria | 788 |
| 486 | Ga0373947_0011709 | 3300035725 | Bacteria | 5027 |
| 487 | Ga0373947_0124556 | 3300035725 | Bacteria | 1640 |
| 488 | Ga0316582_0356473 | 3300036647 | Bacteria | 1006 |
| 489 | Ga0316584_0029457 | 3300036712 | Bacteria | 4052 |
| 490 | Ga0373925_0002443 | 3300037068 | Bacteria | 14891 |
| 491 | Ga0373925_0002514 | 3300037068 | Bacteria | 14651 |
| 492 | Ga0395905_0057227 | 3300037471 | Bacteria | 3647 |
| 493 | Ga0395905_0816249 | 3300037471 | Bacteria | 836 |
| 494 | Ga0436364_0438482 | 3300037853 | Bacteria | 1655 |
| 495 | Ga0436364_0743164 | 3300037853 | Bacteria | 9802 |
| 496 | Ga0436364_1420929 | 3300037853 | Bacteria | 1199 |
| 497 | Ga0237816_04840 | 3300039145 | Bacteria | 922 |
| 498 | Ga0436365_0047289 | 3300039437 | Bacteria | 7014 |
| 499 | Ga0436365_0075962 | 3300039437 | Bacteria | 769 |
| 500 | Ga0436365_1136540 | 3300039437 | Bacteria | 40433 |
| 501 | Ga0436365_1253031 | 3300039437 | Bacteria | 47093 |
| 502 | Ga0436365_1706336 | 3300039437 | Bacteria | 3761 |
| 503 | Ga0436360_0051477 | 3300039438 | Bacteria | 587 |
| 504 | Ga0436360_0140907 | 3300039438 | Bacteria | 1583 |
| 505 | Ga0436360_0259420 | 3300039438 | Bacteria | 1483 |
| 506 | Ga0436360_0321131 | 3300039438 | Bacteria | 1021 |
| 507 | Ga0436360_0355448 | 3300039438 | Bacteria | 2358 |
| 508 | Ga0436360_0454769 | 3300039438 | Bacteria | 2380 |
| 509 | Ga0436360_0537617 | 3300039438 | Bacteria | 7493 |
| 510 | Ga0436360_0773833 | 3300039438 | Bacteria | 748 |
| 511 | Ga0436360_0820186 | 3300039438 | Bacteria | 854 |
| 512 | Ga0436360_0900938 | 3300039438 | Bacteria | 595 |
| 513 | Ga0436360_1057566 | 3300039438 | Bacteria | 1008 |
| 514 | Ga0436360_1065206 | 3300039438 | Bacteria | 2112 |
| 515 | Ga0436360_1154925 | 3300039438 | Bacteria | 775 |
| 516 | Ga0436360_1290282 | 3300039438 | Bacteria | 1299 |
| 517 | Ga0436361_0014203 | 3300039447 | Bacteria | 1592 |
| 518 | Ga0436361_0016113 | 3300039447 | Bacteria | 2363 |
| 519 | Ga0436361_0074846 | 3300039447 | Bacteria | 692 |
| 520 | Ga0436361_0226768 | 3300039447 | Bacteria | 973 |
| 521 | Ga0436361_0240768 | 3300039447 | Bacteria | 945 |
| 522 | Ga0436361_0257678 | 3300039447 | Bacteria | 1959 |
| 523 | Ga0436361_0291348 | 3300039447 | Bacteria | 1687 |
| 524 | Ga0436361_0315369 | 3300039447 | Bacteria | 539 |
| 525 | Ga0436361_0330189 | 3300039447 | Bacteria | 1200 |
| 526 | Ga0436361_0381254 | 3300039447 | Bacteria | 562 |
| 527 | Ga0436361_0415437 | 3300039447 | Bacteria | 1404 |
| 528 | Ga0436361_0658663 | 3300039447 | Bacteria | 1210 |
| 529 | Ga0436361_0710155 | 3300039447 | Bacteria | 505 |
| 530 | Ga0436361_0714783 | 3300039447 | Bacteria | 615 |
| 531 | Ga0436361_0765661 | 3300039447 | Bacteria | 1143 |
| 532 | Ga0436361_0866004 | 3300039447 | Bacteria | 1371 |
| 533 | Ga0436361_0878406 | 3300039447 | Bacteria | 2465 |
| 534 | Ga0436361_0942051 | 3300039447 | Bacteria | 681 |
| 535 | Ga0436361_1025029 | 3300039447 | Bacteria | 3243 |
| 536 | Ga0436361_1184215 | 3300039447 | Bacteria | 1021 |
| 537 | Ga0436363_0272908 | 3300039450 | Bacteria | 1128 |
| 538 | Ga0436363_0323271 | 3300039450 | Bacteria | 5181 |
| 539 | Ga0436363_0746062 | 3300039450 | Bacteria | 9943 |
| 540 | Ga0436363_0854883 | 3300039450 | Bacteria | 828 |
| 541 | Ga0436363_0858619 | 3300039450 | Bacteria | 1652 |
| 542 | Ga0436363_0875430 | 3300039450 | Bacteria | 1677 |
| 543 | Ga0436363_1182780 | 3300039450 | Bacteria | 947 |
| 544 | Ga0436362_0006092 | 3300039453 | Bacteria | 689 |
| 545 | Ga0436362_0133577 | 3300039453 | Bacteria | 1337 |
| 546 | Ga0436362_0374465 | 3300039453 | Bacteria | 536 |
| 547 | Ga0436362_0531292 | 3300039453 | Bacteria | 592 |
| 548 | Ga0436362_0839400 | 3300039453 | Bacteria | 807 |
| 549 | Ga0436362_0976116 | 3300039453 | Bacteria | 8152 |
| 550 | Ga0436362_1087862 | 3300039453 | Bacteria | 1420 |
| 551 | Ga0439436_0104056 | 3300041404 | Bacteria | 792 |
| 552 | Ga0439453_0005235 | 3300041408 | Bacteria | 1968 |
| 553 | Ga0439466_0111000 | 3300041411 | Bacteria | 851 |
| 554 | Ga0439465_0027934 | 3300041413 | Bacteria | 1788 |
| 555 | Ga0451789_0503154 | 3300041443 | Bacteria | 1003 |
| 556 | Ga0451791_0574419 | 3300041451 | Bacteria | 973 |
| 557 | Ga0451793_1391501 | 3300041452 | Bacteria | 735 |
| 558 | Ga0451807_0874557 | 3300041486 | Bacteria | 555 |
| 559 | Ga0451807_1450153 | 3300041486 | Bacteria | 641 |
| 560 | Ga0451807_2360578 | 3300041486 | Bacteria | 703 |
| 561 | Ga0451853_1126604 | 3300041512 | Bacteria | 630 |
| 562 | Ga0439431_0026550 | 3300041997 | Bacteria | 1420 |
| 563 | Ga0439431_0052962 | 3300041997 | Bacteria | 1056 |
| 564 | Ga0439445_0033332 | 3300042004 | Bacteria | 1345 |
| 565 | Ga0439445_0107527 | 3300042004 | Bacteria | 794 |
| 566 | Ga0439432_101817 | 3300042006 | Bacteria | 858 |
| 567 | Ga0439449_0340077 | 3300042007 | Bacteria | 568 |
| 568 | Ga0439452_119086 | 3300042010 | Bacteria | 562 |
| 569 | Ga0439454_035442 | 3300042011 | Bacteria | 799 |
| 570 | Ga0439456_118164 | 3300042013 | Bacteria | 607 |
| 571 | Ga0439446_0178018 | 3300042156 | Bacteria | 710 |
| 572 | Ga0466972_0009543 | 3300044658 | Bacteria | 4874 |
| 573 | Ga0466966_0064041 | 3300044684 | Bacteria | 2316 |
| 574 | Ga0466966_0166692 | 3300044684 | Bacteria | 1340 |
| 575 | Ga0466964_0912549 | 3300044706 | Bacteria | 503 |
| 576 | Ga0466971_0032824 | 3300044719 | Bacteria | 2326 |
| 577 | Ga0466957_0082727 | 3300044842 | Bacteria | 2001 |
| 578 | Ga0466957_0101786 | 3300044842 | Bacteria | 1812 |
| 579 | Ga0466957_0919939 | 3300044842 | Bacteria | 626 |
| 580 | Ga0466960_0128857 | 3300044901 | Bacteria | 1333 |
| 581 | Ga0466960_0214495 | 3300044901 | Bacteria | 1057 |
| 582 | Ga0466959_0160457 | 3300045049 | Bacteria | 1581 |
| 583 | Ga0466959_0416124 | 3300045049 | Bacteria | 913 |
| 584 | Ga0466959_0985704 | 3300045049 | Bacteria | 561 |
| 585 | Ga0451576_0168990 | 3300045051 | Bacteria | 2282 |
| 586 | Ga0451576_0794393 | 3300045051 | Bacteria | 994 |
| 587 | Ga0451576_1431832 | 3300045051 | Bacteria | 719 |
| 588 | Ga0451576_2682197 | 3300045051 | Bacteria | 507 |
| 589 | Ga0466958_0000676 | 3300045836 | Bacteria | 14782 |
| 590 | Ga0495580_0003736 | 3300046472 | Bacteria | 12895 |
| 591 | Ga0495580_0525162 | 3300046472 | Bacteria | 788 |
| 592 | Ga0495582_0043074 | 3300046473 | Bacteria | 2486 |
| 593 | Ga0495585_0493876 | 3300046492 | Bacteria | 582 |
| 594 | Ga0495606_0540266 | 3300046507 | Bacteria | 582 |
| 595 | Ga0495610_0018183 | 3300046512 | Bacteria | 3978 |
| 596 | Ga0495620_0037558 | 3300046515 | Bacteria | 2156 |
| 597 | Ga0495630_0245501 | 3300046517 | Bacteria | 1368 |
| 598 | Ga0495643_0433413 | 3300046522 | Bacteria | 575 |
| 599 | Ga0495586_0405127 | 3300046535 | Bacteria | 785 |
| 600 | Ga0495587_0162159 | 3300046536 | Bacteria | 1272 |
| 601 | Ga0495598_0115737 | 3300046537 | Bacteria | 904 |
| 602 | Ga0495597_0179175 | 3300046542 | Bacteria | 857 |
| 603 | Ga0495645_0086993 | 3300046543 | Bacteria | 2236 |
| 604 | Ga0495645_0503183 | 3300046543 | Bacteria | 757 |
| 605 | Ga0495622_0085278 | 3300046557 | Bacteria | 1453 |
| 606 | Ga0495667_0950970 | 3300046559 | Bacteria | 525 |
| 607 | Ga0495656_0088344 | 3300046615 | Bacteria | 1413 |
| 608 | Ga0495656_0556043 | 3300046615 | Bacteria | 612 |
| 609 | Ga0495668_0032584 | 3300046616 | Bacteria | 2931 |
| 610 | Ga0495668_0112676 | 3300046616 | Bacteria | 1488 |
| 611 | Ga0495625_0225794 | 3300046660 | Bacteria | 1225 |
| 612 | Ga0495625_0315915 | 3300046660 | Bacteria | 996 |
| 613 | Ga0495658_0001492 | 3300046683 | Bacteria | 12268 |
| 614 | Ga0495613_0000576 | 3300046689 | Bacteria | 29823 |
| 615 | Ga0495670_0145421 | 3300046691 | Bacteria | 1242 |
| 616 | Ga0495670_0828002 | 3300046691 | Bacteria | 505 |
| 617 | Ga0495671_0245556 | 3300046692 | Bacteria | 864 |
| 618 | Ga0495589_0426502 | 3300046794 | Bacteria | 608 |
| 619 | Ga0495581_0457221 | 3300047315 | Bacteria | 743 |
| 620 | Ga0495685_119544 | 3300047447 | Bacteria | 865 |
| 621 | Ga0496100_0070642 | 3300048903 | Bacteria | 2329 |
| 622 | Ga0496100_0401356 | 3300048903 | Bacteria | 1044 |
| 623 | Ga0496100_0959993 | 3300048903 | Bacteria | 672 |
| 624 | Ga0496101_0031523 | 3300048904 | Bacteria | 3727 |
| 625 | Ga0496101_0498506 | 3300048904 | Bacteria | 962 |
| 626 | Ga0496102_0783859 | 3300048905 | Bacteria | 876 |
| 627 | Ga0496102_0949578 | 3300048905 | Bacteria | 781 |
| 628 | Ga0496102_1056612 | 3300048905 | Bacteria | 732 |
| 629 | Ga0496102_1308374 | 3300048905 | Bacteria | 644 |
| 630 | Ga0496103_0639786 | 3300048906 | Bacteria | 676 |
| 631 | Ga0496104_0050054 | 3300048907 | Bacteria | 3942 |
| 632 | Ga0496104_0070384 | 3300048907 | Bacteria | 3325 |
| 633 | Ga0496104_0822420 | 3300048907 | Bacteria | 835 |
| 634 | Ga0496104_0873644 | 3300048907 | Bacteria | 804 |
| 635 | Ga0496104_1240668 | 3300048907 | Bacteria | 649 |
| 636 | Ga0496105_0005504 | 3300048908 | Bacteria | 9611 |
| 637 | Ga0496105_0360202 | 3300048908 | Bacteria | 1160 |
| 638 | Ga0496105_0940634 | 3300048908 | Bacteria | 649 |
| 639 | Ga0496106_0186897 | 3300048909 | Bacteria | 1646 |
| 640 | Ga0496107_0632702 | 3300048910 | Bacteria | 789 |
| 641 | Ga0496108_0137085 | 3300048911 | Bacteria | 2106 |
| 642 | Ga0496108_0873310 | 3300048911 | Bacteria | 773 |
| 643 | Ga0496108_1114354 | 3300048911 | Bacteria | 670 |
| 644 | Ga0496108_1326975 | 3300048911 | Bacteria | 604 |
| 645 | Ga0496109_1360813 | 3300048912 | Bacteria | 646 |
| 646 | Ga0496110_0008141 | 3300048913 | Bacteria | 8422 |
| 647 | Ga0496110_0213506 | 3300048913 | Bacteria | 1754 |
| 648 | Ga0496110_0784872 | 3300048913 | Bacteria | 857 |
| 649 | Ga0496110_1080030 | 3300048913 | Bacteria | 710 |
| 650 | Ga0496111_0092518 | 3300048914 | Bacteria | 2217 |
| 651 | Ga0496112_0034695 | 3300048915 | Bacteria | 4910 |
| 652 | Ga0496112_0572117 | 3300048915 | Bacteria | 1063 |
| 653 | Ga0496112_0850217 | 3300048915 | Bacteria | 836 |
| 654 | Ga0496113_0004259 | 3300048916 | Bacteria | 8765 |
| 655 | Ga0496114_0019003 | 3300048917 | Bacteria | 5566 |
| 656 | Ga0496114_0108545 | 3300048917 | Bacteria | 2376 |
| 657 | Ga0496114_0180419 | 3300048917 | Bacteria | 1844 |
| 658 | Ga0496114_0447658 | 3300048917 | Bacteria | 1144 |
| 659 | Ga0496115_0009751 | 3300048918 | Bacteria | 7152 |
| 660 | Ga0496115_0189171 | 3300048918 | Bacteria | 1701 |
| 661 | Ga0496115_0190979 | 3300048918 | Bacteria | 1692 |
| 662 | Ga0496115_0361216 | 3300048918 | Bacteria | 1183 |
| 663 | Ga0496115_0570404 | 3300048918 | Bacteria | 902 |
| 664 | Ga0496116_0092732 | 3300048919 | Bacteria | 1831 |
| 665 | Ga0496117_0085746 | 3300048920 | Bacteria | 2049 |
| 666 | Ga0496117_0115792 | 3300048920 | Bacteria | 1658 |
| 667 | Ga0496117_0487386 | 3300048920 | Bacteria | 601 |
| 668 | Ga0496118_0101757 | 3300048921 | Bacteria | 1939 |
| 669 | Ga0496118_0182585 | 3300048921 | Bacteria | 1266 |
| 670 | Ga0496119_0004353 | 3300048922 | Bacteria | 14129 |
| 671 | Ga0496119_0201215 | 3300048922 | Bacteria | 1031 |
| 672 | Ga0496121_0082395 | 3300048924 | Bacteria | 2543 |
| 673 | Ga0496121_0857690 | 3300048924 | Bacteria | 527 |
| 674 | Ga0496122_0019871 | 3300048925 | Bacteria | 6109 |
| 675 | Ga0496123_0008564 | 3300048926 | Bacteria | 9374 |
| 676 | Ga0496123_0073670 | 3300048926 | Bacteria | 2117 |
| 677 | Ga0496124_0378537 | 3300048927 | Bacteria | 991 |
| 678 | Ga0496124_0536873 | 3300048927 | Bacteria | 775 |
| 679 | Ga0496125_0017448 | 3300048928 | Bacteria | 6842 |
| 680 | Ga0496125_0259025 | 3300048928 | Bacteria | 1091 |
| 681 | Ga0496126_0036822 | 3300048929 | Bacteria | 4572 |
| 682 | Ga0496126_0365140 | 3300048929 | Bacteria | 1178 |
| 683 | Ga0496126_0492443 | 3300048929 | Bacteria | 981 |
| 684 | Ga0496126_0496478 | 3300048929 | Bacteria | 976 |
| 685 | Ga0496126_0567956 | 3300048929 | Bacteria | 898 |
| 686 | Ga0496126_0667863 | 3300048929 | Bacteria | 811 |
| 687 | Ga0496126_0895552 | 3300048929 | Bacteria | 673 |
| 688 | Ga0496126_1203842 | 3300048929 | Bacteria | 557 |
| 689 | Ga0501306_000743 | 3300049127 | Bacteria | 2709 |
| 690 | Ga0501306_004507 | 3300049127 | Bacteria | 1563 |
| 691 | Ga0501306_023656 | 3300049127 | Bacteria | 874 |
| 692 | Ga0501306_033987 | 3300049127 | Bacteria | 769 |
| 693 | Ga0501308_002370 | 3300049128 | Bacteria | 1648 |
| 694 | Ga0501308_020408 | 3300049128 | Bacteria | 825 |
| 695 | Ga0501308_023831 | 3300049128 | Bacteria | 783 |
| 696 | Ga0501308_025413 | 3300049128 | Bacteria | 767 |
| 697 | Ga0501309_000912 | 3300049129 | Bacteria | 2663 |
| 698 | Ga0501310_001976 | 3300049130 | Bacteria | 1910 |
| 699 | Ga0501310_007310 | 3300049130 | Bacteria | 1178 |
| 700 | Ga0501310_039434 | 3300049130 | Bacteria | 653 |
| 701 | Ga0501310_040407 | 3300049130 | Bacteria | 648 |
| 702 | Ga0501343_005978 | 3300049132 | Bacteria | 943 |
| 703 | Ga0501304_010671 | 3300049160 | Bacteria | 806 |
| 704 | Ga0501305_000622 | 3300049161 | Bacteria | 3012 |
| 705 | Ga0501305_003020 | 3300049161 | Bacteria | 1871 |
| 706 | Ga0501305_003176 | 3300049161 | Bacteria | 1843 |
| 707 | Ga0501305_033118 | 3300049161 | Bacteria | 814 |
| 708 | Ga0501305_079125 | 3300049161 | Bacteria | 588 |
| 709 | Ga0501307_007552 | 3300049162 | Bacteria | 1202 |
| 710 | Ga0501307_017811 | 3300049162 | Bacteria | 898 |
| 711 | Ga0501307_059868 | 3300049162 | Bacteria | 589 |
| 712 | Ga0501307_094337 | 3300049162 | Bacteria | 503 |
| 713 | Ga0501311_000194 | 3300049527 | Bacteria | 3556 |
| 714 | Ga0501311_025983 | 3300049527 | Bacteria | 823 |
| 715 | Ga0501312_014537 | 3300049528 | Bacteria | 1107 |
| 716 | Ga0501312_042385 | 3300049528 | Bacteria | 747 |
| 717 | Ga0501312_051210 | 3300049528 | Bacteria | 697 |
| 718 | Ga0501312_059336 | 3300049528 | Bacteria | 660 |
| 719 | Ga0501313_002464 | 3300049529 | Bacteria | 1757 |
| 720 | Ga0501313_010854 | 3300049529 | Bacteria | 1044 |
| 721 | Ga0501313_038902 | 3300049529 | Bacteria | 635 |
| 722 | Ga0501314_004204 | 3300049530 | Bacteria | 1187 |
| 723 | Ga0501314_007586 | 3300049530 | Bacteria | 965 |
| 724 | Ga0501314_029389 | 3300049530 | Bacteria | 605 |
| 725 | Ga0501315_004037 | 3300049531 | Bacteria | 1509 |
| 726 | Ga0501315_006592 | 3300049531 | Bacteria | 1297 |
| 727 | Ga0501315_017497 | 3300049531 | Bacteria | 938 |
| 728 | Ga0501315_085083 | 3300049531 | Bacteria | 542 |
| 729 | Ga0501316_001097 | 3300049532 | Bacteria | 2191 |
| 730 | Ga0501316_032792 | 3300049532 | Bacteria | 701 |
| 731 | Ga0501316_044798 | 3300049532 | Bacteria | 625 |
| 732 | Ga0501316_047918 | 3300049532 | Bacteria | 609 |
| 733 | Ga0501316_049401 | 3300049532 | Bacteria | 603 |
| 734 | Ga0501317_000409 | 3300049533 | Bacteria | 2945 |
| 735 | Ga0501317_026802 | 3300049533 | Bacteria | 815 |
| 736 | Ga0501317_039867 | 3300049533 | Bacteria | 713 |
| 737 | Ga0501317_065175 | 3300049533 | Bacteria | 605 |
| 738 | Ga0501317_097195 | 3300049533 | Bacteria | 528 |
| 739 | Ga0501318_000193 | 3300049534 | Bacteria | 3208 |
| 740 | Ga0501318_012450 | 3300049534 | Bacteria | 975 |
| 741 | Ga0501318_027008 | 3300049534 | Bacteria | 761 |
| 742 | Ga0501318_041516 | 3300049534 | Bacteria | 659 |
| 743 | Ga0501318_059951 | 3300049534 | Bacteria | 582 |
| 744 | Ga0501318_060544 | 3300049534 | Bacteria | 580 |
| 745 | Ga0501318_088202 | 3300049534 | Bacteria | 511 |
| 746 | Ga0501319_004701 | 3300049535 | Bacteria | 957 |
| 747 | Ga0501320_034956 | 3300049536 | Bacteria | 639 |
| 748 | Ga0501320_067016 | 3300049536 | Bacteria | 514 |
| 749 | Ga0501321_003508 | 3300049537 | Bacteria | 1441 |
| 750 | Ga0501321_021272 | 3300049537 | Bacteria | 808 |
| 751 | Ga0501322_000140 | 3300049538 | Bacteria | 2796 |
| 752 | Ga0501323_001515 | 3300049539 | Bacteria | 2084 |
| 753 | Ga0501323_003359 | 3300049539 | Bacteria | 1632 |
| 754 | Ga0501323_006869 | 3300049539 | Bacteria | 1283 |
| 755 | Ga0501323_039089 | 3300049539 | Bacteria | 690 |
| 756 | Ga0501323_088333 | 3300049539 | Bacteria | 514 |
| 757 | Ga0501324_046535 | 3300049540 | Bacteria | 506 |
| 758 | Ga0501325_002382 | 3300049541 | Bacteria | 1279 |
| 759 | Ga0501325_028200 | 3300049541 | Bacteria | 630 |
| 760 | Ga0501325_030217 | 3300049541 | Bacteria | 617 |
| 761 | Ga0501325_060190 | 3300049541 | Bacteria | 500 |
| 762 | Ga0501328_08460 | 3300049544 | Bacteria | 560 |
| 763 | Ga0501329_05604 | 3300049545 | Bacteria | 699 |
| 764 | Ga0501329_13713 | 3300049545 | Bacteria | 536 |
| 765 | Ga0501332_04824 | 3300049548 | Bacteria | 814 |
| 766 | Ga0501332_06926 | 3300049548 | Bacteria | 716 |
| 767 | Ga0501334_16931 | 3300049550 | Bacteria | 566 |
| 768 | Ga0501338_03296 | 3300049554 | Bacteria | 950 |
| 769 | Ga0501340_005181 | 3300049556 | Bacteria | 842 |
| 770 | Ga0501031_0133346 | 3300049568 | Bacteria | 1623 |
| 771 | Ga0501032_0287810 | 3300049569 | Bacteria | 1063 |
| 772 | Ga0501032_0466394 | 3300049569 | Bacteria | 808 |
| 773 | Ga0501033_0112292 | 3300049570 | Bacteria | 1982 |
| 774 | Ga0501033_0438034 | 3300049570 | Bacteria | 909 |
| 775 | Ga0501033_0442771 | 3300049570 | Bacteria | 903 |
| 776 | Ga0501034_0014987 | 3300049571 | Bacteria | 7973 |
| 777 | Ga0501034_0069393 | 3300049571 | Bacteria | 3535 |
| 778 | Ga0501034_0162397 | 3300049571 | Bacteria | 2204 |
| 779 | Ga0501034_0427362 | 3300049571 | Bacteria | 1245 |
| 780 | Ga0501034_0432130 | 3300049571 | Bacteria | 1236 |
| 781 | Ga0501034_0929568 | 3300049571 | Bacteria | 756 |
| 782 | Ga0501034_0992470 | 3300049571 | Bacteria | 724 |
| 783 | Ga0501034_1023422 | 3300049571 | Bacteria | 709 |
| 784 | Ga0501034_1094454 | 3300049571 | Bacteria | 678 |
| 785 | Ga0501036_0027081 | 3300049572 | Bacteria | 4844 |
| 786 | Ga0501036_0134365 | 3300049572 | Bacteria | 2088 |
| 787 | Ga0501036_0827783 | 3300049572 | Bacteria | 762 |
| 788 | Ga0501037_0069329 | 3300049573 | Bacteria | 2567 |
| 789 | Ga0501037_0140866 | 3300049573 | Bacteria | 1726 |
| 790 | Ga0501037_0218316 | 3300049573 | Bacteria | 1342 |
| 791 | Ga0501037_0267468 | 3300049573 | Bacteria | 1194 |
| 792 | Ga0501038_0164752 | 3300049574 | Bacteria | 1799 |
| 793 | Ga0501038_0250905 | 3300049574 | Bacteria | 1402 |
| 794 | Ga0501038_0357450 | 3300049574 | Bacteria | 1136 |
| 795 | Ga0501039_0388403 | 3300049575 | Bacteria | 1096 |
| 796 | Ga0501041_0270794 | 3300049577 | Bacteria | 1068 |
| 797 | Ga0501041_1057593 | 3300049577 | Bacteria | 523 |
| 798 | Ga0501042_0069464 | 3300049578 | Bacteria | 2519 |
| 799 | Ga0501042_0483421 | 3300049578 | Bacteria | 899 |
| 800 | Ga0501043_0247928 | 3300049579 | Bacteria | 1372 |
| 801 | Ga0501043_0292729 | 3300049579 | Bacteria | 1246 |
| 802 | Ga0501043_0594668 | 3300049579 | Bacteria | 818 |
| 803 | Ga0501043_0648365 | 3300049579 | Bacteria | 776 |
| 804 | Ga0501046_0496547 | 3300049580 | Bacteria | 874 |
| 805 | Ga0501047_0023054 | 3300049581 | Bacteria | 5976 |
| 806 | Ga0501047_0120081 | 3300049581 | Bacteria | 2511 |
| 807 | Ga0501047_0573237 | 3300049581 | Bacteria | 952 |
| 808 | Ga0501047_0944058 | 3300049581 | Bacteria | 676 |
| 809 | Ga0501047_1161746 | 3300049581 | Bacteria | 585 |
| 810 | Ga0501048_0093666 | 3300049582 | Bacteria | 2119 |
| 811 | Ga0501048_1103829 | 3300049582 | Bacteria | 571 |
| 812 | Ga0501067_0017088 | 3300049583 | Bacteria | 4009 |
| 813 | Ga0501067_0066298 | 3300049583 | Bacteria | 1998 |
| 814 | Ga0501067_0561634 | 3300049583 | Bacteria | 639 |
| 815 | Ga0501068_0012735 | 3300049584 | Bacteria | 4774 |
| 816 | Ga0501069_0004928 | 3300049585 | Bacteria | 6923 |
| 817 | Ga0501069_0742325 | 3300049585 | Bacteria | 593 |
| 818 | Ga0501070_0017027 | 3300049586 | Bacteria | 6099 |
| 819 | Ga0501070_0031071 | 3300049586 | Bacteria | 4473 |
| 820 | Ga0501071_0136426 | 3300049587 | Bacteria | 1826 |
| 821 | Ga0501073_0043526 | 3300049589 | Bacteria | 3166 |
| 822 | Ga0501073_0069855 | 3300049589 | Bacteria | 2447 |
| 823 | Ga0501073_0095338 | 3300049589 | Bacteria | 2066 |
| 824 | Ga0501073_0663828 | 3300049589 | Bacteria | 719 |
| 825 | Ga0501074_0057091 | 3300049590 | Bacteria | 2812 |
| 826 | Ga0501074_0424223 | 3300049590 | Bacteria | 943 |
| 827 | Ga0501076_0043955 | 3300049592 | Bacteria | 3522 |
| 828 | Ga0501077_0270029 | 3300049593 | Bacteria | 1082 |
| 829 | Ga0501077_0750432 | 3300049593 | Bacteria | 627 |
| 830 | Ga0501077_0755255 | 3300049593 | Bacteria | 625 |
| 831 | Ga0501206_081328 | 3300049653 | Bacteria | 563 |
| 832 | Ga0501211_031963 | 3300049658 | Bacteria | 597 |
| 833 | Ga0501216_077159 | 3300049660 | Bacteria | 699 |
| 834 | Ga0501217_332455 | 3300049661 | Bacteria | 508 |
| 835 | Ga0501238_016664 | 3300049671 | Bacteria | 1020 |
| 836 | Ga0501242_011424 | 3300049674 | Bacteria | 1072 |
| 837 | Ga0501249_079202 | 3300049679 | Bacteria | 772 |
| 838 | Ga0501250_014795 | 3300049680 | Bacteria | 951 |
| 839 | Ga0501252_051456 | 3300049682 | Bacteria | 622 |
| 840 | Ga0501253_103672 | 3300049683 | Bacteria | 670 |
| 841 | Ga0501258_030700 | 3300049687 | Bacteria | 678 |
| 842 | Ga0501225_0077455 | 3300049705 | Bacteria | 951 |
| 843 | Ga0501245_066611 | 3300049708 | Bacteria | 670 |
| 844 | Ga0501079_0193013 | 3300049741 | Bacteria | 1590 |
| 845 | Ga0501079_0378369 | 3300049741 | Bacteria | 1110 |
| 846 | Ga0501079_0436045 | 3300049741 | Bacteria | 1029 |
| 847 | Ga0501080_0009625 | 3300049742 | Bacteria | 8822 |
| 848 | Ga0501081_0174979 | 3300049743 | Bacteria | 1551 |
| 849 | Ga0501083_0086253 | 3300049744 | Bacteria | 2076 |
| 850 | Ga0501083_0263204 | 3300049744 | Bacteria | 1122 |
| 851 | Ga0501083_0842544 | 3300049744 | Bacteria | 597 |
| 852 | Ga0501083_0900677 | 3300049744 | Bacteria | 576 |
| 853 | Ga0501241_024401 | 3300049758 | Bacteria | 1123 |
| 854 | Ga0501241_064591 | 3300049758 | Bacteria | 740 |
| 855 | Ga0501265_076490 | 3300049762 | Bacteria | 575 |
| 856 | Ga0501266_004246 | 3300049763 | Bacteria | 1773 |
| 857 | Ga0501270_084109 | 3300049767 | Bacteria | 638 |
| 858 | Ga0501035_0091548 | 3300049822 | Bacteria | 2676 |
| 859 | Ga0501035_0216953 | 3300049822 | Bacteria | 1635 |
| 860 | Ga0501044_0073393 | 3300049823 | Bacteria | 3478 |
| 861 | Ga0501044_0220649 | 3300049823 | Bacteria | 1846 |
| 862 | Ga0501044_0254098 | 3300049823 | Bacteria | 1697 |
| 863 | Ga0501044_0852389 | 3300049823 | Bacteria | 788 |
| 864 | Ga0501045_0528708 | 3300049824 | Bacteria | 875 |
| 865 | nmdc:mga03683_134374_c1 | 3300050489 | Bacteria | 1109 |
| 866 | nmdc:mga00v17_533473_c1 | 3300050491 | Bacteria | 759 |
| 867 | nmdc:mga00v17_98396_c1 | 3300050491 | Bacteria | 1844 |
| 868 | nmdc:mga0yw44_342159_c1 | 3300050492 | Bacteria | 1006 |
| 869 | nmdc:mga0yw44_373623_c1 | 3300050492 | Bacteria | 962 |
| 870 | nmdc:mga0k408_20070_c1 | 3300050493 | Bacteria | 3739 |
| 871 | nmdc:mga0k408_404010_c1 | 3300050493 | Bacteria | 813 |
| 872 | nmdc:mga06z11_8708_c1 | 3300050494 | Bacteria | 4247 |
| 873 | nmdc:mga04h51_87027_c1 | 3300050495 | Bacteria | 1118 |
| 874 | nmdc:mga07m45_111300_c1 | 3300050496 | Bacteria | 1577 |
| 875 | nmdc:mga07m45_69479_c1 | 3300050496 | Bacteria | 2002 |
| 876 | nmdc:mga09592_293602_c1 | 3300050508 | Bacteria | 1409 |
| 877 | nmdc:mga08y16_200519_c1 | 3300050511 | Bacteria | 2068 |
| 878 | nmdc:mga08y16_273468_c1 | 3300050511 | Bacteria | 1743 |
| 879 | nmdc:mga08y16_56413_c1 | 3300050511 | Bacteria | 4106 |
| 880 | nmdc:mga0n895_2833_c1 | 3300050512 | Bacteria | 13734 |
| 881 | nmdc:mga0n895_954971_c1 | 3300050512 | Bacteria | 840 |
| 882 | nmdc:mga0rr50_349300_c1 | 3300050513 | Bacteria | 1244 |
| 883 | nmdc:mga0rr50_34938_c1 | 3300050513 | Bacteria | 3605 |
| 884 | nmdc:mga08x19_23_c1 | 3300050514 | Bacteria | 288286 |
| 885 | nmdc:mga08x19_853330_c1 | 3300050514 | Bacteria | 647 |
| 886 | nmdc:mga0a205_2479_c1 | 3300050515 | Bacteria | 16274 |
| 887 | nmdc:mga0sz30_13902_c1 | 3300050516 | Bacteria | 3160 |
| 888 | nmdc:mga0sz30_217246_c1 | 3300050516 | Bacteria | 850 |
| 889 | nmdc:mga0sz30_322906_c1 | 3300050516 | Bacteria | 689 |
| 890 | nmdc:mga0sz30_49277_c1 | 3300050516 | Bacteria | 1784 |
| 891 | nmdc:mga0sz30_513372_c1 | 3300050516 | Bacteria | 539 |
| 892 | Ga0495601_0370475 | 3300053077 | Bacteria | 930 |
| 893 | Ga0495601_0722566 | 3300053077 | Bacteria | 635 |
| 894 | Ga0495655_0232202 | 3300053083 | Bacteria | 614 |
| 895 | Ga0495619_0157287 | 3300053085 | Bacteria | 1569 |
| 896 | Ga0500578_0201179 | 3300053086 | Bacteria | 1219 |
| 897 | Ga0500651_0183418 | 3300053093 | Bacteria | 1242 |
| 898 | Ga0500569_018737 | 3300053109 | Bacteria | 1792 |
| 899 | Ga0500572_163444 | 3300053111 | Bacteria | 729 |
| 900 | Ga0500594_0063508 | 3300053118 | Bacteria | 1070 |
| 901 | Ga0500595_026114 | 3300053119 | Bacteria | 2016 |
| 902 | Ga0500595_038381 | 3300053119 | Bacteria | 1557 |
| 903 | Ga0500597_069668 | 3300053120 | Bacteria | 1520 |
| 904 | Ga0500608_041046 | 3300053122 | Bacteria | 2218 |
| 905 | Ga0500608_271920 | 3300053122 | Bacteria | 647 |
| 906 | Ga0500608_341468 | 3300053122 | Bacteria | 535 |
| 907 | Ga0500618_007381 | 3300053125 | Bacteria | 3141 |
| 908 | Ga0500652_178320 | 3300053131 | Bacteria | 872 |
| 909 | Ga0500559_0000113 | 3300053136 | Bacteria | 63512 |
| 910 | Ga0500561_0022440 | 3300053137 | Bacteria | 1500 |
| 911 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 912 | Ga0500577_0040810 | 3300053142 | Bacteria | 1689 |
| 913 | Ga0500588_0090884 | 3300053146 | Bacteria | 1037 |
| 914 | Ga0500616_0192271 | 3300053153 | Bacteria | 910 |
| 915 | Ga0500622_0041650 | 3300053156 | Bacteria | 2389 |
| 916 | Ga0500627_0371094 | 3300053158 | Bacteria | 614 |
| 917 | Ga0500634_0254815 | 3300053161 | Bacteria | 726 |
| 918 | Ga0500636_0029625 | 3300053177 | Bacteria | 3234 |
| 919 | Ga0501084_0039158 | 3300054114 | Bacteria | 3965 |
| 920 | Ga0501084_0071192 | 3300054114 | Bacteria | 2912 |
| 921 | Ga0587084_004230 | 3300059477 | Bacteria | 1631 |
| 922 | Ga0587093_070248 | 3300059478 | Bacteria | 587 |
| 923 | Ga0587066_032047 | 3300059490 | Bacteria | 943 |
| 924 | Ga0587070_164868 | 3300059491 | Bacteria | 566 |
| 925 | Ga0587070_195014 | 3300059491 | Bacteria | 535 |
| 926 | Ga0587073_0066125 | 3300059492 | Bacteria | 861 |
| 927 | Ga0587073_0098652 | 3300059492 | Bacteria | 755 |
| 928 | Ga0587077_026408 | 3300059493 | Bacteria | 1072 |
| 929 | Ga0587077_029785 | 3300059493 | Bacteria | 1031 |
| 930 | Ga0587077_078087 | 3300059493 | Bacteria | 754 |
| 931 | Ga0587080_175963 | 3300059503 | Bacteria | 510 |
| 932 | Ga0587083_0040993 | 3300059505 | Bacteria | 970 |
| 933 | Ga0587086_098783 | 3300059507 | Bacteria | 536 |
| 934 | Ga0587088_006338 | 3300059508 | Bacteria | 1593 |
| 935 | Ga0587094_075067 | 3300059513 | Bacteria | 616 |
| 936 | Ga0587125_015896 | 3300059607 | Bacteria | 839 |
| 937 | Ga0587109_062772 | 3300059624 | Bacteria | 786 |
| 938 | Ga0587109_072081 | 3300059624 | Bacteria | 749 |
| 939 | Ga0587067_100553 | 3300059640 | Bacteria | 669 |
| 940 | Ga0587068_000630 | 3300059641 | Bacteria | 3390 |
| 941 | Ga0587068_004293 | 3300059641 | Bacteria | 1877 |
| 942 | Ga0587068_081954 | 3300059641 | Bacteria | 652 |
| 943 | Ga0587069_011022 | 3300059642 | Bacteria | 1201 |
| 944 | Ga0587069_052056 | 3300059642 | Bacteria | 732 |
| 945 | Ga0587069_107552 | 3300059642 | Bacteria | 577 |
| 946 | Ga0587072_115279 | 3300059643 | Bacteria | 617 |
| 947 | Ga0587072_148066 | 3300059643 | Bacteria | 565 |
| 948 | Ga0587075_026000 | 3300059644 | Bacteria | 903 |
| 949 | Ga0587076_004307 | 3300059645 | Bacteria | 1768 |
| 950 | Ga0587079_002261 | 3300059647 | Bacteria | 2329 |
| 951 | Ga0587079_039403 | 3300059647 | Bacteria | 948 |
| 952 | Ga0587102_064664 | 3300059649 | Bacteria | 516 |
| 953 | Ga0587105_005731 | 3300059651 | Bacteria | 834 |
| 954 | Ga0587107_076157 | 3300059652 | Bacteria | 622 |
| 955 | Ga0587120_009008 | 3300059659 | Bacteria | 826 |
| 956 | Ga0587111_0027932 | 3300060346 | Bacteria | 1133 |
| 957 | Ga0587111_0153195 | 3300060346 | Bacteria | 621 |
| 958 | Ga0501082_0169846 | 3300060353 | Bacteria | 1896 |
| 959 | Ga0501082_0656848 | 3300060353 | Bacteria | 918 |
| 960 | Ga0466962_0020301 | 3300061719 | Bacteria | 3193 |
| 961 | Ga0466962_0527708 | 3300061719 | Bacteria | 599 |
| 962 | Ga0466962_0742836 | 3300061719 | Bacteria | 505 |
| 963 | Ga0530510_0283408 | 3300061734 | Bacteria | 1238 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049583 | Ga0501067_0561634 | Ga0501067_0561634_10_333 | 107 |
| 2 | 3300005539 | Ga0068853_101027538 | Ga0068853_1010275382 | 114 |
| 3 | 3300035089 | Ga0373944_0345386 | Ga0373944_0345386_192_536 | 114 |
| 4 | 3300039438 | Ga0436360_0140907 | Ga0436360_0140907_16_360 | 114 |
| 5 | 3300039447 | Ga0436361_0240768 | Ga0436361_0240768_26_370 | 114 |
| 6 | 3300039447 | Ga0436361_0381254 | Ga0436361_0381254_24_368 | 114 |
| 7 | 3300039453 | Ga0436362_0839400 | Ga0436362_0839400_443_787 | 114 |
| 8 | 3300044706 | Ga0466964_0912549 | Ga0466964_0912549_14_358 | 114 |
| 9 | 3300045049 | Ga0466959_0416124 | Ga0466959_0416124_23_367 | 114 |
| 10 | 3300049162 | Ga0501307_094337 | Ga0501307_094337_14_358 | 114 |
| 11 | 3300049533 | Ga0501317_039867 | Ga0501317_039867_11_355 | 114 |
| 12 | 3300049571 | Ga0501034_1023422 | Ga0501034_1023422_353_697 | 114 |
| 13 | 3300049658 | Ga0501211_031963 | Ga0501211_031963_235_579 | 114 |
| 14 | 3300050516 | nmdc:mga0sz30_322906_c1 | nmdc:mga0sz30_322906_c1_17_361 | 114 |
| 15 | 3300042013 | Ga0439456_118164 | Ga0439456_118164_27_395 | 122 |
| 16 | 3300045051 | Ga0451576_0168990 | Ga0451576_0168990_1206_1574 | 122 |
| 17 | 3300049589 | Ga0501073_0663828 | Ga0501073_0663828_333_701 | 122 |
| 18 | 3300035398 | Ga0316574_0164763 | Ga0316574_0164763_303_674 | 123 |
| 19 | 3300036712 | Ga0316584_0029457 | Ga0316584_0029457_2723_3094 | 123 |
| 20 | 3300039447 | Ga0436361_0315369 | Ga0436361_0315369_17_388 | 123 |
| 21 | 3300046512 | Ga0495610_0018183 | Ga0495610_0018183_1267_1638 | 123 |
| 22 | 3300046522 | Ga0495643_0433413 | Ga0495643_0433413_182_553 | 123 |
| 23 | 3300046542 | Ga0495597_0179175 | Ga0495597_0179175_39_410 | 123 |
| 24 | 3300046615 | Ga0495656_0556043 | Ga0495656_0556043_121_492 | 123 |
| 25 | 3300046616 | Ga0495668_0112676 | Ga0495668_0112676_1107_1478 | 123 |
| 26 | 3300046660 | Ga0495625_0225794 | Ga0495625_0225794_104_475 | 123 |
| 27 | 3300046691 | Ga0495670_0145421 | Ga0495670_0145421_387_758 | 123 |
| 28 | 3300046692 | Ga0495671_0245556 | Ga0495671_0245556_282_653 | 123 |
| 29 | 3300048905 | Ga0496102_1308374 | Ga0496102_1308374_261_632 | 123 |
| 30 | 3300048907 | Ga0496104_1240668 | Ga0496104_1240668_263_634 | 123 |
| 31 | 3300048918 | Ga0496115_0189171 | Ga0496115_0189171_11_382 | 123 |
| 32 | 3300048929 | Ga0496126_0567956 | Ga0496126_0567956_474_845 | 123 |
| 33 | 3300048929 | Ga0496126_1203842 | Ga0496126_1203842_12_383 | 123 |
| 34 | 3300049127 | Ga0501306_000743 | Ga0501306_000743_65_436 | 123 |
| 35 | 3300049128 | Ga0501308_025413 | Ga0501308_025413_336_707 | 123 |
| 36 | 3300049530 | Ga0501314_029389 | Ga0501314_029389_215_586 | 123 |
| 37 | 3300049531 | Ga0501315_004037 | Ga0501315_004037_695_1066 | 123 |
| 38 | 3300049539 | Ga0501323_003359 | Ga0501323_003359_1238_1609 | 123 |
| 39 | 3300049544 | Ga0501328_08460 | Ga0501328_08460_170_541 | 123 |
| 40 | 3300049545 | Ga0501329_13713 | Ga0501329_13713_148_519 | 123 |
| 41 | 3300049571 | Ga0501034_0432130 | Ga0501034_0432130_678_1049 | 123 |
| 42 | 3300049577 | Ga0501041_1057593 | Ga0501041_1057593_133_504 | 123 |
| 43 | 3300049581 | Ga0501047_0944058 | Ga0501047_0944058_91_462 | 123 |
| 44 | 3300049653 | Ga0501206_081328 | Ga0501206_081328_182_553 | 123 |
| 45 | 3300049671 | Ga0501238_016664 | Ga0501238_016664_257_628 | 123 |
| 46 | 3300049674 | Ga0501242_011424 | Ga0501242_011424_540_911 | 123 |
| 47 | 3300049682 | Ga0501252_051456 | Ga0501252_051456_198_569 | 123 |
| 48 | 3300049687 | Ga0501258_030700 | Ga0501258_030700_284_655 | 123 |
| 49 | 3300049705 | Ga0501225_0077455 | Ga0501225_0077455_130_501 | 123 |
| 50 | 3300049758 | Ga0501241_064591 | Ga0501241_064591_228_599 | 123 |
| 51 | 3300049763 | Ga0501266_004246 | Ga0501266_004246_1060_1431 | 123 |
| 52 | 3300050492 | nmdc:mga0yw44_342159_c1 | nmdc:mga0yw44_342159_c1_476_847 | 123 |
| 53 | 3300050516 | nmdc:mga0sz30_49277_c1 | nmdc:mga0sz30_49277_c1_1116_1487 | 123 |
| 54 | 3300053086 | Ga0500578_0201179 | Ga0500578_0201179_39_410 | 123 |
| 55 | 3300053093 | Ga0500651_0183418 | Ga0500651_0183418_373_744 | 123 |
| 56 | 3300053109 | Ga0500569_018737 | Ga0500569_018737_1229_1600 | 123 |
| 57 | 3300053111 | Ga0500572_163444 | Ga0500572_163444_242_613 | 123 |
| 58 | 3300053118 | Ga0500594_0063508 | Ga0500594_0063508_320_691 | 123 |
| 59 | 3300053122 | Ga0500608_041046 | Ga0500608_041046_803_1174 | 123 |
| 60 | 3300053131 | Ga0500652_178320 | Ga0500652_178320_102_473 | 123 |
| 61 | 3300053137 | Ga0500561_0022440 | Ga0500561_0022440_593_964 | 123 |
| 62 | 3300053142 | Ga0500577_0040810 | Ga0500577_0040810_758_1129 | 123 |
| 63 | 3300053146 | Ga0500588_0090884 | Ga0500588_0090884_11_382 | 123 |
| 64 | 3300053156 | Ga0500622_0041650 | Ga0500622_0041650_1787_2158 | 123 |
| 65 | 3300053158 | Ga0500627_0371094 | Ga0500627_0371094_188_559 | 123 |
| 66 | 3300053161 | Ga0500634_0254815 | Ga0500634_0254815_325_696 | 123 |
| 67 | 3300053177 | Ga0500636_0029625 | Ga0500636_0029625_522_893 | 123 |
| 68 | iso_pu_bacteria | 2508501050 | 2508735875 | 127 |
| 69 | iso_pu_bacteria | 2508501114 | 2509078199 | 127 |
| 70 | iso_pu_bacteria | 2671180139 | 2671694494 | 127 |
| 71 | iso_pu_bacteria | 2773857925 | 2774868367 | 127 |
| 72 | iso_pu_bacteria | 2775506901 | 2776259149 | 127 |
| 73 | iso_pu_bacteria | 2835312727 | 2835318461 | 127 |
| 74 | iso_pu_bacteria | 2882456835 | 2882459690 | 127 |
| 75 | iso_pu_bacteria | 2884298095 | 2884300440 | 127 |
| 76 | iso_pu_bacteria | 2894232714 | 2894240756 | 127 |
| 77 | iso_pu_bacteria | 2917554339 | 2917555113 | 127 |
| 78 | 3300048927 | Ga0496124_0378537 | Ga0496124_0378537_104_490 | 128 |
| 79 | iso_pu_bacteria | 2513237087 | 2513594038 | 128 |
| 80 | iso_pu_bacteria | 2643221733 | 2644729065 | 128 |
| 81 | iso_pu_bacteria | 2643221734 | 2644735421 | 128 |
| 82 | iso_pu_bacteria | 2643221736 | 2644747744 | 128 |
| 83 | iso_pu_bacteria | 2818991467 | 2819720934 | 128 |
| 84 | iso_pu_bacteria | 2828305725 | 2828310160 | 128 |
| 85 | iso_pu_bacteria | 2841760612 | 2841761390 | 128 |
| 86 | iso_pu_bacteria | 2841911363 | 2841913393 | 128 |
| 87 | iso_pu_bacteria | 2841917233 | 2841919140 | 128 |
| 88 | iso_pu_bacteria | 2844104063 | 2844104415 | 128 |
| 89 | iso_pu_bacteria | 2851182111 | 2851184462 | 128 |
| 90 | iso_pu_bacteria | 2851246043 | 2851247403 | 128 |
| 91 | iso_pu_bacteria | 2891088606 | 2891092903 | 128 |
| 92 | iso_pu_bacteria | 2909042592 | 2909043610 | 128 |
| 93 | iso_pu_bacteria | 2917699015 | 2917699279 | 128 |
| 94 | iso_pu_bacteria | 8002060224 | 8002061411 | 128 |
| 95 | iso_pu_bacteria | 8057529695 | 8057530427 | 128 |
| 96 | 3300003659 | JGI25404J52841_10003344 | JGI25404J52841_100033442 | 130 |
| 97 | 3300005343 | Ga0070687_100449453 | Ga0070687_1004494532 | 130 |
| 98 | 3300005455 | Ga0070663_100263402 | Ga0070663_1002634023 | 130 |
| 99 | 3300005547 | Ga0070693_100593988 | Ga0070693_1005939882 | 130 |
| 100 | 3300005937 | Ga0081455_10001008 | Ga0081455_1000100828 | 130 |
| 101 | 3300005983 | Ga0081540_1000645 | Ga0081540_100064517 | 130 |
| 102 | 3300006852 | Ga0075433_10001194 | Ga0075433_1000119415 | 130 |
| 103 | 3300006871 | Ga0075434_100004950 | Ga0075434_1000049509 | 130 |
| 104 | 3300007076 | Ga0075435_100018035 | Ga0075435_1000180357 | 130 |
| 105 | 3300009094 | Ga0111539_10023484 | Ga0111539_100234845 | 130 |
| 106 | 3300009094 | Ga0111539_11073743 | Ga0111539_110737432 | 130 |
| 107 | 3300009551 | Ga0105238_11589277 | Ga0105238_115892772 | 130 |
| 108 | 3300025924 | Ga0207694_11038132 | Ga0207694_110381322 | 130 |
| 109 | 3300026067 | Ga0207678_10298726 | Ga0207678_102987261 | 130 |
| 110 | 3300027907 | Ga0207428_10371812 | Ga0207428_103718122 | 130 |
| 111 | 3300034817 | Ga0373948_0160036 | Ga0373948_0160036_109_501 | 130 |
| 112 | 3300034817 | Ga0373948_0170624 | Ga0373948_0170624_146_538 | 130 |
| 113 | 3300034818 | Ga0373950_0054200 | Ga0373950_0054200_362_754 | 130 |
| 114 | 3300034820 | Ga0373959_0142571 | Ga0373959_0142571_11_403 | 130 |
| 115 | 3300035084 | Ga0373928_0027736 | Ga0373928_0027736_158_550 | 130 |
| 116 | 3300035088 | Ga0373940_0027123 | Ga0373940_0027123_973_1365 | 130 |
| 117 | 3300035114 | Ga0373939_0068612 | Ga0373939_0068612_16_408 | 130 |
| 118 | 3300035114 | Ga0373939_0320690 | Ga0373939_0320690_191_583 | 130 |
| 119 | 3300035115 | Ga0373941_0015050 | Ga0373941_0015050_261_653 | 130 |
| 120 | 3300035115 | Ga0373941_0420359 | Ga0373941_0420359_63_455 | 130 |
| 121 | 3300035207 | Ga0373942_0106190 | Ga0373942_0106190_64_456 | 130 |
| 122 | 3300035241 | Ga0373961_0002931 | Ga0373961_0002931_1971_2363 | 130 |
| 123 | 3300035241 | Ga0373961_0017564 | Ga0373961_0017564_339_731 | 130 |
| 124 | 3300035242 | Ga0373962_0004285 | Ga0373962_0004285_429_821 | 130 |
| 125 | 3300035242 | Ga0373962_0018033 | Ga0373962_0018033_396_788 | 130 |
| 126 | 3300035691 | Ga0373931_0001781 | Ga0373931_0001781_5862_6254 | 130 |
| 127 | 3300035691 | Ga0373931_0037853 | Ga0373931_0037853_532_924 | 130 |
| 128 | 3300039447 | Ga0436361_0074846 | Ga0436361_0074846_188_580 | 130 |
| 129 | 3300039447 | Ga0436361_0714783 | Ga0436361_0714783_53_445 | 130 |
| 130 | 3300045051 | Ga0451576_0794393 | Ga0451576_0794393_12_404 | 130 |
| 131 | 3300046557 | Ga0495622_0085278 | Ga0495622_0085278_663_1055 | 130 |
| 132 | 3300049593 | Ga0501077_0755255 | Ga0501077_0755255_88_480 | 130 |
| 133 | 3300049741 | Ga0501079_0436045 | Ga0501079_0436045_214_606 | 130 |
| 134 | 3300050493 | nmdc:mga0k408_20070_c1 | nmdc:mga0k408_20070_c1_1234_1626 | 130 |
| 135 | 3300050511 | nmdc:mga08y16_200519_c1 | nmdc:mga08y16_200519_c1_1501_1893 | 130 |
| 136 | 3300050511 | nmdc:mga08y16_56413_c1 | nmdc:mga08y16_56413_c1_486_878 | 130 |
| 137 | 3300050512 | nmdc:mga0n895_2833_c1 | nmdc:mga0n895_2833_c1_6814_7206 | 130 |
| 138 | 3300050512 | nmdc:mga0n895_954971_c1 | nmdc:mga0n895_954971_c1_55_447 | 130 |
| 139 | 3300050513 | nmdc:mga0rr50_34938_c1 | nmdc:mga0rr50_34938_c1_2437_2829 | 130 |
| 140 | 3300050515 | nmdc:mga0a205_2479_c1 | nmdc:mga0a205_2479_c1_9591_9983 | 130 |
| 141 | 3300003574 | Ga0007410J51695_1051312 | Ga0007410J51695_10513121 | 131 |
| 142 | 3300003575 | Ga0007409J51694_1066553 | Ga0007409J51694_10665531 | 131 |
| 143 | 3300003579 | Ga0007429J51699_1060640 | Ga0007429J51699_10606403 | 131 |
| 144 | 3300003693 | Ga0032354_1108669 | Ga0032354_11086691 | 131 |
| 145 | 3300003693 | Ga0032354_1120138 | Ga0032354_11201381 | 131 |
| 146 | 3300005338 | Ga0068868_100515613 | Ga0068868_1005156132 | 131 |
| 147 | 3300005339 | Ga0070660_101904245 | Ga0070660_1019042451 | 131 |
| 148 | 3300005345 | Ga0070692_10335754 | Ga0070692_103357542 | 131 |
| 149 | 3300005347 | Ga0070668_100556489 | Ga0070668_1005564893 | 131 |
| 150 | 3300005440 | Ga0070705_100613714 | Ga0070705_1006137141 | 131 |
| 151 | 3300005455 | Ga0070663_100519849 | Ga0070663_1005198492 | 131 |
| 152 | 3300005455 | Ga0070663_101416177 | Ga0070663_1014161771 | 131 |
| 153 | 3300005457 | Ga0070662_100952996 | Ga0070662_1009529962 | 131 |
| 154 | 3300005530 | Ga0070679_100590914 | Ga0070679_1005909141 | 131 |
| 155 | 3300005548 | Ga0070665_100639456 | Ga0070665_1006394563 | 131 |
| 156 | 3300005614 | Ga0068856_100384103 | Ga0068856_1003841033 | 131 |
| 157 | 3300005615 | Ga0070702_100133794 | Ga0070702_1001337943 | 131 |
| 158 | 3300005617 | Ga0068859_101925387 | Ga0068859_1019253872 | 131 |
| 159 | 3300005718 | Ga0068866_10470237 | Ga0068866_104702372 | 131 |
| 160 | 3300005840 | Ga0068870_10529583 | Ga0068870_105295831 | 131 |
| 161 | 3300006051 | Ga0075364_10299311 | Ga0075364_102993112 | 131 |
| 162 | 3300006186 | Ga0075369_10014440 | Ga0075369_100144404 | 131 |
| 163 | 3300006844 | Ga0075428_100717334 | Ga0075428_1007173342 | 131 |
| 164 | 3300006881 | Ga0068865_101377807 | Ga0068865_1013778072 | 131 |
| 165 | 3300006914 | Ga0075436_100997377 | Ga0075436_1009973772 | 131 |
| 166 | 3300006931 | Ga0097620_101925399 | Ga0097620_1019253992 | 131 |
| 167 | 3300009148 | Ga0105243_10996934 | Ga0105243_109969342 | 131 |
| 168 | 3300009553 | Ga0105249_10154860 | Ga0105249_101548604 | 131 |
| 169 | 3300010375 | Ga0105239_10861177 | Ga0105239_108611773 | 131 |
| 170 | 3300013104 | Ga0157370_10955547 | Ga0157370_109555472 | 131 |
| 171 | 3300013307 | Ga0157372_12249984 | Ga0157372_122499842 | 131 |
| 172 | 3300014326 | Ga0157380_10008515 | Ga0157380_1000851514 | 131 |
| 173 | 3300014968 | Ga0157379_10158245 | Ga0157379_101582455 | 131 |
| 174 | 3300021361 | Ga0213872_10006909 | Ga0213872_100069093 | 131 |
| 175 | 3300021361 | Ga0213872_10012804 | Ga0213872_100128048 | 131 |
| 176 | 3300021361 | Ga0213872_10021018 | Ga0213872_100210185 | 131 |
| 177 | 3300021361 | Ga0213872_10086084 | Ga0213872_100860843 | 131 |
| 178 | 3300021361 | Ga0213872_10356256 | Ga0213872_103562561 | 131 |
| 179 | 3300021441 | Ga0213871_10027257 | Ga0213871_100272572 | 131 |
| 180 | 3300023309 | Ga0256744_103834 | Ga0256744_1038342 | 131 |
| 181 | 3300023436 | Ga0256743_116418 | Ga0256743_1164182 | 131 |
| 182 | 3300023438 | Ga0256720_144321 | Ga0256720_1443212 | 131 |
| 183 | 3300025899 | Ga0207642_10228685 | Ga0207642_102286852 | 131 |
| 184 | 3300025901 | Ga0207688_10177527 | Ga0207688_101775272 | 131 |
| 185 | 3300025908 | Ga0207643_10552321 | Ga0207643_105523211 | 131 |
| 186 | 3300025908 | Ga0207643_10766157 | Ga0207643_107661572 | 131 |
| 187 | 3300025919 | Ga0207657_10887479 | Ga0207657_108874792 | 131 |
| 188 | 3300025925 | Ga0207650_10929033 | Ga0207650_109290332 | 131 |
| 189 | 3300025933 | Ga0207706_10542975 | Ga0207706_105429753 | 131 |
| 190 | 3300025936 | Ga0207670_10658740 | Ga0207670_106587402 | 131 |
| 191 | 3300026023 | Ga0207677_11095957 | Ga0207677_110959572 | 131 |
| 192 | 3300026035 | Ga0207703_11987339 | Ga0207703_119873392 | 131 |
| 193 | 3300026067 | Ga0207678_10522609 | Ga0207678_105226091 | 131 |
| 194 | 3300026067 | Ga0207678_10693957 | Ga0207678_106939573 | 131 |
| 195 | 3300026118 | Ga0207675_100412225 | Ga0207675_1004122252 | 131 |
| 196 | 3300026118 | Ga0207675_100951766 | Ga0207675_1009517662 | 131 |
| 197 | 3300026121 | Ga0207683_10359400 | Ga0207683_103594003 | 131 |
| 198 | 3300028794 | Ga0307515_10099360 | Ga0307515_100993607 | 131 |
| 199 | 3300028800 | Ga0265338_10069087 | Ga0265338_100690876 | 131 |
| 200 | 3300029272 | Ga0311000_107819 | Ga0311000_1078192 | 131 |
| 201 | 3300029276 | Ga0311004_158584 | Ga0311004_1585842 | 131 |
| 202 | 3300029277 | Ga0311001_1103890 | Ga0311001_11038902 | 131 |
| 203 | 3300029285 | Ga0310981_1004097 | Ga0310981_10040972 | 131 |
| 204 | 3300031235 | Ga0265330_10280996 | Ga0265330_102809962 | 131 |
| 205 | 3300031250 | Ga0265331_10000186 | Ga0265331_1000018640 | 131 |
| 206 | 3300031250 | Ga0265331_10056585 | Ga0265331_100565853 | 131 |
| 207 | 3300031250 | Ga0265331_10418434 | Ga0265331_104184341 | 131 |
| 208 | 3300031251 | Ga0265327_10000381 | Ga0265327_1000038163 | 131 |
| 209 | 3300031251 | Ga0265327_10007046 | Ga0265327_1000704617 | 131 |
| 210 | 3300031344 | Ga0265316_10711285 | Ga0265316_107112852 | 131 |
| 211 | 3300031344 | Ga0265316_11279725 | Ga0265316_112797251 | 131 |
| 212 | 3300031456 | Ga0307513_10354100 | Ga0307513_103541002 | 131 |
| 213 | 3300031548 | Ga0307408_100011406 | Ga0307408_1000114065 | 131 |
| 214 | 3300031595 | Ga0265313_10004521 | Ga0265313_1000452116 | 131 |
| 215 | 3300031595 | Ga0265313_10124296 | Ga0265313_101242963 | 131 |
| 216 | 3300031711 | Ga0265314_10028299 | Ga0265314_100282992 | 131 |
| 217 | 3300031711 | Ga0265314_10072853 | Ga0265314_100728534 | 131 |
| 218 | 3300031711 | Ga0265314_10095028 | Ga0265314_100950282 | 131 |
| 219 | 3300031711 | Ga0265314_10107669 | Ga0265314_101076693 | 131 |
| 220 | 3300031731 | Ga0307405_10104855 | Ga0307405_101048553 | 131 |
| 221 | 3300031852 | Ga0307410_10007156 | Ga0307410_100071568 | 131 |
| 222 | 3300031889 | Ga0326468_10002218 | Ga0326468_100022182 | 131 |
| 223 | 3300031901 | Ga0307406_10036624 | Ga0307406_100366245 | 131 |
| 224 | 3300031903 | Ga0307407_10011518 | Ga0307407_100115184 | 131 |
| 225 | 3300031911 | Ga0307412_10053732 | Ga0307412_100537326 | 131 |
| 226 | 3300031995 | Ga0307409_100004876 | Ga0307409_10000487614 | 131 |
| 227 | 3300032002 | Ga0307416_100221340 | Ga0307416_1002213404 | 131 |
| 228 | 3300032004 | Ga0307414_10075716 | Ga0307414_100757162 | 131 |
| 229 | 3300032005 | Ga0307411_10091338 | Ga0307411_100913382 | 131 |
| 230 | 3300032126 | Ga0307415_100010922 | Ga0307415_1000109228 | 131 |
| 231 | 3300035692 | Ga0373935_1341243 | Ga0373935_1341243_77_472 | 131 |
| 232 | 3300036647 | Ga0316582_0356473 | Ga0316582_0356473_215_610 | 131 |
| 233 | 3300037471 | Ga0395905_0057227 | Ga0395905_0057227_2978_3373 | 131 |
| 234 | 3300037471 | Ga0395905_0816249 | Ga0395905_0816249_281_676 | 131 |
| 235 | 3300039438 | Ga0436360_0051477 | Ga0436360_0051477_92_487 | 131 |
| 236 | 3300039438 | Ga0436360_0259420 | Ga0436360_0259420_604_999 | 131 |
| 237 | 3300039438 | Ga0436360_1057566 | Ga0436360_1057566_92_487 | 131 |
| 238 | 3300039438 | Ga0436360_1065206 | Ga0436360_1065206_524_919 | 131 |
| 239 | 3300039447 | Ga0436361_0016113 | Ga0436361_0016113_1491_1886 | 131 |
| 240 | 3300039447 | Ga0436361_0291348 | Ga0436361_0291348_971_1366 | 131 |
| 241 | 3300039447 | Ga0436361_0330189 | Ga0436361_0330189_80_475 | 131 |
| 242 | 3300039447 | Ga0436361_0415437 | Ga0436361_0415437_58_453 | 131 |
| 243 | 3300039447 | Ga0436361_0658663 | Ga0436361_0658663_723_1118 | 131 |
| 244 | 3300039447 | Ga0436361_0710155 | Ga0436361_0710155_42_437 | 131 |
| 245 | 3300039447 | Ga0436361_0765661 | Ga0436361_0765661_46_441 | 131 |
| 246 | 3300039447 | Ga0436361_0878406 | Ga0436361_0878406_1591_1986 | 131 |
| 247 | 3300039447 | Ga0436361_1184215 | Ga0436361_1184215_92_487 | 131 |
| 248 | 3300039450 | Ga0436363_1182780 | Ga0436363_1182780_309_704 | 131 |
| 249 | 3300041404 | Ga0439436_0104056 | Ga0439436_0104056_150_545 | 131 |
| 250 | 3300041408 | Ga0439453_0005235 | Ga0439453_0005235_1231_1626 | 131 |
| 251 | 3300041512 | Ga0451853_1126604 | Ga0451853_1126604_90_485 | 131 |
| 252 | 3300041997 | Ga0439431_0052962 | Ga0439431_0052962_176_571 | 131 |
| 253 | 3300042007 | Ga0439449_0340077 | Ga0439449_0340077_137_532 | 131 |
| 254 | 3300042011 | Ga0439454_035442 | Ga0439454_035442_74_469 | 131 |
| 255 | 3300044658 | Ga0466972_0009543 | Ga0466972_0009543_1230_1625 | 131 |
| 256 | 3300044684 | Ga0466966_0064041 | Ga0466966_0064041_1148_1543 | 131 |
| 257 | 3300044684 | Ga0466966_0166692 | Ga0466966_0166692_244_639 | 131 |
| 258 | 3300044719 | Ga0466971_0032824 | Ga0466971_0032824_398_793 | 131 |
| 259 | 3300044842 | Ga0466957_0082727 | Ga0466957_0082727_253_648 | 131 |
| 260 | 3300044842 | Ga0466957_0919939 | Ga0466957_0919939_206_601 | 131 |
| 261 | 3300044901 | Ga0466960_0128857 | Ga0466960_0128857_230_625 | 131 |
| 262 | 3300044901 | Ga0466960_0214495 | Ga0466960_0214495_316_711 | 131 |
| 263 | 3300045049 | Ga0466959_0160457 | Ga0466959_0160457_254_649 | 131 |
| 264 | 3300045836 | Ga0466958_0000676 | Ga0466958_0000676_1401_1796 | 131 |
| 265 | 3300046507 | Ga0495606_0540266 | Ga0495606_0540266_91_486 | 131 |
| 266 | 3300046536 | Ga0495587_0162159 | Ga0495587_0162159_842_1237 | 131 |
| 267 | 3300046615 | Ga0495656_0088344 | Ga0495656_0088344_411_806 | 131 |
| 268 | 3300046689 | Ga0495613_0000576 | Ga0495613_0000576_22335_22730 | 131 |
| 269 | 3300046691 | Ga0495670_0828002 | Ga0495670_0828002_99_494 | 131 |
| 270 | 3300048905 | Ga0496102_0949578 | Ga0496102_0949578_139_534 | 131 |
| 271 | 3300048917 | Ga0496114_0180419 | Ga0496114_0180419_1308_1703 | 131 |
| 272 | 3300048929 | Ga0496126_0496478 | Ga0496126_0496478_95_490 | 131 |
| 273 | 3300049127 | Ga0501306_004507 | Ga0501306_004507_637_1032 | 131 |
| 274 | 3300049127 | Ga0501306_023656 | Ga0501306_023656_213_608 | 131 |
| 275 | 3300049127 | Ga0501306_033987 | Ga0501306_033987_181_576 | 131 |
| 276 | 3300049128 | Ga0501308_002370 | Ga0501308_002370_666_1061 | 131 |
| 277 | 3300049128 | Ga0501308_020408 | Ga0501308_020408_47_442 | 131 |
| 278 | 3300049128 | Ga0501308_023831 | Ga0501308_023831_201_596 | 131 |
| 279 | 3300049129 | Ga0501309_000912 | Ga0501309_000912_624_1019 | 131 |
| 280 | 3300049130 | Ga0501310_007310 | Ga0501310_007310_253_648 | 131 |
| 281 | 3300049130 | Ga0501310_039434 | Ga0501310_039434_49_444 | 131 |
| 282 | 3300049130 | Ga0501310_040407 | Ga0501310_040407_227_622 | 131 |
| 283 | 3300049132 | Ga0501343_005978 | Ga0501343_005978_406_801 | 131 |
| 284 | 3300049160 | Ga0501304_010671 | Ga0501304_010671_27_422 | 131 |
| 285 | 3300049161 | Ga0501305_003020 | Ga0501305_003020_453_848 | 131 |
| 286 | 3300049161 | Ga0501305_003176 | Ga0501305_003176_1069_1464 | 131 |
| 287 | 3300049161 | Ga0501305_033118 | Ga0501305_033118_393_788 | 131 |
| 288 | 3300049161 | Ga0501305_079125 | Ga0501305_079125_166_561 | 131 |
| 289 | 3300049162 | Ga0501307_007552 | Ga0501307_007552_280_675 | 131 |
| 290 | 3300049162 | Ga0501307_017811 | Ga0501307_017811_81_476 | 131 |
| 291 | 3300049162 | Ga0501307_059868 | Ga0501307_059868_63_458 | 131 |
| 292 | 3300049527 | Ga0501311_000194 | Ga0501311_000194_14_409 | 131 |
| 293 | 3300049527 | Ga0501311_025983 | Ga0501311_025983_273_668 | 131 |
| 294 | 3300049528 | Ga0501312_014537 | Ga0501312_014537_357_752 | 131 |
| 295 | 3300049528 | Ga0501312_042385 | Ga0501312_042385_53_448 | 131 |
| 296 | 3300049528 | Ga0501312_051210 | Ga0501312_051210_79_474 | 131 |
| 297 | 3300049529 | Ga0501313_002464 | Ga0501313_002464_1044_1439 | 131 |
| 298 | 3300049529 | Ga0501313_010854 | Ga0501313_010854_432_827 | 131 |
| 299 | 3300049529 | Ga0501313_038902 | Ga0501313_038902_78_473 | 131 |
| 300 | 3300049530 | Ga0501314_007586 | Ga0501314_007586_180_575 | 131 |
| 301 | 3300049531 | Ga0501315_006592 | Ga0501315_006592_560_955 | 131 |
| 302 | 3300049531 | Ga0501315_017497 | Ga0501315_017497_308_703 | 131 |
| 303 | 3300049531 | Ga0501315_085083 | Ga0501315_085083_116_511 | 131 |
| 304 | 3300049532 | Ga0501316_001097 | Ga0501316_001097_1461_1856 | 131 |
| 305 | 3300049532 | Ga0501316_032792 | Ga0501316_032792_279_674 | 131 |
| 306 | 3300049532 | Ga0501316_044798 | Ga0501316_044798_203_598 | 131 |
| 307 | 3300049532 | Ga0501316_047918 | Ga0501316_047918_68_463 | 131 |
| 308 | 3300049532 | Ga0501316_049401 | Ga0501316_049401_141_536 | 131 |
| 309 | 3300049533 | Ga0501317_000409 | Ga0501317_000409_686_1081 | 131 |
| 310 | 3300049533 | Ga0501317_026802 | Ga0501317_026802_25_420 | 131 |
| 311 | 3300049533 | Ga0501317_065175 | Ga0501317_065175_132_527 | 131 |
| 312 | 3300049533 | Ga0501317_097195 | Ga0501317_097195_25_420 | 131 |
| 313 | 3300049534 | Ga0501318_000193 | Ga0501318_000193_2294_2689 | 131 |
| 314 | 3300049534 | Ga0501318_012450 | Ga0501318_012450_436_831 | 131 |
| 315 | 3300049534 | Ga0501318_027008 | Ga0501318_027008_25_420 | 131 |
| 316 | 3300049534 | Ga0501318_041516 | Ga0501318_041516_64_459 | 131 |
| 317 | 3300049534 | Ga0501318_059951 | Ga0501318_059951_27_422 | 131 |
| 318 | 3300049534 | Ga0501318_088202 | Ga0501318_088202_83_478 | 131 |
| 319 | 3300049535 | Ga0501319_004701 | Ga0501319_004701_14_409 | 131 |
| 320 | 3300049536 | Ga0501320_034956 | Ga0501320_034956_72_467 | 131 |
| 321 | 3300049536 | Ga0501320_067016 | Ga0501320_067016_81_476 | 131 |
| 322 | 3300049537 | Ga0501321_003508 | Ga0501321_003508_512_907 | 131 |
| 323 | 3300049537 | Ga0501321_021272 | Ga0501321_021272_28_423 | 131 |
| 324 | 3300049538 | Ga0501322_000140 | Ga0501322_000140_198_593 | 131 |
| 325 | 3300049539 | Ga0501323_001515 | Ga0501323_001515_377_772 | 131 |
| 326 | 3300049539 | Ga0501323_006869 | Ga0501323_006869_785_1180 | 131 |
| 327 | 3300049539 | Ga0501323_039089 | Ga0501323_039089_174_569 | 131 |
| 328 | 3300049539 | Ga0501323_088333 | Ga0501323_088333_108_503 | 131 |
| 329 | 3300049540 | Ga0501324_046535 | Ga0501324_046535_62_457 | 131 |
| 330 | 3300049541 | Ga0501325_002382 | Ga0501325_002382_576_971 | 131 |
| 331 | 3300049541 | Ga0501325_028200 | Ga0501325_028200_13_408 | 131 |
| 332 | 3300049541 | Ga0501325_030217 | Ga0501325_030217_43_438 | 131 |
| 333 | 3300049541 | Ga0501325_060190 | Ga0501325_060190_79_474 | 131 |
| 334 | 3300049545 | Ga0501329_05604 | Ga0501329_05604_163_558 | 131 |
| 335 | 3300049548 | Ga0501332_04824 | Ga0501332_04824_15_410 | 131 |
| 336 | 3300049548 | Ga0501332_06926 | Ga0501332_06926_200_595 | 131 |
| 337 | 3300049550 | Ga0501334_16931 | Ga0501334_16931_24_419 | 131 |
| 338 | 3300049554 | Ga0501338_03296 | Ga0501338_03296_62_457 | 131 |
| 339 | 3300049556 | Ga0501340_005181 | Ga0501340_005181_44_439 | 131 |
| 340 | 3300049569 | Ga0501032_0287810 | Ga0501032_0287810_512_907 | 131 |
| 341 | 3300049570 | Ga0501033_0442771 | Ga0501033_0442771_175_570 | 131 |
| 342 | 3300049571 | Ga0501034_0014987 | Ga0501034_0014987_6236_6631 | 131 |
| 343 | 3300049571 | Ga0501034_0427362 | Ga0501034_0427362_559_954 | 131 |
| 344 | 3300049571 | Ga0501034_1094454 | Ga0501034_1094454_17_412 | 131 |
| 345 | 3300049572 | Ga0501036_0134365 | Ga0501036_0134365_1216_1611 | 131 |
| 346 | 3300049573 | Ga0501037_0140866 | Ga0501037_0140866_654_1049 | 131 |
| 347 | 3300049574 | Ga0501038_0357450 | Ga0501038_0357450_77_472 | 131 |
| 348 | 3300049579 | Ga0501043_0292729 | Ga0501043_0292729_619_1014 | 131 |
| 349 | 3300049581 | Ga0501047_0023054 | Ga0501047_0023054_2964_3359 | 131 |
| 350 | 3300049582 | Ga0501048_1103829 | Ga0501048_1103829_124_519 | 131 |
| 351 | 3300049583 | Ga0501067_0066298 | Ga0501067_0066298_1085_1480 | 131 |
| 352 | 3300049584 | Ga0501068_0012735 | Ga0501068_0012735_1742_2137 | 131 |
| 353 | 3300049585 | Ga0501069_0004928 | Ga0501069_0004928_2724_3119 | 131 |
| 354 | 3300049586 | Ga0501070_0017027 | Ga0501070_0017027_3983_4378 | 131 |
| 355 | 3300049589 | Ga0501073_0043526 | Ga0501073_0043526_1427_1822 | 131 |
| 356 | 3300049590 | Ga0501074_0057091 | Ga0501074_0057091_2137_2532 | 131 |
| 357 | 3300049660 | Ga0501216_077159 | Ga0501216_077159_185_580 | 131 |
| 358 | 3300049661 | Ga0501217_332455 | Ga0501217_332455_52_447 | 131 |
| 359 | 3300049679 | Ga0501249_079202 | Ga0501249_079202_216_611 | 131 |
| 360 | 3300049680 | Ga0501250_014795 | Ga0501250_014795_275_670 | 131 |
| 361 | 3300049683 | Ga0501253_103672 | Ga0501253_103672_26_421 | 131 |
| 362 | 3300049741 | Ga0501079_0193013 | Ga0501079_0193013_381_776 | 131 |
| 363 | 3300049742 | Ga0501080_0009625 | Ga0501080_0009625_5006_5401 | 131 |
| 364 | 3300049744 | Ga0501083_0086253 | Ga0501083_0086253_232_627 | 131 |
| 365 | 3300049758 | Ga0501241_024401 | Ga0501241_024401_363_758 | 131 |
| 366 | 3300049762 | Ga0501265_076490 | Ga0501265_076490_46_441 | 131 |
| 367 | 3300049767 | Ga0501270_084109 | Ga0501270_084109_31_426 | 131 |
| 368 | 3300049822 | Ga0501035_0091548 | Ga0501035_0091548_1279_1674 | 131 |
| 369 | 3300049823 | Ga0501044_0220649 | Ga0501044_0220649_997_1392 | 131 |
| 370 | 3300050491 | nmdc:mga00v17_98396_c1 | nmdc:mga00v17_98396_c1_510_905 | 131 |
| 371 | 3300050492 | nmdc:mga0yw44_373623_c1 | nmdc:mga0yw44_373623_c1_76_471 | 131 |
| 372 | 3300050514 | nmdc:mga08x19_853330_c1 | nmdc:mga08x19_853330_c1_155_550 | 131 |
| 373 | 3300053119 | Ga0500595_038381 | Ga0500595_038381_309_704 | 131 |
| 374 | 3300053136 | Ga0500559_0000113 | Ga0500559_0000113_52637_53032 | 131 |
| 375 | 3300053153 | Ga0500616_0192271 | Ga0500616_0192271_78_473 | 131 |
| 376 | 3300054114 | Ga0501084_0039158 | Ga0501084_0039158_2290_2685 | 131 |
| 377 | 3300059491 | Ga0587070_164868 | Ga0587070_164868_98_493 | 131 |
| 378 | 3300061719 | Ga0466962_0020301 | Ga0466962_0020301_389_784 | 131 |
| 379 | 3300061719 | Ga0466962_0742836 | Ga0466962_0742836_76_471 | 131 |
| 380 | 3300003187 | JGI25151J46595_10000038 | JGI25151J46595_1000003817 | 132 |
| 381 | 3300003187 | JGI25151J46595_10029400 | JGI25151J46595_100294003 | 132 |
| 382 | 3300003214 | JGI25165J46597_1000961 | JGI25165J46597_100096114 | 132 |
| 383 | 3300003575 | Ga0007409J51694_1099358 | Ga0007409J51694_10993582 | 132 |
| 384 | 3300003771 | Ga0055526_1007926 | Ga0055526_10079268 | 132 |
| 385 | 3300003771 | Ga0055526_1011996 | Ga0055526_10119965 | 132 |
| 386 | 3300003771 | Ga0055526_1012008 | Ga0055526_10120085 | 132 |
| 387 | 3300003775 | Ga0055524_1006440 | Ga0055524_10064405 | 132 |
| 388 | 3300003775 | Ga0055524_1017171 | Ga0055524_10171712 | 132 |
| 389 | 3300005262 | Ga0065165_1000631 | Ga0065165_100063117 | 132 |
| 390 | 3300005327 | Ga0070658_10015385 | Ga0070658_100153857 | 132 |
| 391 | 3300005327 | Ga0070658_10025403 | Ga0070658_100254035 | 132 |
| 392 | 3300005327 | Ga0070658_10040606 | Ga0070658_100406066 | 132 |
| 393 | 3300005327 | Ga0070658_10543772 | Ga0070658_105437721 | 132 |
| 394 | 3300005327 | Ga0070658_10934740 | Ga0070658_109347402 | 132 |
| 395 | 3300005328 | Ga0070676_10549892 | Ga0070676_105498922 | 132 |
| 396 | 3300005331 | Ga0070670_100651452 | Ga0070670_1006514522 | 132 |
| 397 | 3300005334 | Ga0068869_100549502 | Ga0068869_1005495022 | 132 |
| 398 | 3300005339 | Ga0070660_100004846 | Ga0070660_10000484612 | 132 |
| 399 | 3300005339 | Ga0070660_100011745 | Ga0070660_10001174510 | 132 |
| 400 | 3300005339 | Ga0070660_100062412 | Ga0070660_1000624124 | 132 |
| 401 | 3300005339 | Ga0070660_100383367 | Ga0070660_1003833672 | 132 |
| 402 | 3300005340 | Ga0070689_101171007 | Ga0070689_1011710071 | 132 |
| 403 | 3300005341 | Ga0070691_10182111 | Ga0070691_101821112 | 132 |
| 404 | 3300005344 | Ga0070661_100010348 | Ga0070661_1000103484 | 132 |
| 405 | 3300005344 | Ga0070661_100021704 | Ga0070661_1000217043 | 132 |
| 406 | 3300005347 | Ga0070668_100070464 | Ga0070668_1000704644 | 132 |
| 407 | 3300005347 | Ga0070668_100267353 | Ga0070668_1002673532 | 132 |
| 408 | 3300005347 | Ga0070668_100996861 | Ga0070668_1009968612 | 132 |
| 409 | 3300005353 | Ga0070669_100776251 | Ga0070669_1007762512 | 132 |
| 410 | 3300005355 | Ga0070671_100785994 | Ga0070671_1007859942 | 132 |
| 411 | 3300005356 | Ga0070674_100022024 | Ga0070674_1000220244 | 132 |
| 412 | 3300005356 | Ga0070674_100814071 | Ga0070674_1008140711 | 132 |
| 413 | 3300005364 | Ga0070673_100171656 | Ga0070673_1001716562 | 132 |
| 414 | 3300005364 | Ga0070673_100320084 | Ga0070673_1003200841 | 132 |
| 415 | 3300005364 | Ga0070673_100366749 | Ga0070673_1003667492 | 132 |
| 416 | 3300005366 | Ga0070659_100048719 | Ga0070659_1000487191 | 132 |
| 417 | 3300005366 | Ga0070659_100774510 | Ga0070659_1007745102 | 132 |
| 418 | 3300005434 | Ga0070709_10641614 | Ga0070709_106416142 | 132 |
| 419 | 3300005435 | Ga0070714_100109782 | Ga0070714_1001097822 | 132 |
| 420 | 3300005435 | Ga0070714_100971260 | Ga0070714_1009712602 | 132 |
| 421 | 3300005435 | Ga0070714_101364993 | Ga0070714_1013649932 | 132 |
| 422 | 3300005439 | Ga0070711_100568848 | Ga0070711_1005688481 | 132 |
| 423 | 3300005439 | Ga0070711_100689944 | Ga0070711_1006899442 | 132 |
| 424 | 3300005441 | Ga0070700_100063876 | Ga0070700_1000638762 | 132 |
| 425 | 3300005444 | Ga0070694_100392764 | Ga0070694_1003927642 | 132 |
| 426 | 3300005456 | Ga0070678_100462878 | Ga0070678_1004628782 | 132 |
| 427 | 3300005456 | Ga0070678_100961738 | Ga0070678_1009617382 | 132 |
| 428 | 3300005458 | Ga0070681_11031567 | Ga0070681_110315671 | 132 |
| 429 | 3300005459 | Ga0068867_100133734 | Ga0068867_1001337344 | 132 |
| 430 | 3300005459 | Ga0068867_100254901 | Ga0068867_1002549012 | 132 |
| 431 | 3300005530 | Ga0070679_100048764 | Ga0070679_1000487649 | 132 |
| 432 | 3300005535 | Ga0070684_100219672 | Ga0070684_1002196722 | 132 |
| 433 | 3300005536 | Ga0070697_100005582 | Ga0070697_1000055825 | 132 |
| 434 | 3300005543 | Ga0070672_100153763 | Ga0070672_1001537633 | 132 |
| 435 | 3300005545 | Ga0070695_100007388 | Ga0070695_1000073883 | 132 |
| 436 | 3300005548 | Ga0070665_100212441 | Ga0070665_1002124413 | 132 |
| 437 | 3300005548 | Ga0070665_100421454 | Ga0070665_1004214543 | 132 |
| 438 | 3300005548 | Ga0070665_100936261 | Ga0070665_1009362611 | 132 |
| 439 | 3300005563 | Ga0068855_100018562 | Ga0068855_1000185629 | 132 |
| 440 | 3300005563 | Ga0068855_100034672 | Ga0068855_1000346723 | 132 |
| 441 | 3300005564 | Ga0070664_100181128 | Ga0070664_1001811282 | 132 |
| 442 | 3300005577 | Ga0068857_100071599 | Ga0068857_1000715993 | 132 |
| 443 | 3300005577 | Ga0068857_100547441 | Ga0068857_1005474412 | 132 |
| 444 | 3300005578 | Ga0068854_100008442 | Ga0068854_1000084429 | 132 |
| 445 | 3300005578 | Ga0068854_101588108 | Ga0068854_1015881081 | 132 |
| 446 | 3300005614 | Ga0068856_100068108 | Ga0068856_1000681084 | 132 |
| 447 | 3300005614 | Ga0068856_100283714 | Ga0068856_1002837142 | 132 |
| 448 | 3300005616 | Ga0068852_100009612 | Ga0068852_1000096127 | 132 |
| 449 | 3300005616 | Ga0068852_100023465 | Ga0068852_1000234658 | 132 |
| 450 | 3300005616 | Ga0068852_100984811 | Ga0068852_1009848112 | 132 |
| 451 | 3300005718 | Ga0068866_10304780 | Ga0068866_103047802 | 132 |
| 452 | 3300005719 | Ga0068861_100214013 | Ga0068861_1002140133 | 132 |
| 453 | 3300005834 | Ga0068851_10120448 | Ga0068851_101204483 | 132 |
| 454 | 3300005844 | Ga0068862_100691568 | Ga0068862_1006915682 | 132 |
| 455 | 3300005981 | Ga0081538_10368833 | Ga0081538_103688331 | 132 |
| 456 | 3300006038 | Ga0075365_10442619 | Ga0075365_104426192 | 132 |
| 457 | 3300006038 | Ga0075365_10662485 | Ga0075365_106624851 | 132 |
| 458 | 3300006042 | Ga0075368_10066230 | Ga0075368_100662303 | 132 |
| 459 | 3300006048 | Ga0075363_100049305 | Ga0075363_1000493052 | 132 |
| 460 | 3300006048 | Ga0075363_100387290 | Ga0075363_1003872902 | 132 |
| 461 | 3300006173 | Ga0070716_100894376 | Ga0070716_1008943762 | 132 |
| 462 | 3300006175 | Ga0070712_100393545 | Ga0070712_1003935453 | 132 |
| 463 | 3300006177 | Ga0075362_10244512 | Ga0075362_102445122 | 132 |
| 464 | 3300006178 | Ga0075367_10075360 | Ga0075367_100753604 | 132 |
| 465 | 3300006186 | Ga0075369_10194209 | Ga0075369_101942091 | 132 |
| 466 | 3300006186 | Ga0075369_10234943 | Ga0075369_102349432 | 132 |
| 467 | 3300006195 | Ga0075366_10132234 | Ga0075366_101322341 | 132 |
| 468 | 3300006195 | Ga0075366_10696681 | Ga0075366_106966812 | 132 |
| 469 | 3300006237 | Ga0097621_100176251 | Ga0097621_1001762514 | 132 |
| 470 | 3300006353 | Ga0075370_10277672 | Ga0075370_102776722 | 132 |
| 471 | 3300006358 | Ga0068871_100584219 | Ga0068871_1005842192 | 132 |
| 472 | 3300006358 | Ga0068871_100624673 | Ga0068871_1006246733 | 132 |
| 473 | 3300006880 | Ga0075429_100661389 | Ga0075429_1006613892 | 132 |
| 474 | 3300006881 | Ga0068865_100185308 | Ga0068865_1001853082 | 132 |
| 475 | 3300006881 | Ga0068865_101389042 | Ga0068865_1013890421 | 132 |
| 476 | 3300006914 | Ga0075436_100014756 | Ga0075436_10001475610 | 132 |
| 477 | 3300007076 | Ga0075435_100026460 | Ga0075435_1000264603 | 132 |
| 478 | 3300009093 | Ga0105240_10038434 | Ga0105240_100384347 | 132 |
| 479 | 3300009093 | Ga0105240_10141214 | Ga0105240_101412148 | 132 |
| 480 | 3300009093 | Ga0105240_10662586 | Ga0105240_106625861 | 132 |
| 481 | 3300009093 | Ga0105240_12407093 | Ga0105240_124070931 | 132 |
| 482 | 3300009098 | Ga0105245_10243528 | Ga0105245_102435283 | 132 |
| 483 | 3300009101 | Ga0105247_11130999 | Ga0105247_111309991 | 132 |
| 484 | 3300009148 | Ga0105243_10200032 | Ga0105243_102000322 | 132 |
| 485 | 3300009174 | Ga0105241_11196004 | Ga0105241_111960042 | 132 |
| 486 | 3300009545 | Ga0105237_10268995 | Ga0105237_102689953 | 132 |
| 487 | 3300009551 | Ga0105238_10164963 | Ga0105238_101649633 | 132 |
| 488 | 3300009551 | Ga0105238_10224998 | Ga0105238_102249984 | 132 |
| 489 | 3300009551 | Ga0105238_10969946 | Ga0105238_109699462 | 132 |
| 490 | 3300010375 | Ga0105239_10067735 | Ga0105239_100677352 | 132 |
| 491 | 3300010375 | Ga0105239_10373217 | Ga0105239_103732173 | 132 |
| 492 | 3300010375 | Ga0105239_10484555 | Ga0105239_104845552 | 132 |
| 493 | 3300013104 | Ga0157370_10089218 | Ga0157370_100892188 | 132 |
| 494 | 3300013104 | Ga0157370_10390973 | Ga0157370_103909733 | 132 |
| 495 | 3300013104 | Ga0157370_10667392 | Ga0157370_106673922 | 132 |
| 496 | 3300013105 | Ga0157369_10038065 | Ga0157369_100380659 | 132 |
| 497 | 3300013250 | Ga0171462_1042 | Ga0171462_104259 | 132 |
| 498 | 3300013296 | Ga0157374_10335720 | Ga0157374_103357202 | 132 |
| 499 | 3300013297 | Ga0157378_10621501 | Ga0157378_106215013 | 132 |
| 500 | 3300013306 | Ga0163162_10498696 | Ga0163162_104986962 | 132 |
| 501 | 3300013307 | Ga0157372_10692730 | Ga0157372_106927303 | 132 |
| 502 | 3300013307 | Ga0157372_10700197 | Ga0157372_107001973 | 132 |
| 503 | 3300013308 | Ga0157375_10285686 | Ga0157375_102856861 | 132 |
| 504 | 3300013308 | Ga0157375_13024890 | Ga0157375_130248902 | 132 |
| 505 | 3300014325 | Ga0163163_13035012 | Ga0163163_130350121 | 132 |
| 506 | 3300014497 | Ga0182008_10552102 | Ga0182008_105521022 | 132 |
| 507 | 3300014497 | Ga0182008_10769198 | Ga0182008_107691981 | 132 |
| 508 | 3300014745 | Ga0157377_10105601 | Ga0157377_101056013 | 132 |
| 509 | 3300020070 | Ga0206356_10625610 | Ga0206356_106256102 | 132 |
| 510 | 3300021358 | Ga0213873_10042510 | Ga0213873_100425102 | 132 |
| 511 | 3300021361 | Ga0213872_10077193 | Ga0213872_100771933 | 132 |
| 512 | 3300021361 | Ga0213872_10111276 | Ga0213872_101112763 | 132 |
| 513 | 3300021377 | Ga0213874_10030386 | Ga0213874_100303863 | 132 |
| 514 | 3300021377 | Ga0213874_10089747 | Ga0213874_100897471 | 132 |
| 515 | 3300021384 | Ga0213876_10003867 | Ga0213876_100038673 | 132 |
| 516 | 3300021384 | Ga0213876_10016751 | Ga0213876_100167519 | 132 |
| 517 | 3300021384 | Ga0213876_10017136 | Ga0213876_100171363 | 132 |
| 518 | 3300021388 | Ga0213875_10008348 | Ga0213875_100083483 | 132 |
| 519 | 3300021441 | Ga0213871_10102972 | Ga0213871_101029721 | 132 |
| 520 | 3300025231 | Ga0207427_105022 | Ga0207427_1050224 | 132 |
| 521 | 3300025261 | Ga0209233_1000293 | Ga0209233_100029322 | 132 |
| 522 | 3300025284 | Ga0209130_1001794 | Ga0209130_100179412 | 132 |
| 523 | 3300025291 | Ga0209675_1002527 | Ga0209675_100252714 | 132 |
| 524 | 3300025292 | Ga0209676_1111893 | Ga0209676_11118931 | 132 |
| 525 | 3300025294 | Ga0209025_1000014 | Ga0209025_100001411 | 132 |
| 526 | 3300025294 | Ga0209025_1012375 | Ga0209025_10123757 | 132 |
| 527 | 3300025294 | Ga0209025_1083054 | Ga0209025_10830541 | 132 |
| 528 | 3300025295 | Ga0209564_1002872 | Ga0209564_100287212 | 132 |
| 529 | 3300025295 | Ga0209564_1003215 | Ga0209564_10032158 | 132 |
| 530 | 3300025299 | Ga0209256_1000108 | Ga0209256_1000108185 | 132 |
| 531 | 3300025299 | Ga0209256_1000540 | Ga0209256_100054054 | 132 |
| 532 | 3300025302 | Ga0207426_1004654 | Ga0207426_10046549 | 132 |
| 533 | 3300025304 | Ga0209257_1025525 | Ga0209257_10255252 | 132 |
| 534 | 3300025321 | Ga0207656_10070969 | Ga0207656_100709692 | 132 |
| 535 | 3300025901 | Ga0207688_10011717 | Ga0207688_100117174 | 132 |
| 536 | 3300025901 | Ga0207688_10310436 | Ga0207688_103104363 | 132 |
| 537 | 3300025904 | Ga0207647_10047848 | Ga0207647_100478484 | 132 |
| 538 | 3300025904 | Ga0207647_10121245 | Ga0207647_101212454 | 132 |
| 539 | 3300025907 | Ga0207645_10035969 | Ga0207645_100359693 | 132 |
| 540 | 3300025907 | Ga0207645_10291700 | Ga0207645_102917002 | 132 |
| 541 | 3300025909 | Ga0207705_10001453 | Ga0207705_1000145324 | 132 |
| 542 | 3300025909 | Ga0207705_10070578 | Ga0207705_100705782 | 132 |
| 543 | 3300025909 | Ga0207705_10891694 | Ga0207705_108916941 | 132 |
| 544 | 3300025910 | Ga0207684_10499689 | Ga0207684_104996893 | 132 |
| 545 | 3300025911 | Ga0207654_10179626 | Ga0207654_101796263 | 132 |
| 546 | 3300025911 | Ga0207654_10229343 | Ga0207654_102293432 | 132 |
| 547 | 3300025912 | Ga0207707_10877950 | Ga0207707_108779502 | 132 |
| 548 | 3300025913 | Ga0207695_10002347 | Ga0207695_100023477 | 132 |
| 549 | 3300025913 | Ga0207695_10058589 | Ga0207695_100585892 | 132 |
| 550 | 3300025913 | Ga0207695_10125896 | Ga0207695_101258963 | 132 |
| 551 | 3300025914 | Ga0207671_10610727 | Ga0207671_106107272 | 132 |
| 552 | 3300025914 | Ga0207671_11120025 | Ga0207671_111200252 | 132 |
| 553 | 3300025916 | Ga0207663_11339655 | Ga0207663_113396552 | 132 |
| 554 | 3300025919 | Ga0207657_10008060 | Ga0207657_1000806012 | 132 |
| 555 | 3300025919 | Ga0207657_10043012 | Ga0207657_100430125 | 132 |
| 556 | 3300025919 | Ga0207657_10054867 | Ga0207657_100548679 | 132 |
| 557 | 3300025920 | Ga0207649_10057628 | Ga0207649_100576284 | 132 |
| 558 | 3300025920 | Ga0207649_10123886 | Ga0207649_101238862 | 132 |
| 559 | 3300025921 | Ga0207652_10485160 | Ga0207652_104851602 | 132 |
| 560 | 3300025924 | Ga0207694_10072325 | Ga0207694_100723251 | 132 |
| 561 | 3300025924 | Ga0207694_10161581 | Ga0207694_101615813 | 132 |
| 562 | 3300025924 | Ga0207694_10692700 | Ga0207694_106927002 | 132 |
| 563 | 3300025926 | Ga0207659_10167580 | Ga0207659_101675802 | 132 |
| 564 | 3300025928 | Ga0207700_10618288 | Ga0207700_106182882 | 132 |
| 565 | 3300025929 | Ga0207664_10073108 | Ga0207664_100731086 | 132 |
| 566 | 3300025929 | Ga0207664_10177988 | Ga0207664_101779884 | 132 |
| 567 | 3300025932 | Ga0207690_10039549 | Ga0207690_100395494 | 132 |
| 568 | 3300025932 | Ga0207690_10146492 | Ga0207690_101464923 | 132 |
| 569 | 3300025933 | Ga0207706_10017594 | Ga0207706_100175944 | 132 |
| 570 | 3300025935 | Ga0207709_10362890 | Ga0207709_103628903 | 132 |
| 571 | 3300025937 | Ga0207669_10040699 | Ga0207669_100406993 | 132 |
| 572 | 3300025937 | Ga0207669_10618331 | Ga0207669_106183312 | 132 |
| 573 | 3300025938 | Ga0207704_11029964 | Ga0207704_110299641 | 132 |
| 574 | 3300025938 | Ga0207704_11094741 | Ga0207704_110947412 | 132 |
| 575 | 3300025940 | Ga0207691_10003340 | Ga0207691_1000334018 | 132 |
| 576 | 3300025940 | Ga0207691_10995317 | Ga0207691_109953172 | 132 |
| 577 | 3300025942 | Ga0207689_10975916 | Ga0207689_109759162 | 132 |
| 578 | 3300025942 | Ga0207689_11214199 | Ga0207689_112141992 | 132 |
| 579 | 3300025945 | Ga0207679_10039615 | Ga0207679_100396158 | 132 |
| 580 | 3300025949 | Ga0207667_10000877 | Ga0207667_1000087716 | 132 |
| 581 | 3300025949 | Ga0207667_10002756 | Ga0207667_1000275618 | 132 |
| 582 | 3300025949 | Ga0207667_10019501 | Ga0207667_100195014 | 132 |
| 583 | 3300025960 | Ga0207651_10311804 | Ga0207651_103118042 | 132 |
| 584 | 3300025960 | Ga0207651_11069737 | Ga0207651_110697372 | 132 |
| 585 | 3300025972 | Ga0207668_10546949 | Ga0207668_105469491 | 132 |
| 586 | 3300025972 | Ga0207668_10967315 | Ga0207668_109673152 | 132 |
| 587 | 3300025972 | Ga0207668_11034164 | Ga0207668_110341641 | 132 |
| 588 | 3300025981 | Ga0207640_10023318 | Ga0207640_100233189 | 132 |
| 589 | 3300025981 | Ga0207640_11395091 | Ga0207640_113950911 | 132 |
| 590 | 3300026023 | Ga0207677_10468229 | Ga0207677_104682292 | 132 |
| 591 | 3300026041 | Ga0207639_10151732 | Ga0207639_101517324 | 132 |
| 592 | 3300026041 | Ga0207639_10196410 | Ga0207639_101964103 | 132 |
| 593 | 3300026067 | Ga0207678_10022593 | Ga0207678_100225933 | 132 |
| 594 | 3300026075 | Ga0207708_10112333 | Ga0207708_101123332 | 132 |
| 595 | 3300026078 | Ga0207702_10167468 | Ga0207702_101674681 | 132 |
| 596 | 3300026078 | Ga0207702_10193787 | Ga0207702_101937872 | 132 |
| 597 | 3300026089 | Ga0207648_10105542 | Ga0207648_101055424 | 132 |
| 598 | 3300026089 | Ga0207648_10299667 | Ga0207648_102996673 | 132 |
| 599 | 3300026116 | Ga0207674_10065457 | Ga0207674_100654573 | 132 |
| 600 | 3300026116 | Ga0207674_10955653 | Ga0207674_109556532 | 132 |
| 601 | 3300026118 | Ga0207675_100229874 | Ga0207675_1002298742 | 132 |
| 602 | 3300026121 | Ga0207683_10398170 | Ga0207683_103981702 | 132 |
| 603 | 3300026142 | Ga0207698_10009953 | Ga0207698_100099538 | 132 |
| 604 | 3300026142 | Ga0207698_10084824 | Ga0207698_100848243 | 132 |
| 605 | 3300026142 | Ga0207698_12272721 | Ga0207698_122727211 | 132 |
| 606 | 3300027866 | Ga0209813_10088547 | Ga0209813_100885471 | 132 |
| 607 | 3300028379 | Ga0268266_10085002 | Ga0268266_100850024 | 132 |
| 608 | 3300028379 | Ga0268266_10187330 | Ga0268266_101873303 | 132 |
| 609 | 3300028379 | Ga0268266_10519989 | Ga0268266_105199891 | 132 |
| 610 | 3300028379 | Ga0268266_10774341 | Ga0268266_107743413 | 132 |
| 611 | 3300028380 | Ga0268265_10989906 | Ga0268265_109899062 | 132 |
| 612 | 3300028577 | Ga0265318_10015702 | Ga0265318_100157022 | 132 |
| 613 | 3300028577 | Ga0265318_10102029 | Ga0265318_101020292 | 132 |
| 614 | 3300028786 | Ga0307517_10174085 | Ga0307517_101740852 | 132 |
| 615 | 3300028800 | Ga0265338_10005387 | Ga0265338_1000538717 | 132 |
| 616 | 3300030760 | Ga0265762_1030167 | Ga0265762_10301672 | 132 |
| 617 | 3300030760 | Ga0265762_1115148 | Ga0265762_11151481 | 132 |
| 618 | 3300031235 | Ga0265330_10006774 | Ga0265330_100067743 | 132 |
| 619 | 3300031235 | Ga0265330_10046222 | Ga0265330_100462223 | 132 |
| 620 | 3300031235 | Ga0265330_10149118 | Ga0265330_101491182 | 132 |
| 621 | 3300031235 | Ga0265330_10156425 | Ga0265330_101564252 | 132 |
| 622 | 3300031235 | Ga0265330_10179775 | Ga0265330_101797752 | 132 |
| 623 | 3300031235 | Ga0265330_10180753 | Ga0265330_101807532 | 132 |
| 624 | 3300031235 | Ga0265330_10211989 | Ga0265330_102119892 | 132 |
| 625 | 3300031235 | Ga0265330_10348479 | Ga0265330_103484791 | 132 |
| 626 | 3300031235 | Ga0265330_10350569 | Ga0265330_103505691 | 132 |
| 627 | 3300031235 | Ga0265330_10354749 | Ga0265330_103547491 | 132 |
| 628 | 3300031238 | Ga0265332_10012013 | Ga0265332_100120132 | 132 |
| 629 | 3300031238 | Ga0265332_10117030 | Ga0265332_101170303 | 132 |
| 630 | 3300031238 | Ga0265332_10270892 | Ga0265332_102708921 | 132 |
| 631 | 3300031239 | Ga0265328_10000041 | Ga0265328_1000004182 | 132 |
| 632 | 3300031239 | Ga0265328_10000129 | Ga0265328_1000012917 | 132 |
| 633 | 3300031239 | Ga0265328_10002900 | Ga0265328_100029007 | 132 |
| 634 | 3300031239 | Ga0265328_10002943 | Ga0265328_100029431 | 132 |
| 635 | 3300031239 | Ga0265328_10021114 | Ga0265328_100211142 | 132 |
| 636 | 3300031239 | Ga0265328_10031155 | Ga0265328_100311552 | 132 |
| 637 | 3300031239 | Ga0265328_10031723 | Ga0265328_100317233 | 132 |
| 638 | 3300031239 | Ga0265328_10034301 | Ga0265328_100343013 | 132 |
| 639 | 3300031239 | Ga0265328_10047389 | Ga0265328_100473892 | 132 |
| 640 | 3300031241 | Ga0265325_10001732 | Ga0265325_1000173219 | 132 |
| 641 | 3300031241 | Ga0265325_10045461 | Ga0265325_100454612 | 132 |
| 642 | 3300031241 | Ga0265325_10072848 | Ga0265325_100728481 | 132 |
| 643 | 3300031241 | Ga0265325_10079474 | Ga0265325_100794743 | 132 |
| 644 | 3300031241 | Ga0265325_10150945 | Ga0265325_101509453 | 132 |
| 645 | 3300031242 | Ga0265329_10125809 | Ga0265329_101258092 | 132 |
| 646 | 3300031247 | Ga0265340_10001159 | Ga0265340_100011592 | 132 |
| 647 | 3300031247 | Ga0265340_10007526 | Ga0265340_1000752611 | 132 |
| 648 | 3300031247 | Ga0265340_10010398 | Ga0265340_100103987 | 132 |
| 649 | 3300031247 | Ga0265340_10021947 | Ga0265340_100219478 | 132 |
| 650 | 3300031247 | Ga0265340_10092888 | Ga0265340_100928883 | 132 |
| 651 | 3300031247 | Ga0265340_10148320 | Ga0265340_101483202 | 132 |
| 652 | 3300031247 | Ga0265340_10166397 | Ga0265340_101663972 | 132 |
| 653 | 3300031249 | Ga0265339_10002105 | Ga0265339_1000210515 | 132 |
| 654 | 3300031249 | Ga0265339_10008522 | Ga0265339_100085225 | 132 |
| 655 | 3300031249 | Ga0265339_10042300 | Ga0265339_100423001 | 132 |
| 656 | 3300031249 | Ga0265339_10057240 | Ga0265339_100572403 | 132 |
| 657 | 3300031249 | Ga0265339_10065467 | Ga0265339_100654672 | 132 |
| 658 | 3300031249 | Ga0265339_10081034 | Ga0265339_100810343 | 132 |
| 659 | 3300031249 | Ga0265339_10392194 | Ga0265339_103921942 | 132 |
| 660 | 3300031249 | Ga0265339_10527566 | Ga0265339_105275661 | 132 |
| 661 | 3300031250 | Ga0265331_10000090 | Ga0265331_1000009017 | 132 |
| 662 | 3300031250 | Ga0265331_10001125 | Ga0265331_100011259 | 132 |
| 663 | 3300031250 | Ga0265331_10016732 | Ga0265331_100167327 | 132 |
| 664 | 3300031250 | Ga0265331_10017155 | Ga0265331_100171552 | 132 |
| 665 | 3300031250 | Ga0265331_10076846 | Ga0265331_100768463 | 132 |
| 666 | 3300031251 | Ga0265327_10028470 | Ga0265327_100284702 | 132 |
| 667 | 3300031251 | Ga0265327_10371914 | Ga0265327_103719142 | 132 |
| 668 | 3300031344 | Ga0265316_10015933 | Ga0265316_100159334 | 132 |
| 669 | 3300031344 | Ga0265316_10039265 | Ga0265316_100392657 | 132 |
| 670 | 3300031344 | Ga0265316_10188596 | Ga0265316_101885962 | 132 |
| 671 | 3300031344 | Ga0265316_10507656 | Ga0265316_105076562 | 132 |
| 672 | 3300031344 | Ga0265316_11116696 | Ga0265316_111166961 | 132 |
| 673 | 3300031456 | Ga0307513_10110246 | Ga0307513_101102466 | 132 |
| 674 | 3300031548 | Ga0307408_100741874 | Ga0307408_1007418742 | 132 |
| 675 | 3300031595 | Ga0265313_10000031 | Ga0265313_1000003193 | 132 |
| 676 | 3300031595 | Ga0265313_10019748 | Ga0265313_100197483 | 132 |
| 677 | 3300031595 | Ga0265313_10053277 | Ga0265313_100532774 | 132 |
| 678 | 3300031595 | Ga0265313_10100614 | Ga0265313_101006142 | 132 |
| 679 | 3300031616 | Ga0307508_10155372 | Ga0307508_101553724 | 132 |
| 680 | 3300031649 | Ga0307514_10098619 | Ga0307514_100986195 | 132 |
| 681 | 3300031665 | Ga0316575_10514375 | Ga0316575_105143751 | 132 |
| 682 | 3300031711 | Ga0265314_10000963 | Ga0265314_100009631 | 132 |
| 683 | 3300031711 | Ga0265314_10008857 | Ga0265314_1000885712 | 132 |
| 684 | 3300031711 | Ga0265314_10461989 | Ga0265314_104619892 | 132 |
| 685 | 3300031712 | Ga0265342_10004137 | Ga0265342_1000413717 | 132 |
| 686 | 3300031712 | Ga0265342_10006333 | Ga0265342_100063335 | 132 |
| 687 | 3300031712 | Ga0265342_10182071 | Ga0265342_101820711 | 132 |
| 688 | 3300031712 | Ga0265342_10598166 | Ga0265342_105981661 | 132 |
| 689 | 3300031727 | Ga0316576_10114488 | Ga0316576_101144882 | 132 |
| 690 | 3300031728 | Ga0316578_10748690 | Ga0316578_107486901 | 132 |
| 691 | 3300031731 | Ga0307405_10055833 | Ga0307405_100558333 | 132 |
| 692 | 3300031733 | Ga0316577_10407604 | Ga0316577_104076042 | 132 |
| 693 | 3300031824 | Ga0307413_10782991 | Ga0307413_107829912 | 132 |
| 694 | 3300031852 | Ga0307410_11051262 | Ga0307410_110512622 | 132 |
| 695 | 3300031852 | Ga0307410_11084306 | Ga0307410_110843062 | 132 |
| 696 | 3300031901 | Ga0307406_10090266 | Ga0307406_100902663 | 132 |
| 697 | 3300031901 | Ga0307406_11605471 | Ga0307406_116054712 | 132 |
| 698 | 3300031903 | Ga0307407_10820445 | Ga0307407_108204452 | 132 |
| 699 | 3300031911 | Ga0307412_10262248 | Ga0307412_102622482 | 132 |
| 700 | 3300031995 | Ga0307409_100286660 | Ga0307409_1002866603 | 132 |
| 701 | 3300031995 | Ga0307409_102919525 | Ga0307409_1029195251 | 132 |
| 702 | 3300032002 | Ga0307416_100047875 | Ga0307416_1000478754 | 132 |
| 703 | 3300032002 | Ga0307416_102381471 | Ga0307416_1023814711 | 132 |
| 704 | 3300032002 | Ga0307416_102510348 | Ga0307416_1025103481 | 132 |
| 705 | 3300032004 | Ga0307414_10287420 | Ga0307414_102874201 | 132 |
| 706 | 3300032005 | Ga0307411_10479497 | Ga0307411_104794972 | 132 |
| 707 | 3300032005 | Ga0307411_10995046 | Ga0307411_109950462 | 132 |
| 708 | 3300032168 | Ga0316593_10012327 | Ga0316593_100123275 | 132 |
| 709 | 3300032168 | Ga0316593_10315192 | Ga0316593_103151922 | 132 |
| 710 | 3300033180 | Ga0307510_10114264 | Ga0307510_101142644 | 132 |
| 711 | 3300033524 | Ga0316592_1009885 | Ga0316592_10098853 | 132 |
| 712 | 3300033541 | Ga0316596_1006578 | Ga0316596_10065785 | 132 |
| 713 | 3300034817 | Ga0373948_0011793 | Ga0373948_0011793_902_1300 | 132 |
| 714 | 3300034820 | Ga0373959_0121796 | Ga0373959_0121796_175_573 | 132 |
| 715 | 3300035084 | Ga0373928_0005729 | Ga0373928_0005729_596_994 | 132 |
| 716 | 3300035089 | Ga0373944_0067559 | Ga0373944_0067559_171_569 | 132 |
| 717 | 3300035111 | Ga0373923_0415822 | Ga0373923_0415822_152_550 | 132 |
| 718 | 3300035112 | Ga0373932_0084558 | Ga0373932_0084558_176_574 | 132 |
| 719 | 3300035113 | Ga0373936_0008097 | Ga0373936_0008097_376_774 | 132 |
| 720 | 3300035115 | Ga0373941_0137975 | Ga0373941_0137975_359_757 | 132 |
| 721 | 3300035116 | Ga0373945_0006653 | Ga0373945_0006653_2293_2691 | 132 |
| 722 | 3300035121 | Ga0373960_0016768 | Ga0373960_0016768_69_467 | 132 |
| 723 | 3300035170 | Ga0373943_0007235 | Ga0373943_0007235_4303_4701 | 132 |
| 724 | 3300035170 | Ga0373943_0080948 | Ga0373943_0080948_614_1012 | 132 |
| 725 | 3300035171 | Ga0373946_0602606 | Ga0373946_0602606_20_418 | 132 |
| 726 | 3300035172 | Ga0373955_0036549 | Ga0373955_0036549_257_655 | 132 |
| 727 | 3300035172 | Ga0373955_0739722 | Ga0373955_0739722_91_489 | 132 |
| 728 | 3300035172 | Ga0373955_0759412 | Ga0373955_0759412_73_471 | 132 |
| 729 | 3300035207 | Ga0373942_0039087 | Ga0373942_0039087_689_1087 | 132 |
| 730 | 3300035242 | Ga0373962_0141061 | Ga0373962_0141061_144_542 | 132 |
| 731 | 3300035691 | Ga0373931_0057013 | Ga0373931_0057013_659_1057 | 132 |
| 732 | 3300035691 | Ga0373931_0437656 | Ga0373931_0437656_114_512 | 132 |
| 733 | 3300035692 | Ga0373935_0003403 | Ga0373935_0003403_6673_7071 | 132 |
| 734 | 3300035692 | Ga0373935_0026109 | Ga0373935_0026109_2235_2633 | 132 |
| 735 | 3300035695 | Ga0373927_0000971 | Ga0373927_0000971_14128_14526 | 132 |
| 736 | 3300035695 | Ga0373927_0064151 | Ga0373927_0064151_1941_2339 | 132 |
| 737 | 3300035695 | Ga0373927_0167531 | Ga0373927_0167531_202_600 | 132 |
| 738 | 3300035724 | Ga0373933_0510491 | Ga0373933_0510491_88_486 | 132 |
| 739 | 3300035725 | Ga0373947_0011709 | Ga0373947_0011709_3302_3700 | 132 |
| 740 | 3300035725 | Ga0373947_0124556 | Ga0373947_0124556_333_731 | 132 |
| 741 | 3300037068 | Ga0373925_0002443 | Ga0373925_0002443_689_1087 | 132 |
| 742 | 3300037068 | Ga0373925_0002514 | Ga0373925_0002514_8593_8991 | 132 |
| 743 | 3300037853 | Ga0436364_0438482 | Ga0436364_0438482_677_1075 | 132 |
| 744 | 3300037853 | Ga0436364_0743164 | Ga0436364_0743164_768_1166 | 132 |
| 745 | 3300037853 | Ga0436364_1420929 | Ga0436364_1420929_33_431 | 132 |
| 746 | 3300039145 | Ga0237816_04840 | Ga0237816_04840_56_454 | 132 |
| 747 | 3300039437 | Ga0436365_0047289 | Ga0436365_0047289_2059_2457 | 132 |
| 748 | 3300039437 | Ga0436365_0075962 | Ga0436365_0075962_303_701 | 132 |
| 749 | 3300039437 | Ga0436365_1136540 | Ga0436365_1136540_14179_14577 | 132 |
| 750 | 3300039437 | Ga0436365_1253031 | Ga0436365_1253031_36344_36742 | 132 |
| 751 | 3300039437 | Ga0436365_1706336 | Ga0436365_1706336_1445_1843 | 132 |
| 752 | 3300039438 | Ga0436360_0321131 | Ga0436360_0321131_374_772 | 132 |
| 753 | 3300039438 | Ga0436360_0355448 | Ga0436360_0355448_1409_1807 | 132 |
| 754 | 3300039438 | Ga0436360_0454769 | Ga0436360_0454769_236_634 | 132 |
| 755 | 3300039438 | Ga0436360_0537617 | Ga0436360_0537617_3398_3796 | 132 |
| 756 | 3300039438 | Ga0436360_0773833 | Ga0436360_0773833_308_706 | 132 |
| 757 | 3300039438 | Ga0436360_0820186 | Ga0436360_0820186_34_432 | 132 |
| 758 | 3300039438 | Ga0436360_0900938 | Ga0436360_0900938_49_447 | 132 |
| 759 | 3300039438 | Ga0436360_1154925 | Ga0436360_1154925_289_687 | 132 |
| 760 | 3300039438 | Ga0436360_1290282 | Ga0436360_1290282_267_665 | 132 |
| 761 | 3300039447 | Ga0436361_0014203 | Ga0436361_0014203_829_1227 | 132 |
| 762 | 3300039447 | Ga0436361_0226768 | Ga0436361_0226768_191_589 | 132 |
| 763 | 3300039447 | Ga0436361_0257678 | Ga0436361_0257678_1490_1888 | 132 |
| 764 | 3300039447 | Ga0436361_0866004 | Ga0436361_0866004_764_1162 | 132 |
| 765 | 3300039447 | Ga0436361_0942051 | Ga0436361_0942051_201_599 | 132 |
| 766 | 3300039447 | Ga0436361_1025029 | Ga0436361_1025029_520_918 | 132 |
| 767 | 3300039450 | Ga0436363_0272908 | Ga0436363_0272908_666_1064 | 132 |
| 768 | 3300039450 | Ga0436363_0323271 | Ga0436363_0323271_1375_1773 | 132 |
| 769 | 3300039450 | Ga0436363_0746062 | Ga0436363_0746062_7190_7588 | 132 |
| 770 | 3300039450 | Ga0436363_0854883 | Ga0436363_0854883_267_680 | 132 |
| 771 | 3300039450 | Ga0436363_0858619 | Ga0436363_0858619_1154_1552 | 132 |
| 772 | 3300039450 | Ga0436363_0875430 | Ga0436363_0875430_563_961 | 132 |
| 773 | 3300039453 | Ga0436362_0006092 | Ga0436362_0006092_182_580 | 132 |
| 774 | 3300039453 | Ga0436362_0133577 | Ga0436362_0133577_732_1130 | 132 |
| 775 | 3300039453 | Ga0436362_0374465 | Ga0436362_0374465_46_444 | 132 |
| 776 | 3300039453 | Ga0436362_0531292 | Ga0436362_0531292_158_556 | 132 |
| 777 | 3300039453 | Ga0436362_0976116 | Ga0436362_0976116_7706_8104 | 132 |
| 778 | 3300039453 | Ga0436362_1087862 | Ga0436362_1087862_483_881 | 132 |
| 779 | 3300041411 | Ga0439466_0111000 | Ga0439466_0111000_368_766 | 132 |
| 780 | 3300041413 | Ga0439465_0027934 | Ga0439465_0027934_670_1068 | 132 |
| 781 | 3300041443 | Ga0451789_0503154 | Ga0451789_0503154_542_940 | 132 |
| 782 | 3300041451 | Ga0451791_0574419 | Ga0451791_0574419_258_656 | 132 |
| 783 | 3300041452 | Ga0451793_1391501 | Ga0451793_1391501_186_584 | 132 |
| 784 | 3300041486 | Ga0451807_0874557 | Ga0451807_0874557_40_438 | 132 |
| 785 | 3300041486 | Ga0451807_1450153 | Ga0451807_1450153_20_418 | 132 |
| 786 | 3300041486 | Ga0451807_2360578 | Ga0451807_2360578_249_647 | 132 |
| 787 | 3300041997 | Ga0439431_0026550 | Ga0439431_0026550_126_524 | 132 |
| 788 | 3300042004 | Ga0439445_0033332 | Ga0439445_0033332_806_1204 | 132 |
| 789 | 3300042004 | Ga0439445_0107527 | Ga0439445_0107527_318_716 | 132 |
| 790 | 3300042006 | Ga0439432_101817 | Ga0439432_101817_136_534 | 132 |
| 791 | 3300042010 | Ga0439452_119086 | Ga0439452_119086_94_492 | 132 |
| 792 | 3300042156 | Ga0439446_0178018 | Ga0439446_0178018_129_527 | 132 |
| 793 | 3300044842 | Ga0466957_0101786 | Ga0466957_0101786_616_1014 | 132 |
| 794 | 3300045049 | Ga0466959_0985704 | Ga0466959_0985704_121_519 | 132 |
| 795 | 3300045051 | Ga0451576_1431832 | Ga0451576_1431832_276_674 | 132 |
| 796 | 3300045051 | Ga0451576_2682197 | Ga0451576_2682197_85_483 | 132 |
| 797 | 3300046472 | Ga0495580_0003736 | Ga0495580_0003736_4566_4964 | 132 |
| 798 | 3300046472 | Ga0495580_0525162 | Ga0495580_0525162_379_777 | 132 |
| 799 | 3300046473 | Ga0495582_0043074 | Ga0495582_0043074_583_981 | 132 |
| 800 | 3300046492 | Ga0495585_0493876 | Ga0495585_0493876_128_526 | 132 |
| 801 | 3300046515 | Ga0495620_0037558 | Ga0495620_0037558_1105_1503 | 132 |
| 802 | 3300046517 | Ga0495630_0245501 | Ga0495630_0245501_516_914 | 132 |
| 803 | 3300046535 | Ga0495586_0405127 | Ga0495586_0405127_325_723 | 132 |
| 804 | 3300046537 | Ga0495598_0115737 | Ga0495598_0115737_353_751 | 132 |
| 805 | 3300046543 | Ga0495645_0086993 | Ga0495645_0086993_1700_2098 | 132 |
| 806 | 3300046543 | Ga0495645_0503183 | Ga0495645_0503183_34_432 | 132 |
| 807 | 3300046559 | Ga0495667_0950970 | Ga0495667_0950970_12_410 | 132 |
| 808 | 3300046616 | Ga0495668_0032584 | Ga0495668_0032584_1217_1615 | 132 |
| 809 | 3300046660 | Ga0495625_0315915 | Ga0495625_0315915_433_831 | 132 |
| 810 | 3300046683 | Ga0495658_0001492 | Ga0495658_0001492_8545_8943 | 132 |
| 811 | 3300046794 | Ga0495589_0426502 | Ga0495589_0426502_94_492 | 132 |
| 812 | 3300047315 | Ga0495581_0457221 | Ga0495581_0457221_313_711 | 132 |
| 813 | 3300047447 | Ga0495685_119544 | Ga0495685_119544_372_770 | 132 |
| 814 | 3300048903 | Ga0496100_0070642 | Ga0496100_0070642_694_1092 | 132 |
| 815 | 3300048903 | Ga0496100_0401356 | Ga0496100_0401356_583_981 | 132 |
| 816 | 3300048903 | Ga0496100_0959993 | Ga0496100_0959993_79_477 | 132 |
| 817 | 3300048904 | Ga0496101_0031523 | Ga0496101_0031523_1503_1901 | 132 |
| 818 | 3300048904 | Ga0496101_0498506 | Ga0496101_0498506_303_701 | 132 |
| 819 | 3300048905 | Ga0496102_0783859 | Ga0496102_0783859_360_758 | 132 |
| 820 | 3300048905 | Ga0496102_1056612 | Ga0496102_1056612_272_670 | 132 |
| 821 | 3300048906 | Ga0496103_0639786 | Ga0496103_0639786_30_428 | 132 |
| 822 | 3300048907 | Ga0496104_0050054 | Ga0496104_0050054_416_814 | 132 |
| 823 | 3300048907 | Ga0496104_0070384 | Ga0496104_0070384_52_450 | 132 |
| 824 | 3300048907 | Ga0496104_0822420 | Ga0496104_0822420_377_775 | 132 |
| 825 | 3300048907 | Ga0496104_0873644 | Ga0496104_0873644_27_425 | 132 |
| 826 | 3300048908 | Ga0496105_0005504 | Ga0496105_0005504_1956_2354 | 132 |
| 827 | 3300048908 | Ga0496105_0360202 | Ga0496105_0360202_715_1113 | 132 |
| 828 | 3300048908 | Ga0496105_0940634 | Ga0496105_0940634_224_622 | 132 |
| 829 | 3300048909 | Ga0496106_0186897 | Ga0496106_0186897_1083_1481 | 132 |
| 830 | 3300048910 | Ga0496107_0632702 | Ga0496107_0632702_303_701 | 132 |
| 831 | 3300048911 | Ga0496108_0137085 | Ga0496108_0137085_576_974 | 132 |
| 832 | 3300048911 | Ga0496108_0873310 | Ga0496108_0873310_365_763 | 132 |
| 833 | 3300048911 | Ga0496108_1114354 | Ga0496108_1114354_115_513 | 132 |
| 834 | 3300048911 | Ga0496108_1326975 | Ga0496108_1326975_40_438 | 132 |
| 835 | 3300048912 | Ga0496109_1360813 | Ga0496109_1360813_154_552 | 132 |
| 836 | 3300048913 | Ga0496110_0008141 | Ga0496110_0008141_3484_3882 | 132 |
| 837 | 3300048913 | Ga0496110_0213506 | Ga0496110_0213506_443_841 | 132 |
| 838 | 3300048913 | Ga0496110_0784872 | Ga0496110_0784872_284_682 | 132 |
| 839 | 3300048913 | Ga0496110_1080030 | Ga0496110_1080030_108_506 | 132 |
| 840 | 3300048914 | Ga0496111_0092518 | Ga0496111_0092518_147_545 | 132 |
| 841 | 3300048915 | Ga0496112_0034695 | Ga0496112_0034695_878_1276 | 132 |
| 842 | 3300048915 | Ga0496112_0572117 | Ga0496112_0572117_260_658 | 132 |
| 843 | 3300048915 | Ga0496112_0850217 | Ga0496112_0850217_58_456 | 132 |
| 844 | 3300048916 | Ga0496113_0004259 | Ga0496113_0004259_7291_7689 | 132 |
| 845 | 3300048917 | Ga0496114_0019003 | Ga0496114_0019003_1970_2368 | 132 |
| 846 | 3300048917 | Ga0496114_0108545 | Ga0496114_0108545_1436_1834 | 132 |
| 847 | 3300048917 | Ga0496114_0447658 | Ga0496114_0447658_139_537 | 132 |
| 848 | 3300048918 | Ga0496115_0009751 | Ga0496115_0009751_5540_5938 | 132 |
| 849 | 3300048918 | Ga0496115_0190979 | Ga0496115_0190979_1146_1544 | 132 |
| 850 | 3300048918 | Ga0496115_0361216 | Ga0496115_0361216_619_1017 | 132 |
| 851 | 3300048918 | Ga0496115_0570404 | Ga0496115_0570404_29_427 | 132 |
| 852 | 3300048919 | Ga0496116_0092732 | Ga0496116_0092732_697_1095 | 132 |
| 853 | 3300048920 | Ga0496117_0085746 | Ga0496117_0085746_1253_1651 | 132 |
| 854 | 3300048920 | Ga0496117_0115792 | Ga0496117_0115792_390_788 | 132 |
| 855 | 3300048920 | Ga0496117_0487386 | Ga0496117_0487386_64_462 | 132 |
| 856 | 3300048921 | Ga0496118_0101757 | Ga0496118_0101757_105_503 | 132 |
| 857 | 3300048921 | Ga0496118_0182585 | Ga0496118_0182585_204_602 | 132 |
| 858 | 3300048922 | Ga0496119_0004353 | Ga0496119_0004353_6474_6872 | 132 |
| 859 | 3300048922 | Ga0496119_0201215 | Ga0496119_0201215_597_995 | 132 |
| 860 | 3300048924 | Ga0496121_0082395 | Ga0496121_0082395_166_564 | 132 |
| 861 | 3300048924 | Ga0496121_0857690 | Ga0496121_0857690_106_504 | 132 |
| 862 | 3300048925 | Ga0496122_0019871 | Ga0496122_0019871_1321_1719 | 132 |
| 863 | 3300048926 | Ga0496123_0008564 | Ga0496123_0008564_7643_8041 | 132 |
| 864 | 3300048926 | Ga0496123_0073670 | Ga0496123_0073670_743_1141 | 132 |
| 865 | 3300048927 | Ga0496124_0536873 | Ga0496124_0536873_273_671 | 132 |
| 866 | 3300048928 | Ga0496125_0017448 | Ga0496125_0017448_196_594 | 132 |
| 867 | 3300048928 | Ga0496125_0259025 | Ga0496125_0259025_529_927 | 132 |
| 868 | 3300048929 | Ga0496126_0036822 | Ga0496126_0036822_3805_4203 | 132 |
| 869 | 3300048929 | Ga0496126_0365140 | Ga0496126_0365140_412_810 | 132 |
| 870 | 3300048929 | Ga0496126_0492443 | Ga0496126_0492443_97_495 | 132 |
| 871 | 3300048929 | Ga0496126_0667863 | Ga0496126_0667863_24_422 | 132 |
| 872 | 3300048929 | Ga0496126_0895552 | Ga0496126_0895552_39_437 | 132 |
| 873 | 3300049130 | Ga0501310_001976 | Ga0501310_001976_175_573 | 132 |
| 874 | 3300049161 | Ga0501305_000622 | Ga0501305_000622_2344_2742 | 132 |
| 875 | 3300049528 | Ga0501312_059336 | Ga0501312_059336_202_600 | 132 |
| 876 | 3300049530 | Ga0501314_004204 | Ga0501314_004204_713_1111 | 132 |
| 877 | 3300049534 | Ga0501318_060544 | Ga0501318_060544_153_551 | 132 |
| 878 | 3300049568 | Ga0501031_0133346 | Ga0501031_0133346_1084_1482 | 132 |
| 879 | 3300049569 | Ga0501032_0466394 | Ga0501032_0466394_397_795 | 132 |
| 880 | 3300049570 | Ga0501033_0112292 | Ga0501033_0112292_1040_1438 | 132 |
| 881 | 3300049570 | Ga0501033_0438034 | Ga0501033_0438034_465_863 | 132 |
| 882 | 3300049571 | Ga0501034_0069393 | Ga0501034_0069393_1880_2278 | 132 |
| 883 | 3300049571 | Ga0501034_0162397 | Ga0501034_0162397_1293_1691 | 132 |
| 884 | 3300049571 | Ga0501034_0929568 | Ga0501034_0929568_31_429 | 132 |
| 885 | 3300049571 | Ga0501034_0992470 | Ga0501034_0992470_186_584 | 132 |
| 886 | 3300049572 | Ga0501036_0027081 | Ga0501036_0027081_4211_4609 | 132 |
| 887 | 3300049572 | Ga0501036_0827783 | Ga0501036_0827783_11_409 | 132 |
| 888 | 3300049573 | Ga0501037_0069329 | Ga0501037_0069329_1507_1905 | 132 |
| 889 | 3300049573 | Ga0501037_0218316 | Ga0501037_0218316_631_1029 | 132 |
| 890 | 3300049573 | Ga0501037_0267468 | Ga0501037_0267468_94_492 | 132 |
| 891 | 3300049574 | Ga0501038_0164752 | Ga0501038_0164752_489_887 | 132 |
| 892 | 3300049574 | Ga0501038_0250905 | Ga0501038_0250905_875_1273 | 132 |
| 893 | 3300049575 | Ga0501039_0388403 | Ga0501039_0388403_371_769 | 132 |
| 894 | 3300049577 | Ga0501041_0270794 | Ga0501041_0270794_61_459 | 132 |
| 895 | 3300049578 | Ga0501042_0069464 | Ga0501042_0069464_1023_1421 | 132 |
| 896 | 3300049578 | Ga0501042_0483421 | Ga0501042_0483421_80_478 | 132 |
| 897 | 3300049579 | Ga0501043_0247928 | Ga0501043_0247928_277_675 | 132 |
| 898 | 3300049579 | Ga0501043_0594668 | Ga0501043_0594668_24_422 | 132 |
| 899 | 3300049579 | Ga0501043_0648365 | Ga0501043_0648365_216_614 | 132 |
| 900 | 3300049580 | Ga0501046_0496547 | Ga0501046_0496547_163_561 | 132 |
| 901 | 3300049581 | Ga0501047_0120081 | Ga0501047_0120081_966_1364 | 132 |
| 902 | 3300049581 | Ga0501047_0573237 | Ga0501047_0573237_311_709 | 132 |
| 903 | 3300049581 | Ga0501047_1161746 | Ga0501047_1161746_159_557 | 132 |
| 904 | 3300049582 | Ga0501048_0093666 | Ga0501048_0093666_194_592 | 132 |
| 905 | 3300049583 | Ga0501067_0017088 | Ga0501067_0017088_748_1146 | 132 |
| 906 | 3300049585 | Ga0501069_0742325 | Ga0501069_0742325_56_454 | 132 |
| 907 | 3300049586 | Ga0501070_0031071 | Ga0501070_0031071_3729_4127 | 132 |
| 908 | 3300049587 | Ga0501071_0136426 | Ga0501071_0136426_429_827 | 132 |
| 909 | 3300049589 | Ga0501073_0069855 | Ga0501073_0069855_1296_1694 | 132 |
| 910 | 3300049589 | Ga0501073_0095338 | Ga0501073_0095338_413_811 | 132 |
| 911 | 3300049590 | Ga0501074_0424223 | Ga0501074_0424223_449_847 | 132 |
| 912 | 3300049592 | Ga0501076_0043955 | Ga0501076_0043955_2273_2671 | 132 |
| 913 | 3300049593 | Ga0501077_0270029 | Ga0501077_0270029_573_971 | 132 |
| 914 | 3300049593 | Ga0501077_0750432 | Ga0501077_0750432_145_543 | 132 |
| 915 | 3300049708 | Ga0501245_066611 | Ga0501245_066611_113_511 | 132 |
| 916 | 3300049741 | Ga0501079_0378369 | Ga0501079_0378369_295_693 | 132 |
| 917 | 3300049743 | Ga0501081_0174979 | Ga0501081_0174979_814_1212 | 132 |
| 918 | 3300049744 | Ga0501083_0263204 | Ga0501083_0263204_617_1015 | 132 |
| 919 | 3300049744 | Ga0501083_0842544 | Ga0501083_0842544_155_553 | 132 |
| 920 | 3300049744 | Ga0501083_0900677 | Ga0501083_0900677_119_517 | 132 |
| 921 | 3300049822 | Ga0501035_0216953 | Ga0501035_0216953_278_676 | 132 |
| 922 | 3300049823 | Ga0501044_0073393 | Ga0501044_0073393_1302_1700 | 132 |
| 923 | 3300049823 | Ga0501044_0254098 | Ga0501044_0254098_511_909 | 132 |
| 924 | 3300049823 | Ga0501044_0852389 | Ga0501044_0852389_161_559 | 132 |
| 925 | 3300049824 | Ga0501045_0528708 | Ga0501045_0528708_298_696 | 132 |
| 926 | 3300050489 | nmdc:mga03683_134374_c1 | nmdc:mga03683_134374_c1_28_426 | 132 |
| 927 | 3300050491 | nmdc:mga00v17_533473_c1 | nmdc:mga00v17_533473_c1_184_582 | 132 |
| 928 | 3300050493 | nmdc:mga0k408_404010_c1 | nmdc:mga0k408_404010_c1_227_625 | 132 |
| 929 | 3300050494 | nmdc:mga06z11_8708_c1 | nmdc:mga06z11_8708_c1_2636_3034 | 132 |
| 930 | 3300050495 | nmdc:mga04h51_87027_c1 | nmdc:mga04h51_87027_c1_89_487 | 132 |
| 931 | 3300050496 | nmdc:mga07m45_111300_c1 | nmdc:mga07m45_111300_c1_383_781 | 132 |
| 932 | 3300050496 | nmdc:mga07m45_69479_c1 | nmdc:mga07m45_69479_c1_290_688 | 132 |
| 933 | 3300050508 | nmdc:mga09592_293602_c1 | nmdc:mga09592_293602_c1_402_800 | 132 |
| 934 | 3300050511 | nmdc:mga08y16_273468_c1 | nmdc:mga08y16_273468_c1_1181_1579 | 132 |
| 935 | 3300050513 | nmdc:mga0rr50_349300_c1 | nmdc:mga0rr50_349300_c1_286_684 | 132 |
| 936 | 3300050514 | nmdc:mga08x19_23_c1 | nmdc:mga08x19_23_c1_109308_109706 | 132 |
| 937 | 3300050516 | nmdc:mga0sz30_13902_c1 | nmdc:mga0sz30_13902_c1_673_1071 | 132 |
| 938 | 3300050516 | nmdc:mga0sz30_217246_c1 | nmdc:mga0sz30_217246_c1_399_797 | 132 |
| 939 | 3300050516 | nmdc:mga0sz30_513372_c1 | nmdc:mga0sz30_513372_c1_121_519 | 132 |
| 940 | 3300053077 | Ga0495601_0370475 | Ga0495601_0370475_73_471 | 132 |
| 941 | 3300053077 | Ga0495601_0722566 | Ga0495601_0722566_20_418 | 132 |
| 942 | 3300053083 | Ga0495655_0232202 | Ga0495655_0232202_134_532 | 132 |
| 943 | 3300053085 | Ga0495619_0157287 | Ga0495619_0157287_670_1068 | 132 |
| 944 | 3300053119 | Ga0500595_026114 | Ga0500595_026114_224_622 | 132 |
| 945 | 3300053120 | Ga0500597_069668 | Ga0500597_069668_995_1393 | 132 |
| 946 | 3300053122 | Ga0500608_271920 | Ga0500608_271920_229_627 | 132 |
| 947 | 3300053122 | Ga0500608_341468 | Ga0500608_341468_31_429 | 132 |
| 948 | 3300053125 | Ga0500618_007381 | Ga0500618_007381_639_1037 | 132 |
| 949 | 3300053139 | Ga0500568_0000001 | Ga0500568_0000001_7924_8322 | 132 |
| 950 | 3300054114 | Ga0501084_0071192 | Ga0501084_0071192_1914_2312 | 132 |
| 951 | 3300059477 | Ga0587084_004230 | Ga0587084_004230_532_930 | 132 |
| 952 | 3300059478 | Ga0587093_070248 | Ga0587093_070248_79_477 | 132 |
| 953 | 3300059490 | Ga0587066_032047 | Ga0587066_032047_230_628 | 132 |
| 954 | 3300059491 | Ga0587070_195014 | Ga0587070_195014_56_454 | 132 |
| 955 | 3300059492 | Ga0587073_0066125 | Ga0587073_0066125_308_706 | 132 |
| 956 | 3300059492 | Ga0587073_0098652 | Ga0587073_0098652_328_726 | 132 |
| 957 | 3300059493 | Ga0587077_026408 | Ga0587077_026408_594_992 | 132 |
| 958 | 3300059493 | Ga0587077_029785 | Ga0587077_029785_455_853 | 132 |
| 959 | 3300059493 | Ga0587077_078087 | Ga0587077_078087_285_683 | 132 |
| 960 | 3300059503 | Ga0587080_175963 | Ga0587080_175963_56_454 | 132 |
| 961 | 3300059505 | Ga0587083_0040993 | Ga0587083_0040993_435_833 | 132 |
| 962 | 3300059507 | Ga0587086_098783 | Ga0587086_098783_110_508 | 132 |
| 963 | 3300059508 | Ga0587088_006338 | Ga0587088_006338_293_691 | 132 |
| 964 | 3300059513 | Ga0587094_075067 | Ga0587094_075067_97_495 | 132 |
| 965 | 3300059607 | Ga0587125_015896 | Ga0587125_015896_176_574 | 132 |
| 966 | 3300059624 | Ga0587109_062772 | Ga0587109_062772_73_471 | 132 |
| 967 | 3300059624 | Ga0587109_072081 | Ga0587109_072081_59_457 | 132 |
| 968 | 3300059640 | Ga0587067_100553 | Ga0587067_100553_81_479 | 132 |
| 969 | 3300059641 | Ga0587068_000630 | Ga0587068_000630_911_1309 | 132 |
| 970 | 3300059641 | Ga0587068_004293 | Ga0587068_004293_1169_1567 | 132 |
| 971 | 3300059641 | Ga0587068_081954 | Ga0587068_081954_153_551 | 132 |
| 972 | 3300059642 | Ga0587069_011022 | Ga0587069_011022_766_1164 | 132 |
| 973 | 3300059642 | Ga0587069_052056 | Ga0587069_052056_103_501 | 132 |
| 974 | 3300059642 | Ga0587069_107552 | Ga0587069_107552_112_510 | 132 |
| 975 | 3300059643 | Ga0587072_115279 | Ga0587072_115279_121_519 | 132 |
| 976 | 3300059643 | Ga0587072_148066 | Ga0587072_148066_59_457 | 132 |
| 977 | 3300059644 | Ga0587075_026000 | Ga0587075_026000_430_828 | 132 |
| 978 | 3300059645 | Ga0587076_004307 | Ga0587076_004307_435_833 | 132 |
| 979 | 3300059647 | Ga0587079_002261 | Ga0587079_002261_609_1007 | 132 |
| 980 | 3300059647 | Ga0587079_039403 | Ga0587079_039403_388_786 | 132 |
| 981 | 3300059649 | Ga0587102_064664 | Ga0587102_064664_60_458 | 132 |
| 982 | 3300059651 | Ga0587105_005731 | Ga0587105_005731_290_688 | 132 |
| 983 | 3300059652 | Ga0587107_076157 | Ga0587107_076157_117_515 | 132 |
| 984 | 3300059659 | Ga0587120_009008 | Ga0587120_009008_113_511 | 132 |
| 985 | 3300060346 | Ga0587111_0027932 | Ga0587111_0027932_337_735 | 132 |
| 986 | 3300060346 | Ga0587111_0153195 | Ga0587111_0153195_39_437 | 132 |
| 987 | 3300060353 | Ga0501082_0169846 | Ga0501082_0169846_913_1311 | 132 |
| 988 | 3300060353 | Ga0501082_0656848 | Ga0501082_0656848_81_479 | 132 |
| 989 | 3300061719 | Ga0466962_0527708 | Ga0466962_0527708_131_529 | 132 |
| 990 | 3300061734 | Ga0530510_0283408 | Ga0530510_0283408_380_778 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m4u-assembly1.cif.gz_h | a. baumannii ribosome-eravacycline complex: 30s | 0.9751 | 2 | 132 |
| 7unu-assembly1.cif.gz_h | pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) | 0.9745 | 2 | 132 |
| 4pdb-assembly1.cif.gz_A | crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer | 0.9722 | 4 | 132 |
| 7nhn-assembly1.cif.gz_i | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.969 | 5 | 132 |
| 5uyl-assembly1.cif.gz_H | 70s ribosome bound with cognate ternary complex base-paired to a site codon (structure ii) | 0.968 | 2 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9794 | 75 | 132 | 3.30.1490.10 |
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9773 | 75 | 132 | 3.30.1490.10 |
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9632 | 75 | 132 | 3.30.1490.10 |
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9611 | 75 | 132 | 3.30.1490.10 |
| 3ofbH01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.9486 | 5 | 73 | 3.30.1370.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S3PYM4-F1-model_v4 | Small ribosomal subunit protein uS8 | 1.002 | 5 | 132 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E3V9H6-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9993 | 63 | 132 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1Q6ZZ57-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9975 | 65 | 132 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A3C1PTI8-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9956 | 64 | 132 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A435JWK2-F1-model_v4 | deleted | 0.9953 | 63 | 132 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar