F487398

General Info

Members Datasets Scaffolds Average Seq Length
981 444 961 103

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1182555|Ga0436361_1182555_100_483
Length 127
Sequence MPAQGVLSVSRTRFPHTPVTMDSFYKYHVFFCLNQRDPGADRPSCANCNAQAMQEYAKKRVKQLGLAGPGQVHINKAGCLDRCEEGPAVVVYPEGTWYTYIDESDIDEIVVSHLQNGQVVERLKIDR

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
6 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
10 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
11 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
12 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
13 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
14 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
15 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
16 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
17 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
18 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
19 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
27 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
150 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
216 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
237 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
248 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
249 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
250 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
252 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
253 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
254 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
255 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
256 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
257 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
259 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
265 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
266 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
269 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
270 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
271 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
272 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
273 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
277 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
278 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
279 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
280 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
281 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
282 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
287 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
290 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
291 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
292 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
293 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
294 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
295 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
296 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
297 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
298 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
299 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
300 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
301 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
302 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
303 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
304 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
305 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
306 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
307 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
308 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
309 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
313 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
314 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
315 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
318 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
319 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
323 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
324 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
325 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
326 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
327 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
328 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
329 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
330 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
334 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
338 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
339 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
340 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
341 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
346 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
355 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
356 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
357 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
360 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
363 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
367 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
368 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
372 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
373 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
376 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
377 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
378 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
379 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
380 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
381 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
382 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
383 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
384 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
385 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
397 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
398 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
399 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
400 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
401 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
402 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
403 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
404 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
405 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
406 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
407 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
408 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
409 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
410 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
411 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
412 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
413 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
414 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
415 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
416 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
417 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
418 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
419 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
423 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
424 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
425 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
426 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
427 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
428 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
429 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
430 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
431 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
432 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
433 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
434 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
435 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
436 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
437 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
438 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
439 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
444 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 0.41
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0.92
Rhizoplane 1.94
Rhizosphere 92.66
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10090089 3300001989 Bacteria 934
2 JGI24737J22298_10235586 3300001990 Bacteria 540
3 JGI25156J39149_1052173 3300002705 Bacteria 534
4 rootH1_10054400 3300003316 Bacteria 2871
5 rootL2_10349020 3300003322 Bacteria 1136
6 rootH1_10132885 3300003316 Bacteria 1512
7 rootH1_10132885 3300003323 Bacteria 4122
8 Ga0055527_1002500 3300003760 Bacteria 3093
9 Ga0055535_1004905 3300003761 Bacteria 3093
10 Ga0055542_1035846 3300003762 Bacteria 608
11 Ga0055529_1026361 3300003763 Bacteria 717
12 Ga0055526_1000149 3300003771 Bacteria 61682
13 Ga0065707_10603957 3300005295 Bacteria 688
14 Ga0070658_10065736 3300005327 Bacteria 2961
15 Ga0070676_10001435 3300005328 Bacteria 12035
16 Ga0070676_10247279 3300005328 Bacteria 1189
17 Ga0070676_10321729 3300005328 Bacteria 1055
18 Ga0070676_10331220 3300005328 Bacteria 1041
19 Ga0070683_100069027 3300005329 Bacteria 3294
20 Ga0070690_100776109 3300005330 Bacteria 742
21 Ga0070670_100003563 3300005331 Bacteria 12943
22 Ga0070670_100010188 3300005331 Bacteria 8021
23 Ga0070670_100039316 3300005331 Bacteria 4068
24 Ga0070670_100136031 3300005331 Bacteria 2124
25 Ga0070670_100261144 3300005331 Bacteria 1510
26 Ga0070670_100332215 3300005331 Bacteria 1333
27 Ga0070670_100750698 3300005331 Unclassified 879
28 Ga0070677_10000343 3300005333 Bacteria 16239
29 Ga0068869_100009083 3300005334 Bacteria 6441
30 Ga0068869_100039879 3300005334 Bacteria 3355
31 Ga0068869_101066159 3300005334 Bacteria 706
32 Ga0070666_10530612 3300005335 Unclassified 855
33 Ga0070680_100047758 3300005336 Bacteria 3486
34 Ga0070682_101119016 3300005337 Bacteria 660
35 Ga0068868_100015555 3300005338 Bacteria 5630
36 Ga0068868_100205658 3300005338 Bacteria 1643
37 Ga0068868_101003437 3300005338 Bacteria 764
38 Ga0070689_100044203 3300005340 Bacteria 3426
39 Ga0070689_100233871 3300005340 Bacteria 1511
40 Ga0070689_100372085 3300005340 Bacteria 1202
41 Ga0070689_100494696 3300005340 Bacteria 1047
42 Ga0070689_100797461 3300005340 Unclassified 830
43 Ga0070687_100105981 3300005343 Bacteria 1583
44 Ga0070661_101770516 3300005344 Bacteria 524
45 Ga0070692_10007318 3300005345 Bacteria 4859
46 Ga0070692_10042581 3300005345 Bacteria 2332
47 Ga0070692_10050336 3300005345 Bacteria 2163
48 Ga0070692_10378737 3300005345 Bacteria 887
49 Ga0070668_100006797 3300005347 Bacteria 8481
50 Ga0070668_100010955 3300005347 Bacteria 6747
51 Ga0070668_100025704 3300005347 Bacteria 4466
52 Ga0070668_100027239 3300005347 Bacteria 4339
53 Ga0070668_100110179 3300005347 Bacteria 2190
54 Ga0070668_100259447 3300005347 Bacteria 1445
55 Ga0070668_100274145 3300005347 Bacteria 1407
56 Ga0070668_100638347 3300005347 Bacteria 935
57 Ga0070668_101861703 3300005347 Bacteria 554
58 Ga0070669_100002973 3300005353 Bacteria 12215
59 Ga0070669_100021805 3300005353 Bacteria 4580
60 Ga0070669_100251345 3300005353 Bacteria 1408
61 Ga0070675_100003678 3300005354 Bacteria 11653
62 Ga0070675_100012472 3300005354 Bacteria 6659
63 Ga0070675_100024736 3300005354 Bacteria 4809
64 Ga0070675_100027916 3300005354 Bacteria 4538
65 Ga0070675_100029547 3300005354 Bacteria 4422
66 Ga0070675_100283993 3300005354 Bacteria 1455
67 Ga0070671_100000272 3300005355 Bacteria 34885
68 Ga0070671_100008199 3300005355 Bacteria 8360
69 Ga0070671_100270159 3300005355 Bacteria 1445
70 Ga0070671_102058122 3300005355 Unclassified 508
71 Ga0070674_100005249 3300005356 Bacteria 7458
72 Ga0070674_100034622 3300005356 Bacteria 3375
73 Ga0070674_101500840 3300005356 Unclassified 606
74 Ga0070673_100001140 3300005364 Bacteria 15254
75 Ga0070673_100026294 3300005364 Bacteria 4297
76 Ga0070673_100072629 3300005364 Bacteria 2767
77 Ga0070673_100121931 3300005364 Unclassified 2176
78 Ga0070688_100354713 3300005365 Bacteria 1075
79 Ga0070688_101516301 3300005365 Bacteria 546
80 Ga0070659_100083041 3300005366 Bacteria 2560
81 Ga0070659_101152340 3300005366 Bacteria 684
82 Ga0070667_100052861 3300005367 Bacteria 3428
83 Ga0070667_100140760 3300005367 Bacteria 2113
84 Ga0070667_100634378 3300005367 Bacteria 986
85 Ga0070703_10044843 3300005406 Bacteria 1392
86 Ga0070714_102010201 3300005435 Bacteria 564
87 Ga0070713_100225309 3300005436 Bacteria 1702
88 Ga0070701_10121258 3300005438 Bacteria 1473
89 Ga0070701_10201152 3300005438 Bacteria 1178
90 Ga0070705_100016156 3300005440 Bacteria 3874
91 Ga0070705_100020022 3300005440 Bacteria 3532
92 Ga0070705_100036344 3300005440 Bacteria 2769
93 Ga0070705_100115744 3300005440 Bacteria 1722
94 Ga0070700_100001031 3300005441 Bacteria 13767
95 Ga0070700_100268752 3300005441 Bacteria 1231
96 Ga0070700_100285341 3300005441 Unclassified 1199
97 Ga0070700_100306351 3300005441 Bacteria 1161
98 Ga0070700_100365933 3300005441 Bacteria 1073
99 Ga0070694_100028846 3300005444 Bacteria 3615
100 Ga0070694_100040671 3300005444 Bacteria 3099
101 Ga0070694_100067401 3300005444 Bacteria 2457
102 Ga0070694_100502819 3300005444 Bacteria 965
103 Ga0070694_100809555 3300005444 Bacteria 769
104 Ga0070663_100001918 3300005455 Bacteria 11608
105 Ga0070663_100027027 3300005455 Bacteria 3892
106 Ga0070678_100085002 3300005456 Bacteria 2410
107 Ga0070678_100098340 3300005456 Bacteria 2262
108 Ga0070678_100184096 3300005456 Bacteria 1712
109 Ga0070678_101195126 3300005456 Bacteria 705
110 Ga0070662_100014326 3300005457 Bacteria 5295
111 Ga0070662_100374375 3300005457 Bacteria 1171
112 Ga0070662_101068537 3300005457 Bacteria 692
113 Ga0070681_10004336 3300005458 Bacteria 13482
114 Ga0070681_10232956 3300005458 Bacteria 1756
115 Ga0070681_10685450 3300005458 Bacteria 940
116 Ga0068867_100002138 3300005459 Bacteria 13877
117 Ga0068867_100012234 3300005459 Bacteria 6065
118 Ga0068867_100083659 3300005459 Bacteria 2409
119 Ga0068867_100119410 3300005459 Bacteria 2035
120 Ga0068867_100484352 3300005459 Bacteria 1060
121 Ga0068867_100653289 3300005459 Bacteria 923
122 Ga0070685_10191559 3300005466 Bacteria 1323
123 Ga0070706_100169581 3300005467 Bacteria 2038
124 Ga0070707_100796182 3300005468 Bacteria 909
125 Ga0070698_100271956 3300005471 Bacteria 1626
126 Ga0070698_100702411 3300005471 Bacteria 953
127 Ga0070698_100770047 3300005471 Bacteria 906
128 Ga0070699_101378827 3300005518 Bacteria 647
129 Ga0070679_100449119 3300005530 Bacteria 1234
130 Ga0070679_100778638 3300005530 Bacteria 900
131 Ga0070679_101976911 3300005530 Bacteria 532
132 Ga0070684_100848038 3300005535 Bacteria 855
133 Ga0070697_100033084 3300005536 Bacteria 4163
134 Ga0068853_100004289 3300005539 Bacteria 11022
135 Ga0068853_100388817 3300005539 Bacteria 1304
136 Ga0068853_101408921 3300005539 Bacteria 674
137 Ga0070672_100054860 3300005543 Bacteria 3121
138 Ga0070672_100088452 3300005543 Bacteria 2494
139 Ga0070672_100143722 3300005543 Bacteria 1970
140 Ga0070672_100250812 3300005543 Bacteria 1491
141 Ga0070672_100258234 3300005543 Unclassified 1469
142 Ga0070672_100514592 3300005543 Bacteria 1036
143 Ga0070672_100580341 3300005543 Bacteria 975
144 Ga0070672_101403050 3300005543 Bacteria 625
145 Ga0070672_101659165 3300005543 Bacteria 574
146 Ga0070686_100073813 3300005544 Bacteria 2240
147 Ga0070686_100643806 3300005544 Unclassified 840
148 Ga0070695_100000362 3300005545 Bacteria 23307
149 Ga0070695_100041788 3300005545 Bacteria 2908
150 Ga0070695_100200820 3300005545 Bacteria 1425
151 Ga0070695_100334984 3300005545 Bacteria 1129
152 Ga0070695_100394208 3300005545 Bacteria 1048
153 Ga0070695_100634511 3300005545 Bacteria 842
154 Ga0070696_100000505 3300005546 Bacteria 24609
155 Ga0070696_100053479 3300005546 Bacteria 2811
156 Ga0070696_100161151 3300005546 Bacteria 1653
157 Ga0070696_100196947 3300005546 Bacteria 1502
158 Ga0070696_100421529 3300005546 Bacteria 1048
159 Ga0070696_101117185 3300005546 Bacteria 663
160 Ga0070696_102012307 3300005546 Bacteria 502
161 Ga0070693_100140515 3300005547 Bacteria 1520
162 Ga0070693_100578294 3300005547 Bacteria 808
163 Ga0070693_100595189 3300005547 Bacteria 798
164 Ga0070693_101221868 3300005547 Bacteria 578
165 Ga0070665_100142453 3300005548 Bacteria 2400
166 Ga0070665_100142944 3300005548 Bacteria 2396
167 Ga0070665_100172776 3300005548 Bacteria 2162
168 Ga0070665_100504639 3300005548 Bacteria 1221
169 Ga0070665_100648163 3300005548 Bacteria 1069
170 Ga0070665_100832906 3300005548 Unclassified 936
171 Ga0070704_100016021 3300005549 Bacteria 4726
172 Ga0070704_101142662 3300005549 Bacteria 709
173 Ga0070704_102207376 3300005549 Bacteria 512
174 Ga0068855_100511907 3300005563 Bacteria 1303
175 Ga0068855_101961287 3300005563 Bacteria 592
176 Ga0068855_102032307 3300005563 Bacteria 580
177 Ga0070664_100036137 3300005564 Bacteria 4150
178 Ga0070664_100439196 3300005564 Bacteria 1197
179 Ga0070664_100987814 3300005564 Bacteria 791
180 Ga0068857_100978731 3300005577 Bacteria 814
181 Ga0068857_101698472 3300005577 Unclassified 617
182 Ga0068854_100084706 3300005578 Bacteria 2346
183 Ga0068854_100366708 3300005578 Bacteria 1183
184 Ga0068854_100470663 3300005578 Bacteria 1053
185 Ga0068854_100484517 3300005578 Bacteria 1039
186 Ga0068856_100144536 3300005614 Bacteria 2386
187 Ga0068856_100338379 3300005614 Bacteria 1523
188 Ga0070702_100008243 3300005615 Bacteria 5036
189 Ga0070702_100138509 3300005615 Bacteria 1547
190 Ga0070702_100179160 3300005615 Bacteria 1385
191 Ga0070702_100348826 3300005615 Bacteria 1042
192 Ga0070702_100463840 3300005615 Bacteria 922
193 Ga0070702_100583979 3300005615 Bacteria 835
194 Ga0068852_100002156 3300005616 Bacteria 13522
195 Ga0068852_101755589 3300005616 Bacteria 643
196 Ga0068859_100024361 3300005617 Bacteria 6072
197 Ga0068859_100680431 3300005617 Bacteria 1120
198 Ga0068859_101040905 3300005617 Unclassified 899
199 Ga0068859_102056068 3300005617 Bacteria 631
200 Ga0068859_102283931 3300005617 Bacteria 597
201 Ga0068859_102341637 3300005617 Bacteria 589
202 Ga0068859_103146018 3300005617 Bacteria 503
203 Ga0068864_100034508 3300005618 Bacteria 4303
204 Ga0068864_100035655 3300005618 Bacteria 4236
205 Ga0068864_100062455 3300005618 Bacteria 3227
206 Ga0068864_100155302 3300005618 Bacteria 2076
207 Ga0068864_100176547 3300005618 Bacteria 1951
208 Ga0068864_101331595 3300005618 Bacteria 719
209 Ga0068866_10321836 3300005718 Bacteria 973
210 Ga0068866_10418662 3300005718 Bacteria 868
211 Ga0068861_100001104 3300005719 Bacteria 16728
212 Ga0068861_100086738 3300005719 Bacteria 2461
213 Ga0068861_100210631 3300005719 Bacteria 1637
214 Ga0068861_100242385 3300005719 Bacteria 1534
215 Ga0068861_100336369 3300005719 Bacteria 1320
216 Ga0068861_100715396 3300005719 Bacteria 932
217 Ga0068861_100793843 3300005719 Bacteria 888
218 Ga0068861_101379962 3300005719 Unclassified 688
219 Ga0068851_10001153 3300005834 Bacteria 11457
220 Ga0068851_10620193 3300005834 Bacteria 660
221 Ga0068851_10979707 3300005834 Bacteria 533
222 Ga0068870_10020819 3300005840 Bacteria 3200
223 Ga0068870_10058629 3300005840 Bacteria 2061
224 Ga0068870_10063872 3300005840 Bacteria 1987
225 Ga0068870_10072546 3300005840 Bacteria 1881
226 Ga0068870_10176719 3300005840 Bacteria 1278
227 Ga0068863_100019911 3300005841 Bacteria 6418
228 Ga0068863_100020923 3300005841 Bacteria 6248
229 Ga0068863_100037554 3300005841 Bacteria 4611
230 Ga0068863_100279781 3300005841 Bacteria 1616
231 Ga0068863_100577917 3300005841 Bacteria 1111
232 Ga0068858_100014384 3300005842 Bacteria 7460
233 Ga0068858_100820756 3300005842 Bacteria 908
234 Ga0068858_100908099 3300005842 Bacteria 861
235 Ga0068860_100074707 3300005843 Bacteria 3224
236 Ga0068860_100115727 3300005843 Bacteria 2564
237 Ga0068860_100626423 3300005843 Unclassified 1082
238 Ga0068860_100630676 3300005843 Bacteria 1079
239 Ga0068862_100001798 3300005844 Bacteria 19403
240 Ga0068862_100093345 3300005844 Bacteria 2624
241 Ga0068862_100169713 3300005844 Bacteria 1953
242 Ga0068862_100201451 3300005844 Bacteria 1795
243 Ga0068862_100418843 3300005844 Bacteria 1256
244 Ga0068862_100611945 3300005844 Bacteria 1047
245 Ga0068862_101069913 3300005844 Bacteria 800
246 Ga0070715_10714684 3300006163 Bacteria 600
247 Ga0070716_100247135 3300006173 Bacteria 1213
248 Ga0070716_100453044 3300006173 Bacteria 936
249 Ga0075366_10567510 3300006195 Bacteria 703
250 Ga0075366_10867145 3300006195 Bacteria 562
251 Ga0097621_100013711 3300006237 Bacteria 6051
252 Ga0097621_100014830 3300006237 Bacteria 5845
253 Ga0097621_100116903 3300006237 Bacteria 2259
254 Ga0097621_101322934 3300006237 Bacteria 681
255 Ga0068871_100028272 3300006358 Bacteria 4395
256 Ga0068871_100444041 3300006358 Bacteria 1162
257 Ga0068871_100647272 3300006358 Bacteria 965
258 Ga0068871_100964219 3300006358 Bacteria 793
259 Ga0068871_100994484 3300006358 Bacteria 781
260 Ga0068871_101823323 3300006358 Bacteria 578
261 Ga0075428_100139214 3300006844 Bacteria 2638
262 Ga0075428_100782575 3300006844 Bacteria 1014
263 Ga0075428_101258707 3300006844 Bacteria 779
264 Ga0075430_100003340 3300006846 Bacteria 13437
265 Ga0075430_100626827 3300006846 Bacteria 887
266 Ga0075430_101410397 3300006846 Bacteria 572
267 Ga0075430_101444695 3300006846 Bacteria 565
268 Ga0075431_100146664 3300006847 Bacteria 2432
269 Ga0075431_100752966 3300006847 Bacteria 949
270 Ga0075433_10231742 3300006852 Bacteria 1640
271 Ga0075433_10255444 3300006852 Bacteria 1554
272 Ga0075434_100100901 3300006871 Bacteria 2892
273 Ga0075434_100697291 3300006871 Bacteria 1033
274 Ga0075434_102366301 3300006871 Bacteria 533
275 Ga0075429_100003041 3300006880 Bacteria 14216
276 Ga0068865_100026154 3300006881 Unclassified 3845
277 Ga0068865_100028722 3300006881 Bacteria 3683
278 Ga0068865_100032078 3300006881 Bacteria 3507
279 Ga0075436_100005116 3300006914 Bacteria 9027
280 Ga0075436_100008567 3300006914 Bacteria 6989
281 Ga0075436_100014985 3300006914 Bacteria 5315
282 Ga0075436_100023095 3300006914 Bacteria 4271
283 Ga0075436_100027380 3300006914 Bacteria 3923
284 Ga0097620_100024361 3300006931 Bacteria 6072
285 Ga0097620_100680472 3300006931 Bacteria 1120
286 Ga0097620_101040940 3300006931 Unclassified 899
287 Ga0097620_102055846 3300006931 Bacteria 631
288 Ga0097620_102283865 3300006931 Bacteria 597
289 Ga0097620_102342153 3300006931 Bacteria 589
290 Ga0097620_103143761 3300006931 Bacteria 503
291 Ga0075435_100048639 3300007076 Bacteria 3407
292 Ga0075435_100153380 3300007076 Bacteria 1938
293 Ga0075435_100441910 3300007076 Bacteria 1121
294 Ga0075435_100500327 3300007076 Bacteria 1051
295 Ga0075435_101044791 3300007076 Bacteria 714
296 Ga0075435_101235768 3300007076 Bacteria 654
297 Ga0099794_10192190 3300007265 Bacteria 1044
298 Ga0105244_10001943 3300009036 Bacteria 16050
299 Ga0111539_10068982 3300009094 Bacteria 4175
300 Ga0111539_10169101 3300009094 Bacteria 2554
301 Ga0111539_10207000 3300009094 Bacteria 2287
302 Ga0111539_10241710 3300009094 Bacteria 2102
303 Ga0111539_10764449 3300009094 Bacteria 1124
304 Ga0111539_11322971 3300009094 Bacteria 836
305 Ga0111539_11333324 3300009094 Bacteria 833
306 Ga0111539_12071521 3300009094 Bacteria 660
307 Ga0105245_10024073 3300009098 Bacteria 5346
308 Ga0105245_10024841 3300009098 Bacteria 5265
309 Ga0105245_10439406 3300009098 Bacteria 1311
310 Ga0105245_10536860 3300009098 Bacteria 1190
311 Ga0105245_11322382 3300009098 Bacteria 770
312 Ga0105245_12026452 3300009098 Bacteria 629
313 Ga0105247_10005196 3300009101 Bacteria 8231
314 Ga0105247_10777281 3300009101 Bacteria 728
315 Ga0114129_10281193 3300009147 Bacteria 2223
316 Ga0114129_11355901 3300009147 Bacteria 879
317 Ga0114129_12654672 3300009147 Bacteria 597
318 Ga0105243_10002425 3300009148 Bacteria 15590
319 Ga0105243_10171534 3300009148 Bacteria 1879
320 Ga0105241_10742711 3300009174 Bacteria 899
321 Ga0105241_11874651 3300009174 Bacteria 587
322 Ga0105242_10006248 3300009176 Bacteria 9176
323 Ga0105242_10196669 3300009176 Bacteria 1788
324 Ga0105242_10305091 3300009176 Bacteria 1454
325 Ga0105242_10429105 3300009176 Bacteria 1240
326 Ga0105248_10000992 3300009177 Bacteria 31434
327 Ga0105248_10088473 3300009177 Bacteria 3486
328 Ga0105248_10341517 3300009177 Bacteria 1686
329 Ga0105248_10681694 3300009177 Bacteria 1159
330 Ga0105237_10016087 3300009545 Bacteria 7781
331 Ga0105238_10957048 3300009551 Bacteria 876
332 Ga0105249_10049127 3300009553 Bacteria 3847
333 Ga0105249_11819985 3300009553 Bacteria 682
334 Ga0105239_10377220 3300010375 Bacteria 1603
335 Ga0105239_10450025 3300010375 Unclassified 1461
336 Ga0105239_10605315 3300010375 Bacteria 1250
337 Ga0105246_10034593 3300011119 Unclassified 3369
338 Ga0105246_10723807 3300011119 Bacteria 875
339 Ga0157371_11556417 3300013102 Bacteria 517
340 Ga0157374_10072086 3300013296 Unclassified 3258
341 Ga0157374_10163480 3300013296 Bacteria 2169
342 Ga0157374_10180513 3300013296 Bacteria 2061
343 Ga0157378_10211669 3300013297 Bacteria 1838
344 Ga0157378_11127728 3300013297 Unclassified 822
345 Ga0157378_11562892 3300013297 Bacteria 705
346 Ga0157378_11805173 3300013297 Bacteria 660
347 Ga0163162_10020397 3300013306 Bacteria 6512
348 Ga0163162_10176898 3300013306 Bacteria 2259
349 Ga0163162_10189891 3300013306 Bacteria 2182
350 Ga0163162_10286935 3300013306 Unclassified 1778
351 Ga0163162_10580090 3300013306 Bacteria 1248
352 Ga0163162_11387607 3300013306 Bacteria 799
353 Ga0163162_12037595 3300013306 Unclassified 658
354 Ga0157372_10338033 3300013307 Bacteria 1754
355 Ga0157375_10012622 3300013308 Bacteria 7497
356 Ga0157375_10045551 3300013308 Bacteria 4270
357 Ga0157375_10057193 3300013308 Bacteria 3854
358 Ga0157375_10101514 3300013308 Bacteria 2960
359 Ga0157375_10531471 3300013308 Bacteria 1339
360 Ga0157375_10826088 3300013308 Bacteria 1074
361 Ga0157375_11653512 3300013308 Bacteria 758
362 Ga0157375_12394512 3300013308 Bacteria 630
363 Ga0163163_10039634 3300014325 Bacteria 4599
364 Ga0163163_10052788 3300014325 Bacteria 4011
365 Ga0163163_10101835 3300014325 Bacteria 2894
366 Ga0163163_10946256 3300014325 Bacteria 925
367 Ga0157380_10005801 3300014326 Bacteria 8642
368 Ga0157380_10041592 3300014326 Bacteria 3587
369 Ga0157380_10200791 3300014326 Bacteria 1769
370 Ga0157380_10778776 3300014326 Bacteria 971
371 Ga0157380_10804785 3300014326 Bacteria 957
372 Ga0157377_10080238 3300014745 Bacteria 1906
373 Ga0157379_10025408 3300014968 Bacteria 5262
374 Ga0157376_10012058 3300014969 Bacteria 6398
375 Ga0157376_10079043 3300014969 Bacteria 2819
376 Ga0157376_10874410 3300014969 Bacteria 915
377 Ga0157376_10955437 3300014969 Bacteria 878
378 Ga0182006_1000216 3300015261 Bacteria 56213
379 Ga0182005_1000119 3300015265 Bacteria 57192
380 Ga0163161_10020699 3300017792 Bacteria 4620
381 Ga0163161_10033804 3300017792 Bacteria 3654
382 Ga0163161_10359575 3300017792 Bacteria 1159
383 Ga0209672_100041 3300025228 Bacteria 278535
384 Ga0209147_100866 3300025229 Bacteria 14070
385 Ga0209437_101838 3300025233 Bacteria 4528
386 Ga0209258_100822 3300025242 Bacteria 17427
387 Ga0209646_1000384 3300025246 Bacteria 28428
388 Ga0209026_1044080 3300025250 Bacteria 643
389 Ga0209148_1001387 3300025254 Bacteria 12523
390 Ga0209759_1056599 3300025256 Bacteria 572
391 Ga0209455_1007106 3300025272 Bacteria 3204
392 Ga0209564_1000010 3300025295 Bacteria 885399
393 Ga0209564_1001321 3300025295 Bacteria 26542
394 Ga0207697_10047453 3300025315 Bacteria 1770
395 Ga0207697_10240881 3300025315 Bacteria 799
396 Ga0207656_10012067 3300025321 Bacteria 3279
397 Ga0207655_1007846 3300025728 Bacteria 6866
398 Ga0207653_10042017 3300025885 Bacteria 1503
399 Ga0207682_10000198 3300025893 Bacteria 27362
400 Ga0207682_10026622 3300025893 Bacteria 2300
401 Ga0207682_10612067 3300025893 Bacteria 513
402 Ga0207642_10008609 3300025899 Bacteria 3512
403 Ga0207642_10196980 3300025899 Bacteria 1110
404 Ga0207688_10154182 3300025901 Bacteria 1359
405 Ga0207680_10057628 3300025903 Bacteria 2351
406 Ga0207647_10009548 3300025904 Bacteria 6886
407 Ga0207685_10585062 3300025905 Bacteria 597
408 Ga0207699_10237170 3300025906 Bacteria 1252
409 Ga0207645_10000676 3300025907 Bacteria 28210
410 Ga0207645_10030039 3300025907 Bacteria 3502
411 Ga0207645_10054591 3300025907 Bacteria 2552
412 Ga0207645_10311729 3300025907 Bacteria 1049
413 Ga0207643_10039589 3300025908 Bacteria 2652
414 Ga0207643_10045286 3300025908 Bacteria 2484
415 Ga0207643_10049201 3300025908 Bacteria 2389
416 Ga0207643_10109580 3300025908 Bacteria 1626
417 Ga0207643_10352679 3300025908 Bacteria 924
418 Ga0207705_10063847 3300025909 Bacteria 2661
419 Ga0207705_10875486 3300025909 Bacteria 696
420 Ga0207684_10112094 3300025910 Bacteria 2335
421 Ga0207654_10464225 3300025911 Bacteria 890
422 Ga0207707_10009678 3300025912 Bacteria 8361
423 Ga0207707_10105173 3300025912 Bacteria 2467
424 Ga0207707_11010548 3300025912 Bacteria 682
425 Ga0207671_10035591 3300025914 Bacteria 3694
426 Ga0207671_10071944 3300025914 Bacteria 2580
427 Ga0207660_10043657 3300025917 Bacteria 3150
428 Ga0207660_10386898 3300025917 Bacteria 1125
429 Ga0207660_10489759 3300025917 Bacteria 997
430 Ga0207662_10070919 3300025918 Bacteria 2108
431 Ga0207662_10239084 3300025918 Bacteria 1188
432 Ga0207662_10686993 3300025918 Bacteria 717
433 Ga0207657_10193589 3300025919 Bacteria 1639
434 Ga0207652_10013645 3300025921 Bacteria 6569
435 Ga0207652_10393285 3300025921 Bacteria 1251
436 Ga0207646_10470972 3300025922 Bacteria 1133
437 Ga0207646_10870301 3300025922 Bacteria 800
438 Ga0207681_10005688 3300025923 Bacteria 7657
439 Ga0207681_10013210 3300025923 Bacteria 5105
440 Ga0207681_10170319 3300025923 Bacteria 1650
441 Ga0207681_10236162 3300025923 Bacteria 1421
442 Ga0207681_10920762 3300025923 Bacteria 732
443 Ga0207650_10018612 3300025925 Bacteria 4876
444 Ga0207650_10114126 3300025925 Bacteria 2095
445 Ga0207650_10250069 3300025925 Bacteria 1435
446 Ga0207650_10492403 3300025925 Bacteria 1024
447 Ga0207650_10637532 3300025925 Bacteria 898
448 Ga0207650_11494197 3300025925 Bacteria 574
449 Ga0207659_10047713 3300025926 Bacteria 3030
450 Ga0207659_10133056 3300025926 Bacteria 1922
451 Ga0207659_10368540 3300025926 Bacteria 1195
452 Ga0207659_11437017 3300025926 Bacteria 591
453 Ga0207659_11662868 3300025926 Unclassified 544
454 Ga0207687_10029887 3300025927 Bacteria 3668
455 Ga0207687_10487589 3300025927 Bacteria 1027
456 Ga0207687_10548927 3300025927 Bacteria 969
457 Ga0207687_10807528 3300025927 Unclassified 800
458 Ga0207664_10048574 3300025929 Bacteria 3338
459 Ga0207644_10010982 3300025931 Bacteria 5981
460 Ga0207644_10013052 3300025931 Bacteria 5529
461 Ga0207644_11312588 3300025931 Bacteria 608
462 Ga0207690_10937728 3300025932 Bacteria 719
463 Ga0207706_10020283 3300025933 Bacteria 5974
464 Ga0207706_10100010 3300025933 Bacteria 2552
465 Ga0207706_10307885 3300025933 Bacteria 1380
466 Ga0207706_10463432 3300025933 Bacteria 1096
467 Ga0207706_11422832 3300025933 Unclassified 568
468 Ga0207686_10159311 3300025934 Bacteria 1580
469 Ga0207686_10219545 3300025934 Bacteria 1372
470 Ga0207709_11653259 3300025935 Bacteria 532
471 Ga0207670_10018384 3300025936 Bacteria 4248
472 Ga0207670_10164638 3300025936 Bacteria 1658
473 Ga0207670_10353646 3300025936 Bacteria 1164
474 Ga0207670_10374350 3300025936 Bacteria 1133
475 Ga0207670_10536282 3300025936 Bacteria 954
476 Ga0207670_11609061 3300025936 Unclassified 552
477 Ga0207669_10031072 3300025937 Bacteria 2978
478 Ga0207669_10104538 3300025937 Bacteria 1881
479 Ga0207669_10238642 3300025937 Bacteria 1346
480 Ga0207669_10342286 3300025937 Bacteria 1152
481 Ga0207669_11354190 3300025937 Bacteria 605
482 Ga0207704_10011015 3300025938 Bacteria 4436
483 Ga0207704_11683730 3300025938 Bacteria 545
484 Ga0207704_11904836 3300025938 Bacteria 511
485 Ga0207665_10270644 3300025939 Bacteria 1261
486 Ga0207665_10295733 3300025939 Bacteria 1209
487 Ga0207691_10000243 3300025940 Bacteria 53649
488 Ga0207691_10001181 3300025940 Bacteria 25967
489 Ga0207691_10037545 3300025940 Bacteria 4486
490 Ga0207691_10091771 3300025940 Bacteria 2721
491 Ga0207691_10247947 3300025940 Bacteria 1538
492 Ga0207691_10406630 3300025940 Bacteria 1161
493 Ga0207691_10533164 3300025940 Bacteria 996
494 Ga0207691_10588554 3300025940 Bacteria 942
495 Ga0207711_10018678 3300025941 Bacteria 5764
496 Ga0207711_10278090 3300025941 Bacteria 1541
497 Ga0207711_11084510 3300025941 Bacteria 741
498 Ga0207689_10015420 3300025942 Bacteria 6470
499 Ga0207689_10049475 3300025942 Bacteria 3467
500 Ga0207689_10108288 3300025942 Bacteria 2283
501 Ga0207689_10755351 3300025942 Bacteria 821
502 Ga0207689_10882363 3300025942 Bacteria 755
503 Ga0207689_11612523 3300025942 Bacteria 540
504 Ga0207689_11652216 3300025942 Bacteria 532
505 Ga0207679_10070680 3300025945 Bacteria 2631
506 Ga0207679_10544100 3300025945 Bacteria 1041
507 Ga0207679_11258125 3300025945 Bacteria 679
508 Ga0207667_10131745 3300025949 Bacteria 2575
509 Ga0207651_10011474 3300025960 Bacteria 4963
510 Ga0207651_10034413 3300025960 Bacteria 3281
511 Ga0207651_10081940 3300025960 Unclassified 2328
512 Ga0207651_10153936 3300025960 Bacteria 1794
513 Ga0207712_10613324 3300025961 Bacteria 942
514 Ga0207712_12111792 3300025961 Bacteria 504
515 Ga0207668_10005128 3300025972 Bacteria 7706
516 Ga0207668_10007321 3300025972 Bacteria 6559
517 Ga0207668_10007526 3300025972 Bacteria 6481
518 Ga0207668_10036649 3300025972 Bacteria 3275
519 Ga0207668_10093152 3300025972 Bacteria 2219
520 Ga0207668_10730533 3300025972 Bacteria 872
521 Ga0207640_10118510 3300025981 Bacteria 1891
522 Ga0207640_10425787 3300025981 Bacteria 1087
523 Ga0207640_10431519 3300025981 Bacteria 1081
524 Ga0207640_11063617 3300025981 Bacteria 714
525 Ga0207658_10011658 3300025986 Bacteria 5987
526 Ga0207658_10103985 3300025986 Bacteria 2230
527 Ga0207658_10416996 3300025986 Unclassified 1183
528 Ga0207677_10164429 3300026023 Bacteria 1728
529 Ga0207677_10513924 3300026023 Bacteria 1038
530 Ga0207703_10769894 3300026035 Bacteria 918
531 Ga0207703_10912679 3300026035 Unclassified 841
532 Ga0207703_10999934 3300026035 Bacteria 802
533 Ga0207639_10257170 3300026041 Bacteria 1525
534 Ga0207639_11263962 3300026041 Bacteria 693
535 Ga0207678_10000013 3300026067 Bacteria 141619
536 Ga0207708_10002536 3300026075 Bacteria 13436
537 Ga0207708_10058634 3300026075 Bacteria 2937
538 Ga0207708_10159046 3300026075 Bacteria 1783
539 Ga0207708_10178673 3300026075 Bacteria 1684
540 Ga0207708_10229266 3300026075 Bacteria 1491
541 Ga0207708_10394572 3300026075 Bacteria 1143
542 Ga0207708_10834841 3300026075 Bacteria 795
543 Ga0207702_10272306 3300026078 Bacteria 1597
544 Ga0207641_10112676 3300026088 Bacteria 2414
545 Ga0207641_10115124 3300026088 Bacteria 2390
546 Ga0207641_10239056 3300026088 Bacteria 1691
547 Ga0207641_10357094 3300026088 Bacteria 1394
548 Ga0207641_10364275 3300026088 Bacteria 1381
549 Ga0207641_10871257 3300026088 Bacteria 893
550 Ga0207641_12109513 3300026088 Unclassified 564
551 Ga0207641_12291666 3300026088 Bacteria 540
552 Ga0207648_10009225 3300026089 Bacteria 9476
553 Ga0207648_10012144 3300026089 Bacteria 8073
554 Ga0207648_10017883 3300026089 Bacteria 6432
555 Ga0207648_10112143 3300026089 Bacteria 2394
556 Ga0207648_10551302 3300026089 Bacteria 1059
557 Ga0207648_10891868 3300026089 Bacteria 830
558 Ga0207648_11890090 3300026089 Bacteria 558
559 Ga0207676_10033387 3300026095 Bacteria 3887
560 Ga0207676_10129115 3300026095 Bacteria 2146
561 Ga0207676_10150985 3300026095 Bacteria 2001
562 Ga0207676_10202340 3300026095 Bacteria 1756
563 Ga0207676_10482633 3300026095 Bacteria 1174
564 Ga0207674_10396770 3300026116 Bacteria 1333
565 Ga0207674_11218433 3300026116 Bacteria 722
566 Ga0207675_100001853 3300026118 Bacteria 21203
567 Ga0207675_100020956 3300026118 Bacteria 6095
568 Ga0207675_100046593 3300026118 Bacteria 4051
569 Ga0207675_100110998 3300026118 Bacteria 2587
570 Ga0207675_100268847 3300026118 Bacteria 1654
571 Ga0207675_100307665 3300026118 Bacteria 1545
572 Ga0207675_100673391 3300026118 Bacteria 1042
573 Ga0207675_100755244 3300026118 Bacteria 984
574 Ga0207675_100895014 3300026118 Bacteria 904
575 Ga0207675_101003193 3300026118 Bacteria 853
576 Ga0207675_101787281 3300026118 Bacteria 634
577 Ga0207683_10000308 3300026121 Bacteria 44216
578 Ga0207683_10100953 3300026121 Unclassified 2576
579 Ga0207683_10194654 3300026121 Bacteria 1842
580 Ga0207683_11693062 3300026121 Bacteria 582
581 Ga0207698_10014478 3300026142 Bacteria 5245
582 Ga0207698_11364666 3300026142 Bacteria 724
583 Ga0209281_1004553 3300027111 Bacteria 4122
584 Ga0209967_1007547 3300027364 Bacteria 1489
585 Ga0209981_1000274 3300027378 Bacteria 6602
586 Ga0209996_1000426 3300027395 Bacteria 5104
587 Ga0210000_1012802 3300027462 Bacteria 1248
588 Ga0209995_1002372 3300027471 Bacteria 2972
589 Ga0209968_1028162 3300027526 Bacteria 932
590 Ga0209999_1003045 3300027543 Bacteria 2984
591 Ga0209970_1030478 3300027614 Bacteria 936
592 Ga0209971_1093017 3300027682 Bacteria 736
593 Ga0209974_10435536 3300027876 Bacteria 518
594 Ga0207428_10008206 3300027907 Bacteria 9445
595 Ga0207428_10132309 3300027907 Bacteria 1908
596 Ga0268266_10035503 3300028379 Bacteria 4241
597 Ga0268266_10154387 3300028379 Bacteria 2072
598 Ga0268266_10222798 3300028379 Bacteria 1734
599 Ga0268266_10289909 3300028379 Bacteria 1524
600 Ga0268266_10567504 3300028379 Unclassified 1088
601 Ga0268265_10000606 3300028380 Bacteria 35982
602 Ga0268265_10007059 3300028380 Bacteria 7595
603 Ga0268265_10056208 3300028380 Bacteria 2993
604 Ga0268265_10103415 3300028380 Bacteria 2306
605 Ga0268265_10230804 3300028380 Bacteria 1626
606 Ga0268265_10398107 3300028380 Bacteria 1272
607 Ga0268264_10040446 3300028381 Bacteria 3852
608 Ga0268264_10071335 3300028381 Bacteria 2943
609 Ga0268264_10111072 3300028381 Bacteria 2401
610 Ga0268264_10535440 3300028381 Bacteria 1147
611 Ga0268264_10695181 3300028381 Bacteria 1010
612 Ga0307515_10525023 3300028794 Bacteria 793
613 Ga0265338_10000344 3300028800 Bacteria 84742
614 Ga0237817_12217 3300030083 Bacteria 863
615 Ga0265327_10030111 3300031251 Bacteria 3074
616 Ga0307513_10436371 3300031456 Bacteria 1037
617 Ga0307408_100181728 3300031548 Bacteria 1687
618 Ga0307408_100829886 3300031548 Bacteria 841
619 Ga0307408_100831804 3300031548 Bacteria 840
620 Ga0307408_101444943 3300031548 Bacteria 649
621 Ga0316575_10030526 3300031665 Bacteria 2107
622 Ga0316575_10033995 3300031665 Bacteria 2001
623 Ga0316579_10000015 3300031691 Bacteria 39681
624 Ga0316579_10010200 3300031691 Bacteria 3967
625 Ga0316579_10140937 3300031691 Bacteria 1162
626 Ga0316576_10071290 3300031727 Bacteria 2563
627 Ga0316578_10005745 3300031728 Bacteria 6051
628 Ga0316578_10396209 3300031728 Bacteria 818
629 Ga0316577_10001781 3300031733 Bacteria 10385
630 Ga0307413_10976700 3300031824 Bacteria 724
631 Ga0307413_11268788 3300031824 Bacteria 643
632 Ga0307407_10500016 3300031903 Bacteria 891
633 Ga0307412_10372141 3300031911 Bacteria 1154
634 Ga0307412_10911307 3300031911 Bacteria 771
635 Ga0307409_100724543 3300031995 Bacteria 996
636 Ga0307416_101043310 3300032002 Bacteria 921
637 Ga0307416_101562953 3300032002 Bacteria 765
638 Ga0307411_10125767 3300032005 Bacteria 1864
639 Ga0307411_11439750 3300032005 Bacteria 631
640 Ga0316583_10000483 3300032133 Bacteria 11841
641 Ga0316583_10004823 3300032133 Bacteria 4817
642 Ga0316585_10021392 3300032137 Bacteria 1986
643 Ga0316585_10028949 3300032137 Bacteria 1734
644 Ga0316580_10008681 3300032139 Bacteria 3049
645 Ga0316593_10000385 3300032168 Bacteria 7877
646 Ga0373938_0157733 3300034957 Unclassified 607
647 Ga0373929_0118124 3300035085 Bacteria 684
648 Ga0373929_0164303 3300035085 Bacteria 603
649 Ga0373934_0000134 3300035086 Bacteria 27424
650 Ga0373934_0440898 3300035086 Bacteria 546
651 Ga0373949_0052465 3300035090 Bacteria 1031
652 Ga0373949_0074343 3300035090 Bacteria 896
653 Ga0373951_0180728 3300035091 Bacteria 606
654 Ga0373952_0296346 3300035092 Bacteria 503
655 Ga0373923_0625352 3300035111 Bacteria 531
656 Ga0373932_0061752 3300035112 Bacteria 1141
657 Ga0373932_0142798 3300035112 Bacteria 815
658 Ga0373936_0025745 3300035113 Bacteria 2302
659 Ga0373936_0059916 3300035113 Bacteria 1552
660 Ga0373939_0203489 3300035114 Bacteria 750
661 Ga0373939_0465874 3300035114 Unclassified 534
662 Ga0373941_0040943 3300035115 Bacteria 1432
663 Ga0373953_0140382 3300035117 Bacteria 1033
664 Ga0373954_0000002 3300035118 Bacteria 147478
665 Ga0373956_0000006 3300035119 Bacteria 65782
666 Ga0373957_0000372 3300035120 Bacteria 11352
667 Ga0373957_0205146 3300035120 Bacteria 822
668 Ga0373960_0051783 3300035121 Bacteria 1221
669 Ga0373960_0118127 3300035121 Bacteria 877
670 Ga0373960_0246755 3300035121 Unclassified 647
671 Ga0373943_0006741 3300035170 Bacteria 5155
672 Ga0373946_0569281 3300035171 Bacteria 585
673 Ga0373955_0136521 3300035172 Bacteria 1435
674 Ga0373955_0272091 3300035172 Bacteria 1018
675 Ga0373955_0577636 3300035172 Bacteria 688
676 Ga0373942_0320732 3300035207 Bacteria 542
677 Ga0373962_0390465 3300035242 Bacteria 510
678 Ga0316574_0081081 3300035398 Bacteria 2060
679 Ga0316574_0191459 3300035398 Bacteria 1315
680 Ga0316574_0225932 3300035398 Bacteria 1199
681 Ga0373924_0117450 3300035410 Bacteria 1153
682 Ga0373931_0047678 3300035691 Bacteria 2268
683 Ga0373935_0036900 3300035692 Bacteria 3057
684 Ga0373935_1004514 3300035692 Bacteria 620
685 Ga0373927_0018661 3300035695 Bacteria 4553
686 Ga0373927_0047624 3300035695 Bacteria 2773
687 Ga0373933_0000564 3300035724 Bacteria 23136
688 Ga0373933_0079276 3300035724 Bacteria 2011
689 Ga0373933_0161536 3300035724 Bacteria 1423
690 Ga0373933_0247749 3300035724 Bacteria 1147
691 Ga0373947_0025727 3300035725 Bacteria 3432
692 Ga0373947_0838267 3300035725 Bacteria 628
693 Ga0373937_0000358 3300036401 Bacteria 42468
694 Ga0373937_0003219 3300036401 Bacteria 13673
695 Ga0373937_0047835 3300036401 Bacteria 3914
696 Ga0373937_0347205 3300036401 Bacteria 1405
697 Ga0373937_1243825 3300036401 Bacteria 693
698 Ga0316582_0003674 3300036647 Bacteria 7582
699 Ga0316582_0019086 3300036647 Bacteria 4006
700 Ga0316582_0385781 3300036647 Bacteria 964
701 Ga0316584_0008900 3300036712 Bacteria 6941
702 Ga0316584_0099029 3300036712 Bacteria 2183
703 Ga0316584_0188920 3300036712 Bacteria 1524
704 Ga0316584_0514716 3300036712 Bacteria 839
705 Ga0373925_0061295 3300037068 Bacteria 2825
706 Ga0373925_0071100 3300037068 Bacteria 2631
707 Ga0373925_0775520 3300037068 Bacteria 790
708 Ga0395899_0004310 3300037312 Bacteria 11107
709 Ga0395900_0006117 3300037418 Bacteria 12551
710 Ga0395900_0270883 3300037418 Bacteria 1692
711 Ga0395898_0298265 3300037466 Bacteria 1537
712 Ga0395898_1603184 3300037466 Bacteria 575
713 Ga0395905_0035171 3300037471 Bacteria 4703
714 Ga0316581_0001262 3300037588 Bacteria 5612
715 Ga0316581_0001282 3300037588 Bacteria 5581
716 Ga0316581_0054570 3300037588 Bacteria 1225
717 Ga0395901_0085802 3300038443 Bacteria 3291
718 Ga0395901_0255660 3300038443 Bacteria 1824
719 Ga0395901_0661644 3300038443 Bacteria 1046
720 Ga0436360_0635523 3300039438 Bacteria 804
721 Ga0436361_1182555 3300039447 Bacteria 934
722 Ga0436363_1444570 3300039450 Bacteria 873
723 Ga0451802_1603895 3300041460 Bacteria 583
724 Ga0451807_0680206 3300041486 Bacteria 1997
725 Ga0451807_2332697 3300041486 Bacteria 3050
726 Ga0451849_1451196 3300041505 Bacteria 777
727 Ga0451853_0470233 3300041512 Bacteria 611
728 Ga0439441_000116 3300042001 Bacteria 6525
729 Ga0439443_019482 3300042003 Bacteria 1058
730 Ga0439451_003581 3300042009 Bacteria 3145
731 Ga0439462_0064584 3300042015 Bacteria 991
732 Ga0439446_0028390 3300042156 Bacteria 1610
733 Ga0439434_0000212 3300042435 Bacteria 16124
734 Ga0439435_0000206 3300042436 Bacteria 8300
735 Ga0439435_0013850 3300042436 Bacteria 1982
736 Ga0439444_0002792 3300042437 Bacteria 2418
737 Ga0439460_0000714 3300042461 Bacteria 7402
738 Ga0451577_0023914 3300042876 Bacteria 5565
739 Ga0453683_0028389 3300044673 Bacteria 3544
740 Ga0466963_0602491 3300044694 Bacteria 776
741 Ga0466964_0021058 3300044706 Bacteria 2518
742 Ga0466964_0138052 3300044706 Bacteria 1117
743 Ga0466964_0443880 3300044706 Bacteria 687
744 Ga0453684_0276423 3300044712 Bacteria 1917
745 Ga0466957_0344334 3300044842 Bacteria 1010
746 Ga0451576_0000147 3300045051 Bacteria 179223
747 Ga0451576_0196786 3300045051 Bacteria 2105
748 Ga0451576_1110250 3300045051 Bacteria 827
749 Ga0466967_0001049 3300045976 Bacteria 15200
750 Ga0466967_1158875 3300045976 Bacteria 770
751 Ga0495617_004040 3300046452 Bacteria 5392
752 Ga0495603_0225283 3300046455 Bacteria 1081
753 Ga0495651_0000233 3300046462 Bacteria 42757
754 Ga0495653_0359564 3300046463 Bacteria 934
755 Ga0495650_0001544 3300046471 Bacteria 21838
756 Ga0495650_0003055 3300046471 Bacteria 12597
757 Ga0495650_0003627 3300046471 Bacteria 11112
758 Ga0495580_0026867 3300046472 Bacteria 4192
759 Ga0495605_0000635 3300046474 Bacteria 26971
760 Ga0495584_0027265 3300046491 Bacteria 2894
761 Ga0495584_0164912 3300046491 Bacteria 1126
762 Ga0495585_0024699 3300046492 Bacteria 3444
763 Ga0495607_0249086 3300046501 Bacteria 856
764 Ga0495583_0005068 3300046506 Bacteria 9096
765 Ga0495606_0001517 3300046507 Bacteria 30788
766 Ga0495606_0352355 3300046507 Bacteria 781
767 Ga0495610_0003364 3300046512 Bacteria 12537
768 Ga0495631_0017774 3300046518 Bacteria 3357
769 Ga0495637_0010764 3300046520 Bacteria 4412
770 Ga0495643_0000891 3300046522 Bacteria 31774
771 Ga0495648_0019571 3300046524 Bacteria 4755
772 Ga0495642_0128916 3300046528 Bacteria 1088
773 Ga0495642_0276100 3300046528 Bacteria 736
774 Ga0495652_0678468 3300046529 Bacteria 695
775 Ga0495621_0054065 3300046539 Bacteria 1443
776 Ga0495621_0105592 3300046539 Bacteria 1076
777 Ga0495621_0194908 3300046539 Bacteria 813
778 Ga0495621_0418329 3300046539 Bacteria 570
779 Ga0495597_0000288 3300046542 Bacteria 45373
780 Ga0495597_0001250 3300046542 Bacteria 18776
781 Ga0495622_0407801 3300046557 Bacteria 585
782 Ga0495633_0001228 3300046558 Bacteria 20576
783 Ga0495633_0001987 3300046558 Bacteria 14800
784 Ga0495633_0058546 3300046558 Bacteria 1808
785 Ga0495667_0230855 3300046559 Bacteria 1180
786 Ga0495668_0006127 3300046616 Bacteria 7963
787 Ga0495611_0011338 3300046648 Bacteria 3778
788 Ga0495625_0002229 3300046660 Bacteria 21422
789 Ga0495625_0426629 3300046660 Bacteria 823
790 Ga0495659_0214696 3300046664 Bacteria 793
791 Ga0495659_0232478 3300046664 Bacteria 764
792 Ga0495659_0394030 3300046664 Bacteria 597
793 Ga0495657_0022573 3300046675 Bacteria 4506
794 Ga0495599_0229993 3300046678 Bacteria 1132
795 Ga0495599_0798874 3300046678 Bacteria 539
796 Ga0495623_0334738 3300046679 Bacteria 828
797 Ga0495646_0223782 3300046680 Bacteria 1016
798 Ga0495647_0090012 3300046681 Bacteria 1257
799 Ga0495669_0042821 3300046684 Bacteria 2014
800 Ga0495669_0170482 3300046684 Bacteria 1035
801 Ga0495670_0003908 3300046691 Bacteria 7320
802 Ga0495670_0484820 3300046691 Bacteria 671
803 Ga0495671_0069779 3300046692 Bacteria 1727
804 Ga0495671_0134307 3300046692 Bacteria 1206
805 Ga0495649_0001795 3300046694 Bacteria 15780
806 Ga0495649_0363175 3300046694 Bacteria 730
807 Ga0495589_0041328 3300046794 Bacteria 2301
808 Ga0495604_0150888 3300047317 Bacteria 1651
809 Ga0495636_0001239 3300047318 Bacteria 9652
810 Ga0495636_0037440 3300047318 Bacteria 2003
811 Ga0495636_0074493 3300047318 Bacteria 1454
812 Ga0495636_0161940 3300047318 Bacteria 1008
813 Ga0495674_0011089 3300047319 Bacteria 8509
814 Ga0495672_0001040 3300047320 Bacteria 28407
815 Ga0495676_1076910 3300047321 Bacteria 511
816 Ga0495680_0178343 3300047322 Bacteria 1535
817 Ga0495680_0284998 3300047322 Bacteria 1163
818 Ga0495683_0071477 3300047323 Bacteria 1703
819 Ga0495683_0276296 3300047323 Bacteria 729
820 Ga0495675_0741735 3300047444 Bacteria 547
821 Ga0495677_0019685 3300047445 Bacteria 2447
822 Ga0495677_0140460 3300047445 Bacteria 927
823 Ga0495677_0242725 3300047445 Bacteria 704
824 Ga0495677_0379970 3300047445 Bacteria 558
825 Ga0495686_0105936 3300047472 Bacteria 1691
826 Ga0495602_0030492 3300048088 Bacteria 5113
827 Ga0495615_0182378 3300048090 Bacteria 640
828 Ga0495615_0280598 3300048090 Bacteria 535
829 Ga0496100_1225962 3300048903 Bacteria 592
830 Ga0496102_0000082 3300048905 Bacteria 139079
831 Ga0496102_0047863 3300048905 Bacteria 3887
832 Ga0496102_1062859 3300048905 Bacteria 729
833 Ga0496103_0066025 3300048906 Bacteria 2258
834 Ga0496103_0347642 3300048906 Bacteria 953
835 Ga0496103_0393577 3300048906 Bacteria 890
836 Ga0496106_0192535 3300048909 Bacteria 1622
837 Ga0496107_0379772 3300048910 Bacteria 1051
838 Ga0496108_0344050 3300048911 Bacteria 1301
839 Ga0496110_0536630 3300048913 Bacteria 1064
840 Ga0496111_0523171 3300048914 Bacteria 872
841 Ga0496112_0076310 3300048915 Bacteria 3315
842 Ga0496113_1563851 3300048916 Bacteria 508
843 Ga0496115_0471551 3300048918 Bacteria 1012
844 Ga0496115_1214065 3300048918 Bacteria 566
845 Ga0496116_0048615 3300048919 Bacteria 2845
846 Ga0496120_0173576 3300048923 Bacteria 1064
847 Ga0496122_0046444 3300048925 Bacteria 3363
848 Ga0496123_0006778 3300048926 Bacteria 11006
849 Ga0496124_0358112 3300048927 Bacteria 1029
850 Ga0496125_0040546 3300048928 Bacteria 3993
851 Ga0495678_001082 3300049459 Bacteria 23004
852 Ga0495678_243424 3300049459 Bacteria 537
853 Ga0495682_0080302 3300049460 Bacteria 1173
854 Ga0501291_011127 3300049514 Bacteria 1292
855 Ga0501292_017546 3300049515 Bacteria 1133
856 Ga0501298_122829 3300049521 Bacteria 613
857 Ga0501031_0704530 3300049568 Bacteria 648
858 Ga0501034_0053868 3300049571 Bacteria 4050
859 Ga0501036_0937023 3300049572 Bacteria 710
860 Ga0501036_1745253 3300049572 Bacteria 501
861 Ga0501037_0918886 3300049573 Bacteria 573
862 Ga0501038_0945091 3300049574 Bacteria 635
863 Ga0501039_0020140 3300049575 Bacteria 5115
864 Ga0501040_0609611 3300049576 Bacteria 789
865 Ga0501040_1403187 3300049576 Bacteria 507
866 Ga0501041_0063052 3300049577 Bacteria 2270
867 Ga0501046_0657115 3300049580 Bacteria 741
868 Ga0501047_0175940 3300049581 Bacteria 2007
869 Ga0501048_0465107 3300049582 Bacteria 906
870 Ga0501067_0068582 3300049583 Bacteria 1964
871 Ga0501067_0492210 3300049583 Bacteria 686
872 Ga0501068_0078372 3300049584 Bacteria 2025
873 Ga0501069_0033482 3300049585 Bacteria 2831
874 Ga0501069_0068700 3300049585 Bacteria 1983
875 Ga0501070_0005016 3300049586 Bacteria 11294
876 Ga0501071_0000992 3300049587 Bacteria 15550
877 Ga0501071_0206685 3300049587 Bacteria 1476
878 Ga0501071_0672692 3300049587 Bacteria 797
879 Ga0501072_0039301 3300049588 Bacteria 3715
880 Ga0501072_0044939 3300049588 Bacteria 3472
881 Ga0501072_1566929 3300049588 Bacteria 508
882 Ga0501073_0014106 3300049589 Bacteria 5806
883 Ga0501073_0020687 3300049589 Bacteria 4746
884 Ga0501073_0044227 3300049589 Bacteria 3139
885 Ga0501073_0126736 3300049589 Bacteria 1769
886 Ga0501073_0658564 3300049589 Bacteria 723
887 Ga0501074_0051011 3300049590 Bacteria 2986
888 Ga0501074_0613353 3300049590 Bacteria 769
889 Ga0501075_0004058 3300049591 Bacteria 9884
890 Ga0501075_0190161 3300049591 Bacteria 1566
891 Ga0501076_0007046 3300049592 Bacteria 8166
892 Ga0501076_0989243 3300049592 Bacteria 693
893 Ga0501077_0780346 3300049593 Bacteria 614
894 Ga0501209_120950 3300049656 Bacteria 777
895 Ga0501210_041048 3300049657 Bacteria 508
896 Ga0501227_214815 3300049665 Bacteria 547
897 Ga0501233_080143 3300049668 Bacteria 839
898 Ga0501236_108293 3300049670 Bacteria 553
899 Ga0501238_036258 3300049671 Bacteria 720
900 Ga0501229_025299 3300049706 Bacteria 798
901 Ga0501079_0298026 3300049741 Bacteria 1261
902 Ga0501080_0000702 3300049742 Bacteria 26939
903 Ga0501080_0108918 3300049742 Bacteria 2567
904 Ga0501080_0165598 3300049742 Bacteria 2040
905 Ga0501080_0440280 3300049742 Bacteria 1169
906 Ga0501080_0553069 3300049742 Bacteria 1025
907 Ga0501081_0017373 3300049743 Bacteria 4761
908 Ga0501083_0047000 3300049744 Bacteria 2918
909 Ga0501263_030547 3300049760 Bacteria 760
910 Ga0501268_162210 3300049765 Bacteria 522
911 Ga0501035_0526722 3300049822 Bacteria 970
912 Ga0501035_1443530 3300049822 Bacteria 526
913 Ga0501044_0930798 3300049823 Bacteria 743
914 Ga0501045_0202285 3300049824 Bacteria 1480
915 nmdc:mga05p37_325958_c1 3300050507 Bacteria 1816
916 nmdc:mga09592_1739728_c1 3300050508 Bacteria 502
917 nmdc:mga09592_24148_c1 3300050508 Bacteria 5026
918 nmdc:mga09592_310877_c1 3300050508 Bacteria 1366
919 nmdc:mga0qj67_1283043_c1 3300050509 Bacteria 568
920 nmdc:mga0qj67_337701_c1 3300050509 Unclassified 1219
921 nmdc:mga0qj67_48258_c1 3300050509 Bacteria 3364
922 nmdc:mga06r32_42207_c1 3300050510 Bacteria 4336
923 nmdc:mga06r32_45053_c1 3300050510 Bacteria 4203
924 nmdc:mga06r32_500298_c1 3300050510 Bacteria 1192
925 nmdc:mga08y16_12222_c1 3300050511 Bacteria 9022
926 nmdc:mga08y16_1265296_c1 3300050511 Bacteria 706
927 nmdc:mga08y16_12995_c1 3300050511 Bacteria 8762
928 nmdc:mga08y16_1525026_c1 3300050511 Bacteria 628
929 nmdc:mga08y16_1773734_c1 3300050511 Bacteria 571
930 nmdc:mga08y16_594708_c1 3300050511 Bacteria 1116
931 nmdc:mga08y16_775464_c1 3300050511 Bacteria 953
932 nmdc:mga0n895_13666_c1 3300050512 Bacteria 7339
933 nmdc:mga0n895_157436_c1 3300050512 Bacteria 2302
934 nmdc:mga0n895_18900_c1 3300050512 Bacteria 6391
935 nmdc:mga0n895_2090538_c1 3300050512 Bacteria 523
936 nmdc:mga0n895_332007_c1 3300050512 Bacteria 1540
937 nmdc:mga0rr50_265435_c1 3300050513 Bacteria 1429
938 nmdc:mga0rr50_367362_c1 3300050513 Bacteria 1212
939 nmdc:mga08x19_13941_c1 3300050514 Bacteria 4869
940 nmdc:mga08x19_367441_c1 3300050514 Bacteria 1006
941 nmdc:mga08x19_4051_c1 3300050514 Bacteria 8704
942 nmdc:mga08x19_483065_c1 3300050514 Bacteria 874
943 nmdc:mga08x19_75883_c1 3300050514 Bacteria 2199
944 nmdc:mga08x19_848419_c1 3300050514 Bacteria 649
945 nmdc:mga0a205_201535_c1 3300050515 Bacteria 1880
946 nmdc:mga0a205_21134_c1 3300050515 Bacteria 6155
947 nmdc:mga0a205_573741_c1 3300050515 Bacteria 982
948 Ga0495619_0370050 3300053085 Bacteria 991
949 Ga0500641_0226762 3300053096 Bacteria 791
950 Ga0500594_0081341 3300053118 Bacteria 969
951 Ga0500642_0294423 3300053130 Bacteria 734
952 Ga0500586_000619 3300053145 Bacteria 7214
953 Ga0501084_0081724 3300054114 Bacteria 2711
954 Ga0501084_1015371 3300054114 Bacteria 697
955 Ga0590071_201214 3300059421 Bacteria 524
956 Ga0587079_106088 3300059647 Bacteria 677
957 Ga0587102_016759 3300059649 Bacteria 791
958 Ga0587111_0037126 3300060346 Bacteria 1023
959 Ga0501082_0023335 3300060353 Bacteria 5337
960 Ga0501082_0093054 3300060353 Bacteria 2604
961 Ga0501082_1509367 3300060353 Bacteria 587

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_10378737 Ga0070692_103787372 82
2 3300005459 Ga0068867_100083659 Ga0068867_1000836594 82
3 3300005546 Ga0070696_100196947 Ga0070696_1001969473 82
4 3300026075 Ga0207708_10058634 Ga0207708_100586344 82
5 3300026089 Ga0207648_10017883 Ga0207648_100178834 82
6 3300007265 Ga0099794_10192190 Ga0099794_101921902 83
7 3300005444 Ga0070694_100502819 Ga0070694_1005028192 84
8 3300005545 Ga0070695_100200820 Ga0070695_1002008203 84
9 3300005546 Ga0070696_101117185 Ga0070696_1011171852 84
10 3300009094 Ga0111539_10241710 Ga0111539_102417104 84
11 3300014326 Ga0157380_10804785 Ga0157380_108047851 84
12 3300005471 Ga0070698_100702411 Ga0070698_1007024112 89
13 3300005546 Ga0070696_100161151 Ga0070696_1001611512 90
14 3300005340 Ga0070689_100494696 Ga0070689_1004946961 91
15 3300005365 Ga0070688_101516301 Ga0070688_1015163012 91
16 3300005438 Ga0070701_10201152 Ga0070701_102011522 91
17 3300005441 Ga0070700_100306351 Ga0070700_1003063512 91
18 3300005544 Ga0070686_100073813 Ga0070686_1000738132 91
19 3300005615 Ga0070702_100348826 Ga0070702_1003488262 91
20 3300006358 Ga0068871_100994484 Ga0068871_1009944842 91
21 3300009176 Ga0105242_10196669 Ga0105242_101966692 91
22 3300025934 Ga0207686_10219545 Ga0207686_102195452 91
23 3300025936 Ga0207670_10164638 Ga0207670_101646382 91
24 3300026075 Ga0207708_10229266 Ga0207708_102292662 91
25 3300026118 Ga0207675_100895014 Ga0207675_1008950142 91
26 3300005545 Ga0070695_100634511 Ga0070695_1006345112 92
27 3300042009 Ga0439451_003581 Ga0439451_003581_626_934 93
28 3300049587 Ga0501071_0672692 Ga0501071_0672692_11_319 93
29 3300042003 Ga0439443_019482 Ga0439443_019482_738_1046 94
30 3300042436 Ga0439435_0013850 Ga0439435_0013850_937_1245 94
31 3300042437 Ga0439444_0002792 Ga0439444_0002792_1922_2230 94
32 3300042461 Ga0439460_0000714 Ga0439460_0000714_6830_7138 94
33 3300005530 Ga0070679_101976911 Ga0070679_1019769111 95
34 3300049572 Ga0501036_0937023 Ga0501036_0937023_193_516 95
35 3300049582 Ga0501048_0465107 Ga0501048_0465107_386_709 95
36 3300005327 Ga0070658_10065736 Ga0070658_100657363 100
37 3300005328 Ga0070676_10001435 Ga0070676_100014357 100
38 3300005328 Ga0070676_10321729 Ga0070676_103217292 100
39 3300005328 Ga0070676_10331220 Ga0070676_103312202 100
40 3300005331 Ga0070670_100003563 Ga0070670_1000035631 100
41 3300005331 Ga0070670_100010188 Ga0070670_1000101888 100
42 3300005331 Ga0070670_100039316 Ga0070670_1000393164 100
43 3300005331 Ga0070670_100136031 Ga0070670_1001360312 100
44 3300005331 Ga0070670_100332215 Ga0070670_1003322152 100
45 3300005331 Ga0070670_100750698 Ga0070670_1007506981 100
46 3300005333 Ga0070677_10000343 Ga0070677_100003433 100
47 3300005334 Ga0068869_100009083 Ga0068869_1000090833 100
48 3300005334 Ga0068869_100039879 Ga0068869_1000398793 100
49 3300005335 Ga0070666_10530612 Ga0070666_105306121 100
50 3300005336 Ga0070680_100047758 Ga0070680_1000477582 100
51 3300005338 Ga0068868_100015555 Ga0068868_1000155556 100
52 3300005338 Ga0068868_100205658 Ga0068868_1002056581 100
53 3300005340 Ga0070689_100044203 Ga0070689_1000442031 100
54 3300005340 Ga0070689_100797461 Ga0070689_1007974612 100
55 3300005345 Ga0070692_10042581 Ga0070692_100425813 100
56 3300005345 Ga0070692_10050336 Ga0070692_100503361 100
57 3300005347 Ga0070668_100006797 Ga0070668_1000067972 100
58 3300005347 Ga0070668_100010955 Ga0070668_1000109552 100
59 3300005347 Ga0070668_100027239 Ga0070668_1000272393 100
60 3300005347 Ga0070668_100110179 Ga0070668_1001101793 100
61 3300005347 Ga0070668_100259447 Ga0070668_1002594472 100
62 3300005347 Ga0070668_100274145 Ga0070668_1002741452 100
63 3300005347 Ga0070668_100638347 Ga0070668_1006383472 100
64 3300005347 Ga0070668_101861703 Ga0070668_1018617032 100
65 3300005353 Ga0070669_100021805 Ga0070669_1000218054 100
66 3300005353 Ga0070669_100251345 Ga0070669_1002513453 100
67 3300005354 Ga0070675_100003678 Ga0070675_1000036786 100
68 3300005354 Ga0070675_100012472 Ga0070675_1000124722 100
69 3300005354 Ga0070675_100027916 Ga0070675_1000279163 100
70 3300005354 Ga0070675_100029547 Ga0070675_1000295473 100
71 3300005354 Ga0070675_100283993 Ga0070675_1002839933 100
72 3300005355 Ga0070671_100000272 Ga0070671_10000027230 100
73 3300005355 Ga0070671_100008199 Ga0070671_1000081997 100
74 3300005355 Ga0070671_100270159 Ga0070671_1002701592 100
75 3300005355 Ga0070671_102058122 Ga0070671_1020581221 100
76 3300005356 Ga0070674_100005249 Ga0070674_1000052493 100
77 3300005356 Ga0070674_100034622 Ga0070674_1000346226 100
78 3300005356 Ga0070674_101500840 Ga0070674_1015008401 100
79 3300005364 Ga0070673_100001140 Ga0070673_1000011405 100
80 3300005364 Ga0070673_100026294 Ga0070673_1000262943 100
81 3300005364 Ga0070673_100121931 Ga0070673_1001219312 100
82 3300005365 Ga0070688_100354713 Ga0070688_1003547132 100
83 3300005366 Ga0070659_100083041 Ga0070659_1000830413 100
84 3300005366 Ga0070659_101152340 Ga0070659_1011523401 100
85 3300005367 Ga0070667_100052861 Ga0070667_1000528613 100
86 3300005367 Ga0070667_100140760 Ga0070667_1001407602 100
87 3300005367 Ga0070667_100634378 Ga0070667_1006343782 100
88 3300005435 Ga0070714_102010201 Ga0070714_1020102011 100
89 3300005436 Ga0070713_100225309 Ga0070713_1002253093 100
90 3300005440 Ga0070705_100016156 Ga0070705_1000161564 100
91 3300005440 Ga0070705_100020022 Ga0070705_1000200224 100
92 3300005440 Ga0070705_100115744 Ga0070705_1001157442 100
93 3300005441 Ga0070700_100268752 Ga0070700_1002687522 100
94 3300005441 Ga0070700_100285341 Ga0070700_1002853412 100
95 3300005444 Ga0070694_100028846 Ga0070694_1000288462 100
96 3300005444 Ga0070694_100040671 Ga0070694_1000406713 100
97 3300005444 Ga0070694_100067401 Ga0070694_1000674012 100
98 3300005455 Ga0070663_100027027 Ga0070663_1000270272 100
99 3300005456 Ga0070678_100085002 Ga0070678_1000850021 100
100 3300005456 Ga0070678_100098340 Ga0070678_1000983403 100
101 3300005456 Ga0070678_100184096 Ga0070678_1001840962 100
102 3300005456 Ga0070678_101195126 Ga0070678_1011951261 100
103 3300005457 Ga0070662_100014326 Ga0070662_1000143264 100
104 3300005458 Ga0070681_10004336 Ga0070681_100043365 100
105 3300005458 Ga0070681_10232956 Ga0070681_102329563 100
106 3300005459 Ga0068867_100012234 Ga0068867_1000122347 100
107 3300005459 Ga0068867_100119410 Ga0068867_1001194102 100
108 3300005459 Ga0068867_100653289 Ga0068867_1006532891 100
109 3300005466 Ga0070685_10191559 Ga0070685_101915591 100
110 3300005467 Ga0070706_100169581 Ga0070706_1001695812 100
111 3300005468 Ga0070707_100796182 Ga0070707_1007961822 100
112 3300005471 Ga0070698_100271956 Ga0070698_1002719563 100
113 3300005471 Ga0070698_100770047 Ga0070698_1007700472 100
114 3300005530 Ga0070679_100449119 Ga0070679_1004491192 100
115 3300005530 Ga0070679_100778638 Ga0070679_1007786381 100
116 3300005536 Ga0070697_100033084 Ga0070697_1000330842 100
117 3300005539 Ga0068853_100004289 Ga0068853_1000042897 100
118 3300005543 Ga0070672_100088452 Ga0070672_1000884522 100
119 3300005543 Ga0070672_100143722 Ga0070672_1001437221 100
120 3300005543 Ga0070672_100250812 Ga0070672_1002508121 100
121 3300005543 Ga0070672_100258234 Ga0070672_1002582343 100
122 3300005543 Ga0070672_100514592 Ga0070672_1005145922 100
123 3300005543 Ga0070672_100580341 Ga0070672_1005803412 100
124 3300005543 Ga0070672_101403050 Ga0070672_1014030502 100
125 3300005543 Ga0070672_101659165 Ga0070672_1016591651 100
126 3300005544 Ga0070686_100643806 Ga0070686_1006438061 100
127 3300005545 Ga0070695_100000362 Ga0070695_1000003626 100
128 3300005545 Ga0070695_100041788 Ga0070695_1000417882 100
129 3300005545 Ga0070695_100334984 Ga0070695_1003349842 100
130 3300005545 Ga0070695_100394208 Ga0070695_1003942082 100
131 3300005546 Ga0070696_100000505 Ga0070696_10000050513 100
132 3300005546 Ga0070696_100053479 Ga0070696_1000534793 100
133 3300005546 Ga0070696_102012307 Ga0070696_1020123071 100
134 3300005547 Ga0070693_101221868 Ga0070693_1012218681 100
135 3300005548 Ga0070665_100142453 Ga0070665_1001424533 100
136 3300005548 Ga0070665_100142944 Ga0070665_1001429444 100
137 3300005548 Ga0070665_100172776 Ga0070665_1001727762 100
138 3300005548 Ga0070665_100504639 Ga0070665_1005046392 100
139 3300005548 Ga0070665_100648163 Ga0070665_1006481632 100
140 3300005548 Ga0070665_100832906 Ga0070665_1008329061 100
141 3300005549 Ga0070704_100016021 Ga0070704_1000160213 100
142 3300005563 Ga0068855_100511907 Ga0068855_1005119072 100
143 3300005563 Ga0068855_101961287 Ga0068855_1019612872 100
144 3300005564 Ga0070664_100036137 Ga0070664_1000361375 100
145 3300005564 Ga0070664_100439196 Ga0070664_1004391962 100
146 3300005577 Ga0068857_101698472 Ga0068857_1016984722 100
147 3300005578 Ga0068854_100084706 Ga0068854_1000847063 100
148 3300005578 Ga0068854_100366708 Ga0068854_1003667082 100
149 3300005578 Ga0068854_100470663 Ga0068854_1004706632 100
150 3300005614 Ga0068856_100144536 Ga0068856_1001445363 100
151 3300005615 Ga0070702_100179160 Ga0070702_1001791601 100
152 3300005615 Ga0070702_100583979 Ga0070702_1005839792 100
153 3300005616 Ga0068852_100002156 Ga0068852_1000021566 100
154 3300005616 Ga0068852_101755589 Ga0068852_1017555891 100
155 3300005617 Ga0068859_100680431 Ga0068859_1006804312 100
156 3300005617 Ga0068859_101040905 Ga0068859_1010409051 100
157 3300005617 Ga0068859_102283931 Ga0068859_1022839311 100
158 3300005617 Ga0068859_102341637 Ga0068859_1023416371 100
159 3300005618 Ga0068864_100034508 Ga0068864_1000345084 100
160 3300005618 Ga0068864_100035655 Ga0068864_1000356556 100
161 3300005618 Ga0068864_100062455 Ga0068864_1000624553 100
162 3300005618 Ga0068864_100155302 Ga0068864_1001553023 100
163 3300005618 Ga0068864_100176547 Ga0068864_1001765473 100
164 3300005618 Ga0068864_101331595 Ga0068864_1013315951 100
165 3300005718 Ga0068866_10321836 Ga0068866_103218362 100
166 3300005719 Ga0068861_100210631 Ga0068861_1002106312 100
167 3300005719 Ga0068861_100242385 Ga0068861_1002423852 100
168 3300005719 Ga0068861_100715396 Ga0068861_1007153962 100
169 3300005719 Ga0068861_100793843 Ga0068861_1007938432 100
170 3300005719 Ga0068861_101379962 Ga0068861_1013799621 100
171 3300005834 Ga0068851_10001153 Ga0068851_100011538 100
172 3300005834 Ga0068851_10979707 Ga0068851_109797072 100
173 3300005840 Ga0068870_10020819 Ga0068870_100208193 100
174 3300005840 Ga0068870_10058629 Ga0068870_100586293 100
175 3300005840 Ga0068870_10063872 Ga0068870_100638722 100
176 3300005840 Ga0068870_10176719 Ga0068870_101767192 100
177 3300005841 Ga0068863_100019911 Ga0068863_1000199112 100
178 3300005841 Ga0068863_100020923 Ga0068863_1000209232 100
179 3300005841 Ga0068863_100037554 Ga0068863_1000375543 100
180 3300005841 Ga0068863_100279781 Ga0068863_1002797811 100
181 3300005842 Ga0068858_100014384 Ga0068858_1000143848 100
182 3300005842 Ga0068858_100908099 Ga0068858_1009080992 100
183 3300005843 Ga0068860_100074707 Ga0068860_1000747074 100
184 3300005843 Ga0068860_100115727 Ga0068860_1001157274 100
185 3300005843 Ga0068860_100626423 Ga0068860_1006264231 100
186 3300005843 Ga0068860_100630676 Ga0068860_1006306762 100
187 3300005844 Ga0068862_100093345 Ga0068862_1000933452 100
188 3300005844 Ga0068862_100201451 Ga0068862_1002014513 100
189 3300005844 Ga0068862_100418843 Ga0068862_1004188432 100
190 3300005844 Ga0068862_100611945 Ga0068862_1006119452 100
191 3300006163 Ga0070715_10714684 Ga0070715_107146842 100
192 3300006173 Ga0070716_100247135 Ga0070716_1002471351 100
193 3300006195 Ga0075366_10867145 Ga0075366_108671452 100
194 3300006237 Ga0097621_100013711 Ga0097621_1000137116 100
195 3300006237 Ga0097621_100116903 Ga0097621_1001169033 100
196 3300006237 Ga0097621_101322934 Ga0097621_1013229341 100
197 3300006358 Ga0068871_100444041 Ga0068871_1004440411 100
198 3300006358 Ga0068871_100647272 Ga0068871_1006472722 100
199 3300006358 Ga0068871_100964219 Ga0068871_1009642192 100
200 3300006358 Ga0068871_101823323 Ga0068871_1018233232 100
201 3300006844 Ga0075428_100782575 Ga0075428_1007825752 100
202 3300006844 Ga0075428_101258707 Ga0075428_1012587072 100
203 3300006846 Ga0075430_100626827 Ga0075430_1006268272 100
204 3300006846 Ga0075430_101444695 Ga0075430_1014446952 100
205 3300006852 Ga0075433_10231742 Ga0075433_102317423 100
206 3300006852 Ga0075433_10255444 Ga0075433_102554442 100
207 3300006871 Ga0075434_100100901 Ga0075434_1001009013 100
208 3300006871 Ga0075434_100697291 Ga0075434_1006972912 100
209 3300006871 Ga0075434_102366301 Ga0075434_1023663012 100
210 3300006880 Ga0075429_100003041 Ga0075429_10000304115 100
211 3300006881 Ga0068865_100026154 Ga0068865_1000261546 100
212 3300006881 Ga0068865_100032078 Ga0068865_1000320785 100
213 3300006914 Ga0075436_100005116 Ga0075436_1000051169 100
214 3300006914 Ga0075436_100008567 Ga0075436_1000085678 100
215 3300006914 Ga0075436_100014985 Ga0075436_1000149856 100
216 3300006914 Ga0075436_100023095 Ga0075436_1000230956 100
217 3300006914 Ga0075436_100027380 Ga0075436_1000273803 100
218 3300006931 Ga0097620_100680472 Ga0097620_1006804722 100
219 3300006931 Ga0097620_101040940 Ga0097620_1010409401 100
220 3300006931 Ga0097620_102283865 Ga0097620_1022838651 100
221 3300006931 Ga0097620_102342153 Ga0097620_1023421532 100
222 3300007076 Ga0075435_100048639 Ga0075435_1000486392 100
223 3300007076 Ga0075435_100153380 Ga0075435_1001533803 100
224 3300007076 Ga0075435_101044791 Ga0075435_1010447912 100
225 3300007076 Ga0075435_101235768 Ga0075435_1012357682 100
226 3300009094 Ga0111539_10764449 Ga0111539_107644491 100
227 3300009094 Ga0111539_11322971 Ga0111539_113229712 100
228 3300009094 Ga0111539_11333324 Ga0111539_113333242 100
229 3300009098 Ga0105245_10024073 Ga0105245_100240731 100
230 3300009098 Ga0105245_10439406 Ga0105245_104394062 100
231 3300009098 Ga0105245_10536860 Ga0105245_105368602 100
232 3300009098 Ga0105245_12026452 Ga0105245_120264522 100
233 3300009101 Ga0105247_10005196 Ga0105247_100051965 100
234 3300009101 Ga0105247_10777281 Ga0105247_107772812 100
235 3300009147 Ga0114129_10281193 Ga0114129_102811933 100
236 3300009147 Ga0114129_12654672 Ga0114129_126546722 100
237 3300009148 Ga0105243_10171534 Ga0105243_101715343 100
238 3300009174 Ga0105241_10742711 Ga0105241_107427112 100
239 3300009174 Ga0105241_11874651 Ga0105241_118746511 100
240 3300009176 Ga0105242_10429105 Ga0105242_104291052 100
241 3300009177 Ga0105248_10000992 Ga0105248_1000099227 100
242 3300009177 Ga0105248_10088473 Ga0105248_100884731 100
243 3300009177 Ga0105248_10341517 Ga0105248_103415172 100
244 3300009545 Ga0105237_10016087 Ga0105237_1001608710 100
245 3300009551 Ga0105238_10957048 Ga0105238_109570482 100
246 3300009553 Ga0105249_11819985 Ga0105249_118199851 100
247 3300010375 Ga0105239_10377220 Ga0105239_103772203 100
248 3300010375 Ga0105239_10450025 Ga0105239_104500252 100
249 3300010375 Ga0105239_10605315 Ga0105239_106053152 100
250 3300011119 Ga0105246_10034593 Ga0105246_100345932 100
251 3300011119 Ga0105246_10723807 Ga0105246_107238072 100
252 3300013102 Ga0157371_11556417 Ga0157371_115564172 100
253 3300013296 Ga0157374_10072086 Ga0157374_100720862 100
254 3300013296 Ga0157374_10163480 Ga0157374_101634804 100
255 3300013296 Ga0157374_10180513 Ga0157374_101805132 100
256 3300013297 Ga0157378_10211669 Ga0157378_102116693 100
257 3300013297 Ga0157378_11127728 Ga0157378_111277282 100
258 3300013297 Ga0157378_11562892 Ga0157378_115628922 100
259 3300013297 Ga0157378_11805173 Ga0157378_118051732 100
260 3300013306 Ga0163162_10020397 Ga0163162_100203974 100
261 3300013306 Ga0163162_10176898 Ga0163162_101768983 100
262 3300013306 Ga0163162_10189891 Ga0163162_101898914 100
263 3300013306 Ga0163162_10286935 Ga0163162_102869354 100
264 3300013306 Ga0163162_11387607 Ga0163162_113876072 100
265 3300013306 Ga0163162_12037595 Ga0163162_120375952 100
266 3300013308 Ga0157375_10012622 Ga0157375_100126228 100
267 3300013308 Ga0157375_10045551 Ga0157375_100455512 100
268 3300013308 Ga0157375_10057193 Ga0157375_100571933 100
269 3300013308 Ga0157375_10101514 Ga0157375_101015142 100
270 3300013308 Ga0157375_10531471 Ga0157375_105314712 100
271 3300013308 Ga0157375_11653512 Ga0157375_116535122 100
272 3300013308 Ga0157375_12394512 Ga0157375_123945121 100
273 3300014325 Ga0163163_10039634 Ga0163163_100396342 100
274 3300014325 Ga0163163_10052788 Ga0163163_100527882 100
275 3300014325 Ga0163163_10101835 Ga0163163_101018352 100
276 3300014325 Ga0163163_10946256 Ga0163163_109462562 100
277 3300014326 Ga0157380_10041592 Ga0157380_100415924 100
278 3300014326 Ga0157380_10200791 Ga0157380_102007912 100
279 3300014326 Ga0157380_10778776 Ga0157380_107787762 100
280 3300014968 Ga0157379_10025408 Ga0157379_100254082 100
281 3300014969 Ga0157376_10012058 Ga0157376_100120588 100
282 3300014969 Ga0157376_10874410 Ga0157376_108744102 100
283 3300014969 Ga0157376_10955437 Ga0157376_109554372 100
284 3300017792 Ga0163161_10020699 Ga0163161_100206992 100
285 3300017792 Ga0163161_10033804 Ga0163161_100338044 100
286 3300025315 Ga0207697_10047453 Ga0207697_100474533 100
287 3300025315 Ga0207697_10240881 Ga0207697_102408811 100
288 3300025321 Ga0207656_10012067 Ga0207656_100120673 100
289 3300025893 Ga0207682_10000198 Ga0207682_1000019817 100
290 3300025899 Ga0207642_10196980 Ga0207642_101969802 100
291 3300025903 Ga0207680_10057628 Ga0207680_100576282 100
292 3300025905 Ga0207685_10585062 Ga0207685_105850622 100
293 3300025906 Ga0207699_10237170 Ga0207699_102371702 100
294 3300025907 Ga0207645_10000676 Ga0207645_1000067617 100
295 3300025907 Ga0207645_10030039 Ga0207645_100300393 100
296 3300025907 Ga0207645_10311729 Ga0207645_103117292 100
297 3300025908 Ga0207643_10039589 Ga0207643_100395892 100
298 3300025908 Ga0207643_10045286 Ga0207643_100452862 100
299 3300025908 Ga0207643_10049201 Ga0207643_100492012 100
300 3300025908 Ga0207643_10352679 Ga0207643_103526792 100
301 3300025909 Ga0207705_10063847 Ga0207705_100638472 100
302 3300025910 Ga0207684_10112094 Ga0207684_101120943 100
303 3300025911 Ga0207654_10464225 Ga0207654_104642252 100
304 3300025912 Ga0207707_10009678 Ga0207707_100096787 100
305 3300025912 Ga0207707_10105173 Ga0207707_101051732 100
306 3300025914 Ga0207671_10071944 Ga0207671_100719444 100
307 3300025917 Ga0207660_10043657 Ga0207660_100436575 100
308 3300025917 Ga0207660_10386898 Ga0207660_103868982 100
309 3300025918 Ga0207662_10686993 Ga0207662_106869931 100
310 3300025919 Ga0207657_10193589 Ga0207657_101935891 100
311 3300025921 Ga0207652_10013645 Ga0207652_100136452 100
312 3300025921 Ga0207652_10393285 Ga0207652_103932852 100
313 3300025922 Ga0207646_10870301 Ga0207646_108703012 100
314 3300025923 Ga0207681_10005688 Ga0207681_100056889 100
315 3300025923 Ga0207681_10170319 Ga0207681_101703193 100
316 3300025923 Ga0207681_10236162 Ga0207681_102361622 100
317 3300025923 Ga0207681_10920762 Ga0207681_109207622 100
318 3300025925 Ga0207650_10018612 Ga0207650_100186125 100
319 3300025925 Ga0207650_10114126 Ga0207650_101141262 100
320 3300025925 Ga0207650_10250069 Ga0207650_102500692 100
321 3300025925 Ga0207650_10492403 Ga0207650_104924032 100
322 3300025925 Ga0207650_10637532 Ga0207650_106375322 100
323 3300025926 Ga0207659_10133056 Ga0207659_101330562 100
324 3300025926 Ga0207659_10368540 Ga0207659_103685402 100
325 3300025926 Ga0207659_11437017 Ga0207659_114370172 100
326 3300025926 Ga0207659_11662868 Ga0207659_116628681 100
327 3300025927 Ga0207687_10487589 Ga0207687_104875892 100
328 3300025927 Ga0207687_10548927 Ga0207687_105489271 100
329 3300025927 Ga0207687_10807528 Ga0207687_108075282 100
330 3300025929 Ga0207664_10048574 Ga0207664_100485743 100
331 3300025931 Ga0207644_10010982 Ga0207644_100109825 100
332 3300025931 Ga0207644_10013052 Ga0207644_100130523 100
333 3300025932 Ga0207690_10937728 Ga0207690_109377281 100
334 3300025933 Ga0207706_10020283 Ga0207706_100202835 100
335 3300025933 Ga0207706_10100010 Ga0207706_101000104 100
336 3300025933 Ga0207706_11422832 Ga0207706_114228322 100
337 3300025934 Ga0207686_10159311 Ga0207686_101593113 100
338 3300025936 Ga0207670_10353646 Ga0207670_103536462 100
339 3300025936 Ga0207670_10374350 Ga0207670_103743503 100
340 3300025936 Ga0207670_10536282 Ga0207670_105362822 100
341 3300025936 Ga0207670_11609061 Ga0207670_116090611 100
342 3300025937 Ga0207669_10031072 Ga0207669_100310723 100
343 3300025937 Ga0207669_10238642 Ga0207669_102386422 100
344 3300025937 Ga0207669_10342286 Ga0207669_103422862 100
345 3300025938 Ga0207704_11683730 Ga0207704_116837302 100
346 3300025939 Ga0207665_10270644 Ga0207665_102706442 100
347 3300025939 Ga0207665_10295733 Ga0207665_102957332 100
348 3300025940 Ga0207691_10000243 Ga0207691_1000024317 100
349 3300025940 Ga0207691_10001181 Ga0207691_1000118125 100
350 3300025940 Ga0207691_10091771 Ga0207691_100917712 100
351 3300025940 Ga0207691_10247947 Ga0207691_102479473 100
352 3300025940 Ga0207691_10406630 Ga0207691_104066302 100
353 3300025940 Ga0207691_10533164 Ga0207691_105331641 100
354 3300025940 Ga0207691_10588554 Ga0207691_105885542 100
355 3300025941 Ga0207711_10018678 Ga0207711_100186785 100
356 3300025941 Ga0207711_10278090 Ga0207711_102780902 100
357 3300025941 Ga0207711_11084510 Ga0207711_110845102 100
358 3300025942 Ga0207689_10015420 Ga0207689_100154207 100
359 3300025942 Ga0207689_10049475 Ga0207689_100494756 100
360 3300025942 Ga0207689_10755351 Ga0207689_107553512 100
361 3300025942 Ga0207689_10882363 Ga0207689_108823631 100
362 3300025942 Ga0207689_11612523 Ga0207689_116125231 100
363 3300025942 Ga0207689_11652216 Ga0207689_116522162 100
364 3300025945 Ga0207679_10070680 Ga0207679_100706803 100
365 3300025945 Ga0207679_11258125 Ga0207679_112581251 100
366 3300025960 Ga0207651_10011474 Ga0207651_100114742 100
367 3300025960 Ga0207651_10034413 Ga0207651_100344132 100
368 3300025960 Ga0207651_10081940 Ga0207651_100819402 100
369 3300025961 Ga0207712_10613324 Ga0207712_106133242 100
370 3300025972 Ga0207668_10005128 Ga0207668_100051289 100
371 3300025972 Ga0207668_10007321 Ga0207668_100073214 100
372 3300025972 Ga0207668_10036649 Ga0207668_100366492 100
373 3300025972 Ga0207668_10093152 Ga0207668_100931523 100
374 3300025972 Ga0207668_10730533 Ga0207668_107305332 100
375 3300025981 Ga0207640_10118510 Ga0207640_101185101 100
376 3300025981 Ga0207640_10425787 Ga0207640_104257872 100
377 3300025986 Ga0207658_10011658 Ga0207658_100116584 100
378 3300025986 Ga0207658_10103985 Ga0207658_101039852 100
379 3300025986 Ga0207658_10416996 Ga0207658_104169962 100
380 3300026023 Ga0207677_10164429 Ga0207677_101644293 100
381 3300026035 Ga0207703_10769894 Ga0207703_107698941 100
382 3300026035 Ga0207703_10912679 Ga0207703_109126792 100
383 3300026041 Ga0207639_10257170 Ga0207639_102571702 100
384 3300026041 Ga0207639_11263962 Ga0207639_112639622 100
385 3300026075 Ga0207708_10178673 Ga0207708_101786732 100
386 3300026078 Ga0207702_10272306 Ga0207702_102723061 100
387 3300026088 Ga0207641_10112676 Ga0207641_101126763 100
388 3300026088 Ga0207641_10115124 Ga0207641_101151243 100
389 3300026088 Ga0207641_10239056 Ga0207641_102390562 100
390 3300026088 Ga0207641_10357094 Ga0207641_103570941 100
391 3300026088 Ga0207641_10364275 Ga0207641_103642752 100
392 3300026088 Ga0207641_12109513 Ga0207641_121095131 100
393 3300026089 Ga0207648_10009225 Ga0207648_100092258 100
394 3300026089 Ga0207648_10112143 Ga0207648_101121433 100
395 3300026089 Ga0207648_10551302 Ga0207648_105513022 100
396 3300026089 Ga0207648_11890090 Ga0207648_118900901 100
397 3300026095 Ga0207676_10033387 Ga0207676_100333874 100
398 3300026095 Ga0207676_10129115 Ga0207676_101291154 100
399 3300026095 Ga0207676_10150985 Ga0207676_101509852 100
400 3300026095 Ga0207676_10482633 Ga0207676_104826332 100
401 3300026116 Ga0207674_11218433 Ga0207674_112184331 100
402 3300026118 Ga0207675_100020956 Ga0207675_1000209564 100
403 3300026118 Ga0207675_100046593 Ga0207675_1000465935 100
404 3300026118 Ga0207675_100110998 Ga0207675_1001109983 100
405 3300026118 Ga0207675_100307665 Ga0207675_1003076652 100
406 3300026118 Ga0207675_100673391 Ga0207675_1006733912 100
407 3300026118 Ga0207675_100755244 Ga0207675_1007552441 100
408 3300026118 Ga0207675_101003193 Ga0207675_1010031931 100
409 3300026118 Ga0207675_101787281 Ga0207675_1017872811 100
410 3300026121 Ga0207683_10000308 Ga0207683_1000030817 100
411 3300026121 Ga0207683_10100953 Ga0207683_101009535 100
412 3300026121 Ga0207683_11693062 Ga0207683_116930622 100
413 3300026142 Ga0207698_10014478 Ga0207698_100144782 100
414 3300026142 Ga0207698_11364666 Ga0207698_113646661 100
415 3300027364 Ga0209967_1007547 Ga0209967_10075473 100
416 3300027378 Ga0209981_1000274 Ga0209981_10002742 100
417 3300027395 Ga0209996_1000426 Ga0209996_10004264 100
418 3300027462 Ga0210000_1012802 Ga0210000_10128022 100
419 3300027471 Ga0209995_1002372 Ga0209995_10023724 100
420 3300027526 Ga0209968_1028162 Ga0209968_10281622 100
421 3300027543 Ga0209999_1003045 Ga0209999_10030454 100
422 3300027614 Ga0209970_1030478 Ga0209970_10304782 100
423 3300027682 Ga0209971_1093017 Ga0209971_10930172 100
424 3300027876 Ga0209974_10435536 Ga0209974_104355362 100
425 3300028379 Ga0268266_10035503 Ga0268266_100355036 100
426 3300028379 Ga0268266_10154387 Ga0268266_101543873 100
427 3300028379 Ga0268266_10222798 Ga0268266_102227983 100
428 3300028379 Ga0268266_10289909 Ga0268266_102899092 100
429 3300028379 Ga0268266_10567504 Ga0268266_105675042 100
430 3300028380 Ga0268265_10007059 Ga0268265_100070595 100
431 3300028380 Ga0268265_10056208 Ga0268265_100562083 100
432 3300028380 Ga0268265_10103415 Ga0268265_101034153 100
433 3300028380 Ga0268265_10398107 Ga0268265_103981072 100
434 3300028381 Ga0268264_10040446 Ga0268264_100404463 100
435 3300028381 Ga0268264_10071335 Ga0268264_100713353 100
436 3300028381 Ga0268264_10111072 Ga0268264_101110723 100
437 3300028381 Ga0268264_10535440 Ga0268264_105354402 100
438 3300028381 Ga0268264_10695181 Ga0268264_106951812 100
439 3300031251 Ga0265327_10030111 Ga0265327_100301112 100
440 3300031548 Ga0307408_100829886 Ga0307408_1008298862 100
441 3300031548 Ga0307408_100831804 Ga0307408_1008318042 100
442 3300031665 Ga0316575_10030526 Ga0316575_100305263 100
443 3300031665 Ga0316575_10033995 Ga0316575_100339951 100
444 3300031691 Ga0316579_10010200 Ga0316579_100102004 100
445 3300031691 Ga0316579_10140937 Ga0316579_101409371 100
446 3300031727 Ga0316576_10071290 Ga0316576_100712903 100
447 3300031728 Ga0316578_10396209 Ga0316578_103962091 100
448 3300031733 Ga0316577_10001781 Ga0316577_100017812 100
449 3300031824 Ga0307413_11268788 Ga0307413_112687882 100
450 3300031995 Ga0307409_100724543 Ga0307409_1007245432 100
451 3300032002 Ga0307416_101043310 Ga0307416_1010433102 100
452 3300032137 Ga0316585_10021392 Ga0316585_100213924 100
453 3300032137 Ga0316585_10028949 Ga0316585_100289492 100
454 3300032139 Ga0316580_10008681 Ga0316580_100086814 100
455 3300032168 Ga0316593_10000385 Ga0316593_100003859 100
456 3300034957 Ga0373938_0157733 Ga0373938_0157733_255_563 100
457 3300035085 Ga0373929_0164303 Ga0373929_0164303_58_366 100
458 3300035086 Ga0373934_0000134 Ga0373934_0000134_20745_21053 100
459 3300035090 Ga0373949_0052465 Ga0373949_0052465_609_917 100
460 3300035090 Ga0373949_0074343 Ga0373949_0074343_66_374 100
461 3300035091 Ga0373951_0180728 Ga0373951_0180728_231_539 100
462 3300035092 Ga0373952_0296346 Ga0373952_0296346_50_358 100
463 3300035112 Ga0373932_0061752 Ga0373932_0061752_484_792 100
464 3300035112 Ga0373932_0142798 Ga0373932_0142798_347_655 100
465 3300035113 Ga0373936_0059916 Ga0373936_0059916_154_462 100
466 3300035114 Ga0373939_0203489 Ga0373939_0203489_185_493 100
467 3300035114 Ga0373939_0465874 Ga0373939_0465874_31_339 100
468 3300035119 Ga0373956_0000006 Ga0373956_0000006_9484_9792 100
469 3300035120 Ga0373957_0000372 Ga0373957_0000372_9702_10010 100
470 3300035121 Ga0373960_0118127 Ga0373960_0118127_540_851 100
471 3300035121 Ga0373960_0246755 Ga0373960_0246755_214_522 100
472 3300035170 Ga0373943_0006741 Ga0373943_0006741_4693_5001 100
473 3300035171 Ga0373946_0569281 Ga0373946_0569281_155_463 100
474 3300035172 Ga0373955_0272091 Ga0373955_0272091_688_996 100
475 3300035172 Ga0373955_0577636 Ga0373955_0577636_27_335 100
476 3300035398 Ga0316574_0081081 Ga0316574_0081081_1488_1796 100
477 3300035398 Ga0316574_0191459 Ga0316574_0191459_270_578 100
478 3300035410 Ga0373924_0117450 Ga0373924_0117450_57_365 100
479 3300035691 Ga0373931_0047678 Ga0373931_0047678_682_990 100
480 3300035695 Ga0373927_0047624 Ga0373927_0047624_2328_2636 100
481 3300035724 Ga0373933_0000564 Ga0373933_0000564_9097_9405 100
482 3300035724 Ga0373933_0079276 Ga0373933_0079276_1193_1507 100
483 3300035724 Ga0373933_0161536 Ga0373933_0161536_282_590 100
484 3300035725 Ga0373947_0025727 Ga0373947_0025727_2992_3300 100
485 3300036401 Ga0373937_0003219 Ga0373937_0003219_1574_1882 100
486 3300036401 Ga0373937_0047835 Ga0373937_0047835_2167_2481 100
487 3300036401 Ga0373937_1243825 Ga0373937_1243825_199_507 100
488 3300036647 Ga0316582_0019086 Ga0316582_0019086_2310_2618 100
489 3300036647 Ga0316582_0385781 Ga0316582_0385781_491_799 100
490 3300036712 Ga0316584_0008900 Ga0316584_0008900_4646_4963 100
491 3300037068 Ga0373925_0061295 Ga0373925_0061295_155_463 100
492 3300037068 Ga0373925_0775520 Ga0373925_0775520_376_684 100
493 3300037588 Ga0316581_0001282 Ga0316581_0001282_1361_1678 100
494 3300037588 Ga0316581_0054570 Ga0316581_0054570_872_1180 100
495 3300039450 Ga0436363_1444570 Ga0436363_1444570_283_591 100
496 3300041486 Ga0451807_2332697 Ga0451807_2332697_1408_1716 100
497 3300041505 Ga0451849_1451196 Ga0451849_1451196_279_587 100
498 3300041512 Ga0451853_0470233 Ga0451853_0470233_84_392 100
499 3300042001 Ga0439441_000116 Ga0439441_000116_2404_2712 100
500 3300042015 Ga0439462_0064584 Ga0439462_0064584_88_408 100
501 3300042156 Ga0439446_0028390 Ga0439446_0028390_68_388 100
502 3300042435 Ga0439434_0000212 Ga0439434_0000212_13306_13626 100
503 3300042436 Ga0439435_0000206 Ga0439435_0000206_3293_3613 100
504 3300042876 Ga0451577_0023914 Ga0451577_0023914_3192_3500 100
505 3300044673 Ga0453683_0028389 Ga0453683_0028389_1101_1409 100
506 3300044694 Ga0466963_0602491 Ga0466963_0602491_408_716 100
507 3300044706 Ga0466964_0021058 Ga0466964_0021058_2075_2383 100
508 3300044706 Ga0466964_0443880 Ga0466964_0443880_193_501 100
509 3300044712 Ga0453684_0276423 Ga0453684_0276423_404_712 100
510 3300045051 Ga0451576_0000147 Ga0451576_0000147_161489_161797 100
511 3300045051 Ga0451576_0196786 Ga0451576_0196786_583_891 100
512 3300045976 Ga0466967_0001049 Ga0466967_0001049_12348_12656 100
513 3300046462 Ga0495651_0000233 Ga0495651_0000233_35331_35639 100
514 3300046528 Ga0495642_0128916 Ga0495642_0128916_597_905 100
515 3300046539 Ga0495621_0418329 Ga0495621_0418329_89_397 100
516 3300046664 Ga0495659_0232478 Ga0495659_0232478_202_510 100
517 3300046675 Ga0495657_0022573 Ga0495657_0022573_3401_3709 100
518 3300046679 Ga0495623_0334738 Ga0495623_0334738_251_559 100
519 3300046681 Ga0495647_0090012 Ga0495647_0090012_519_827 100
520 3300046684 Ga0495669_0042821 Ga0495669_0042821_657_965 100
521 3300047318 Ga0495636_0074493 Ga0495636_0074493_1060_1368 100
522 3300047321 Ga0495676_1076910 Ga0495676_1076910_89_397 100
523 3300047322 Ga0495680_0178343 Ga0495680_0178343_979_1287 100
524 3300047444 Ga0495675_0741735 Ga0495675_0741735_37_345 100
525 3300047445 Ga0495677_0379970 Ga0495677_0379970_17_325 100
526 3300048090 Ga0495615_0280598 Ga0495615_0280598_199_507 100
527 3300048903 Ga0496100_1225962 Ga0496100_1225962_41_349 100
528 3300048909 Ga0496106_0192535 Ga0496106_0192535_398_736 100
529 3300048911 Ga0496108_0344050 Ga0496108_0344050_449_757 100
530 3300048915 Ga0496112_0076310 Ga0496112_0076310_2467_2775 100
531 3300048916 Ga0496113_1563851 Ga0496113_1563851_97_435 100
532 3300048918 Ga0496115_1214065 Ga0496115_1214065_151_459 100
533 3300049515 Ga0501292_017546 Ga0501292_017546_445_753 100
534 3300049568 Ga0501031_0704530 Ga0501031_0704530_206_514 100
535 3300049571 Ga0501034_0053868 Ga0501034_0053868_1111_1419 100
536 3300049572 Ga0501036_1745253 Ga0501036_1745253_137_445 100
537 3300049576 Ga0501040_1403187 Ga0501040_1403187_101_409 100
538 3300049580 Ga0501046_0657115 Ga0501046_0657115_185_493 100
539 3300049581 Ga0501047_0175940 Ga0501047_0175940_985_1293 100
540 3300049583 Ga0501067_0068582 Ga0501067_0068582_1415_1723 100
541 3300049583 Ga0501067_0492210 Ga0501067_0492210_71_379 100
542 3300049585 Ga0501069_0033482 Ga0501069_0033482_1419_1727 100
543 3300049585 Ga0501069_0068700 Ga0501069_0068700_155_463 100
544 3300049586 Ga0501070_0005016 Ga0501070_0005016_8825_9133 100
545 3300049587 Ga0501071_0206685 Ga0501071_0206685_381_701 100
546 3300049588 Ga0501072_0044939 Ga0501072_0044939_1175_1483 100
547 3300049588 Ga0501072_1566929 Ga0501072_1566929_61_381 100
548 3300049589 Ga0501073_0126736 Ga0501073_0126736_1234_1542 100
549 3300049590 Ga0501074_0051011 Ga0501074_0051011_2644_2952 100
550 3300049591 Ga0501075_0190161 Ga0501075_0190161_76_384 100
551 3300049592 Ga0501076_0989243 Ga0501076_0989243_119_427 100
552 3300049593 Ga0501077_0780346 Ga0501077_0780346_162_470 100
553 3300049657 Ga0501210_041048 Ga0501210_041048_15_323 100
554 3300049741 Ga0501079_0298026 Ga0501079_0298026_318_626 100
555 3300049742 Ga0501080_0108918 Ga0501080_0108918_319_627 100
556 3300049744 Ga0501083_0047000 Ga0501083_0047000_1023_1331 100
557 3300049765 Ga0501268_162210 Ga0501268_162210_90_398 100
558 3300049822 Ga0501035_0526722 Ga0501035_0526722_438_746 100
559 3300049822 Ga0501035_1443530 Ga0501035_1443530_152_460 100
560 3300050507 nmdc:mga05p37_325958_c1 nmdc:mga05p37_325958_c1_751_1059 100
561 3300050508 nmdc:mga09592_1739728_c1 nmdc:mga09592_1739728_c1_109_417 100
562 3300050508 nmdc:mga09592_24148_c1 nmdc:mga09592_24148_c1_1911_2219 100
563 3300050509 nmdc:mga0qj67_1283043_c1 nmdc:mga0qj67_1283043_c1_162_497 100
564 3300050509 nmdc:mga0qj67_337701_c1 nmdc:mga0qj67_337701_c1_291_599 100
565 3300050510 nmdc:mga06r32_42207_c1 nmdc:mga06r32_42207_c1_3566_3874 100
566 3300050511 nmdc:mga08y16_1265296_c1 nmdc:mga08y16_1265296_c1_365_673 100
567 3300050511 nmdc:mga08y16_1525026_c1 nmdc:mga08y16_1525026_c1_186_494 100
568 3300050511 nmdc:mga08y16_775464_c1 nmdc:mga08y16_775464_c1_475_783 100
569 3300050512 nmdc:mga0n895_157436_c1 nmdc:mga0n895_157436_c1_289_597 100
570 3300050512 nmdc:mga0n895_18900_c1 nmdc:mga0n895_18900_c1_5587_5895 100
571 3300050512 nmdc:mga0n895_332007_c1 nmdc:mga0n895_332007_c1_241_549 100
572 3300050513 nmdc:mga0rr50_265435_c1 nmdc:mga0rr50_265435_c1_156_464 100
573 3300050514 nmdc:mga08x19_13941_c1 nmdc:mga08x19_13941_c1_4239_4547 100
574 3300050514 nmdc:mga08x19_367441_c1 nmdc:mga08x19_367441_c1_138_446 100
575 3300050514 nmdc:mga08x19_4051_c1 nmdc:mga08x19_4051_c1_7907_8215 100
576 3300050514 nmdc:mga08x19_483065_c1 nmdc:mga08x19_483065_c1_186_494 100
577 3300050514 nmdc:mga08x19_75883_c1 nmdc:mga08x19_75883_c1_1210_1518 100
578 3300050514 nmdc:mga08x19_848419_c1 nmdc:mga08x19_848419_c1_315_623 100
579 3300050515 nmdc:mga0a205_201535_c1 nmdc:mga0a205_201535_c1_192_500 100
580 3300050515 nmdc:mga0a205_21134_c1 nmdc:mga0a205_21134_c1_5437_5745 100
581 3300053085 Ga0495619_0370050 Ga0495619_0370050_583_891 100
582 3300053096 Ga0500641_0226762 Ga0500641_0226762_120_428 100
583 3300054114 Ga0501084_0081724 Ga0501084_0081724_2233_2541 100
584 3300059421 Ga0590071_201214 Ga0590071_201214_61_369 100
585 3300060353 Ga0501082_0093054 Ga0501082_0093054_1234_1542 100
586 3300005295 Ga0065707_10603957 Ga0065707_106039572 101
587 3300005328 Ga0070676_10247279 Ga0070676_102472792 101
588 3300005329 Ga0070683_100069027 Ga0070683_1000690273 101
589 3300005330 Ga0070690_100776109 Ga0070690_1007761092 101
590 3300005331 Ga0070670_100261144 Ga0070670_1002611442 101
591 3300005334 Ga0068869_101066159 Ga0068869_1010661592 101
592 3300005337 Ga0070682_101119016 Ga0070682_1011190161 101
593 3300005338 Ga0068868_101003437 Ga0068868_1010034372 101
594 3300005340 Ga0070689_100233871 Ga0070689_1002338713 101
595 3300005340 Ga0070689_100372085 Ga0070689_1003720851 101
596 3300005343 Ga0070687_100105981 Ga0070687_1001059812 101
597 3300005345 Ga0070692_10007318 Ga0070692_100073185 101
598 3300005347 Ga0070668_100025704 Ga0070668_1000257044 101
599 3300005353 Ga0070669_100002973 Ga0070669_1000029735 101
600 3300005354 Ga0070675_100024736 Ga0070675_1000247364 101
601 3300005364 Ga0070673_100072629 Ga0070673_1000726293 101
602 3300005406 Ga0070703_10044843 Ga0070703_100448431 101
603 3300005438 Ga0070701_10121258 Ga0070701_101212582 101
604 3300005440 Ga0070705_100036344 Ga0070705_1000363445 101
605 3300005441 Ga0070700_100001031 Ga0070700_10000103113 101
606 3300005441 Ga0070700_100365933 Ga0070700_1003659332 101
607 3300005444 Ga0070694_100809555 Ga0070694_1008095552 101
608 3300005457 Ga0070662_100374375 Ga0070662_1003743752 101
609 3300005458 Ga0070681_10685450 Ga0070681_106854502 101
610 3300005459 Ga0068867_100002138 Ga0068867_10000213811 101
611 3300005459 Ga0068867_100484352 Ga0068867_1004843522 101
612 3300005518 Ga0070699_101378827 Ga0070699_1013788272 101
613 3300005535 Ga0070684_100848038 Ga0070684_1008480382 101
614 3300005543 Ga0070672_100054860 Ga0070672_1000548605 101
615 3300005546 Ga0070696_100421529 Ga0070696_1004215292 101
616 3300005547 Ga0070693_100140515 Ga0070693_1001405152 101
617 3300005547 Ga0070693_100578294 Ga0070693_1005782942 101
618 3300005547 Ga0070693_100595189 Ga0070693_1005951892 101
619 3300005549 Ga0070704_101142662 Ga0070704_1011426621 101
620 3300005564 Ga0070664_100987814 Ga0070664_1009878142 101
621 3300005577 Ga0068857_100978731 Ga0068857_1009787311 101
622 3300005578 Ga0068854_100484517 Ga0068854_1004845173 101
623 3300005614 Ga0068856_100338379 Ga0068856_1003383792 101
624 3300005615 Ga0070702_100008243 Ga0070702_1000082433 101
625 3300005615 Ga0070702_100138509 Ga0070702_1001385092 101
626 3300005615 Ga0070702_100463840 Ga0070702_1004638402 101
627 3300005617 Ga0068859_100024361 Ga0068859_1000243615 101
628 3300005617 Ga0068859_102056068 Ga0068859_1020560681 101
629 3300005617 Ga0068859_103146018 Ga0068859_1031460182 101
630 3300005718 Ga0068866_10418662 Ga0068866_104186622 101
631 3300005719 Ga0068861_100001104 Ga0068861_10000110413 101
632 3300005719 Ga0068861_100086738 Ga0068861_1000867383 101
633 3300005719 Ga0068861_100336369 Ga0068861_1003363692 101
634 3300005834 Ga0068851_10620193 Ga0068851_106201932 101
635 3300005840 Ga0068870_10072546 Ga0068870_100725463 101
636 3300005841 Ga0068863_100577917 Ga0068863_1005779172 101
637 3300005842 Ga0068858_100820756 Ga0068858_1008207562 101
638 3300005844 Ga0068862_100001798 Ga0068862_10000179814 101
639 3300005844 Ga0068862_100169713 Ga0068862_1001697132 101
640 3300005844 Ga0068862_101069913 Ga0068862_1010699132 101
641 3300006195 Ga0075366_10567510 Ga0075366_105675102 101
642 3300006237 Ga0097621_100014830 Ga0097621_1000148304 101
643 3300006358 Ga0068871_100028272 Ga0068871_1000282723 101
644 3300006844 Ga0075428_100139214 Ga0075428_1001392144 101
645 3300006846 Ga0075430_100003340 Ga0075430_1000033408 101
646 3300006846 Ga0075430_101410397 Ga0075430_1014103972 101
647 3300006847 Ga0075431_100146664 Ga0075431_1001466642 101
648 3300006847 Ga0075431_100752966 Ga0075431_1007529662 101
649 3300006881 Ga0068865_100028722 Ga0068865_1000287221 101
650 3300006931 Ga0097620_100024361 Ga0097620_1000243615 101
651 3300006931 Ga0097620_102055846 Ga0097620_1020558461 101
652 3300006931 Ga0097620_103143761 Ga0097620_1031437612 101
653 3300007076 Ga0075435_100441910 Ga0075435_1004419102 101
654 3300009094 Ga0111539_10068982 Ga0111539_100689824 101
655 3300009094 Ga0111539_10169101 Ga0111539_101691013 101
656 3300009094 Ga0111539_12071521 Ga0111539_120715212 101
657 3300009098 Ga0105245_10024841 Ga0105245_100248415 101
658 3300009098 Ga0105245_11322382 Ga0105245_113223822 101
659 3300009147 Ga0114129_11355901 Ga0114129_113559012 101
660 3300009148 Ga0105243_10002425 Ga0105243_100024257 101
661 3300009176 Ga0105242_10006248 Ga0105242_100062485 101
662 3300009176 Ga0105242_10305091 Ga0105242_103050913 101
663 3300009177 Ga0105248_10681694 Ga0105248_106816942 101
664 3300009553 Ga0105249_10049127 Ga0105249_100491276 101
665 3300013306 Ga0163162_10580090 Ga0163162_105800902 101
666 3300013307 Ga0157372_10338033 Ga0157372_103380332 101
667 3300013308 Ga0157375_10826088 Ga0157375_108260882 101
668 3300014326 Ga0157380_10005801 Ga0157380_100058012 101
669 3300014745 Ga0157377_10080238 Ga0157377_100802383 101
670 3300014969 Ga0157376_10079043 Ga0157376_100790432 101
671 3300017792 Ga0163161_10359575 Ga0163161_103595751 101
672 3300025885 Ga0207653_10042017 Ga0207653_100420172 101
673 3300025893 Ga0207682_10026622 Ga0207682_100266223 101
674 3300025899 Ga0207642_10008609 Ga0207642_100086093 101
675 3300025901 Ga0207688_10154182 Ga0207688_101541822 101
676 3300025907 Ga0207645_10054591 Ga0207645_100545912 101
677 3300025908 Ga0207643_10109580 Ga0207643_101095802 101
678 3300025912 Ga0207707_11010548 Ga0207707_110105482 101
679 3300025917 Ga0207660_10489759 Ga0207660_104897592 101
680 3300025918 Ga0207662_10070919 Ga0207662_100709193 101
681 3300025918 Ga0207662_10239084 Ga0207662_102390842 101
682 3300025922 Ga0207646_10470972 Ga0207646_104709722 101
683 3300025923 Ga0207681_10013210 Ga0207681_100132103 101
684 3300025925 Ga0207650_11494197 Ga0207650_114941972 101
685 3300025926 Ga0207659_10047713 Ga0207659_100477132 101
686 3300025927 Ga0207687_10029887 Ga0207687_100298874 101
687 3300025931 Ga0207644_11312588 Ga0207644_113125882 101
688 3300025933 Ga0207706_10307885 Ga0207706_103078852 101
689 3300025935 Ga0207709_11653259 Ga0207709_116532592 101
690 3300025936 Ga0207670_10018384 Ga0207670_100183842 101
691 3300025937 Ga0207669_10104538 Ga0207669_101045382 101
692 3300025937 Ga0207669_11354190 Ga0207669_113541902 101
693 3300025938 Ga0207704_10011015 Ga0207704_100110151 101
694 3300025938 Ga0207704_11904836 Ga0207704_119048361 101
695 3300025940 Ga0207691_10037545 Ga0207691_100375456 101
696 3300025942 Ga0207689_10108288 Ga0207689_101082882 101
697 3300025945 Ga0207679_10544100 Ga0207679_105441002 101
698 3300025960 Ga0207651_10153936 Ga0207651_101539362 101
699 3300025961 Ga0207712_12111792 Ga0207712_121117922 101
700 3300025972 Ga0207668_10007526 Ga0207668_100075266 101
701 3300025981 Ga0207640_10431519 Ga0207640_104315191 101
702 3300025981 Ga0207640_11063617 Ga0207640_110636172 101
703 3300026023 Ga0207677_10513924 Ga0207677_105139242 101
704 3300026035 Ga0207703_10999934 Ga0207703_109999341 101
705 3300026075 Ga0207708_10002536 Ga0207708_100025361 101
706 3300026075 Ga0207708_10159046 Ga0207708_101590462 101
707 3300026075 Ga0207708_10394572 Ga0207708_103945721 101
708 3300026075 Ga0207708_10834841 Ga0207708_108348412 101
709 3300026088 Ga0207641_10871257 Ga0207641_108712572 101
710 3300026088 Ga0207641_12291666 Ga0207641_122916662 101
711 3300026089 Ga0207648_10012144 Ga0207648_100121441 101
712 3300026089 Ga0207648_10891868 Ga0207648_108918682 101
713 3300026116 Ga0207674_10396770 Ga0207674_103967702 101
714 3300026118 Ga0207675_100001853 Ga0207675_10000185312 101
715 3300026118 Ga0207675_100268847 Ga0207675_1002688472 101
716 3300026121 Ga0207683_10194654 Ga0207683_101946542 101
717 3300027907 Ga0207428_10008206 Ga0207428_100082064 101
718 3300027907 Ga0207428_10132309 Ga0207428_101323092 101
719 3300028380 Ga0268265_10000606 Ga0268265_1000060637 101
720 3300028380 Ga0268265_10230804 Ga0268265_102308042 101
721 3300031548 Ga0307408_100181728 Ga0307408_1001817283 101
722 3300031691 Ga0316579_10000015 Ga0316579_100000156 101
723 3300031728 Ga0316578_10005745 Ga0316578_100057458 101
724 3300031824 Ga0307413_10976700 Ga0307413_109767002 101
725 3300031903 Ga0307407_10500016 Ga0307407_105000162 101
726 3300031911 Ga0307412_10372141 Ga0307412_103721412 101
727 3300031911 Ga0307412_10911307 Ga0307412_109113072 101
728 3300032002 Ga0307416_101562953 Ga0307416_1015629532 101
729 3300032005 Ga0307411_10125767 Ga0307411_101257673 101
730 3300032005 Ga0307411_11439750 Ga0307411_114397502 101
731 3300032133 Ga0316583_10000483 Ga0316583_100004834 101
732 3300032133 Ga0316583_10004823 Ga0316583_100048235 101
733 3300035085 Ga0373929_0118124 Ga0373929_0118124_90_401 101
734 3300035086 Ga0373934_0440898 Ga0373934_0440898_211_522 101
735 3300035113 Ga0373936_0025745 Ga0373936_0025745_1952_2272 101
736 3300035115 Ga0373941_0040943 Ga0373941_0040943_1050_1361 101
737 3300035117 Ga0373953_0140382 Ga0373953_0140382_147_467 101
738 3300035121 Ga0373960_0051783 Ga0373960_0051783_821_1132 101
739 3300035242 Ga0373962_0390465 Ga0373962_0390465_32_343 101
740 3300035692 Ga0373935_0036900 Ga0373935_0036900_2086_2406 101
741 3300035692 Ga0373935_1004514 Ga0373935_1004514_188_499 101
742 3300035695 Ga0373927_0018661 Ga0373927_0018661_730_1050 101
743 3300035724 Ga0373933_0247749 Ga0373933_0247749_512_823 101
744 3300036401 Ga0373937_0347205 Ga0373937_0347205_338_658 101
745 3300036647 Ga0316582_0003674 Ga0316582_0003674_2792_3103 101
746 3300036712 Ga0316584_0514716 Ga0316584_0514716_142_453 101
747 3300037068 Ga0373925_0071100 Ga0373925_0071100_270_590 101
748 3300037588 Ga0316581_0001262 Ga0316581_0001262_159_470 101
749 3300041460 Ga0451802_1603895 Ga0451802_1603895_138_452 101
750 3300041486 Ga0451807_0680206 Ga0451807_0680206_1024_1338 101
751 3300045051 Ga0451576_1110250 Ga0451576_1110250_42_362 101
752 3300046528 Ga0495642_0276100 Ga0495642_0276100_100_411 101
753 3300046539 Ga0495621_0194908 Ga0495621_0194908_411_722 101
754 3300046684 Ga0495669_0170482 Ga0495669_0170482_106_417 101
755 3300048090 Ga0495615_0182378 Ga0495615_0182378_26_337 101
756 3300049514 Ga0501291_011127 Ga0501291_011127_167_478 101
757 3300049521 Ga0501298_122829 Ga0501298_122829_129_440 101
758 3300049574 Ga0501038_0945091 Ga0501038_0945091_14_325 101
759 3300049584 Ga0501068_0078372 Ga0501068_0078372_347_658 101
760 3300049589 Ga0501073_0020687 Ga0501073_0020687_3133_3444 101
761 3300049589 Ga0501073_0044227 Ga0501073_0044227_1297_1608 101
762 3300049589 Ga0501073_0658564 Ga0501073_0658564_128_439 101
763 3300049665 Ga0501227_214815 Ga0501227_214815_91_402 101
764 3300049668 Ga0501233_080143 Ga0501233_080143_182_493 101
765 3300049670 Ga0501236_108293 Ga0501236_108293_12_323 101
766 3300049706 Ga0501229_025299 Ga0501229_025299_298_609 101
767 3300049742 Ga0501080_0440280 Ga0501080_0440280_809_1120 101
768 3300049742 Ga0501080_0553069 Ga0501080_0553069_76_387 101
769 3300049760 Ga0501263_030547 Ga0501263_030547_109_420 101
770 3300050508 nmdc:mga09592_310877_c1 nmdc:mga09592_310877_c1_879_1190 101
771 3300050509 nmdc:mga0qj67_48258_c1 nmdc:mga0qj67_48258_c1_108_419 101
772 3300050510 nmdc:mga06r32_45053_c1 nmdc:mga06r32_45053_c1_2336_2647 101
773 3300050510 nmdc:mga06r32_500298_c1 nmdc:mga06r32_500298_c1_169_480 101
774 3300050511 nmdc:mga08y16_12222_c1 nmdc:mga08y16_12222_c1_2314_2625 101
775 3300050511 nmdc:mga08y16_12995_c1 nmdc:mga08y16_12995_c1_5089_5400 101
776 3300050511 nmdc:mga08y16_594708_c1 nmdc:mga08y16_594708_c1_110_421 101
777 3300050512 nmdc:mga0n895_2090538_c1 nmdc:mga0n895_2090538_c1_196_507 101
778 3300054114 Ga0501084_1015371 Ga0501084_1015371_256_567 101
779 iso_pu_bacteria 2510065045 2510253128 101
780 iso_pu_bacteria 2512047030 2512347298 101
781 iso_pu_bacteria 2515154122 2515681724 101
782 iso_pu_bacteria 2718217991 2719638918 101
783 iso_pu_bacteria 2885270888 2885274158 101
784 iso_pu_bacteria 2902682994 2902689043 101
785 iso_pu_bacteria 8055266321 8055268098 101
786 3300005549 Ga0070704_102207376 Ga0070704_1022073761 102
787 3300007076 Ga0075435_100500327 Ga0075435_1005003272 102
788 3300009094 Ga0111539_10207000 Ga0111539_102070002 102
789 3300026095 Ga0207676_10202340 Ga0207676_102023402 102
790 3300031548 Ga0307408_101444943 Ga0307408_1014449432 102
791 3300035111 Ga0373923_0625352 Ga0373923_0625352_17_331 102
792 3300035118 Ga0373954_0000002 Ga0373954_0000002_44670_44984 102
793 3300035120 Ga0373957_0205146 Ga0373957_0205146_257_571 102
794 3300035172 Ga0373955_0136521 Ga0373955_0136521_64_378 102
795 3300035207 Ga0373942_0320732 Ga0373942_0320732_217_531 102
796 3300036401 Ga0373937_0000358 Ga0373937_0000358_7224_7538 102
797 3300036712 Ga0316584_0099029 Ga0316584_0099029_750_1067 102
798 3300046491 Ga0495584_0164912 Ga0495584_0164912_413_727 102
799 3300046539 Ga0495621_0054065 Ga0495621_0054065_846_1160 102
800 3300046539 Ga0495621_0105592 Ga0495621_0105592_585_899 102
801 3300046557 Ga0495622_0407801 Ga0495622_0407801_122_436 102
802 3300046559 Ga0495667_0230855 Ga0495667_0230855_774_1088 102
803 3300046664 Ga0495659_0394030 Ga0495659_0394030_23_337 102
804 3300049573 Ga0501037_0918886 Ga0501037_0918886_53_367 102
805 3300049575 Ga0501039_0020140 Ga0501039_0020140_244_558 102
806 3300049576 Ga0501040_0609611 Ga0501040_0609611_287_601 102
807 3300049577 Ga0501041_0063052 Ga0501041_0063052_311_625 102
808 3300049587 Ga0501071_0000992 Ga0501071_0000992_9331_9645 102
809 3300049588 Ga0501072_0039301 Ga0501072_0039301_2857_3171 102
810 3300049589 Ga0501073_0014106 Ga0501073_0014106_3713_4027 102
811 3300049590 Ga0501074_0613353 Ga0501074_0613353_169_483 102
812 3300049591 Ga0501075_0004058 Ga0501075_0004058_2660_2974 102
813 3300049592 Ga0501076_0007046 Ga0501076_0007046_5277_5591 102
814 3300049742 Ga0501080_0000702 Ga0501080_0000702_20059_20373 102
815 3300049742 Ga0501080_0165598 Ga0501080_0165598_1453_1770 102
816 3300049743 Ga0501081_0017373 Ga0501081_0017373_4411_4725 102
817 3300049823 Ga0501044_0930798 Ga0501044_0930798_257_571 102
818 3300049824 Ga0501045_0202285 Ga0501045_0202285_989_1303 102
819 3300050511 nmdc:mga08y16_1773734_c1 nmdc:mga08y16_1773734_c1_35_349 102
820 3300050512 nmdc:mga0n895_13666_c1 nmdc:mga0n895_13666_c1_3428_3742 102
821 3300050513 nmdc:mga0rr50_367362_c1 nmdc:mga0rr50_367362_c1_681_995 102
822 3300050515 nmdc:mga0a205_573741_c1 nmdc:mga0a205_573741_c1_281_595 102
823 3300060353 Ga0501082_0023335 Ga0501082_0023335_4387_4701 102
824 3300060353 Ga0501082_1509367 Ga0501082_1509367_47_361 102
825 iso_pu_bacteria 2501025502 2501080264 102
826 iso_pu_bacteria 2510917013 2511089759 102
827 iso_pu_bacteria 2510917014 2511095156 102
828 iso_pu_bacteria 2510917015 2511104815 102
829 iso_pu_bacteria 2513237082 2513551329 102
830 iso_pu_bacteria 2513237083 2513559971 102
831 iso_pu_bacteria 2515154189 2516016732 102
832 iso_pu_bacteria 2808606384 2808968391 102
833 iso_pu_bacteria 2808606390 2809003222 102
834 iso_pu_bacteria 2808606391 2809010499 102
835 iso_pu_bacteria 2856287931 2856293193 102
836 iso_pu_bacteria 2857357740 2857366690 102
837 iso_pu_bacteria 2883087390 2883090586 102
838 iso_pu_bacteria 8003955200 8003957236 102
839 3300003771 Ga0055526_1000149 Ga0055526_100014914 103
840 3300005344 Ga0070661_101770516 Ga0070661_1017705161 103
841 3300005563 Ga0068855_102032307 Ga0068855_1020323071 103
842 3300006173 Ga0070716_100453044 Ga0070716_1004530441 103
843 3300009036 Ga0105244_10001943 Ga0105244_100019433 103
844 3300015261 Ga0182006_1000216 Ga0182006_10002168 103
845 3300015265 Ga0182005_1000119 Ga0182005_10001198 103
846 3300025233 Ga0209437_101838 Ga0209437_1018384 103
847 3300025246 Ga0209646_1000384 Ga0209646_100038413 103
848 3300025250 Ga0209026_1044080 Ga0209026_10440802 103
849 3300025295 Ga0209564_1000010 Ga0209564_1000010776 103
850 3300025295 Ga0209564_1001321 Ga0209564_10013218 103
851 3300025728 Ga0207655_1007846 Ga0207655_10078467 103
852 3300025893 Ga0207682_10612067 Ga0207682_106120671 103
853 3300027111 Ga0209281_1004553 Ga0209281_10045535 103
854 3300028794 Ga0307515_10525023 Ga0307515_105250232 103
855 3300031456 Ga0307513_10436371 Ga0307513_104363712 103
856 3300035398 Ga0316574_0225932 Ga0316574_0225932_296_613 103
857 3300035725 Ga0373947_0838267 Ga0373947_0838267_65_382 103
858 3300036712 Ga0316584_0188920 Ga0316584_0188920_104_418 103
859 3300037312 Ga0395899_0004310 Ga0395899_0004310_1391_1708 103
860 3300037418 Ga0395900_0006117 Ga0395900_0006117_12133_12450 103
861 3300037418 Ga0395900_0270883 Ga0395900_0270883_339_656 103
862 3300037466 Ga0395898_0298265 Ga0395898_0298265_642_959 103
863 3300037466 Ga0395898_1603184 Ga0395898_1603184_175_492 103
864 3300037471 Ga0395905_0035171 Ga0395905_0035171_3959_4276 103
865 3300038443 Ga0395901_0085802 Ga0395901_0085802_23_340 103
866 3300038443 Ga0395901_0255660 Ga0395901_0255660_1447_1764 103
867 3300038443 Ga0395901_0661644 Ga0395901_0661644_433_750 103
868 3300046452 Ga0495617_004040 Ga0495617_004040_1738_2055 103
869 3300046471 Ga0495650_0001544 Ga0495650_0001544_6584_6901 103
870 3300046471 Ga0495650_0003055 Ga0495650_0003055_6621_6944 103
871 3300046474 Ga0495605_0000635 Ga0495605_0000635_20002_20319 103
872 3300046506 Ga0495583_0005068 Ga0495583_0005068_4374_4691 103
873 3300046507 Ga0495606_0001517 Ga0495606_0001517_23855_24172 103
874 3300046512 Ga0495610_0003364 Ga0495610_0003364_907_1224 103
875 3300046520 Ga0495637_0010764 Ga0495637_0010764_2798_3115 103
876 3300046522 Ga0495643_0000891 Ga0495643_0000891_20168_20485 103
877 3300046524 Ga0495648_0019571 Ga0495648_0019571_351_668 103
878 3300046542 Ga0495597_0000288 Ga0495597_0000288_33731_34048 103
879 3300046558 Ga0495633_0001228 Ga0495633_0001228_6877_7194 103
880 3300046558 Ga0495633_0001987 Ga0495633_0001987_6723_7040 103
881 3300046616 Ga0495668_0006127 Ga0495668_0006127_6586_6903 103
882 3300046660 Ga0495625_0002229 Ga0495625_0002229_6711_7034 103
883 3300046660 Ga0495625_0426629 Ga0495625_0426629_318_635 103
884 3300046664 Ga0495659_0214696 Ga0495659_0214696_130_447 103
885 3300046678 Ga0495599_0798874 Ga0495599_0798874_59_376 103
886 3300046691 Ga0495670_0484820 Ga0495670_0484820_128_445 103
887 3300046692 Ga0495671_0069779 Ga0495671_0069779_619_936 103
888 3300046692 Ga0495671_0134307 Ga0495671_0134307_64_381 103
889 3300046694 Ga0495649_0001795 Ga0495649_0001795_5013_5330 103
890 3300046694 Ga0495649_0363175 Ga0495649_0363175_341_658 103
891 3300047318 Ga0495636_0037440 Ga0495636_0037440_1655_1972 103
892 3300047318 Ga0495636_0161940 Ga0495636_0161940_680_997 103
893 3300047320 Ga0495672_0001040 Ga0495672_0001040_16702_17019 103
894 3300047323 Ga0495683_0071477 Ga0495683_0071477_1076_1393 103
895 3300047445 Ga0495677_0140460 Ga0495677_0140460_261_578 103
896 3300047445 Ga0495677_0242725 Ga0495677_0242725_196_513 103
897 3300047472 Ga0495686_0105936 Ga0495686_0105936_103_420 103
898 3300048905 Ga0496102_0000082 Ga0496102_0000082_131986_132303 103
899 3300048905 Ga0496102_0047863 Ga0496102_0047863_3160_3477 103
900 3300048905 Ga0496102_1062859 Ga0496102_1062859_310_627 103
901 3300048906 Ga0496103_0066025 Ga0496103_0066025_933_1250 103
902 3300048906 Ga0496103_0347642 Ga0496103_0347642_89_406 103
903 3300048906 Ga0496103_0393577 Ga0496103_0393577_464_781 103
904 3300048910 Ga0496107_0379772 Ga0496107_0379772_662_979 103
905 3300048913 Ga0496110_0536630 Ga0496110_0536630_519_836 103
906 3300048914 Ga0496111_0523171 Ga0496111_0523171_11_328 103
907 3300048919 Ga0496116_0048615 Ga0496116_0048615_385_702 103
908 3300048923 Ga0496120_0173576 Ga0496120_0173576_710_1027 103
909 3300048925 Ga0496122_0046444 Ga0496122_0046444_2558_2875 103
910 3300048926 Ga0496123_0006778 Ga0496123_0006778_6743_7060 103
911 3300048927 Ga0496124_0358112 Ga0496124_0358112_209_526 103
912 3300048928 Ga0496125_0040546 Ga0496125_0040546_605_922 103
913 3300049459 Ga0495678_001082 Ga0495678_001082_11398_11715 103
914 3300049459 Ga0495678_243424 Ga0495678_243424_34_351 103
915 3300049656 Ga0501209_120950 Ga0501209_120950_411_731 103
916 3300049671 Ga0501238_036258 Ga0501238_036258_169_489 103
917 3300053118 Ga0500594_0081341 Ga0500594_0081341_495_812 103
918 3300053130 Ga0500642_0294423 Ga0500642_0294423_222_539 103
919 3300053145 Ga0500586_000619 Ga0500586_000619_6678_6995 103
920 3300059647 Ga0587079_106088 Ga0587079_106088_253_570 103
921 3300059649 Ga0587102_016759 Ga0587102_016759_407_724 103
922 3300060346 Ga0587111_0037126 Ga0587111_0037126_239_556 103
923 3300046455 Ga0495603_0225283 Ga0495603_0225283_77_400 104
924 3300046491 Ga0495584_0027265 Ga0495584_0027265_2504_2827 104
925 3300046492 Ga0495585_0024699 Ga0495585_0024699_2501_2824 104
926 3300046501 Ga0495607_0249086 Ga0495607_0249086_126_449 104
927 3300046507 Ga0495606_0352355 Ga0495606_0352355_137_460 104
928 3300046518 Ga0495631_0017774 Ga0495631_0017774_2710_3033 104
929 3300046542 Ga0495597_0001250 Ga0495597_0001250_12277_12600 104
930 3300046558 Ga0495633_0058546 Ga0495633_0058546_1041_1364 104
931 3300046648 Ga0495611_0011338 Ga0495611_0011338_2835_3158 104
932 3300046691 Ga0495670_0003908 Ga0495670_0003908_1701_2024 104
933 3300046794 Ga0495589_0041328 Ga0495589_0041328_1325_1648 104
934 3300047318 Ga0495636_0001239 Ga0495636_0001239_2561_2884 104
935 3300047323 Ga0495683_0276296 Ga0495683_0276296_393_716 104
936 3300047445 Ga0495677_0019685 Ga0495677_0019685_367_690 104
937 3300001989 JGI24739J22299_10090089 JGI24739J22299_100900892 105
938 3300001990 JGI24737J22298_10235586 JGI24737J22298_102355862 105
939 3300002705 JGI25156J39149_1052173 JGI25156J39149_10521732 105
940 3300003316 rootH1_10054400 rootH1_100544004 105
941 3300003322 rootL2_10349020 rootL2_103490202 105
942 3300003323 rootH1_10132885 rootH1_101328852 105
943 3300003760 Ga0055527_1002500 Ga0055527_10025002 105
944 3300003761 Ga0055535_1004905 Ga0055535_10049052 105
945 3300003762 Ga0055542_1035846 Ga0055542_10358462 105
946 3300003763 Ga0055529_1026361 Ga0055529_10263611 105
947 3300005455 Ga0070663_100001918 Ga0070663_1000019183 105
948 3300005457 Ga0070662_101068537 Ga0070662_1010685372 105
949 3300005539 Ga0068853_100388817 Ga0068853_1003888172 105
950 3300005539 Ga0068853_101408921 Ga0068853_1014089212 105
951 3300025228 Ga0209672_100041 Ga0209672_1000418 105
952 3300025229 Ga0209147_100866 Ga0209147_10086613 105
953 3300025242 Ga0209258_100822 Ga0209258_10082213 105
954 3300025254 Ga0209148_1001387 Ga0209148_10013878 105
955 3300025256 Ga0209759_1056599 Ga0209759_10565991 105
956 3300025272 Ga0209455_1007106 Ga0209455_10071064 105
957 3300025904 Ga0207647_10009548 Ga0207647_100095482 105
958 3300025909 Ga0207705_10875486 Ga0207705_108754862 105
959 3300025914 Ga0207671_10035591 Ga0207671_100355914 105
960 3300025933 Ga0207706_10463432 Ga0207706_104634322 105
961 3300025949 Ga0207667_10131745 Ga0207667_101317452 105
962 3300026067 Ga0207678_10000013 Ga0207678_1000001398 105
963 3300028800 Ga0265338_10000344 Ga0265338_1000034468 105
964 3300030083 Ga0237817_12217 Ga0237817_122171 105
965 3300039438 Ga0436360_0635523 Ga0436360_0635523_97_423 105
966 3300039447 Ga0436361_1182555 Ga0436361_1182555_100_483 105
967 3300044706 Ga0466964_0138052 Ga0466964_0138052_218_541 105
968 3300044842 Ga0466957_0344334 Ga0466957_0344334_549_872 105
969 3300045976 Ga0466967_1158875 Ga0466967_1158875_300_623 105
970 3300046463 Ga0495653_0359564 Ga0495653_0359564_125_448 105
971 3300046471 Ga0495650_0003627 Ga0495650_0003627_6070_6393 105
972 3300046472 Ga0495580_0026867 Ga0495580_0026867_154_477 105
973 3300046529 Ga0495652_0678468 Ga0495652_0678468_248_571 105
974 3300046678 Ga0495599_0229993 Ga0495599_0229993_678_1001 105
975 3300046680 Ga0495646_0223782 Ga0495646_0223782_418_741 105
976 3300047317 Ga0495604_0150888 Ga0495604_0150888_1312_1635 105
977 3300047319 Ga0495674_0011089 Ga0495674_0011089_1430_1753 105
978 3300047322 Ga0495680_0284998 Ga0495680_0284998_693_1016 105
979 3300048088 Ga0495602_0030492 Ga0495602_0030492_3882_4205 105
980 3300048918 Ga0496115_0471551 Ga0496115_0471551_322_648 105
981 3300049460 Ga0495682_0080302 Ga0495682_0080302_713_1036 105

Structural Annotation

Top 5 Hits

ID Description Score Start End
5abr-assembly1.cif.gz_B structure of fesi protein from azotobacter vinelandii 0.9382 7 105
7p8n-assembly1.cif.gz_b tmhydabc- t. maritima hydrogenase with bridge closed 0.9222 7 103
7p8n-assembly1.cif.gz_B tmhydabc- t. maritima hydrogenase with bridge closed 0.9167 7 103
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.9121 7 103
7q4v-assembly1.cif.gz_B electron bifurcating hydrogenase - hydabc from a. woodii 0.9107 3 105
ID Description Score Start End Superfamily
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9382 7 105 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.894 7 105 3.40.30.10
af_Q55BP2_216_308_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8774 7 105 3.40.30.10
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.87 7 105 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8606 7 105 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2Z6TL74-F1-model_v4 deleted 0.9952 34 105
AF-B9B3A7-F1-model_v4 deleted 0.9951 1 105
AF-A2VV29-F1-model_v4 deleted 0.9943 1 105
AF-A0A5E4S288-F1-model_v4 Ferredoxin, 2Fe-2S 0.9929 1 105
AF-A0A5Q4GE00-F1-model_v4 (2Fe-2S) ferredoxin domain-containing protein 0.9927 3 105

Feature Viewer

pLDDT pTM Quality
96.16 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map