F487398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 981 | 444 | 961 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_1182555|Ga0436361_1182555_100_483 |
| Length | 127 |
| Sequence | MPAQGVLSVSRTRFPHTPVTMDSFYKYHVFFCLNQRDPGADRPSCANCNAQAMQEYAKKRVKQLGLAGPGQVHINKAGCLDRCEEGPAVVVYPEGTWYTYIDESDIDEIVVSHLQNGQVVERLKIDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 5 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 6 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 7 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 8 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 9 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 10 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 11 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 12 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 13 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 14 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 15 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 16 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 17 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 18 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 19 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 22 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 23 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 117 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 231 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 237 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 238 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 239 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 240 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 248 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 249 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 250 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 252 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 257 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 266 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 273 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 277 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 278 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 279 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 281 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 282 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 284 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 285 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 286 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 287 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 288 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 289 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 290 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 291 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 292 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 295 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 296 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 297 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 298 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 299 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 300 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 301 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 302 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 303 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 304 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 305 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 306 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 307 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 308 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 309 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 312 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 313 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 367 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 368 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 372 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 373 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 374 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 375 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 376 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 377 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 378 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 379 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 380 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 383 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 384 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 385 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 408 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 409 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 410 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 411 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 412 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 413 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 414 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 419 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 420 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 434 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 435 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 436 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 437 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 439 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 444 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.45 |
| Metatranscriptomes | 0.41 |
| Isolates | 2.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0.92 |
| Rhizoplane | 1.94 |
| Rhizosphere | 92.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10090089 | 3300001989 | Bacteria | 934 |
| 2 | JGI24737J22298_10235586 | 3300001990 | Bacteria | 540 |
| 3 | JGI25156J39149_1052173 | 3300002705 | Bacteria | 534 |
| 4 | rootH1_10054400 | 3300003316 | Bacteria | 2871 |
| 5 | rootL2_10349020 | 3300003322 | Bacteria | 1136 |
| 6 | rootH1_10132885 | 3300003316 | Bacteria | 1512 |
| 7 | rootH1_10132885 | 3300003323 | Bacteria | 4122 |
| 8 | Ga0055527_1002500 | 3300003760 | Bacteria | 3093 |
| 9 | Ga0055535_1004905 | 3300003761 | Bacteria | 3093 |
| 10 | Ga0055542_1035846 | 3300003762 | Bacteria | 608 |
| 11 | Ga0055529_1026361 | 3300003763 | Bacteria | 717 |
| 12 | Ga0055526_1000149 | 3300003771 | Bacteria | 61682 |
| 13 | Ga0065707_10603957 | 3300005295 | Bacteria | 688 |
| 14 | Ga0070658_10065736 | 3300005327 | Bacteria | 2961 |
| 15 | Ga0070676_10001435 | 3300005328 | Bacteria | 12035 |
| 16 | Ga0070676_10247279 | 3300005328 | Bacteria | 1189 |
| 17 | Ga0070676_10321729 | 3300005328 | Bacteria | 1055 |
| 18 | Ga0070676_10331220 | 3300005328 | Bacteria | 1041 |
| 19 | Ga0070683_100069027 | 3300005329 | Bacteria | 3294 |
| 20 | Ga0070690_100776109 | 3300005330 | Bacteria | 742 |
| 21 | Ga0070670_100003563 | 3300005331 | Bacteria | 12943 |
| 22 | Ga0070670_100010188 | 3300005331 | Bacteria | 8021 |
| 23 | Ga0070670_100039316 | 3300005331 | Bacteria | 4068 |
| 24 | Ga0070670_100136031 | 3300005331 | Bacteria | 2124 |
| 25 | Ga0070670_100261144 | 3300005331 | Bacteria | 1510 |
| 26 | Ga0070670_100332215 | 3300005331 | Bacteria | 1333 |
| 27 | Ga0070670_100750698 | 3300005331 | Unclassified | 879 |
| 28 | Ga0070677_10000343 | 3300005333 | Bacteria | 16239 |
| 29 | Ga0068869_100009083 | 3300005334 | Bacteria | 6441 |
| 30 | Ga0068869_100039879 | 3300005334 | Bacteria | 3355 |
| 31 | Ga0068869_101066159 | 3300005334 | Bacteria | 706 |
| 32 | Ga0070666_10530612 | 3300005335 | Unclassified | 855 |
| 33 | Ga0070680_100047758 | 3300005336 | Bacteria | 3486 |
| 34 | Ga0070682_101119016 | 3300005337 | Bacteria | 660 |
| 35 | Ga0068868_100015555 | 3300005338 | Bacteria | 5630 |
| 36 | Ga0068868_100205658 | 3300005338 | Bacteria | 1643 |
| 37 | Ga0068868_101003437 | 3300005338 | Bacteria | 764 |
| 38 | Ga0070689_100044203 | 3300005340 | Bacteria | 3426 |
| 39 | Ga0070689_100233871 | 3300005340 | Bacteria | 1511 |
| 40 | Ga0070689_100372085 | 3300005340 | Bacteria | 1202 |
| 41 | Ga0070689_100494696 | 3300005340 | Bacteria | 1047 |
| 42 | Ga0070689_100797461 | 3300005340 | Unclassified | 830 |
| 43 | Ga0070687_100105981 | 3300005343 | Bacteria | 1583 |
| 44 | Ga0070661_101770516 | 3300005344 | Bacteria | 524 |
| 45 | Ga0070692_10007318 | 3300005345 | Bacteria | 4859 |
| 46 | Ga0070692_10042581 | 3300005345 | Bacteria | 2332 |
| 47 | Ga0070692_10050336 | 3300005345 | Bacteria | 2163 |
| 48 | Ga0070692_10378737 | 3300005345 | Bacteria | 887 |
| 49 | Ga0070668_100006797 | 3300005347 | Bacteria | 8481 |
| 50 | Ga0070668_100010955 | 3300005347 | Bacteria | 6747 |
| 51 | Ga0070668_100025704 | 3300005347 | Bacteria | 4466 |
| 52 | Ga0070668_100027239 | 3300005347 | Bacteria | 4339 |
| 53 | Ga0070668_100110179 | 3300005347 | Bacteria | 2190 |
| 54 | Ga0070668_100259447 | 3300005347 | Bacteria | 1445 |
| 55 | Ga0070668_100274145 | 3300005347 | Bacteria | 1407 |
| 56 | Ga0070668_100638347 | 3300005347 | Bacteria | 935 |
| 57 | Ga0070668_101861703 | 3300005347 | Bacteria | 554 |
| 58 | Ga0070669_100002973 | 3300005353 | Bacteria | 12215 |
| 59 | Ga0070669_100021805 | 3300005353 | Bacteria | 4580 |
| 60 | Ga0070669_100251345 | 3300005353 | Bacteria | 1408 |
| 61 | Ga0070675_100003678 | 3300005354 | Bacteria | 11653 |
| 62 | Ga0070675_100012472 | 3300005354 | Bacteria | 6659 |
| 63 | Ga0070675_100024736 | 3300005354 | Bacteria | 4809 |
| 64 | Ga0070675_100027916 | 3300005354 | Bacteria | 4538 |
| 65 | Ga0070675_100029547 | 3300005354 | Bacteria | 4422 |
| 66 | Ga0070675_100283993 | 3300005354 | Bacteria | 1455 |
| 67 | Ga0070671_100000272 | 3300005355 | Bacteria | 34885 |
| 68 | Ga0070671_100008199 | 3300005355 | Bacteria | 8360 |
| 69 | Ga0070671_100270159 | 3300005355 | Bacteria | 1445 |
| 70 | Ga0070671_102058122 | 3300005355 | Unclassified | 508 |
| 71 | Ga0070674_100005249 | 3300005356 | Bacteria | 7458 |
| 72 | Ga0070674_100034622 | 3300005356 | Bacteria | 3375 |
| 73 | Ga0070674_101500840 | 3300005356 | Unclassified | 606 |
| 74 | Ga0070673_100001140 | 3300005364 | Bacteria | 15254 |
| 75 | Ga0070673_100026294 | 3300005364 | Bacteria | 4297 |
| 76 | Ga0070673_100072629 | 3300005364 | Bacteria | 2767 |
| 77 | Ga0070673_100121931 | 3300005364 | Unclassified | 2176 |
| 78 | Ga0070688_100354713 | 3300005365 | Bacteria | 1075 |
| 79 | Ga0070688_101516301 | 3300005365 | Bacteria | 546 |
| 80 | Ga0070659_100083041 | 3300005366 | Bacteria | 2560 |
| 81 | Ga0070659_101152340 | 3300005366 | Bacteria | 684 |
| 82 | Ga0070667_100052861 | 3300005367 | Bacteria | 3428 |
| 83 | Ga0070667_100140760 | 3300005367 | Bacteria | 2113 |
| 84 | Ga0070667_100634378 | 3300005367 | Bacteria | 986 |
| 85 | Ga0070703_10044843 | 3300005406 | Bacteria | 1392 |
| 86 | Ga0070714_102010201 | 3300005435 | Bacteria | 564 |
| 87 | Ga0070713_100225309 | 3300005436 | Bacteria | 1702 |
| 88 | Ga0070701_10121258 | 3300005438 | Bacteria | 1473 |
| 89 | Ga0070701_10201152 | 3300005438 | Bacteria | 1178 |
| 90 | Ga0070705_100016156 | 3300005440 | Bacteria | 3874 |
| 91 | Ga0070705_100020022 | 3300005440 | Bacteria | 3532 |
| 92 | Ga0070705_100036344 | 3300005440 | Bacteria | 2769 |
| 93 | Ga0070705_100115744 | 3300005440 | Bacteria | 1722 |
| 94 | Ga0070700_100001031 | 3300005441 | Bacteria | 13767 |
| 95 | Ga0070700_100268752 | 3300005441 | Bacteria | 1231 |
| 96 | Ga0070700_100285341 | 3300005441 | Unclassified | 1199 |
| 97 | Ga0070700_100306351 | 3300005441 | Bacteria | 1161 |
| 98 | Ga0070700_100365933 | 3300005441 | Bacteria | 1073 |
| 99 | Ga0070694_100028846 | 3300005444 | Bacteria | 3615 |
| 100 | Ga0070694_100040671 | 3300005444 | Bacteria | 3099 |
| 101 | Ga0070694_100067401 | 3300005444 | Bacteria | 2457 |
| 102 | Ga0070694_100502819 | 3300005444 | Bacteria | 965 |
| 103 | Ga0070694_100809555 | 3300005444 | Bacteria | 769 |
| 104 | Ga0070663_100001918 | 3300005455 | Bacteria | 11608 |
| 105 | Ga0070663_100027027 | 3300005455 | Bacteria | 3892 |
| 106 | Ga0070678_100085002 | 3300005456 | Bacteria | 2410 |
| 107 | Ga0070678_100098340 | 3300005456 | Bacteria | 2262 |
| 108 | Ga0070678_100184096 | 3300005456 | Bacteria | 1712 |
| 109 | Ga0070678_101195126 | 3300005456 | Bacteria | 705 |
| 110 | Ga0070662_100014326 | 3300005457 | Bacteria | 5295 |
| 111 | Ga0070662_100374375 | 3300005457 | Bacteria | 1171 |
| 112 | Ga0070662_101068537 | 3300005457 | Bacteria | 692 |
| 113 | Ga0070681_10004336 | 3300005458 | Bacteria | 13482 |
| 114 | Ga0070681_10232956 | 3300005458 | Bacteria | 1756 |
| 115 | Ga0070681_10685450 | 3300005458 | Bacteria | 940 |
| 116 | Ga0068867_100002138 | 3300005459 | Bacteria | 13877 |
| 117 | Ga0068867_100012234 | 3300005459 | Bacteria | 6065 |
| 118 | Ga0068867_100083659 | 3300005459 | Bacteria | 2409 |
| 119 | Ga0068867_100119410 | 3300005459 | Bacteria | 2035 |
| 120 | Ga0068867_100484352 | 3300005459 | Bacteria | 1060 |
| 121 | Ga0068867_100653289 | 3300005459 | Bacteria | 923 |
| 122 | Ga0070685_10191559 | 3300005466 | Bacteria | 1323 |
| 123 | Ga0070706_100169581 | 3300005467 | Bacteria | 2038 |
| 124 | Ga0070707_100796182 | 3300005468 | Bacteria | 909 |
| 125 | Ga0070698_100271956 | 3300005471 | Bacteria | 1626 |
| 126 | Ga0070698_100702411 | 3300005471 | Bacteria | 953 |
| 127 | Ga0070698_100770047 | 3300005471 | Bacteria | 906 |
| 128 | Ga0070699_101378827 | 3300005518 | Bacteria | 647 |
| 129 | Ga0070679_100449119 | 3300005530 | Bacteria | 1234 |
| 130 | Ga0070679_100778638 | 3300005530 | Bacteria | 900 |
| 131 | Ga0070679_101976911 | 3300005530 | Bacteria | 532 |
| 132 | Ga0070684_100848038 | 3300005535 | Bacteria | 855 |
| 133 | Ga0070697_100033084 | 3300005536 | Bacteria | 4163 |
| 134 | Ga0068853_100004289 | 3300005539 | Bacteria | 11022 |
| 135 | Ga0068853_100388817 | 3300005539 | Bacteria | 1304 |
| 136 | Ga0068853_101408921 | 3300005539 | Bacteria | 674 |
| 137 | Ga0070672_100054860 | 3300005543 | Bacteria | 3121 |
| 138 | Ga0070672_100088452 | 3300005543 | Bacteria | 2494 |
| 139 | Ga0070672_100143722 | 3300005543 | Bacteria | 1970 |
| 140 | Ga0070672_100250812 | 3300005543 | Bacteria | 1491 |
| 141 | Ga0070672_100258234 | 3300005543 | Unclassified | 1469 |
| 142 | Ga0070672_100514592 | 3300005543 | Bacteria | 1036 |
| 143 | Ga0070672_100580341 | 3300005543 | Bacteria | 975 |
| 144 | Ga0070672_101403050 | 3300005543 | Bacteria | 625 |
| 145 | Ga0070672_101659165 | 3300005543 | Bacteria | 574 |
| 146 | Ga0070686_100073813 | 3300005544 | Bacteria | 2240 |
| 147 | Ga0070686_100643806 | 3300005544 | Unclassified | 840 |
| 148 | Ga0070695_100000362 | 3300005545 | Bacteria | 23307 |
| 149 | Ga0070695_100041788 | 3300005545 | Bacteria | 2908 |
| 150 | Ga0070695_100200820 | 3300005545 | Bacteria | 1425 |
| 151 | Ga0070695_100334984 | 3300005545 | Bacteria | 1129 |
| 152 | Ga0070695_100394208 | 3300005545 | Bacteria | 1048 |
| 153 | Ga0070695_100634511 | 3300005545 | Bacteria | 842 |
| 154 | Ga0070696_100000505 | 3300005546 | Bacteria | 24609 |
| 155 | Ga0070696_100053479 | 3300005546 | Bacteria | 2811 |
| 156 | Ga0070696_100161151 | 3300005546 | Bacteria | 1653 |
| 157 | Ga0070696_100196947 | 3300005546 | Bacteria | 1502 |
| 158 | Ga0070696_100421529 | 3300005546 | Bacteria | 1048 |
| 159 | Ga0070696_101117185 | 3300005546 | Bacteria | 663 |
| 160 | Ga0070696_102012307 | 3300005546 | Bacteria | 502 |
| 161 | Ga0070693_100140515 | 3300005547 | Bacteria | 1520 |
| 162 | Ga0070693_100578294 | 3300005547 | Bacteria | 808 |
| 163 | Ga0070693_100595189 | 3300005547 | Bacteria | 798 |
| 164 | Ga0070693_101221868 | 3300005547 | Bacteria | 578 |
| 165 | Ga0070665_100142453 | 3300005548 | Bacteria | 2400 |
| 166 | Ga0070665_100142944 | 3300005548 | Bacteria | 2396 |
| 167 | Ga0070665_100172776 | 3300005548 | Bacteria | 2162 |
| 168 | Ga0070665_100504639 | 3300005548 | Bacteria | 1221 |
| 169 | Ga0070665_100648163 | 3300005548 | Bacteria | 1069 |
| 170 | Ga0070665_100832906 | 3300005548 | Unclassified | 936 |
| 171 | Ga0070704_100016021 | 3300005549 | Bacteria | 4726 |
| 172 | Ga0070704_101142662 | 3300005549 | Bacteria | 709 |
| 173 | Ga0070704_102207376 | 3300005549 | Bacteria | 512 |
| 174 | Ga0068855_100511907 | 3300005563 | Bacteria | 1303 |
| 175 | Ga0068855_101961287 | 3300005563 | Bacteria | 592 |
| 176 | Ga0068855_102032307 | 3300005563 | Bacteria | 580 |
| 177 | Ga0070664_100036137 | 3300005564 | Bacteria | 4150 |
| 178 | Ga0070664_100439196 | 3300005564 | Bacteria | 1197 |
| 179 | Ga0070664_100987814 | 3300005564 | Bacteria | 791 |
| 180 | Ga0068857_100978731 | 3300005577 | Bacteria | 814 |
| 181 | Ga0068857_101698472 | 3300005577 | Unclassified | 617 |
| 182 | Ga0068854_100084706 | 3300005578 | Bacteria | 2346 |
| 183 | Ga0068854_100366708 | 3300005578 | Bacteria | 1183 |
| 184 | Ga0068854_100470663 | 3300005578 | Bacteria | 1053 |
| 185 | Ga0068854_100484517 | 3300005578 | Bacteria | 1039 |
| 186 | Ga0068856_100144536 | 3300005614 | Bacteria | 2386 |
| 187 | Ga0068856_100338379 | 3300005614 | Bacteria | 1523 |
| 188 | Ga0070702_100008243 | 3300005615 | Bacteria | 5036 |
| 189 | Ga0070702_100138509 | 3300005615 | Bacteria | 1547 |
| 190 | Ga0070702_100179160 | 3300005615 | Bacteria | 1385 |
| 191 | Ga0070702_100348826 | 3300005615 | Bacteria | 1042 |
| 192 | Ga0070702_100463840 | 3300005615 | Bacteria | 922 |
| 193 | Ga0070702_100583979 | 3300005615 | Bacteria | 835 |
| 194 | Ga0068852_100002156 | 3300005616 | Bacteria | 13522 |
| 195 | Ga0068852_101755589 | 3300005616 | Bacteria | 643 |
| 196 | Ga0068859_100024361 | 3300005617 | Bacteria | 6072 |
| 197 | Ga0068859_100680431 | 3300005617 | Bacteria | 1120 |
| 198 | Ga0068859_101040905 | 3300005617 | Unclassified | 899 |
| 199 | Ga0068859_102056068 | 3300005617 | Bacteria | 631 |
| 200 | Ga0068859_102283931 | 3300005617 | Bacteria | 597 |
| 201 | Ga0068859_102341637 | 3300005617 | Bacteria | 589 |
| 202 | Ga0068859_103146018 | 3300005617 | Bacteria | 503 |
| 203 | Ga0068864_100034508 | 3300005618 | Bacteria | 4303 |
| 204 | Ga0068864_100035655 | 3300005618 | Bacteria | 4236 |
| 205 | Ga0068864_100062455 | 3300005618 | Bacteria | 3227 |
| 206 | Ga0068864_100155302 | 3300005618 | Bacteria | 2076 |
| 207 | Ga0068864_100176547 | 3300005618 | Bacteria | 1951 |
| 208 | Ga0068864_101331595 | 3300005618 | Bacteria | 719 |
| 209 | Ga0068866_10321836 | 3300005718 | Bacteria | 973 |
| 210 | Ga0068866_10418662 | 3300005718 | Bacteria | 868 |
| 211 | Ga0068861_100001104 | 3300005719 | Bacteria | 16728 |
| 212 | Ga0068861_100086738 | 3300005719 | Bacteria | 2461 |
| 213 | Ga0068861_100210631 | 3300005719 | Bacteria | 1637 |
| 214 | Ga0068861_100242385 | 3300005719 | Bacteria | 1534 |
| 215 | Ga0068861_100336369 | 3300005719 | Bacteria | 1320 |
| 216 | Ga0068861_100715396 | 3300005719 | Bacteria | 932 |
| 217 | Ga0068861_100793843 | 3300005719 | Bacteria | 888 |
| 218 | Ga0068861_101379962 | 3300005719 | Unclassified | 688 |
| 219 | Ga0068851_10001153 | 3300005834 | Bacteria | 11457 |
| 220 | Ga0068851_10620193 | 3300005834 | Bacteria | 660 |
| 221 | Ga0068851_10979707 | 3300005834 | Bacteria | 533 |
| 222 | Ga0068870_10020819 | 3300005840 | Bacteria | 3200 |
| 223 | Ga0068870_10058629 | 3300005840 | Bacteria | 2061 |
| 224 | Ga0068870_10063872 | 3300005840 | Bacteria | 1987 |
| 225 | Ga0068870_10072546 | 3300005840 | Bacteria | 1881 |
| 226 | Ga0068870_10176719 | 3300005840 | Bacteria | 1278 |
| 227 | Ga0068863_100019911 | 3300005841 | Bacteria | 6418 |
| 228 | Ga0068863_100020923 | 3300005841 | Bacteria | 6248 |
| 229 | Ga0068863_100037554 | 3300005841 | Bacteria | 4611 |
| 230 | Ga0068863_100279781 | 3300005841 | Bacteria | 1616 |
| 231 | Ga0068863_100577917 | 3300005841 | Bacteria | 1111 |
| 232 | Ga0068858_100014384 | 3300005842 | Bacteria | 7460 |
| 233 | Ga0068858_100820756 | 3300005842 | Bacteria | 908 |
| 234 | Ga0068858_100908099 | 3300005842 | Bacteria | 861 |
| 235 | Ga0068860_100074707 | 3300005843 | Bacteria | 3224 |
| 236 | Ga0068860_100115727 | 3300005843 | Bacteria | 2564 |
| 237 | Ga0068860_100626423 | 3300005843 | Unclassified | 1082 |
| 238 | Ga0068860_100630676 | 3300005843 | Bacteria | 1079 |
| 239 | Ga0068862_100001798 | 3300005844 | Bacteria | 19403 |
| 240 | Ga0068862_100093345 | 3300005844 | Bacteria | 2624 |
| 241 | Ga0068862_100169713 | 3300005844 | Bacteria | 1953 |
| 242 | Ga0068862_100201451 | 3300005844 | Bacteria | 1795 |
| 243 | Ga0068862_100418843 | 3300005844 | Bacteria | 1256 |
| 244 | Ga0068862_100611945 | 3300005844 | Bacteria | 1047 |
| 245 | Ga0068862_101069913 | 3300005844 | Bacteria | 800 |
| 246 | Ga0070715_10714684 | 3300006163 | Bacteria | 600 |
| 247 | Ga0070716_100247135 | 3300006173 | Bacteria | 1213 |
| 248 | Ga0070716_100453044 | 3300006173 | Bacteria | 936 |
| 249 | Ga0075366_10567510 | 3300006195 | Bacteria | 703 |
| 250 | Ga0075366_10867145 | 3300006195 | Bacteria | 562 |
| 251 | Ga0097621_100013711 | 3300006237 | Bacteria | 6051 |
| 252 | Ga0097621_100014830 | 3300006237 | Bacteria | 5845 |
| 253 | Ga0097621_100116903 | 3300006237 | Bacteria | 2259 |
| 254 | Ga0097621_101322934 | 3300006237 | Bacteria | 681 |
| 255 | Ga0068871_100028272 | 3300006358 | Bacteria | 4395 |
| 256 | Ga0068871_100444041 | 3300006358 | Bacteria | 1162 |
| 257 | Ga0068871_100647272 | 3300006358 | Bacteria | 965 |
| 258 | Ga0068871_100964219 | 3300006358 | Bacteria | 793 |
| 259 | Ga0068871_100994484 | 3300006358 | Bacteria | 781 |
| 260 | Ga0068871_101823323 | 3300006358 | Bacteria | 578 |
| 261 | Ga0075428_100139214 | 3300006844 | Bacteria | 2638 |
| 262 | Ga0075428_100782575 | 3300006844 | Bacteria | 1014 |
| 263 | Ga0075428_101258707 | 3300006844 | Bacteria | 779 |
| 264 | Ga0075430_100003340 | 3300006846 | Bacteria | 13437 |
| 265 | Ga0075430_100626827 | 3300006846 | Bacteria | 887 |
| 266 | Ga0075430_101410397 | 3300006846 | Bacteria | 572 |
| 267 | Ga0075430_101444695 | 3300006846 | Bacteria | 565 |
| 268 | Ga0075431_100146664 | 3300006847 | Bacteria | 2432 |
| 269 | Ga0075431_100752966 | 3300006847 | Bacteria | 949 |
| 270 | Ga0075433_10231742 | 3300006852 | Bacteria | 1640 |
| 271 | Ga0075433_10255444 | 3300006852 | Bacteria | 1554 |
| 272 | Ga0075434_100100901 | 3300006871 | Bacteria | 2892 |
| 273 | Ga0075434_100697291 | 3300006871 | Bacteria | 1033 |
| 274 | Ga0075434_102366301 | 3300006871 | Bacteria | 533 |
| 275 | Ga0075429_100003041 | 3300006880 | Bacteria | 14216 |
| 276 | Ga0068865_100026154 | 3300006881 | Unclassified | 3845 |
| 277 | Ga0068865_100028722 | 3300006881 | Bacteria | 3683 |
| 278 | Ga0068865_100032078 | 3300006881 | Bacteria | 3507 |
| 279 | Ga0075436_100005116 | 3300006914 | Bacteria | 9027 |
| 280 | Ga0075436_100008567 | 3300006914 | Bacteria | 6989 |
| 281 | Ga0075436_100014985 | 3300006914 | Bacteria | 5315 |
| 282 | Ga0075436_100023095 | 3300006914 | Bacteria | 4271 |
| 283 | Ga0075436_100027380 | 3300006914 | Bacteria | 3923 |
| 284 | Ga0097620_100024361 | 3300006931 | Bacteria | 6072 |
| 285 | Ga0097620_100680472 | 3300006931 | Bacteria | 1120 |
| 286 | Ga0097620_101040940 | 3300006931 | Unclassified | 899 |
| 287 | Ga0097620_102055846 | 3300006931 | Bacteria | 631 |
| 288 | Ga0097620_102283865 | 3300006931 | Bacteria | 597 |
| 289 | Ga0097620_102342153 | 3300006931 | Bacteria | 589 |
| 290 | Ga0097620_103143761 | 3300006931 | Bacteria | 503 |
| 291 | Ga0075435_100048639 | 3300007076 | Bacteria | 3407 |
| 292 | Ga0075435_100153380 | 3300007076 | Bacteria | 1938 |
| 293 | Ga0075435_100441910 | 3300007076 | Bacteria | 1121 |
| 294 | Ga0075435_100500327 | 3300007076 | Bacteria | 1051 |
| 295 | Ga0075435_101044791 | 3300007076 | Bacteria | 714 |
| 296 | Ga0075435_101235768 | 3300007076 | Bacteria | 654 |
| 297 | Ga0099794_10192190 | 3300007265 | Bacteria | 1044 |
| 298 | Ga0105244_10001943 | 3300009036 | Bacteria | 16050 |
| 299 | Ga0111539_10068982 | 3300009094 | Bacteria | 4175 |
| 300 | Ga0111539_10169101 | 3300009094 | Bacteria | 2554 |
| 301 | Ga0111539_10207000 | 3300009094 | Bacteria | 2287 |
| 302 | Ga0111539_10241710 | 3300009094 | Bacteria | 2102 |
| 303 | Ga0111539_10764449 | 3300009094 | Bacteria | 1124 |
| 304 | Ga0111539_11322971 | 3300009094 | Bacteria | 836 |
| 305 | Ga0111539_11333324 | 3300009094 | Bacteria | 833 |
| 306 | Ga0111539_12071521 | 3300009094 | Bacteria | 660 |
| 307 | Ga0105245_10024073 | 3300009098 | Bacteria | 5346 |
| 308 | Ga0105245_10024841 | 3300009098 | Bacteria | 5265 |
| 309 | Ga0105245_10439406 | 3300009098 | Bacteria | 1311 |
| 310 | Ga0105245_10536860 | 3300009098 | Bacteria | 1190 |
| 311 | Ga0105245_11322382 | 3300009098 | Bacteria | 770 |
| 312 | Ga0105245_12026452 | 3300009098 | Bacteria | 629 |
| 313 | Ga0105247_10005196 | 3300009101 | Bacteria | 8231 |
| 314 | Ga0105247_10777281 | 3300009101 | Bacteria | 728 |
| 315 | Ga0114129_10281193 | 3300009147 | Bacteria | 2223 |
| 316 | Ga0114129_11355901 | 3300009147 | Bacteria | 879 |
| 317 | Ga0114129_12654672 | 3300009147 | Bacteria | 597 |
| 318 | Ga0105243_10002425 | 3300009148 | Bacteria | 15590 |
| 319 | Ga0105243_10171534 | 3300009148 | Bacteria | 1879 |
| 320 | Ga0105241_10742711 | 3300009174 | Bacteria | 899 |
| 321 | Ga0105241_11874651 | 3300009174 | Bacteria | 587 |
| 322 | Ga0105242_10006248 | 3300009176 | Bacteria | 9176 |
| 323 | Ga0105242_10196669 | 3300009176 | Bacteria | 1788 |
| 324 | Ga0105242_10305091 | 3300009176 | Bacteria | 1454 |
| 325 | Ga0105242_10429105 | 3300009176 | Bacteria | 1240 |
| 326 | Ga0105248_10000992 | 3300009177 | Bacteria | 31434 |
| 327 | Ga0105248_10088473 | 3300009177 | Bacteria | 3486 |
| 328 | Ga0105248_10341517 | 3300009177 | Bacteria | 1686 |
| 329 | Ga0105248_10681694 | 3300009177 | Bacteria | 1159 |
| 330 | Ga0105237_10016087 | 3300009545 | Bacteria | 7781 |
| 331 | Ga0105238_10957048 | 3300009551 | Bacteria | 876 |
| 332 | Ga0105249_10049127 | 3300009553 | Bacteria | 3847 |
| 333 | Ga0105249_11819985 | 3300009553 | Bacteria | 682 |
| 334 | Ga0105239_10377220 | 3300010375 | Bacteria | 1603 |
| 335 | Ga0105239_10450025 | 3300010375 | Unclassified | 1461 |
| 336 | Ga0105239_10605315 | 3300010375 | Bacteria | 1250 |
| 337 | Ga0105246_10034593 | 3300011119 | Unclassified | 3369 |
| 338 | Ga0105246_10723807 | 3300011119 | Bacteria | 875 |
| 339 | Ga0157371_11556417 | 3300013102 | Bacteria | 517 |
| 340 | Ga0157374_10072086 | 3300013296 | Unclassified | 3258 |
| 341 | Ga0157374_10163480 | 3300013296 | Bacteria | 2169 |
| 342 | Ga0157374_10180513 | 3300013296 | Bacteria | 2061 |
| 343 | Ga0157378_10211669 | 3300013297 | Bacteria | 1838 |
| 344 | Ga0157378_11127728 | 3300013297 | Unclassified | 822 |
| 345 | Ga0157378_11562892 | 3300013297 | Bacteria | 705 |
| 346 | Ga0157378_11805173 | 3300013297 | Bacteria | 660 |
| 347 | Ga0163162_10020397 | 3300013306 | Bacteria | 6512 |
| 348 | Ga0163162_10176898 | 3300013306 | Bacteria | 2259 |
| 349 | Ga0163162_10189891 | 3300013306 | Bacteria | 2182 |
| 350 | Ga0163162_10286935 | 3300013306 | Unclassified | 1778 |
| 351 | Ga0163162_10580090 | 3300013306 | Bacteria | 1248 |
| 352 | Ga0163162_11387607 | 3300013306 | Bacteria | 799 |
| 353 | Ga0163162_12037595 | 3300013306 | Unclassified | 658 |
| 354 | Ga0157372_10338033 | 3300013307 | Bacteria | 1754 |
| 355 | Ga0157375_10012622 | 3300013308 | Bacteria | 7497 |
| 356 | Ga0157375_10045551 | 3300013308 | Bacteria | 4270 |
| 357 | Ga0157375_10057193 | 3300013308 | Bacteria | 3854 |
| 358 | Ga0157375_10101514 | 3300013308 | Bacteria | 2960 |
| 359 | Ga0157375_10531471 | 3300013308 | Bacteria | 1339 |
| 360 | Ga0157375_10826088 | 3300013308 | Bacteria | 1074 |
| 361 | Ga0157375_11653512 | 3300013308 | Bacteria | 758 |
| 362 | Ga0157375_12394512 | 3300013308 | Bacteria | 630 |
| 363 | Ga0163163_10039634 | 3300014325 | Bacteria | 4599 |
| 364 | Ga0163163_10052788 | 3300014325 | Bacteria | 4011 |
| 365 | Ga0163163_10101835 | 3300014325 | Bacteria | 2894 |
| 366 | Ga0163163_10946256 | 3300014325 | Bacteria | 925 |
| 367 | Ga0157380_10005801 | 3300014326 | Bacteria | 8642 |
| 368 | Ga0157380_10041592 | 3300014326 | Bacteria | 3587 |
| 369 | Ga0157380_10200791 | 3300014326 | Bacteria | 1769 |
| 370 | Ga0157380_10778776 | 3300014326 | Bacteria | 971 |
| 371 | Ga0157380_10804785 | 3300014326 | Bacteria | 957 |
| 372 | Ga0157377_10080238 | 3300014745 | Bacteria | 1906 |
| 373 | Ga0157379_10025408 | 3300014968 | Bacteria | 5262 |
| 374 | Ga0157376_10012058 | 3300014969 | Bacteria | 6398 |
| 375 | Ga0157376_10079043 | 3300014969 | Bacteria | 2819 |
| 376 | Ga0157376_10874410 | 3300014969 | Bacteria | 915 |
| 377 | Ga0157376_10955437 | 3300014969 | Bacteria | 878 |
| 378 | Ga0182006_1000216 | 3300015261 | Bacteria | 56213 |
| 379 | Ga0182005_1000119 | 3300015265 | Bacteria | 57192 |
| 380 | Ga0163161_10020699 | 3300017792 | Bacteria | 4620 |
| 381 | Ga0163161_10033804 | 3300017792 | Bacteria | 3654 |
| 382 | Ga0163161_10359575 | 3300017792 | Bacteria | 1159 |
| 383 | Ga0209672_100041 | 3300025228 | Bacteria | 278535 |
| 384 | Ga0209147_100866 | 3300025229 | Bacteria | 14070 |
| 385 | Ga0209437_101838 | 3300025233 | Bacteria | 4528 |
| 386 | Ga0209258_100822 | 3300025242 | Bacteria | 17427 |
| 387 | Ga0209646_1000384 | 3300025246 | Bacteria | 28428 |
| 388 | Ga0209026_1044080 | 3300025250 | Bacteria | 643 |
| 389 | Ga0209148_1001387 | 3300025254 | Bacteria | 12523 |
| 390 | Ga0209759_1056599 | 3300025256 | Bacteria | 572 |
| 391 | Ga0209455_1007106 | 3300025272 | Bacteria | 3204 |
| 392 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 393 | Ga0209564_1001321 | 3300025295 | Bacteria | 26542 |
| 394 | Ga0207697_10047453 | 3300025315 | Bacteria | 1770 |
| 395 | Ga0207697_10240881 | 3300025315 | Bacteria | 799 |
| 396 | Ga0207656_10012067 | 3300025321 | Bacteria | 3279 |
| 397 | Ga0207655_1007846 | 3300025728 | Bacteria | 6866 |
| 398 | Ga0207653_10042017 | 3300025885 | Bacteria | 1503 |
| 399 | Ga0207682_10000198 | 3300025893 | Bacteria | 27362 |
| 400 | Ga0207682_10026622 | 3300025893 | Bacteria | 2300 |
| 401 | Ga0207682_10612067 | 3300025893 | Bacteria | 513 |
| 402 | Ga0207642_10008609 | 3300025899 | Bacteria | 3512 |
| 403 | Ga0207642_10196980 | 3300025899 | Bacteria | 1110 |
| 404 | Ga0207688_10154182 | 3300025901 | Bacteria | 1359 |
| 405 | Ga0207680_10057628 | 3300025903 | Bacteria | 2351 |
| 406 | Ga0207647_10009548 | 3300025904 | Bacteria | 6886 |
| 407 | Ga0207685_10585062 | 3300025905 | Bacteria | 597 |
| 408 | Ga0207699_10237170 | 3300025906 | Bacteria | 1252 |
| 409 | Ga0207645_10000676 | 3300025907 | Bacteria | 28210 |
| 410 | Ga0207645_10030039 | 3300025907 | Bacteria | 3502 |
| 411 | Ga0207645_10054591 | 3300025907 | Bacteria | 2552 |
| 412 | Ga0207645_10311729 | 3300025907 | Bacteria | 1049 |
| 413 | Ga0207643_10039589 | 3300025908 | Bacteria | 2652 |
| 414 | Ga0207643_10045286 | 3300025908 | Bacteria | 2484 |
| 415 | Ga0207643_10049201 | 3300025908 | Bacteria | 2389 |
| 416 | Ga0207643_10109580 | 3300025908 | Bacteria | 1626 |
| 417 | Ga0207643_10352679 | 3300025908 | Bacteria | 924 |
| 418 | Ga0207705_10063847 | 3300025909 | Bacteria | 2661 |
| 419 | Ga0207705_10875486 | 3300025909 | Bacteria | 696 |
| 420 | Ga0207684_10112094 | 3300025910 | Bacteria | 2335 |
| 421 | Ga0207654_10464225 | 3300025911 | Bacteria | 890 |
| 422 | Ga0207707_10009678 | 3300025912 | Bacteria | 8361 |
| 423 | Ga0207707_10105173 | 3300025912 | Bacteria | 2467 |
| 424 | Ga0207707_11010548 | 3300025912 | Bacteria | 682 |
| 425 | Ga0207671_10035591 | 3300025914 | Bacteria | 3694 |
| 426 | Ga0207671_10071944 | 3300025914 | Bacteria | 2580 |
| 427 | Ga0207660_10043657 | 3300025917 | Bacteria | 3150 |
| 428 | Ga0207660_10386898 | 3300025917 | Bacteria | 1125 |
| 429 | Ga0207660_10489759 | 3300025917 | Bacteria | 997 |
| 430 | Ga0207662_10070919 | 3300025918 | Bacteria | 2108 |
| 431 | Ga0207662_10239084 | 3300025918 | Bacteria | 1188 |
| 432 | Ga0207662_10686993 | 3300025918 | Bacteria | 717 |
| 433 | Ga0207657_10193589 | 3300025919 | Bacteria | 1639 |
| 434 | Ga0207652_10013645 | 3300025921 | Bacteria | 6569 |
| 435 | Ga0207652_10393285 | 3300025921 | Bacteria | 1251 |
| 436 | Ga0207646_10470972 | 3300025922 | Bacteria | 1133 |
| 437 | Ga0207646_10870301 | 3300025922 | Bacteria | 800 |
| 438 | Ga0207681_10005688 | 3300025923 | Bacteria | 7657 |
| 439 | Ga0207681_10013210 | 3300025923 | Bacteria | 5105 |
| 440 | Ga0207681_10170319 | 3300025923 | Bacteria | 1650 |
| 441 | Ga0207681_10236162 | 3300025923 | Bacteria | 1421 |
| 442 | Ga0207681_10920762 | 3300025923 | Bacteria | 732 |
| 443 | Ga0207650_10018612 | 3300025925 | Bacteria | 4876 |
| 444 | Ga0207650_10114126 | 3300025925 | Bacteria | 2095 |
| 445 | Ga0207650_10250069 | 3300025925 | Bacteria | 1435 |
| 446 | Ga0207650_10492403 | 3300025925 | Bacteria | 1024 |
| 447 | Ga0207650_10637532 | 3300025925 | Bacteria | 898 |
| 448 | Ga0207650_11494197 | 3300025925 | Bacteria | 574 |
| 449 | Ga0207659_10047713 | 3300025926 | Bacteria | 3030 |
| 450 | Ga0207659_10133056 | 3300025926 | Bacteria | 1922 |
| 451 | Ga0207659_10368540 | 3300025926 | Bacteria | 1195 |
| 452 | Ga0207659_11437017 | 3300025926 | Bacteria | 591 |
| 453 | Ga0207659_11662868 | 3300025926 | Unclassified | 544 |
| 454 | Ga0207687_10029887 | 3300025927 | Bacteria | 3668 |
| 455 | Ga0207687_10487589 | 3300025927 | Bacteria | 1027 |
| 456 | Ga0207687_10548927 | 3300025927 | Bacteria | 969 |
| 457 | Ga0207687_10807528 | 3300025927 | Unclassified | 800 |
| 458 | Ga0207664_10048574 | 3300025929 | Bacteria | 3338 |
| 459 | Ga0207644_10010982 | 3300025931 | Bacteria | 5981 |
| 460 | Ga0207644_10013052 | 3300025931 | Bacteria | 5529 |
| 461 | Ga0207644_11312588 | 3300025931 | Bacteria | 608 |
| 462 | Ga0207690_10937728 | 3300025932 | Bacteria | 719 |
| 463 | Ga0207706_10020283 | 3300025933 | Bacteria | 5974 |
| 464 | Ga0207706_10100010 | 3300025933 | Bacteria | 2552 |
| 465 | Ga0207706_10307885 | 3300025933 | Bacteria | 1380 |
| 466 | Ga0207706_10463432 | 3300025933 | Bacteria | 1096 |
| 467 | Ga0207706_11422832 | 3300025933 | Unclassified | 568 |
| 468 | Ga0207686_10159311 | 3300025934 | Bacteria | 1580 |
| 469 | Ga0207686_10219545 | 3300025934 | Bacteria | 1372 |
| 470 | Ga0207709_11653259 | 3300025935 | Bacteria | 532 |
| 471 | Ga0207670_10018384 | 3300025936 | Bacteria | 4248 |
| 472 | Ga0207670_10164638 | 3300025936 | Bacteria | 1658 |
| 473 | Ga0207670_10353646 | 3300025936 | Bacteria | 1164 |
| 474 | Ga0207670_10374350 | 3300025936 | Bacteria | 1133 |
| 475 | Ga0207670_10536282 | 3300025936 | Bacteria | 954 |
| 476 | Ga0207670_11609061 | 3300025936 | Unclassified | 552 |
| 477 | Ga0207669_10031072 | 3300025937 | Bacteria | 2978 |
| 478 | Ga0207669_10104538 | 3300025937 | Bacteria | 1881 |
| 479 | Ga0207669_10238642 | 3300025937 | Bacteria | 1346 |
| 480 | Ga0207669_10342286 | 3300025937 | Bacteria | 1152 |
| 481 | Ga0207669_11354190 | 3300025937 | Bacteria | 605 |
| 482 | Ga0207704_10011015 | 3300025938 | Bacteria | 4436 |
| 483 | Ga0207704_11683730 | 3300025938 | Bacteria | 545 |
| 484 | Ga0207704_11904836 | 3300025938 | Bacteria | 511 |
| 485 | Ga0207665_10270644 | 3300025939 | Bacteria | 1261 |
| 486 | Ga0207665_10295733 | 3300025939 | Bacteria | 1209 |
| 487 | Ga0207691_10000243 | 3300025940 | Bacteria | 53649 |
| 488 | Ga0207691_10001181 | 3300025940 | Bacteria | 25967 |
| 489 | Ga0207691_10037545 | 3300025940 | Bacteria | 4486 |
| 490 | Ga0207691_10091771 | 3300025940 | Bacteria | 2721 |
| 491 | Ga0207691_10247947 | 3300025940 | Bacteria | 1538 |
| 492 | Ga0207691_10406630 | 3300025940 | Bacteria | 1161 |
| 493 | Ga0207691_10533164 | 3300025940 | Bacteria | 996 |
| 494 | Ga0207691_10588554 | 3300025940 | Bacteria | 942 |
| 495 | Ga0207711_10018678 | 3300025941 | Bacteria | 5764 |
| 496 | Ga0207711_10278090 | 3300025941 | Bacteria | 1541 |
| 497 | Ga0207711_11084510 | 3300025941 | Bacteria | 741 |
| 498 | Ga0207689_10015420 | 3300025942 | Bacteria | 6470 |
| 499 | Ga0207689_10049475 | 3300025942 | Bacteria | 3467 |
| 500 | Ga0207689_10108288 | 3300025942 | Bacteria | 2283 |
| 501 | Ga0207689_10755351 | 3300025942 | Bacteria | 821 |
| 502 | Ga0207689_10882363 | 3300025942 | Bacteria | 755 |
| 503 | Ga0207689_11612523 | 3300025942 | Bacteria | 540 |
| 504 | Ga0207689_11652216 | 3300025942 | Bacteria | 532 |
| 505 | Ga0207679_10070680 | 3300025945 | Bacteria | 2631 |
| 506 | Ga0207679_10544100 | 3300025945 | Bacteria | 1041 |
| 507 | Ga0207679_11258125 | 3300025945 | Bacteria | 679 |
| 508 | Ga0207667_10131745 | 3300025949 | Bacteria | 2575 |
| 509 | Ga0207651_10011474 | 3300025960 | Bacteria | 4963 |
| 510 | Ga0207651_10034413 | 3300025960 | Bacteria | 3281 |
| 511 | Ga0207651_10081940 | 3300025960 | Unclassified | 2328 |
| 512 | Ga0207651_10153936 | 3300025960 | Bacteria | 1794 |
| 513 | Ga0207712_10613324 | 3300025961 | Bacteria | 942 |
| 514 | Ga0207712_12111792 | 3300025961 | Bacteria | 504 |
| 515 | Ga0207668_10005128 | 3300025972 | Bacteria | 7706 |
| 516 | Ga0207668_10007321 | 3300025972 | Bacteria | 6559 |
| 517 | Ga0207668_10007526 | 3300025972 | Bacteria | 6481 |
| 518 | Ga0207668_10036649 | 3300025972 | Bacteria | 3275 |
| 519 | Ga0207668_10093152 | 3300025972 | Bacteria | 2219 |
| 520 | Ga0207668_10730533 | 3300025972 | Bacteria | 872 |
| 521 | Ga0207640_10118510 | 3300025981 | Bacteria | 1891 |
| 522 | Ga0207640_10425787 | 3300025981 | Bacteria | 1087 |
| 523 | Ga0207640_10431519 | 3300025981 | Bacteria | 1081 |
| 524 | Ga0207640_11063617 | 3300025981 | Bacteria | 714 |
| 525 | Ga0207658_10011658 | 3300025986 | Bacteria | 5987 |
| 526 | Ga0207658_10103985 | 3300025986 | Bacteria | 2230 |
| 527 | Ga0207658_10416996 | 3300025986 | Unclassified | 1183 |
| 528 | Ga0207677_10164429 | 3300026023 | Bacteria | 1728 |
| 529 | Ga0207677_10513924 | 3300026023 | Bacteria | 1038 |
| 530 | Ga0207703_10769894 | 3300026035 | Bacteria | 918 |
| 531 | Ga0207703_10912679 | 3300026035 | Unclassified | 841 |
| 532 | Ga0207703_10999934 | 3300026035 | Bacteria | 802 |
| 533 | Ga0207639_10257170 | 3300026041 | Bacteria | 1525 |
| 534 | Ga0207639_11263962 | 3300026041 | Bacteria | 693 |
| 535 | Ga0207678_10000013 | 3300026067 | Bacteria | 141619 |
| 536 | Ga0207708_10002536 | 3300026075 | Bacteria | 13436 |
| 537 | Ga0207708_10058634 | 3300026075 | Bacteria | 2937 |
| 538 | Ga0207708_10159046 | 3300026075 | Bacteria | 1783 |
| 539 | Ga0207708_10178673 | 3300026075 | Bacteria | 1684 |
| 540 | Ga0207708_10229266 | 3300026075 | Bacteria | 1491 |
| 541 | Ga0207708_10394572 | 3300026075 | Bacteria | 1143 |
| 542 | Ga0207708_10834841 | 3300026075 | Bacteria | 795 |
| 543 | Ga0207702_10272306 | 3300026078 | Bacteria | 1597 |
| 544 | Ga0207641_10112676 | 3300026088 | Bacteria | 2414 |
| 545 | Ga0207641_10115124 | 3300026088 | Bacteria | 2390 |
| 546 | Ga0207641_10239056 | 3300026088 | Bacteria | 1691 |
| 547 | Ga0207641_10357094 | 3300026088 | Bacteria | 1394 |
| 548 | Ga0207641_10364275 | 3300026088 | Bacteria | 1381 |
| 549 | Ga0207641_10871257 | 3300026088 | Bacteria | 893 |
| 550 | Ga0207641_12109513 | 3300026088 | Unclassified | 564 |
| 551 | Ga0207641_12291666 | 3300026088 | Bacteria | 540 |
| 552 | Ga0207648_10009225 | 3300026089 | Bacteria | 9476 |
| 553 | Ga0207648_10012144 | 3300026089 | Bacteria | 8073 |
| 554 | Ga0207648_10017883 | 3300026089 | Bacteria | 6432 |
| 555 | Ga0207648_10112143 | 3300026089 | Bacteria | 2394 |
| 556 | Ga0207648_10551302 | 3300026089 | Bacteria | 1059 |
| 557 | Ga0207648_10891868 | 3300026089 | Bacteria | 830 |
| 558 | Ga0207648_11890090 | 3300026089 | Bacteria | 558 |
| 559 | Ga0207676_10033387 | 3300026095 | Bacteria | 3887 |
| 560 | Ga0207676_10129115 | 3300026095 | Bacteria | 2146 |
| 561 | Ga0207676_10150985 | 3300026095 | Bacteria | 2001 |
| 562 | Ga0207676_10202340 | 3300026095 | Bacteria | 1756 |
| 563 | Ga0207676_10482633 | 3300026095 | Bacteria | 1174 |
| 564 | Ga0207674_10396770 | 3300026116 | Bacteria | 1333 |
| 565 | Ga0207674_11218433 | 3300026116 | Bacteria | 722 |
| 566 | Ga0207675_100001853 | 3300026118 | Bacteria | 21203 |
| 567 | Ga0207675_100020956 | 3300026118 | Bacteria | 6095 |
| 568 | Ga0207675_100046593 | 3300026118 | Bacteria | 4051 |
| 569 | Ga0207675_100110998 | 3300026118 | Bacteria | 2587 |
| 570 | Ga0207675_100268847 | 3300026118 | Bacteria | 1654 |
| 571 | Ga0207675_100307665 | 3300026118 | Bacteria | 1545 |
| 572 | Ga0207675_100673391 | 3300026118 | Bacteria | 1042 |
| 573 | Ga0207675_100755244 | 3300026118 | Bacteria | 984 |
| 574 | Ga0207675_100895014 | 3300026118 | Bacteria | 904 |
| 575 | Ga0207675_101003193 | 3300026118 | Bacteria | 853 |
| 576 | Ga0207675_101787281 | 3300026118 | Bacteria | 634 |
| 577 | Ga0207683_10000308 | 3300026121 | Bacteria | 44216 |
| 578 | Ga0207683_10100953 | 3300026121 | Unclassified | 2576 |
| 579 | Ga0207683_10194654 | 3300026121 | Bacteria | 1842 |
| 580 | Ga0207683_11693062 | 3300026121 | Bacteria | 582 |
| 581 | Ga0207698_10014478 | 3300026142 | Bacteria | 5245 |
| 582 | Ga0207698_11364666 | 3300026142 | Bacteria | 724 |
| 583 | Ga0209281_1004553 | 3300027111 | Bacteria | 4122 |
| 584 | Ga0209967_1007547 | 3300027364 | Bacteria | 1489 |
| 585 | Ga0209981_1000274 | 3300027378 | Bacteria | 6602 |
| 586 | Ga0209996_1000426 | 3300027395 | Bacteria | 5104 |
| 587 | Ga0210000_1012802 | 3300027462 | Bacteria | 1248 |
| 588 | Ga0209995_1002372 | 3300027471 | Bacteria | 2972 |
| 589 | Ga0209968_1028162 | 3300027526 | Bacteria | 932 |
| 590 | Ga0209999_1003045 | 3300027543 | Bacteria | 2984 |
| 591 | Ga0209970_1030478 | 3300027614 | Bacteria | 936 |
| 592 | Ga0209971_1093017 | 3300027682 | Bacteria | 736 |
| 593 | Ga0209974_10435536 | 3300027876 | Bacteria | 518 |
| 594 | Ga0207428_10008206 | 3300027907 | Bacteria | 9445 |
| 595 | Ga0207428_10132309 | 3300027907 | Bacteria | 1908 |
| 596 | Ga0268266_10035503 | 3300028379 | Bacteria | 4241 |
| 597 | Ga0268266_10154387 | 3300028379 | Bacteria | 2072 |
| 598 | Ga0268266_10222798 | 3300028379 | Bacteria | 1734 |
| 599 | Ga0268266_10289909 | 3300028379 | Bacteria | 1524 |
| 600 | Ga0268266_10567504 | 3300028379 | Unclassified | 1088 |
| 601 | Ga0268265_10000606 | 3300028380 | Bacteria | 35982 |
| 602 | Ga0268265_10007059 | 3300028380 | Bacteria | 7595 |
| 603 | Ga0268265_10056208 | 3300028380 | Bacteria | 2993 |
| 604 | Ga0268265_10103415 | 3300028380 | Bacteria | 2306 |
| 605 | Ga0268265_10230804 | 3300028380 | Bacteria | 1626 |
| 606 | Ga0268265_10398107 | 3300028380 | Bacteria | 1272 |
| 607 | Ga0268264_10040446 | 3300028381 | Bacteria | 3852 |
| 608 | Ga0268264_10071335 | 3300028381 | Bacteria | 2943 |
| 609 | Ga0268264_10111072 | 3300028381 | Bacteria | 2401 |
| 610 | Ga0268264_10535440 | 3300028381 | Bacteria | 1147 |
| 611 | Ga0268264_10695181 | 3300028381 | Bacteria | 1010 |
| 612 | Ga0307515_10525023 | 3300028794 | Bacteria | 793 |
| 613 | Ga0265338_10000344 | 3300028800 | Bacteria | 84742 |
| 614 | Ga0237817_12217 | 3300030083 | Bacteria | 863 |
| 615 | Ga0265327_10030111 | 3300031251 | Bacteria | 3074 |
| 616 | Ga0307513_10436371 | 3300031456 | Bacteria | 1037 |
| 617 | Ga0307408_100181728 | 3300031548 | Bacteria | 1687 |
| 618 | Ga0307408_100829886 | 3300031548 | Bacteria | 841 |
| 619 | Ga0307408_100831804 | 3300031548 | Bacteria | 840 |
| 620 | Ga0307408_101444943 | 3300031548 | Bacteria | 649 |
| 621 | Ga0316575_10030526 | 3300031665 | Bacteria | 2107 |
| 622 | Ga0316575_10033995 | 3300031665 | Bacteria | 2001 |
| 623 | Ga0316579_10000015 | 3300031691 | Bacteria | 39681 |
| 624 | Ga0316579_10010200 | 3300031691 | Bacteria | 3967 |
| 625 | Ga0316579_10140937 | 3300031691 | Bacteria | 1162 |
| 626 | Ga0316576_10071290 | 3300031727 | Bacteria | 2563 |
| 627 | Ga0316578_10005745 | 3300031728 | Bacteria | 6051 |
| 628 | Ga0316578_10396209 | 3300031728 | Bacteria | 818 |
| 629 | Ga0316577_10001781 | 3300031733 | Bacteria | 10385 |
| 630 | Ga0307413_10976700 | 3300031824 | Bacteria | 724 |
| 631 | Ga0307413_11268788 | 3300031824 | Bacteria | 643 |
| 632 | Ga0307407_10500016 | 3300031903 | Bacteria | 891 |
| 633 | Ga0307412_10372141 | 3300031911 | Bacteria | 1154 |
| 634 | Ga0307412_10911307 | 3300031911 | Bacteria | 771 |
| 635 | Ga0307409_100724543 | 3300031995 | Bacteria | 996 |
| 636 | Ga0307416_101043310 | 3300032002 | Bacteria | 921 |
| 637 | Ga0307416_101562953 | 3300032002 | Bacteria | 765 |
| 638 | Ga0307411_10125767 | 3300032005 | Bacteria | 1864 |
| 639 | Ga0307411_11439750 | 3300032005 | Bacteria | 631 |
| 640 | Ga0316583_10000483 | 3300032133 | Bacteria | 11841 |
| 641 | Ga0316583_10004823 | 3300032133 | Bacteria | 4817 |
| 642 | Ga0316585_10021392 | 3300032137 | Bacteria | 1986 |
| 643 | Ga0316585_10028949 | 3300032137 | Bacteria | 1734 |
| 644 | Ga0316580_10008681 | 3300032139 | Bacteria | 3049 |
| 645 | Ga0316593_10000385 | 3300032168 | Bacteria | 7877 |
| 646 | Ga0373938_0157733 | 3300034957 | Unclassified | 607 |
| 647 | Ga0373929_0118124 | 3300035085 | Bacteria | 684 |
| 648 | Ga0373929_0164303 | 3300035085 | Bacteria | 603 |
| 649 | Ga0373934_0000134 | 3300035086 | Bacteria | 27424 |
| 650 | Ga0373934_0440898 | 3300035086 | Bacteria | 546 |
| 651 | Ga0373949_0052465 | 3300035090 | Bacteria | 1031 |
| 652 | Ga0373949_0074343 | 3300035090 | Bacteria | 896 |
| 653 | Ga0373951_0180728 | 3300035091 | Bacteria | 606 |
| 654 | Ga0373952_0296346 | 3300035092 | Bacteria | 503 |
| 655 | Ga0373923_0625352 | 3300035111 | Bacteria | 531 |
| 656 | Ga0373932_0061752 | 3300035112 | Bacteria | 1141 |
| 657 | Ga0373932_0142798 | 3300035112 | Bacteria | 815 |
| 658 | Ga0373936_0025745 | 3300035113 | Bacteria | 2302 |
| 659 | Ga0373936_0059916 | 3300035113 | Bacteria | 1552 |
| 660 | Ga0373939_0203489 | 3300035114 | Bacteria | 750 |
| 661 | Ga0373939_0465874 | 3300035114 | Unclassified | 534 |
| 662 | Ga0373941_0040943 | 3300035115 | Bacteria | 1432 |
| 663 | Ga0373953_0140382 | 3300035117 | Bacteria | 1033 |
| 664 | Ga0373954_0000002 | 3300035118 | Bacteria | 147478 |
| 665 | Ga0373956_0000006 | 3300035119 | Bacteria | 65782 |
| 666 | Ga0373957_0000372 | 3300035120 | Bacteria | 11352 |
| 667 | Ga0373957_0205146 | 3300035120 | Bacteria | 822 |
| 668 | Ga0373960_0051783 | 3300035121 | Bacteria | 1221 |
| 669 | Ga0373960_0118127 | 3300035121 | Bacteria | 877 |
| 670 | Ga0373960_0246755 | 3300035121 | Unclassified | 647 |
| 671 | Ga0373943_0006741 | 3300035170 | Bacteria | 5155 |
| 672 | Ga0373946_0569281 | 3300035171 | Bacteria | 585 |
| 673 | Ga0373955_0136521 | 3300035172 | Bacteria | 1435 |
| 674 | Ga0373955_0272091 | 3300035172 | Bacteria | 1018 |
| 675 | Ga0373955_0577636 | 3300035172 | Bacteria | 688 |
| 676 | Ga0373942_0320732 | 3300035207 | Bacteria | 542 |
| 677 | Ga0373962_0390465 | 3300035242 | Bacteria | 510 |
| 678 | Ga0316574_0081081 | 3300035398 | Bacteria | 2060 |
| 679 | Ga0316574_0191459 | 3300035398 | Bacteria | 1315 |
| 680 | Ga0316574_0225932 | 3300035398 | Bacteria | 1199 |
| 681 | Ga0373924_0117450 | 3300035410 | Bacteria | 1153 |
| 682 | Ga0373931_0047678 | 3300035691 | Bacteria | 2268 |
| 683 | Ga0373935_0036900 | 3300035692 | Bacteria | 3057 |
| 684 | Ga0373935_1004514 | 3300035692 | Bacteria | 620 |
| 685 | Ga0373927_0018661 | 3300035695 | Bacteria | 4553 |
| 686 | Ga0373927_0047624 | 3300035695 | Bacteria | 2773 |
| 687 | Ga0373933_0000564 | 3300035724 | Bacteria | 23136 |
| 688 | Ga0373933_0079276 | 3300035724 | Bacteria | 2011 |
| 689 | Ga0373933_0161536 | 3300035724 | Bacteria | 1423 |
| 690 | Ga0373933_0247749 | 3300035724 | Bacteria | 1147 |
| 691 | Ga0373947_0025727 | 3300035725 | Bacteria | 3432 |
| 692 | Ga0373947_0838267 | 3300035725 | Bacteria | 628 |
| 693 | Ga0373937_0000358 | 3300036401 | Bacteria | 42468 |
| 694 | Ga0373937_0003219 | 3300036401 | Bacteria | 13673 |
| 695 | Ga0373937_0047835 | 3300036401 | Bacteria | 3914 |
| 696 | Ga0373937_0347205 | 3300036401 | Bacteria | 1405 |
| 697 | Ga0373937_1243825 | 3300036401 | Bacteria | 693 |
| 698 | Ga0316582_0003674 | 3300036647 | Bacteria | 7582 |
| 699 | Ga0316582_0019086 | 3300036647 | Bacteria | 4006 |
| 700 | Ga0316582_0385781 | 3300036647 | Bacteria | 964 |
| 701 | Ga0316584_0008900 | 3300036712 | Bacteria | 6941 |
| 702 | Ga0316584_0099029 | 3300036712 | Bacteria | 2183 |
| 703 | Ga0316584_0188920 | 3300036712 | Bacteria | 1524 |
| 704 | Ga0316584_0514716 | 3300036712 | Bacteria | 839 |
| 705 | Ga0373925_0061295 | 3300037068 | Bacteria | 2825 |
| 706 | Ga0373925_0071100 | 3300037068 | Bacteria | 2631 |
| 707 | Ga0373925_0775520 | 3300037068 | Bacteria | 790 |
| 708 | Ga0395899_0004310 | 3300037312 | Bacteria | 11107 |
| 709 | Ga0395900_0006117 | 3300037418 | Bacteria | 12551 |
| 710 | Ga0395900_0270883 | 3300037418 | Bacteria | 1692 |
| 711 | Ga0395898_0298265 | 3300037466 | Bacteria | 1537 |
| 712 | Ga0395898_1603184 | 3300037466 | Bacteria | 575 |
| 713 | Ga0395905_0035171 | 3300037471 | Bacteria | 4703 |
| 714 | Ga0316581_0001262 | 3300037588 | Bacteria | 5612 |
| 715 | Ga0316581_0001282 | 3300037588 | Bacteria | 5581 |
| 716 | Ga0316581_0054570 | 3300037588 | Bacteria | 1225 |
| 717 | Ga0395901_0085802 | 3300038443 | Bacteria | 3291 |
| 718 | Ga0395901_0255660 | 3300038443 | Bacteria | 1824 |
| 719 | Ga0395901_0661644 | 3300038443 | Bacteria | 1046 |
| 720 | Ga0436360_0635523 | 3300039438 | Bacteria | 804 |
| 721 | Ga0436361_1182555 | 3300039447 | Bacteria | 934 |
| 722 | Ga0436363_1444570 | 3300039450 | Bacteria | 873 |
| 723 | Ga0451802_1603895 | 3300041460 | Bacteria | 583 |
| 724 | Ga0451807_0680206 | 3300041486 | Bacteria | 1997 |
| 725 | Ga0451807_2332697 | 3300041486 | Bacteria | 3050 |
| 726 | Ga0451849_1451196 | 3300041505 | Bacteria | 777 |
| 727 | Ga0451853_0470233 | 3300041512 | Bacteria | 611 |
| 728 | Ga0439441_000116 | 3300042001 | Bacteria | 6525 |
| 729 | Ga0439443_019482 | 3300042003 | Bacteria | 1058 |
| 730 | Ga0439451_003581 | 3300042009 | Bacteria | 3145 |
| 731 | Ga0439462_0064584 | 3300042015 | Bacteria | 991 |
| 732 | Ga0439446_0028390 | 3300042156 | Bacteria | 1610 |
| 733 | Ga0439434_0000212 | 3300042435 | Bacteria | 16124 |
| 734 | Ga0439435_0000206 | 3300042436 | Bacteria | 8300 |
| 735 | Ga0439435_0013850 | 3300042436 | Bacteria | 1982 |
| 736 | Ga0439444_0002792 | 3300042437 | Bacteria | 2418 |
| 737 | Ga0439460_0000714 | 3300042461 | Bacteria | 7402 |
| 738 | Ga0451577_0023914 | 3300042876 | Bacteria | 5565 |
| 739 | Ga0453683_0028389 | 3300044673 | Bacteria | 3544 |
| 740 | Ga0466963_0602491 | 3300044694 | Bacteria | 776 |
| 741 | Ga0466964_0021058 | 3300044706 | Bacteria | 2518 |
| 742 | Ga0466964_0138052 | 3300044706 | Bacteria | 1117 |
| 743 | Ga0466964_0443880 | 3300044706 | Bacteria | 687 |
| 744 | Ga0453684_0276423 | 3300044712 | Bacteria | 1917 |
| 745 | Ga0466957_0344334 | 3300044842 | Bacteria | 1010 |
| 746 | Ga0451576_0000147 | 3300045051 | Bacteria | 179223 |
| 747 | Ga0451576_0196786 | 3300045051 | Bacteria | 2105 |
| 748 | Ga0451576_1110250 | 3300045051 | Bacteria | 827 |
| 749 | Ga0466967_0001049 | 3300045976 | Bacteria | 15200 |
| 750 | Ga0466967_1158875 | 3300045976 | Bacteria | 770 |
| 751 | Ga0495617_004040 | 3300046452 | Bacteria | 5392 |
| 752 | Ga0495603_0225283 | 3300046455 | Bacteria | 1081 |
| 753 | Ga0495651_0000233 | 3300046462 | Bacteria | 42757 |
| 754 | Ga0495653_0359564 | 3300046463 | Bacteria | 934 |
| 755 | Ga0495650_0001544 | 3300046471 | Bacteria | 21838 |
| 756 | Ga0495650_0003055 | 3300046471 | Bacteria | 12597 |
| 757 | Ga0495650_0003627 | 3300046471 | Bacteria | 11112 |
| 758 | Ga0495580_0026867 | 3300046472 | Bacteria | 4192 |
| 759 | Ga0495605_0000635 | 3300046474 | Bacteria | 26971 |
| 760 | Ga0495584_0027265 | 3300046491 | Bacteria | 2894 |
| 761 | Ga0495584_0164912 | 3300046491 | Bacteria | 1126 |
| 762 | Ga0495585_0024699 | 3300046492 | Bacteria | 3444 |
| 763 | Ga0495607_0249086 | 3300046501 | Bacteria | 856 |
| 764 | Ga0495583_0005068 | 3300046506 | Bacteria | 9096 |
| 765 | Ga0495606_0001517 | 3300046507 | Bacteria | 30788 |
| 766 | Ga0495606_0352355 | 3300046507 | Bacteria | 781 |
| 767 | Ga0495610_0003364 | 3300046512 | Bacteria | 12537 |
| 768 | Ga0495631_0017774 | 3300046518 | Bacteria | 3357 |
| 769 | Ga0495637_0010764 | 3300046520 | Bacteria | 4412 |
| 770 | Ga0495643_0000891 | 3300046522 | Bacteria | 31774 |
| 771 | Ga0495648_0019571 | 3300046524 | Bacteria | 4755 |
| 772 | Ga0495642_0128916 | 3300046528 | Bacteria | 1088 |
| 773 | Ga0495642_0276100 | 3300046528 | Bacteria | 736 |
| 774 | Ga0495652_0678468 | 3300046529 | Bacteria | 695 |
| 775 | Ga0495621_0054065 | 3300046539 | Bacteria | 1443 |
| 776 | Ga0495621_0105592 | 3300046539 | Bacteria | 1076 |
| 777 | Ga0495621_0194908 | 3300046539 | Bacteria | 813 |
| 778 | Ga0495621_0418329 | 3300046539 | Bacteria | 570 |
| 779 | Ga0495597_0000288 | 3300046542 | Bacteria | 45373 |
| 780 | Ga0495597_0001250 | 3300046542 | Bacteria | 18776 |
| 781 | Ga0495622_0407801 | 3300046557 | Bacteria | 585 |
| 782 | Ga0495633_0001228 | 3300046558 | Bacteria | 20576 |
| 783 | Ga0495633_0001987 | 3300046558 | Bacteria | 14800 |
| 784 | Ga0495633_0058546 | 3300046558 | Bacteria | 1808 |
| 785 | Ga0495667_0230855 | 3300046559 | Bacteria | 1180 |
| 786 | Ga0495668_0006127 | 3300046616 | Bacteria | 7963 |
| 787 | Ga0495611_0011338 | 3300046648 | Bacteria | 3778 |
| 788 | Ga0495625_0002229 | 3300046660 | Bacteria | 21422 |
| 789 | Ga0495625_0426629 | 3300046660 | Bacteria | 823 |
| 790 | Ga0495659_0214696 | 3300046664 | Bacteria | 793 |
| 791 | Ga0495659_0232478 | 3300046664 | Bacteria | 764 |
| 792 | Ga0495659_0394030 | 3300046664 | Bacteria | 597 |
| 793 | Ga0495657_0022573 | 3300046675 | Bacteria | 4506 |
| 794 | Ga0495599_0229993 | 3300046678 | Bacteria | 1132 |
| 795 | Ga0495599_0798874 | 3300046678 | Bacteria | 539 |
| 796 | Ga0495623_0334738 | 3300046679 | Bacteria | 828 |
| 797 | Ga0495646_0223782 | 3300046680 | Bacteria | 1016 |
| 798 | Ga0495647_0090012 | 3300046681 | Bacteria | 1257 |
| 799 | Ga0495669_0042821 | 3300046684 | Bacteria | 2014 |
| 800 | Ga0495669_0170482 | 3300046684 | Bacteria | 1035 |
| 801 | Ga0495670_0003908 | 3300046691 | Bacteria | 7320 |
| 802 | Ga0495670_0484820 | 3300046691 | Bacteria | 671 |
| 803 | Ga0495671_0069779 | 3300046692 | Bacteria | 1727 |
| 804 | Ga0495671_0134307 | 3300046692 | Bacteria | 1206 |
| 805 | Ga0495649_0001795 | 3300046694 | Bacteria | 15780 |
| 806 | Ga0495649_0363175 | 3300046694 | Bacteria | 730 |
| 807 | Ga0495589_0041328 | 3300046794 | Bacteria | 2301 |
| 808 | Ga0495604_0150888 | 3300047317 | Bacteria | 1651 |
| 809 | Ga0495636_0001239 | 3300047318 | Bacteria | 9652 |
| 810 | Ga0495636_0037440 | 3300047318 | Bacteria | 2003 |
| 811 | Ga0495636_0074493 | 3300047318 | Bacteria | 1454 |
| 812 | Ga0495636_0161940 | 3300047318 | Bacteria | 1008 |
| 813 | Ga0495674_0011089 | 3300047319 | Bacteria | 8509 |
| 814 | Ga0495672_0001040 | 3300047320 | Bacteria | 28407 |
| 815 | Ga0495676_1076910 | 3300047321 | Bacteria | 511 |
| 816 | Ga0495680_0178343 | 3300047322 | Bacteria | 1535 |
| 817 | Ga0495680_0284998 | 3300047322 | Bacteria | 1163 |
| 818 | Ga0495683_0071477 | 3300047323 | Bacteria | 1703 |
| 819 | Ga0495683_0276296 | 3300047323 | Bacteria | 729 |
| 820 | Ga0495675_0741735 | 3300047444 | Bacteria | 547 |
| 821 | Ga0495677_0019685 | 3300047445 | Bacteria | 2447 |
| 822 | Ga0495677_0140460 | 3300047445 | Bacteria | 927 |
| 823 | Ga0495677_0242725 | 3300047445 | Bacteria | 704 |
| 824 | Ga0495677_0379970 | 3300047445 | Bacteria | 558 |
| 825 | Ga0495686_0105936 | 3300047472 | Bacteria | 1691 |
| 826 | Ga0495602_0030492 | 3300048088 | Bacteria | 5113 |
| 827 | Ga0495615_0182378 | 3300048090 | Bacteria | 640 |
| 828 | Ga0495615_0280598 | 3300048090 | Bacteria | 535 |
| 829 | Ga0496100_1225962 | 3300048903 | Bacteria | 592 |
| 830 | Ga0496102_0000082 | 3300048905 | Bacteria | 139079 |
| 831 | Ga0496102_0047863 | 3300048905 | Bacteria | 3887 |
| 832 | Ga0496102_1062859 | 3300048905 | Bacteria | 729 |
| 833 | Ga0496103_0066025 | 3300048906 | Bacteria | 2258 |
| 834 | Ga0496103_0347642 | 3300048906 | Bacteria | 953 |
| 835 | Ga0496103_0393577 | 3300048906 | Bacteria | 890 |
| 836 | Ga0496106_0192535 | 3300048909 | Bacteria | 1622 |
| 837 | Ga0496107_0379772 | 3300048910 | Bacteria | 1051 |
| 838 | Ga0496108_0344050 | 3300048911 | Bacteria | 1301 |
| 839 | Ga0496110_0536630 | 3300048913 | Bacteria | 1064 |
| 840 | Ga0496111_0523171 | 3300048914 | Bacteria | 872 |
| 841 | Ga0496112_0076310 | 3300048915 | Bacteria | 3315 |
| 842 | Ga0496113_1563851 | 3300048916 | Bacteria | 508 |
| 843 | Ga0496115_0471551 | 3300048918 | Bacteria | 1012 |
| 844 | Ga0496115_1214065 | 3300048918 | Bacteria | 566 |
| 845 | Ga0496116_0048615 | 3300048919 | Bacteria | 2845 |
| 846 | Ga0496120_0173576 | 3300048923 | Bacteria | 1064 |
| 847 | Ga0496122_0046444 | 3300048925 | Bacteria | 3363 |
| 848 | Ga0496123_0006778 | 3300048926 | Bacteria | 11006 |
| 849 | Ga0496124_0358112 | 3300048927 | Bacteria | 1029 |
| 850 | Ga0496125_0040546 | 3300048928 | Bacteria | 3993 |
| 851 | Ga0495678_001082 | 3300049459 | Bacteria | 23004 |
| 852 | Ga0495678_243424 | 3300049459 | Bacteria | 537 |
| 853 | Ga0495682_0080302 | 3300049460 | Bacteria | 1173 |
| 854 | Ga0501291_011127 | 3300049514 | Bacteria | 1292 |
| 855 | Ga0501292_017546 | 3300049515 | Bacteria | 1133 |
| 856 | Ga0501298_122829 | 3300049521 | Bacteria | 613 |
| 857 | Ga0501031_0704530 | 3300049568 | Bacteria | 648 |
| 858 | Ga0501034_0053868 | 3300049571 | Bacteria | 4050 |
| 859 | Ga0501036_0937023 | 3300049572 | Bacteria | 710 |
| 860 | Ga0501036_1745253 | 3300049572 | Bacteria | 501 |
| 861 | Ga0501037_0918886 | 3300049573 | Bacteria | 573 |
| 862 | Ga0501038_0945091 | 3300049574 | Bacteria | 635 |
| 863 | Ga0501039_0020140 | 3300049575 | Bacteria | 5115 |
| 864 | Ga0501040_0609611 | 3300049576 | Bacteria | 789 |
| 865 | Ga0501040_1403187 | 3300049576 | Bacteria | 507 |
| 866 | Ga0501041_0063052 | 3300049577 | Bacteria | 2270 |
| 867 | Ga0501046_0657115 | 3300049580 | Bacteria | 741 |
| 868 | Ga0501047_0175940 | 3300049581 | Bacteria | 2007 |
| 869 | Ga0501048_0465107 | 3300049582 | Bacteria | 906 |
| 870 | Ga0501067_0068582 | 3300049583 | Bacteria | 1964 |
| 871 | Ga0501067_0492210 | 3300049583 | Bacteria | 686 |
| 872 | Ga0501068_0078372 | 3300049584 | Bacteria | 2025 |
| 873 | Ga0501069_0033482 | 3300049585 | Bacteria | 2831 |
| 874 | Ga0501069_0068700 | 3300049585 | Bacteria | 1983 |
| 875 | Ga0501070_0005016 | 3300049586 | Bacteria | 11294 |
| 876 | Ga0501071_0000992 | 3300049587 | Bacteria | 15550 |
| 877 | Ga0501071_0206685 | 3300049587 | Bacteria | 1476 |
| 878 | Ga0501071_0672692 | 3300049587 | Bacteria | 797 |
| 879 | Ga0501072_0039301 | 3300049588 | Bacteria | 3715 |
| 880 | Ga0501072_0044939 | 3300049588 | Bacteria | 3472 |
| 881 | Ga0501072_1566929 | 3300049588 | Bacteria | 508 |
| 882 | Ga0501073_0014106 | 3300049589 | Bacteria | 5806 |
| 883 | Ga0501073_0020687 | 3300049589 | Bacteria | 4746 |
| 884 | Ga0501073_0044227 | 3300049589 | Bacteria | 3139 |
| 885 | Ga0501073_0126736 | 3300049589 | Bacteria | 1769 |
| 886 | Ga0501073_0658564 | 3300049589 | Bacteria | 723 |
| 887 | Ga0501074_0051011 | 3300049590 | Bacteria | 2986 |
| 888 | Ga0501074_0613353 | 3300049590 | Bacteria | 769 |
| 889 | Ga0501075_0004058 | 3300049591 | Bacteria | 9884 |
| 890 | Ga0501075_0190161 | 3300049591 | Bacteria | 1566 |
| 891 | Ga0501076_0007046 | 3300049592 | Bacteria | 8166 |
| 892 | Ga0501076_0989243 | 3300049592 | Bacteria | 693 |
| 893 | Ga0501077_0780346 | 3300049593 | Bacteria | 614 |
| 894 | Ga0501209_120950 | 3300049656 | Bacteria | 777 |
| 895 | Ga0501210_041048 | 3300049657 | Bacteria | 508 |
| 896 | Ga0501227_214815 | 3300049665 | Bacteria | 547 |
| 897 | Ga0501233_080143 | 3300049668 | Bacteria | 839 |
| 898 | Ga0501236_108293 | 3300049670 | Bacteria | 553 |
| 899 | Ga0501238_036258 | 3300049671 | Bacteria | 720 |
| 900 | Ga0501229_025299 | 3300049706 | Bacteria | 798 |
| 901 | Ga0501079_0298026 | 3300049741 | Bacteria | 1261 |
| 902 | Ga0501080_0000702 | 3300049742 | Bacteria | 26939 |
| 903 | Ga0501080_0108918 | 3300049742 | Bacteria | 2567 |
| 904 | Ga0501080_0165598 | 3300049742 | Bacteria | 2040 |
| 905 | Ga0501080_0440280 | 3300049742 | Bacteria | 1169 |
| 906 | Ga0501080_0553069 | 3300049742 | Bacteria | 1025 |
| 907 | Ga0501081_0017373 | 3300049743 | Bacteria | 4761 |
| 908 | Ga0501083_0047000 | 3300049744 | Bacteria | 2918 |
| 909 | Ga0501263_030547 | 3300049760 | Bacteria | 760 |
| 910 | Ga0501268_162210 | 3300049765 | Bacteria | 522 |
| 911 | Ga0501035_0526722 | 3300049822 | Bacteria | 970 |
| 912 | Ga0501035_1443530 | 3300049822 | Bacteria | 526 |
| 913 | Ga0501044_0930798 | 3300049823 | Bacteria | 743 |
| 914 | Ga0501045_0202285 | 3300049824 | Bacteria | 1480 |
| 915 | nmdc:mga05p37_325958_c1 | 3300050507 | Bacteria | 1816 |
| 916 | nmdc:mga09592_1739728_c1 | 3300050508 | Bacteria | 502 |
| 917 | nmdc:mga09592_24148_c1 | 3300050508 | Bacteria | 5026 |
| 918 | nmdc:mga09592_310877_c1 | 3300050508 | Bacteria | 1366 |
| 919 | nmdc:mga0qj67_1283043_c1 | 3300050509 | Bacteria | 568 |
| 920 | nmdc:mga0qj67_337701_c1 | 3300050509 | Unclassified | 1219 |
| 921 | nmdc:mga0qj67_48258_c1 | 3300050509 | Bacteria | 3364 |
| 922 | nmdc:mga06r32_42207_c1 | 3300050510 | Bacteria | 4336 |
| 923 | nmdc:mga06r32_45053_c1 | 3300050510 | Bacteria | 4203 |
| 924 | nmdc:mga06r32_500298_c1 | 3300050510 | Bacteria | 1192 |
| 925 | nmdc:mga08y16_12222_c1 | 3300050511 | Bacteria | 9022 |
| 926 | nmdc:mga08y16_1265296_c1 | 3300050511 | Bacteria | 706 |
| 927 | nmdc:mga08y16_12995_c1 | 3300050511 | Bacteria | 8762 |
| 928 | nmdc:mga08y16_1525026_c1 | 3300050511 | Bacteria | 628 |
| 929 | nmdc:mga08y16_1773734_c1 | 3300050511 | Bacteria | 571 |
| 930 | nmdc:mga08y16_594708_c1 | 3300050511 | Bacteria | 1116 |
| 931 | nmdc:mga08y16_775464_c1 | 3300050511 | Bacteria | 953 |
| 932 | nmdc:mga0n895_13666_c1 | 3300050512 | Bacteria | 7339 |
| 933 | nmdc:mga0n895_157436_c1 | 3300050512 | Bacteria | 2302 |
| 934 | nmdc:mga0n895_18900_c1 | 3300050512 | Bacteria | 6391 |
| 935 | nmdc:mga0n895_2090538_c1 | 3300050512 | Bacteria | 523 |
| 936 | nmdc:mga0n895_332007_c1 | 3300050512 | Bacteria | 1540 |
| 937 | nmdc:mga0rr50_265435_c1 | 3300050513 | Bacteria | 1429 |
| 938 | nmdc:mga0rr50_367362_c1 | 3300050513 | Bacteria | 1212 |
| 939 | nmdc:mga08x19_13941_c1 | 3300050514 | Bacteria | 4869 |
| 940 | nmdc:mga08x19_367441_c1 | 3300050514 | Bacteria | 1006 |
| 941 | nmdc:mga08x19_4051_c1 | 3300050514 | Bacteria | 8704 |
| 942 | nmdc:mga08x19_483065_c1 | 3300050514 | Bacteria | 874 |
| 943 | nmdc:mga08x19_75883_c1 | 3300050514 | Bacteria | 2199 |
| 944 | nmdc:mga08x19_848419_c1 | 3300050514 | Bacteria | 649 |
| 945 | nmdc:mga0a205_201535_c1 | 3300050515 | Bacteria | 1880 |
| 946 | nmdc:mga0a205_21134_c1 | 3300050515 | Bacteria | 6155 |
| 947 | nmdc:mga0a205_573741_c1 | 3300050515 | Bacteria | 982 |
| 948 | Ga0495619_0370050 | 3300053085 | Bacteria | 991 |
| 949 | Ga0500641_0226762 | 3300053096 | Bacteria | 791 |
| 950 | Ga0500594_0081341 | 3300053118 | Bacteria | 969 |
| 951 | Ga0500642_0294423 | 3300053130 | Bacteria | 734 |
| 952 | Ga0500586_000619 | 3300053145 | Bacteria | 7214 |
| 953 | Ga0501084_0081724 | 3300054114 | Bacteria | 2711 |
| 954 | Ga0501084_1015371 | 3300054114 | Bacteria | 697 |
| 955 | Ga0590071_201214 | 3300059421 | Bacteria | 524 |
| 956 | Ga0587079_106088 | 3300059647 | Bacteria | 677 |
| 957 | Ga0587102_016759 | 3300059649 | Bacteria | 791 |
| 958 | Ga0587111_0037126 | 3300060346 | Bacteria | 1023 |
| 959 | Ga0501082_0023335 | 3300060353 | Bacteria | 5337 |
| 960 | Ga0501082_0093054 | 3300060353 | Bacteria | 2604 |
| 961 | Ga0501082_1509367 | 3300060353 | Bacteria | 587 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005345 | Ga0070692_10378737 | Ga0070692_103787372 | 82 |
| 2 | 3300005459 | Ga0068867_100083659 | Ga0068867_1000836594 | 82 |
| 3 | 3300005546 | Ga0070696_100196947 | Ga0070696_1001969473 | 82 |
| 4 | 3300026075 | Ga0207708_10058634 | Ga0207708_100586344 | 82 |
| 5 | 3300026089 | Ga0207648_10017883 | Ga0207648_100178834 | 82 |
| 6 | 3300007265 | Ga0099794_10192190 | Ga0099794_101921902 | 83 |
| 7 | 3300005444 | Ga0070694_100502819 | Ga0070694_1005028192 | 84 |
| 8 | 3300005545 | Ga0070695_100200820 | Ga0070695_1002008203 | 84 |
| 9 | 3300005546 | Ga0070696_101117185 | Ga0070696_1011171852 | 84 |
| 10 | 3300009094 | Ga0111539_10241710 | Ga0111539_102417104 | 84 |
| 11 | 3300014326 | Ga0157380_10804785 | Ga0157380_108047851 | 84 |
| 12 | 3300005471 | Ga0070698_100702411 | Ga0070698_1007024112 | 89 |
| 13 | 3300005546 | Ga0070696_100161151 | Ga0070696_1001611512 | 90 |
| 14 | 3300005340 | Ga0070689_100494696 | Ga0070689_1004946961 | 91 |
| 15 | 3300005365 | Ga0070688_101516301 | Ga0070688_1015163012 | 91 |
| 16 | 3300005438 | Ga0070701_10201152 | Ga0070701_102011522 | 91 |
| 17 | 3300005441 | Ga0070700_100306351 | Ga0070700_1003063512 | 91 |
| 18 | 3300005544 | Ga0070686_100073813 | Ga0070686_1000738132 | 91 |
| 19 | 3300005615 | Ga0070702_100348826 | Ga0070702_1003488262 | 91 |
| 20 | 3300006358 | Ga0068871_100994484 | Ga0068871_1009944842 | 91 |
| 21 | 3300009176 | Ga0105242_10196669 | Ga0105242_101966692 | 91 |
| 22 | 3300025934 | Ga0207686_10219545 | Ga0207686_102195452 | 91 |
| 23 | 3300025936 | Ga0207670_10164638 | Ga0207670_101646382 | 91 |
| 24 | 3300026075 | Ga0207708_10229266 | Ga0207708_102292662 | 91 |
| 25 | 3300026118 | Ga0207675_100895014 | Ga0207675_1008950142 | 91 |
| 26 | 3300005545 | Ga0070695_100634511 | Ga0070695_1006345112 | 92 |
| 27 | 3300042009 | Ga0439451_003581 | Ga0439451_003581_626_934 | 93 |
| 28 | 3300049587 | Ga0501071_0672692 | Ga0501071_0672692_11_319 | 93 |
| 29 | 3300042003 | Ga0439443_019482 | Ga0439443_019482_738_1046 | 94 |
| 30 | 3300042436 | Ga0439435_0013850 | Ga0439435_0013850_937_1245 | 94 |
| 31 | 3300042437 | Ga0439444_0002792 | Ga0439444_0002792_1922_2230 | 94 |
| 32 | 3300042461 | Ga0439460_0000714 | Ga0439460_0000714_6830_7138 | 94 |
| 33 | 3300005530 | Ga0070679_101976911 | Ga0070679_1019769111 | 95 |
| 34 | 3300049572 | Ga0501036_0937023 | Ga0501036_0937023_193_516 | 95 |
| 35 | 3300049582 | Ga0501048_0465107 | Ga0501048_0465107_386_709 | 95 |
| 36 | 3300005327 | Ga0070658_10065736 | Ga0070658_100657363 | 100 |
| 37 | 3300005328 | Ga0070676_10001435 | Ga0070676_100014357 | 100 |
| 38 | 3300005328 | Ga0070676_10321729 | Ga0070676_103217292 | 100 |
| 39 | 3300005328 | Ga0070676_10331220 | Ga0070676_103312202 | 100 |
| 40 | 3300005331 | Ga0070670_100003563 | Ga0070670_1000035631 | 100 |
| 41 | 3300005331 | Ga0070670_100010188 | Ga0070670_1000101888 | 100 |
| 42 | 3300005331 | Ga0070670_100039316 | Ga0070670_1000393164 | 100 |
| 43 | 3300005331 | Ga0070670_100136031 | Ga0070670_1001360312 | 100 |
| 44 | 3300005331 | Ga0070670_100332215 | Ga0070670_1003322152 | 100 |
| 45 | 3300005331 | Ga0070670_100750698 | Ga0070670_1007506981 | 100 |
| 46 | 3300005333 | Ga0070677_10000343 | Ga0070677_100003433 | 100 |
| 47 | 3300005334 | Ga0068869_100009083 | Ga0068869_1000090833 | 100 |
| 48 | 3300005334 | Ga0068869_100039879 | Ga0068869_1000398793 | 100 |
| 49 | 3300005335 | Ga0070666_10530612 | Ga0070666_105306121 | 100 |
| 50 | 3300005336 | Ga0070680_100047758 | Ga0070680_1000477582 | 100 |
| 51 | 3300005338 | Ga0068868_100015555 | Ga0068868_1000155556 | 100 |
| 52 | 3300005338 | Ga0068868_100205658 | Ga0068868_1002056581 | 100 |
| 53 | 3300005340 | Ga0070689_100044203 | Ga0070689_1000442031 | 100 |
| 54 | 3300005340 | Ga0070689_100797461 | Ga0070689_1007974612 | 100 |
| 55 | 3300005345 | Ga0070692_10042581 | Ga0070692_100425813 | 100 |
| 56 | 3300005345 | Ga0070692_10050336 | Ga0070692_100503361 | 100 |
| 57 | 3300005347 | Ga0070668_100006797 | Ga0070668_1000067972 | 100 |
| 58 | 3300005347 | Ga0070668_100010955 | Ga0070668_1000109552 | 100 |
| 59 | 3300005347 | Ga0070668_100027239 | Ga0070668_1000272393 | 100 |
| 60 | 3300005347 | Ga0070668_100110179 | Ga0070668_1001101793 | 100 |
| 61 | 3300005347 | Ga0070668_100259447 | Ga0070668_1002594472 | 100 |
| 62 | 3300005347 | Ga0070668_100274145 | Ga0070668_1002741452 | 100 |
| 63 | 3300005347 | Ga0070668_100638347 | Ga0070668_1006383472 | 100 |
| 64 | 3300005347 | Ga0070668_101861703 | Ga0070668_1018617032 | 100 |
| 65 | 3300005353 | Ga0070669_100021805 | Ga0070669_1000218054 | 100 |
| 66 | 3300005353 | Ga0070669_100251345 | Ga0070669_1002513453 | 100 |
| 67 | 3300005354 | Ga0070675_100003678 | Ga0070675_1000036786 | 100 |
| 68 | 3300005354 | Ga0070675_100012472 | Ga0070675_1000124722 | 100 |
| 69 | 3300005354 | Ga0070675_100027916 | Ga0070675_1000279163 | 100 |
| 70 | 3300005354 | Ga0070675_100029547 | Ga0070675_1000295473 | 100 |
| 71 | 3300005354 | Ga0070675_100283993 | Ga0070675_1002839933 | 100 |
| 72 | 3300005355 | Ga0070671_100000272 | Ga0070671_10000027230 | 100 |
| 73 | 3300005355 | Ga0070671_100008199 | Ga0070671_1000081997 | 100 |
| 74 | 3300005355 | Ga0070671_100270159 | Ga0070671_1002701592 | 100 |
| 75 | 3300005355 | Ga0070671_102058122 | Ga0070671_1020581221 | 100 |
| 76 | 3300005356 | Ga0070674_100005249 | Ga0070674_1000052493 | 100 |
| 77 | 3300005356 | Ga0070674_100034622 | Ga0070674_1000346226 | 100 |
| 78 | 3300005356 | Ga0070674_101500840 | Ga0070674_1015008401 | 100 |
| 79 | 3300005364 | Ga0070673_100001140 | Ga0070673_1000011405 | 100 |
| 80 | 3300005364 | Ga0070673_100026294 | Ga0070673_1000262943 | 100 |
| 81 | 3300005364 | Ga0070673_100121931 | Ga0070673_1001219312 | 100 |
| 82 | 3300005365 | Ga0070688_100354713 | Ga0070688_1003547132 | 100 |
| 83 | 3300005366 | Ga0070659_100083041 | Ga0070659_1000830413 | 100 |
| 84 | 3300005366 | Ga0070659_101152340 | Ga0070659_1011523401 | 100 |
| 85 | 3300005367 | Ga0070667_100052861 | Ga0070667_1000528613 | 100 |
| 86 | 3300005367 | Ga0070667_100140760 | Ga0070667_1001407602 | 100 |
| 87 | 3300005367 | Ga0070667_100634378 | Ga0070667_1006343782 | 100 |
| 88 | 3300005435 | Ga0070714_102010201 | Ga0070714_1020102011 | 100 |
| 89 | 3300005436 | Ga0070713_100225309 | Ga0070713_1002253093 | 100 |
| 90 | 3300005440 | Ga0070705_100016156 | Ga0070705_1000161564 | 100 |
| 91 | 3300005440 | Ga0070705_100020022 | Ga0070705_1000200224 | 100 |
| 92 | 3300005440 | Ga0070705_100115744 | Ga0070705_1001157442 | 100 |
| 93 | 3300005441 | Ga0070700_100268752 | Ga0070700_1002687522 | 100 |
| 94 | 3300005441 | Ga0070700_100285341 | Ga0070700_1002853412 | 100 |
| 95 | 3300005444 | Ga0070694_100028846 | Ga0070694_1000288462 | 100 |
| 96 | 3300005444 | Ga0070694_100040671 | Ga0070694_1000406713 | 100 |
| 97 | 3300005444 | Ga0070694_100067401 | Ga0070694_1000674012 | 100 |
| 98 | 3300005455 | Ga0070663_100027027 | Ga0070663_1000270272 | 100 |
| 99 | 3300005456 | Ga0070678_100085002 | Ga0070678_1000850021 | 100 |
| 100 | 3300005456 | Ga0070678_100098340 | Ga0070678_1000983403 | 100 |
| 101 | 3300005456 | Ga0070678_100184096 | Ga0070678_1001840962 | 100 |
| 102 | 3300005456 | Ga0070678_101195126 | Ga0070678_1011951261 | 100 |
| 103 | 3300005457 | Ga0070662_100014326 | Ga0070662_1000143264 | 100 |
| 104 | 3300005458 | Ga0070681_10004336 | Ga0070681_100043365 | 100 |
| 105 | 3300005458 | Ga0070681_10232956 | Ga0070681_102329563 | 100 |
| 106 | 3300005459 | Ga0068867_100012234 | Ga0068867_1000122347 | 100 |
| 107 | 3300005459 | Ga0068867_100119410 | Ga0068867_1001194102 | 100 |
| 108 | 3300005459 | Ga0068867_100653289 | Ga0068867_1006532891 | 100 |
| 109 | 3300005466 | Ga0070685_10191559 | Ga0070685_101915591 | 100 |
| 110 | 3300005467 | Ga0070706_100169581 | Ga0070706_1001695812 | 100 |
| 111 | 3300005468 | Ga0070707_100796182 | Ga0070707_1007961822 | 100 |
| 112 | 3300005471 | Ga0070698_100271956 | Ga0070698_1002719563 | 100 |
| 113 | 3300005471 | Ga0070698_100770047 | Ga0070698_1007700472 | 100 |
| 114 | 3300005530 | Ga0070679_100449119 | Ga0070679_1004491192 | 100 |
| 115 | 3300005530 | Ga0070679_100778638 | Ga0070679_1007786381 | 100 |
| 116 | 3300005536 | Ga0070697_100033084 | Ga0070697_1000330842 | 100 |
| 117 | 3300005539 | Ga0068853_100004289 | Ga0068853_1000042897 | 100 |
| 118 | 3300005543 | Ga0070672_100088452 | Ga0070672_1000884522 | 100 |
| 119 | 3300005543 | Ga0070672_100143722 | Ga0070672_1001437221 | 100 |
| 120 | 3300005543 | Ga0070672_100250812 | Ga0070672_1002508121 | 100 |
| 121 | 3300005543 | Ga0070672_100258234 | Ga0070672_1002582343 | 100 |
| 122 | 3300005543 | Ga0070672_100514592 | Ga0070672_1005145922 | 100 |
| 123 | 3300005543 | Ga0070672_100580341 | Ga0070672_1005803412 | 100 |
| 124 | 3300005543 | Ga0070672_101403050 | Ga0070672_1014030502 | 100 |
| 125 | 3300005543 | Ga0070672_101659165 | Ga0070672_1016591651 | 100 |
| 126 | 3300005544 | Ga0070686_100643806 | Ga0070686_1006438061 | 100 |
| 127 | 3300005545 | Ga0070695_100000362 | Ga0070695_1000003626 | 100 |
| 128 | 3300005545 | Ga0070695_100041788 | Ga0070695_1000417882 | 100 |
| 129 | 3300005545 | Ga0070695_100334984 | Ga0070695_1003349842 | 100 |
| 130 | 3300005545 | Ga0070695_100394208 | Ga0070695_1003942082 | 100 |
| 131 | 3300005546 | Ga0070696_100000505 | Ga0070696_10000050513 | 100 |
| 132 | 3300005546 | Ga0070696_100053479 | Ga0070696_1000534793 | 100 |
| 133 | 3300005546 | Ga0070696_102012307 | Ga0070696_1020123071 | 100 |
| 134 | 3300005547 | Ga0070693_101221868 | Ga0070693_1012218681 | 100 |
| 135 | 3300005548 | Ga0070665_100142453 | Ga0070665_1001424533 | 100 |
| 136 | 3300005548 | Ga0070665_100142944 | Ga0070665_1001429444 | 100 |
| 137 | 3300005548 | Ga0070665_100172776 | Ga0070665_1001727762 | 100 |
| 138 | 3300005548 | Ga0070665_100504639 | Ga0070665_1005046392 | 100 |
| 139 | 3300005548 | Ga0070665_100648163 | Ga0070665_1006481632 | 100 |
| 140 | 3300005548 | Ga0070665_100832906 | Ga0070665_1008329061 | 100 |
| 141 | 3300005549 | Ga0070704_100016021 | Ga0070704_1000160213 | 100 |
| 142 | 3300005563 | Ga0068855_100511907 | Ga0068855_1005119072 | 100 |
| 143 | 3300005563 | Ga0068855_101961287 | Ga0068855_1019612872 | 100 |
| 144 | 3300005564 | Ga0070664_100036137 | Ga0070664_1000361375 | 100 |
| 145 | 3300005564 | Ga0070664_100439196 | Ga0070664_1004391962 | 100 |
| 146 | 3300005577 | Ga0068857_101698472 | Ga0068857_1016984722 | 100 |
| 147 | 3300005578 | Ga0068854_100084706 | Ga0068854_1000847063 | 100 |
| 148 | 3300005578 | Ga0068854_100366708 | Ga0068854_1003667082 | 100 |
| 149 | 3300005578 | Ga0068854_100470663 | Ga0068854_1004706632 | 100 |
| 150 | 3300005614 | Ga0068856_100144536 | Ga0068856_1001445363 | 100 |
| 151 | 3300005615 | Ga0070702_100179160 | Ga0070702_1001791601 | 100 |
| 152 | 3300005615 | Ga0070702_100583979 | Ga0070702_1005839792 | 100 |
| 153 | 3300005616 | Ga0068852_100002156 | Ga0068852_1000021566 | 100 |
| 154 | 3300005616 | Ga0068852_101755589 | Ga0068852_1017555891 | 100 |
| 155 | 3300005617 | Ga0068859_100680431 | Ga0068859_1006804312 | 100 |
| 156 | 3300005617 | Ga0068859_101040905 | Ga0068859_1010409051 | 100 |
| 157 | 3300005617 | Ga0068859_102283931 | Ga0068859_1022839311 | 100 |
| 158 | 3300005617 | Ga0068859_102341637 | Ga0068859_1023416371 | 100 |
| 159 | 3300005618 | Ga0068864_100034508 | Ga0068864_1000345084 | 100 |
| 160 | 3300005618 | Ga0068864_100035655 | Ga0068864_1000356556 | 100 |
| 161 | 3300005618 | Ga0068864_100062455 | Ga0068864_1000624553 | 100 |
| 162 | 3300005618 | Ga0068864_100155302 | Ga0068864_1001553023 | 100 |
| 163 | 3300005618 | Ga0068864_100176547 | Ga0068864_1001765473 | 100 |
| 164 | 3300005618 | Ga0068864_101331595 | Ga0068864_1013315951 | 100 |
| 165 | 3300005718 | Ga0068866_10321836 | Ga0068866_103218362 | 100 |
| 166 | 3300005719 | Ga0068861_100210631 | Ga0068861_1002106312 | 100 |
| 167 | 3300005719 | Ga0068861_100242385 | Ga0068861_1002423852 | 100 |
| 168 | 3300005719 | Ga0068861_100715396 | Ga0068861_1007153962 | 100 |
| 169 | 3300005719 | Ga0068861_100793843 | Ga0068861_1007938432 | 100 |
| 170 | 3300005719 | Ga0068861_101379962 | Ga0068861_1013799621 | 100 |
| 171 | 3300005834 | Ga0068851_10001153 | Ga0068851_100011538 | 100 |
| 172 | 3300005834 | Ga0068851_10979707 | Ga0068851_109797072 | 100 |
| 173 | 3300005840 | Ga0068870_10020819 | Ga0068870_100208193 | 100 |
| 174 | 3300005840 | Ga0068870_10058629 | Ga0068870_100586293 | 100 |
| 175 | 3300005840 | Ga0068870_10063872 | Ga0068870_100638722 | 100 |
| 176 | 3300005840 | Ga0068870_10176719 | Ga0068870_101767192 | 100 |
| 177 | 3300005841 | Ga0068863_100019911 | Ga0068863_1000199112 | 100 |
| 178 | 3300005841 | Ga0068863_100020923 | Ga0068863_1000209232 | 100 |
| 179 | 3300005841 | Ga0068863_100037554 | Ga0068863_1000375543 | 100 |
| 180 | 3300005841 | Ga0068863_100279781 | Ga0068863_1002797811 | 100 |
| 181 | 3300005842 | Ga0068858_100014384 | Ga0068858_1000143848 | 100 |
| 182 | 3300005842 | Ga0068858_100908099 | Ga0068858_1009080992 | 100 |
| 183 | 3300005843 | Ga0068860_100074707 | Ga0068860_1000747074 | 100 |
| 184 | 3300005843 | Ga0068860_100115727 | Ga0068860_1001157274 | 100 |
| 185 | 3300005843 | Ga0068860_100626423 | Ga0068860_1006264231 | 100 |
| 186 | 3300005843 | Ga0068860_100630676 | Ga0068860_1006306762 | 100 |
| 187 | 3300005844 | Ga0068862_100093345 | Ga0068862_1000933452 | 100 |
| 188 | 3300005844 | Ga0068862_100201451 | Ga0068862_1002014513 | 100 |
| 189 | 3300005844 | Ga0068862_100418843 | Ga0068862_1004188432 | 100 |
| 190 | 3300005844 | Ga0068862_100611945 | Ga0068862_1006119452 | 100 |
| 191 | 3300006163 | Ga0070715_10714684 | Ga0070715_107146842 | 100 |
| 192 | 3300006173 | Ga0070716_100247135 | Ga0070716_1002471351 | 100 |
| 193 | 3300006195 | Ga0075366_10867145 | Ga0075366_108671452 | 100 |
| 194 | 3300006237 | Ga0097621_100013711 | Ga0097621_1000137116 | 100 |
| 195 | 3300006237 | Ga0097621_100116903 | Ga0097621_1001169033 | 100 |
| 196 | 3300006237 | Ga0097621_101322934 | Ga0097621_1013229341 | 100 |
| 197 | 3300006358 | Ga0068871_100444041 | Ga0068871_1004440411 | 100 |
| 198 | 3300006358 | Ga0068871_100647272 | Ga0068871_1006472722 | 100 |
| 199 | 3300006358 | Ga0068871_100964219 | Ga0068871_1009642192 | 100 |
| 200 | 3300006358 | Ga0068871_101823323 | Ga0068871_1018233232 | 100 |
| 201 | 3300006844 | Ga0075428_100782575 | Ga0075428_1007825752 | 100 |
| 202 | 3300006844 | Ga0075428_101258707 | Ga0075428_1012587072 | 100 |
| 203 | 3300006846 | Ga0075430_100626827 | Ga0075430_1006268272 | 100 |
| 204 | 3300006846 | Ga0075430_101444695 | Ga0075430_1014446952 | 100 |
| 205 | 3300006852 | Ga0075433_10231742 | Ga0075433_102317423 | 100 |
| 206 | 3300006852 | Ga0075433_10255444 | Ga0075433_102554442 | 100 |
| 207 | 3300006871 | Ga0075434_100100901 | Ga0075434_1001009013 | 100 |
| 208 | 3300006871 | Ga0075434_100697291 | Ga0075434_1006972912 | 100 |
| 209 | 3300006871 | Ga0075434_102366301 | Ga0075434_1023663012 | 100 |
| 210 | 3300006880 | Ga0075429_100003041 | Ga0075429_10000304115 | 100 |
| 211 | 3300006881 | Ga0068865_100026154 | Ga0068865_1000261546 | 100 |
| 212 | 3300006881 | Ga0068865_100032078 | Ga0068865_1000320785 | 100 |
| 213 | 3300006914 | Ga0075436_100005116 | Ga0075436_1000051169 | 100 |
| 214 | 3300006914 | Ga0075436_100008567 | Ga0075436_1000085678 | 100 |
| 215 | 3300006914 | Ga0075436_100014985 | Ga0075436_1000149856 | 100 |
| 216 | 3300006914 | Ga0075436_100023095 | Ga0075436_1000230956 | 100 |
| 217 | 3300006914 | Ga0075436_100027380 | Ga0075436_1000273803 | 100 |
| 218 | 3300006931 | Ga0097620_100680472 | Ga0097620_1006804722 | 100 |
| 219 | 3300006931 | Ga0097620_101040940 | Ga0097620_1010409401 | 100 |
| 220 | 3300006931 | Ga0097620_102283865 | Ga0097620_1022838651 | 100 |
| 221 | 3300006931 | Ga0097620_102342153 | Ga0097620_1023421532 | 100 |
| 222 | 3300007076 | Ga0075435_100048639 | Ga0075435_1000486392 | 100 |
| 223 | 3300007076 | Ga0075435_100153380 | Ga0075435_1001533803 | 100 |
| 224 | 3300007076 | Ga0075435_101044791 | Ga0075435_1010447912 | 100 |
| 225 | 3300007076 | Ga0075435_101235768 | Ga0075435_1012357682 | 100 |
| 226 | 3300009094 | Ga0111539_10764449 | Ga0111539_107644491 | 100 |
| 227 | 3300009094 | Ga0111539_11322971 | Ga0111539_113229712 | 100 |
| 228 | 3300009094 | Ga0111539_11333324 | Ga0111539_113333242 | 100 |
| 229 | 3300009098 | Ga0105245_10024073 | Ga0105245_100240731 | 100 |
| 230 | 3300009098 | Ga0105245_10439406 | Ga0105245_104394062 | 100 |
| 231 | 3300009098 | Ga0105245_10536860 | Ga0105245_105368602 | 100 |
| 232 | 3300009098 | Ga0105245_12026452 | Ga0105245_120264522 | 100 |
| 233 | 3300009101 | Ga0105247_10005196 | Ga0105247_100051965 | 100 |
| 234 | 3300009101 | Ga0105247_10777281 | Ga0105247_107772812 | 100 |
| 235 | 3300009147 | Ga0114129_10281193 | Ga0114129_102811933 | 100 |
| 236 | 3300009147 | Ga0114129_12654672 | Ga0114129_126546722 | 100 |
| 237 | 3300009148 | Ga0105243_10171534 | Ga0105243_101715343 | 100 |
| 238 | 3300009174 | Ga0105241_10742711 | Ga0105241_107427112 | 100 |
| 239 | 3300009174 | Ga0105241_11874651 | Ga0105241_118746511 | 100 |
| 240 | 3300009176 | Ga0105242_10429105 | Ga0105242_104291052 | 100 |
| 241 | 3300009177 | Ga0105248_10000992 | Ga0105248_1000099227 | 100 |
| 242 | 3300009177 | Ga0105248_10088473 | Ga0105248_100884731 | 100 |
| 243 | 3300009177 | Ga0105248_10341517 | Ga0105248_103415172 | 100 |
| 244 | 3300009545 | Ga0105237_10016087 | Ga0105237_1001608710 | 100 |
| 245 | 3300009551 | Ga0105238_10957048 | Ga0105238_109570482 | 100 |
| 246 | 3300009553 | Ga0105249_11819985 | Ga0105249_118199851 | 100 |
| 247 | 3300010375 | Ga0105239_10377220 | Ga0105239_103772203 | 100 |
| 248 | 3300010375 | Ga0105239_10450025 | Ga0105239_104500252 | 100 |
| 249 | 3300010375 | Ga0105239_10605315 | Ga0105239_106053152 | 100 |
| 250 | 3300011119 | Ga0105246_10034593 | Ga0105246_100345932 | 100 |
| 251 | 3300011119 | Ga0105246_10723807 | Ga0105246_107238072 | 100 |
| 252 | 3300013102 | Ga0157371_11556417 | Ga0157371_115564172 | 100 |
| 253 | 3300013296 | Ga0157374_10072086 | Ga0157374_100720862 | 100 |
| 254 | 3300013296 | Ga0157374_10163480 | Ga0157374_101634804 | 100 |
| 255 | 3300013296 | Ga0157374_10180513 | Ga0157374_101805132 | 100 |
| 256 | 3300013297 | Ga0157378_10211669 | Ga0157378_102116693 | 100 |
| 257 | 3300013297 | Ga0157378_11127728 | Ga0157378_111277282 | 100 |
| 258 | 3300013297 | Ga0157378_11562892 | Ga0157378_115628922 | 100 |
| 259 | 3300013297 | Ga0157378_11805173 | Ga0157378_118051732 | 100 |
| 260 | 3300013306 | Ga0163162_10020397 | Ga0163162_100203974 | 100 |
| 261 | 3300013306 | Ga0163162_10176898 | Ga0163162_101768983 | 100 |
| 262 | 3300013306 | Ga0163162_10189891 | Ga0163162_101898914 | 100 |
| 263 | 3300013306 | Ga0163162_10286935 | Ga0163162_102869354 | 100 |
| 264 | 3300013306 | Ga0163162_11387607 | Ga0163162_113876072 | 100 |
| 265 | 3300013306 | Ga0163162_12037595 | Ga0163162_120375952 | 100 |
| 266 | 3300013308 | Ga0157375_10012622 | Ga0157375_100126228 | 100 |
| 267 | 3300013308 | Ga0157375_10045551 | Ga0157375_100455512 | 100 |
| 268 | 3300013308 | Ga0157375_10057193 | Ga0157375_100571933 | 100 |
| 269 | 3300013308 | Ga0157375_10101514 | Ga0157375_101015142 | 100 |
| 270 | 3300013308 | Ga0157375_10531471 | Ga0157375_105314712 | 100 |
| 271 | 3300013308 | Ga0157375_11653512 | Ga0157375_116535122 | 100 |
| 272 | 3300013308 | Ga0157375_12394512 | Ga0157375_123945121 | 100 |
| 273 | 3300014325 | Ga0163163_10039634 | Ga0163163_100396342 | 100 |
| 274 | 3300014325 | Ga0163163_10052788 | Ga0163163_100527882 | 100 |
| 275 | 3300014325 | Ga0163163_10101835 | Ga0163163_101018352 | 100 |
| 276 | 3300014325 | Ga0163163_10946256 | Ga0163163_109462562 | 100 |
| 277 | 3300014326 | Ga0157380_10041592 | Ga0157380_100415924 | 100 |
| 278 | 3300014326 | Ga0157380_10200791 | Ga0157380_102007912 | 100 |
| 279 | 3300014326 | Ga0157380_10778776 | Ga0157380_107787762 | 100 |
| 280 | 3300014968 | Ga0157379_10025408 | Ga0157379_100254082 | 100 |
| 281 | 3300014969 | Ga0157376_10012058 | Ga0157376_100120588 | 100 |
| 282 | 3300014969 | Ga0157376_10874410 | Ga0157376_108744102 | 100 |
| 283 | 3300014969 | Ga0157376_10955437 | Ga0157376_109554372 | 100 |
| 284 | 3300017792 | Ga0163161_10020699 | Ga0163161_100206992 | 100 |
| 285 | 3300017792 | Ga0163161_10033804 | Ga0163161_100338044 | 100 |
| 286 | 3300025315 | Ga0207697_10047453 | Ga0207697_100474533 | 100 |
| 287 | 3300025315 | Ga0207697_10240881 | Ga0207697_102408811 | 100 |
| 288 | 3300025321 | Ga0207656_10012067 | Ga0207656_100120673 | 100 |
| 289 | 3300025893 | Ga0207682_10000198 | Ga0207682_1000019817 | 100 |
| 290 | 3300025899 | Ga0207642_10196980 | Ga0207642_101969802 | 100 |
| 291 | 3300025903 | Ga0207680_10057628 | Ga0207680_100576282 | 100 |
| 292 | 3300025905 | Ga0207685_10585062 | Ga0207685_105850622 | 100 |
| 293 | 3300025906 | Ga0207699_10237170 | Ga0207699_102371702 | 100 |
| 294 | 3300025907 | Ga0207645_10000676 | Ga0207645_1000067617 | 100 |
| 295 | 3300025907 | Ga0207645_10030039 | Ga0207645_100300393 | 100 |
| 296 | 3300025907 | Ga0207645_10311729 | Ga0207645_103117292 | 100 |
| 297 | 3300025908 | Ga0207643_10039589 | Ga0207643_100395892 | 100 |
| 298 | 3300025908 | Ga0207643_10045286 | Ga0207643_100452862 | 100 |
| 299 | 3300025908 | Ga0207643_10049201 | Ga0207643_100492012 | 100 |
| 300 | 3300025908 | Ga0207643_10352679 | Ga0207643_103526792 | 100 |
| 301 | 3300025909 | Ga0207705_10063847 | Ga0207705_100638472 | 100 |
| 302 | 3300025910 | Ga0207684_10112094 | Ga0207684_101120943 | 100 |
| 303 | 3300025911 | Ga0207654_10464225 | Ga0207654_104642252 | 100 |
| 304 | 3300025912 | Ga0207707_10009678 | Ga0207707_100096787 | 100 |
| 305 | 3300025912 | Ga0207707_10105173 | Ga0207707_101051732 | 100 |
| 306 | 3300025914 | Ga0207671_10071944 | Ga0207671_100719444 | 100 |
| 307 | 3300025917 | Ga0207660_10043657 | Ga0207660_100436575 | 100 |
| 308 | 3300025917 | Ga0207660_10386898 | Ga0207660_103868982 | 100 |
| 309 | 3300025918 | Ga0207662_10686993 | Ga0207662_106869931 | 100 |
| 310 | 3300025919 | Ga0207657_10193589 | Ga0207657_101935891 | 100 |
| 311 | 3300025921 | Ga0207652_10013645 | Ga0207652_100136452 | 100 |
| 312 | 3300025921 | Ga0207652_10393285 | Ga0207652_103932852 | 100 |
| 313 | 3300025922 | Ga0207646_10870301 | Ga0207646_108703012 | 100 |
| 314 | 3300025923 | Ga0207681_10005688 | Ga0207681_100056889 | 100 |
| 315 | 3300025923 | Ga0207681_10170319 | Ga0207681_101703193 | 100 |
| 316 | 3300025923 | Ga0207681_10236162 | Ga0207681_102361622 | 100 |
| 317 | 3300025923 | Ga0207681_10920762 | Ga0207681_109207622 | 100 |
| 318 | 3300025925 | Ga0207650_10018612 | Ga0207650_100186125 | 100 |
| 319 | 3300025925 | Ga0207650_10114126 | Ga0207650_101141262 | 100 |
| 320 | 3300025925 | Ga0207650_10250069 | Ga0207650_102500692 | 100 |
| 321 | 3300025925 | Ga0207650_10492403 | Ga0207650_104924032 | 100 |
| 322 | 3300025925 | Ga0207650_10637532 | Ga0207650_106375322 | 100 |
| 323 | 3300025926 | Ga0207659_10133056 | Ga0207659_101330562 | 100 |
| 324 | 3300025926 | Ga0207659_10368540 | Ga0207659_103685402 | 100 |
| 325 | 3300025926 | Ga0207659_11437017 | Ga0207659_114370172 | 100 |
| 326 | 3300025926 | Ga0207659_11662868 | Ga0207659_116628681 | 100 |
| 327 | 3300025927 | Ga0207687_10487589 | Ga0207687_104875892 | 100 |
| 328 | 3300025927 | Ga0207687_10548927 | Ga0207687_105489271 | 100 |
| 329 | 3300025927 | Ga0207687_10807528 | Ga0207687_108075282 | 100 |
| 330 | 3300025929 | Ga0207664_10048574 | Ga0207664_100485743 | 100 |
| 331 | 3300025931 | Ga0207644_10010982 | Ga0207644_100109825 | 100 |
| 332 | 3300025931 | Ga0207644_10013052 | Ga0207644_100130523 | 100 |
| 333 | 3300025932 | Ga0207690_10937728 | Ga0207690_109377281 | 100 |
| 334 | 3300025933 | Ga0207706_10020283 | Ga0207706_100202835 | 100 |
| 335 | 3300025933 | Ga0207706_10100010 | Ga0207706_101000104 | 100 |
| 336 | 3300025933 | Ga0207706_11422832 | Ga0207706_114228322 | 100 |
| 337 | 3300025934 | Ga0207686_10159311 | Ga0207686_101593113 | 100 |
| 338 | 3300025936 | Ga0207670_10353646 | Ga0207670_103536462 | 100 |
| 339 | 3300025936 | Ga0207670_10374350 | Ga0207670_103743503 | 100 |
| 340 | 3300025936 | Ga0207670_10536282 | Ga0207670_105362822 | 100 |
| 341 | 3300025936 | Ga0207670_11609061 | Ga0207670_116090611 | 100 |
| 342 | 3300025937 | Ga0207669_10031072 | Ga0207669_100310723 | 100 |
| 343 | 3300025937 | Ga0207669_10238642 | Ga0207669_102386422 | 100 |
| 344 | 3300025937 | Ga0207669_10342286 | Ga0207669_103422862 | 100 |
| 345 | 3300025938 | Ga0207704_11683730 | Ga0207704_116837302 | 100 |
| 346 | 3300025939 | Ga0207665_10270644 | Ga0207665_102706442 | 100 |
| 347 | 3300025939 | Ga0207665_10295733 | Ga0207665_102957332 | 100 |
| 348 | 3300025940 | Ga0207691_10000243 | Ga0207691_1000024317 | 100 |
| 349 | 3300025940 | Ga0207691_10001181 | Ga0207691_1000118125 | 100 |
| 350 | 3300025940 | Ga0207691_10091771 | Ga0207691_100917712 | 100 |
| 351 | 3300025940 | Ga0207691_10247947 | Ga0207691_102479473 | 100 |
| 352 | 3300025940 | Ga0207691_10406630 | Ga0207691_104066302 | 100 |
| 353 | 3300025940 | Ga0207691_10533164 | Ga0207691_105331641 | 100 |
| 354 | 3300025940 | Ga0207691_10588554 | Ga0207691_105885542 | 100 |
| 355 | 3300025941 | Ga0207711_10018678 | Ga0207711_100186785 | 100 |
| 356 | 3300025941 | Ga0207711_10278090 | Ga0207711_102780902 | 100 |
| 357 | 3300025941 | Ga0207711_11084510 | Ga0207711_110845102 | 100 |
| 358 | 3300025942 | Ga0207689_10015420 | Ga0207689_100154207 | 100 |
| 359 | 3300025942 | Ga0207689_10049475 | Ga0207689_100494756 | 100 |
| 360 | 3300025942 | Ga0207689_10755351 | Ga0207689_107553512 | 100 |
| 361 | 3300025942 | Ga0207689_10882363 | Ga0207689_108823631 | 100 |
| 362 | 3300025942 | Ga0207689_11612523 | Ga0207689_116125231 | 100 |
| 363 | 3300025942 | Ga0207689_11652216 | Ga0207689_116522162 | 100 |
| 364 | 3300025945 | Ga0207679_10070680 | Ga0207679_100706803 | 100 |
| 365 | 3300025945 | Ga0207679_11258125 | Ga0207679_112581251 | 100 |
| 366 | 3300025960 | Ga0207651_10011474 | Ga0207651_100114742 | 100 |
| 367 | 3300025960 | Ga0207651_10034413 | Ga0207651_100344132 | 100 |
| 368 | 3300025960 | Ga0207651_10081940 | Ga0207651_100819402 | 100 |
| 369 | 3300025961 | Ga0207712_10613324 | Ga0207712_106133242 | 100 |
| 370 | 3300025972 | Ga0207668_10005128 | Ga0207668_100051289 | 100 |
| 371 | 3300025972 | Ga0207668_10007321 | Ga0207668_100073214 | 100 |
| 372 | 3300025972 | Ga0207668_10036649 | Ga0207668_100366492 | 100 |
| 373 | 3300025972 | Ga0207668_10093152 | Ga0207668_100931523 | 100 |
| 374 | 3300025972 | Ga0207668_10730533 | Ga0207668_107305332 | 100 |
| 375 | 3300025981 | Ga0207640_10118510 | Ga0207640_101185101 | 100 |
| 376 | 3300025981 | Ga0207640_10425787 | Ga0207640_104257872 | 100 |
| 377 | 3300025986 | Ga0207658_10011658 | Ga0207658_100116584 | 100 |
| 378 | 3300025986 | Ga0207658_10103985 | Ga0207658_101039852 | 100 |
| 379 | 3300025986 | Ga0207658_10416996 | Ga0207658_104169962 | 100 |
| 380 | 3300026023 | Ga0207677_10164429 | Ga0207677_101644293 | 100 |
| 381 | 3300026035 | Ga0207703_10769894 | Ga0207703_107698941 | 100 |
| 382 | 3300026035 | Ga0207703_10912679 | Ga0207703_109126792 | 100 |
| 383 | 3300026041 | Ga0207639_10257170 | Ga0207639_102571702 | 100 |
| 384 | 3300026041 | Ga0207639_11263962 | Ga0207639_112639622 | 100 |
| 385 | 3300026075 | Ga0207708_10178673 | Ga0207708_101786732 | 100 |
| 386 | 3300026078 | Ga0207702_10272306 | Ga0207702_102723061 | 100 |
| 387 | 3300026088 | Ga0207641_10112676 | Ga0207641_101126763 | 100 |
| 388 | 3300026088 | Ga0207641_10115124 | Ga0207641_101151243 | 100 |
| 389 | 3300026088 | Ga0207641_10239056 | Ga0207641_102390562 | 100 |
| 390 | 3300026088 | Ga0207641_10357094 | Ga0207641_103570941 | 100 |
| 391 | 3300026088 | Ga0207641_10364275 | Ga0207641_103642752 | 100 |
| 392 | 3300026088 | Ga0207641_12109513 | Ga0207641_121095131 | 100 |
| 393 | 3300026089 | Ga0207648_10009225 | Ga0207648_100092258 | 100 |
| 394 | 3300026089 | Ga0207648_10112143 | Ga0207648_101121433 | 100 |
| 395 | 3300026089 | Ga0207648_10551302 | Ga0207648_105513022 | 100 |
| 396 | 3300026089 | Ga0207648_11890090 | Ga0207648_118900901 | 100 |
| 397 | 3300026095 | Ga0207676_10033387 | Ga0207676_100333874 | 100 |
| 398 | 3300026095 | Ga0207676_10129115 | Ga0207676_101291154 | 100 |
| 399 | 3300026095 | Ga0207676_10150985 | Ga0207676_101509852 | 100 |
| 400 | 3300026095 | Ga0207676_10482633 | Ga0207676_104826332 | 100 |
| 401 | 3300026116 | Ga0207674_11218433 | Ga0207674_112184331 | 100 |
| 402 | 3300026118 | Ga0207675_100020956 | Ga0207675_1000209564 | 100 |
| 403 | 3300026118 | Ga0207675_100046593 | Ga0207675_1000465935 | 100 |
| 404 | 3300026118 | Ga0207675_100110998 | Ga0207675_1001109983 | 100 |
| 405 | 3300026118 | Ga0207675_100307665 | Ga0207675_1003076652 | 100 |
| 406 | 3300026118 | Ga0207675_100673391 | Ga0207675_1006733912 | 100 |
| 407 | 3300026118 | Ga0207675_100755244 | Ga0207675_1007552441 | 100 |
| 408 | 3300026118 | Ga0207675_101003193 | Ga0207675_1010031931 | 100 |
| 409 | 3300026118 | Ga0207675_101787281 | Ga0207675_1017872811 | 100 |
| 410 | 3300026121 | Ga0207683_10000308 | Ga0207683_1000030817 | 100 |
| 411 | 3300026121 | Ga0207683_10100953 | Ga0207683_101009535 | 100 |
| 412 | 3300026121 | Ga0207683_11693062 | Ga0207683_116930622 | 100 |
| 413 | 3300026142 | Ga0207698_10014478 | Ga0207698_100144782 | 100 |
| 414 | 3300026142 | Ga0207698_11364666 | Ga0207698_113646661 | 100 |
| 415 | 3300027364 | Ga0209967_1007547 | Ga0209967_10075473 | 100 |
| 416 | 3300027378 | Ga0209981_1000274 | Ga0209981_10002742 | 100 |
| 417 | 3300027395 | Ga0209996_1000426 | Ga0209996_10004264 | 100 |
| 418 | 3300027462 | Ga0210000_1012802 | Ga0210000_10128022 | 100 |
| 419 | 3300027471 | Ga0209995_1002372 | Ga0209995_10023724 | 100 |
| 420 | 3300027526 | Ga0209968_1028162 | Ga0209968_10281622 | 100 |
| 421 | 3300027543 | Ga0209999_1003045 | Ga0209999_10030454 | 100 |
| 422 | 3300027614 | Ga0209970_1030478 | Ga0209970_10304782 | 100 |
| 423 | 3300027682 | Ga0209971_1093017 | Ga0209971_10930172 | 100 |
| 424 | 3300027876 | Ga0209974_10435536 | Ga0209974_104355362 | 100 |
| 425 | 3300028379 | Ga0268266_10035503 | Ga0268266_100355036 | 100 |
| 426 | 3300028379 | Ga0268266_10154387 | Ga0268266_101543873 | 100 |
| 427 | 3300028379 | Ga0268266_10222798 | Ga0268266_102227983 | 100 |
| 428 | 3300028379 | Ga0268266_10289909 | Ga0268266_102899092 | 100 |
| 429 | 3300028379 | Ga0268266_10567504 | Ga0268266_105675042 | 100 |
| 430 | 3300028380 | Ga0268265_10007059 | Ga0268265_100070595 | 100 |
| 431 | 3300028380 | Ga0268265_10056208 | Ga0268265_100562083 | 100 |
| 432 | 3300028380 | Ga0268265_10103415 | Ga0268265_101034153 | 100 |
| 433 | 3300028380 | Ga0268265_10398107 | Ga0268265_103981072 | 100 |
| 434 | 3300028381 | Ga0268264_10040446 | Ga0268264_100404463 | 100 |
| 435 | 3300028381 | Ga0268264_10071335 | Ga0268264_100713353 | 100 |
| 436 | 3300028381 | Ga0268264_10111072 | Ga0268264_101110723 | 100 |
| 437 | 3300028381 | Ga0268264_10535440 | Ga0268264_105354402 | 100 |
| 438 | 3300028381 | Ga0268264_10695181 | Ga0268264_106951812 | 100 |
| 439 | 3300031251 | Ga0265327_10030111 | Ga0265327_100301112 | 100 |
| 440 | 3300031548 | Ga0307408_100829886 | Ga0307408_1008298862 | 100 |
| 441 | 3300031548 | Ga0307408_100831804 | Ga0307408_1008318042 | 100 |
| 442 | 3300031665 | Ga0316575_10030526 | Ga0316575_100305263 | 100 |
| 443 | 3300031665 | Ga0316575_10033995 | Ga0316575_100339951 | 100 |
| 444 | 3300031691 | Ga0316579_10010200 | Ga0316579_100102004 | 100 |
| 445 | 3300031691 | Ga0316579_10140937 | Ga0316579_101409371 | 100 |
| 446 | 3300031727 | Ga0316576_10071290 | Ga0316576_100712903 | 100 |
| 447 | 3300031728 | Ga0316578_10396209 | Ga0316578_103962091 | 100 |
| 448 | 3300031733 | Ga0316577_10001781 | Ga0316577_100017812 | 100 |
| 449 | 3300031824 | Ga0307413_11268788 | Ga0307413_112687882 | 100 |
| 450 | 3300031995 | Ga0307409_100724543 | Ga0307409_1007245432 | 100 |
| 451 | 3300032002 | Ga0307416_101043310 | Ga0307416_1010433102 | 100 |
| 452 | 3300032137 | Ga0316585_10021392 | Ga0316585_100213924 | 100 |
| 453 | 3300032137 | Ga0316585_10028949 | Ga0316585_100289492 | 100 |
| 454 | 3300032139 | Ga0316580_10008681 | Ga0316580_100086814 | 100 |
| 455 | 3300032168 | Ga0316593_10000385 | Ga0316593_100003859 | 100 |
| 456 | 3300034957 | Ga0373938_0157733 | Ga0373938_0157733_255_563 | 100 |
| 457 | 3300035085 | Ga0373929_0164303 | Ga0373929_0164303_58_366 | 100 |
| 458 | 3300035086 | Ga0373934_0000134 | Ga0373934_0000134_20745_21053 | 100 |
| 459 | 3300035090 | Ga0373949_0052465 | Ga0373949_0052465_609_917 | 100 |
| 460 | 3300035090 | Ga0373949_0074343 | Ga0373949_0074343_66_374 | 100 |
| 461 | 3300035091 | Ga0373951_0180728 | Ga0373951_0180728_231_539 | 100 |
| 462 | 3300035092 | Ga0373952_0296346 | Ga0373952_0296346_50_358 | 100 |
| 463 | 3300035112 | Ga0373932_0061752 | Ga0373932_0061752_484_792 | 100 |
| 464 | 3300035112 | Ga0373932_0142798 | Ga0373932_0142798_347_655 | 100 |
| 465 | 3300035113 | Ga0373936_0059916 | Ga0373936_0059916_154_462 | 100 |
| 466 | 3300035114 | Ga0373939_0203489 | Ga0373939_0203489_185_493 | 100 |
| 467 | 3300035114 | Ga0373939_0465874 | Ga0373939_0465874_31_339 | 100 |
| 468 | 3300035119 | Ga0373956_0000006 | Ga0373956_0000006_9484_9792 | 100 |
| 469 | 3300035120 | Ga0373957_0000372 | Ga0373957_0000372_9702_10010 | 100 |
| 470 | 3300035121 | Ga0373960_0118127 | Ga0373960_0118127_540_851 | 100 |
| 471 | 3300035121 | Ga0373960_0246755 | Ga0373960_0246755_214_522 | 100 |
| 472 | 3300035170 | Ga0373943_0006741 | Ga0373943_0006741_4693_5001 | 100 |
| 473 | 3300035171 | Ga0373946_0569281 | Ga0373946_0569281_155_463 | 100 |
| 474 | 3300035172 | Ga0373955_0272091 | Ga0373955_0272091_688_996 | 100 |
| 475 | 3300035172 | Ga0373955_0577636 | Ga0373955_0577636_27_335 | 100 |
| 476 | 3300035398 | Ga0316574_0081081 | Ga0316574_0081081_1488_1796 | 100 |
| 477 | 3300035398 | Ga0316574_0191459 | Ga0316574_0191459_270_578 | 100 |
| 478 | 3300035410 | Ga0373924_0117450 | Ga0373924_0117450_57_365 | 100 |
| 479 | 3300035691 | Ga0373931_0047678 | Ga0373931_0047678_682_990 | 100 |
| 480 | 3300035695 | Ga0373927_0047624 | Ga0373927_0047624_2328_2636 | 100 |
| 481 | 3300035724 | Ga0373933_0000564 | Ga0373933_0000564_9097_9405 | 100 |
| 482 | 3300035724 | Ga0373933_0079276 | Ga0373933_0079276_1193_1507 | 100 |
| 483 | 3300035724 | Ga0373933_0161536 | Ga0373933_0161536_282_590 | 100 |
| 484 | 3300035725 | Ga0373947_0025727 | Ga0373947_0025727_2992_3300 | 100 |
| 485 | 3300036401 | Ga0373937_0003219 | Ga0373937_0003219_1574_1882 | 100 |
| 486 | 3300036401 | Ga0373937_0047835 | Ga0373937_0047835_2167_2481 | 100 |
| 487 | 3300036401 | Ga0373937_1243825 | Ga0373937_1243825_199_507 | 100 |
| 488 | 3300036647 | Ga0316582_0019086 | Ga0316582_0019086_2310_2618 | 100 |
| 489 | 3300036647 | Ga0316582_0385781 | Ga0316582_0385781_491_799 | 100 |
| 490 | 3300036712 | Ga0316584_0008900 | Ga0316584_0008900_4646_4963 | 100 |
| 491 | 3300037068 | Ga0373925_0061295 | Ga0373925_0061295_155_463 | 100 |
| 492 | 3300037068 | Ga0373925_0775520 | Ga0373925_0775520_376_684 | 100 |
| 493 | 3300037588 | Ga0316581_0001282 | Ga0316581_0001282_1361_1678 | 100 |
| 494 | 3300037588 | Ga0316581_0054570 | Ga0316581_0054570_872_1180 | 100 |
| 495 | 3300039450 | Ga0436363_1444570 | Ga0436363_1444570_283_591 | 100 |
| 496 | 3300041486 | Ga0451807_2332697 | Ga0451807_2332697_1408_1716 | 100 |
| 497 | 3300041505 | Ga0451849_1451196 | Ga0451849_1451196_279_587 | 100 |
| 498 | 3300041512 | Ga0451853_0470233 | Ga0451853_0470233_84_392 | 100 |
| 499 | 3300042001 | Ga0439441_000116 | Ga0439441_000116_2404_2712 | 100 |
| 500 | 3300042015 | Ga0439462_0064584 | Ga0439462_0064584_88_408 | 100 |
| 501 | 3300042156 | Ga0439446_0028390 | Ga0439446_0028390_68_388 | 100 |
| 502 | 3300042435 | Ga0439434_0000212 | Ga0439434_0000212_13306_13626 | 100 |
| 503 | 3300042436 | Ga0439435_0000206 | Ga0439435_0000206_3293_3613 | 100 |
| 504 | 3300042876 | Ga0451577_0023914 | Ga0451577_0023914_3192_3500 | 100 |
| 505 | 3300044673 | Ga0453683_0028389 | Ga0453683_0028389_1101_1409 | 100 |
| 506 | 3300044694 | Ga0466963_0602491 | Ga0466963_0602491_408_716 | 100 |
| 507 | 3300044706 | Ga0466964_0021058 | Ga0466964_0021058_2075_2383 | 100 |
| 508 | 3300044706 | Ga0466964_0443880 | Ga0466964_0443880_193_501 | 100 |
| 509 | 3300044712 | Ga0453684_0276423 | Ga0453684_0276423_404_712 | 100 |
| 510 | 3300045051 | Ga0451576_0000147 | Ga0451576_0000147_161489_161797 | 100 |
| 511 | 3300045051 | Ga0451576_0196786 | Ga0451576_0196786_583_891 | 100 |
| 512 | 3300045976 | Ga0466967_0001049 | Ga0466967_0001049_12348_12656 | 100 |
| 513 | 3300046462 | Ga0495651_0000233 | Ga0495651_0000233_35331_35639 | 100 |
| 514 | 3300046528 | Ga0495642_0128916 | Ga0495642_0128916_597_905 | 100 |
| 515 | 3300046539 | Ga0495621_0418329 | Ga0495621_0418329_89_397 | 100 |
| 516 | 3300046664 | Ga0495659_0232478 | Ga0495659_0232478_202_510 | 100 |
| 517 | 3300046675 | Ga0495657_0022573 | Ga0495657_0022573_3401_3709 | 100 |
| 518 | 3300046679 | Ga0495623_0334738 | Ga0495623_0334738_251_559 | 100 |
| 519 | 3300046681 | Ga0495647_0090012 | Ga0495647_0090012_519_827 | 100 |
| 520 | 3300046684 | Ga0495669_0042821 | Ga0495669_0042821_657_965 | 100 |
| 521 | 3300047318 | Ga0495636_0074493 | Ga0495636_0074493_1060_1368 | 100 |
| 522 | 3300047321 | Ga0495676_1076910 | Ga0495676_1076910_89_397 | 100 |
| 523 | 3300047322 | Ga0495680_0178343 | Ga0495680_0178343_979_1287 | 100 |
| 524 | 3300047444 | Ga0495675_0741735 | Ga0495675_0741735_37_345 | 100 |
| 525 | 3300047445 | Ga0495677_0379970 | Ga0495677_0379970_17_325 | 100 |
| 526 | 3300048090 | Ga0495615_0280598 | Ga0495615_0280598_199_507 | 100 |
| 527 | 3300048903 | Ga0496100_1225962 | Ga0496100_1225962_41_349 | 100 |
| 528 | 3300048909 | Ga0496106_0192535 | Ga0496106_0192535_398_736 | 100 |
| 529 | 3300048911 | Ga0496108_0344050 | Ga0496108_0344050_449_757 | 100 |
| 530 | 3300048915 | Ga0496112_0076310 | Ga0496112_0076310_2467_2775 | 100 |
| 531 | 3300048916 | Ga0496113_1563851 | Ga0496113_1563851_97_435 | 100 |
| 532 | 3300048918 | Ga0496115_1214065 | Ga0496115_1214065_151_459 | 100 |
| 533 | 3300049515 | Ga0501292_017546 | Ga0501292_017546_445_753 | 100 |
| 534 | 3300049568 | Ga0501031_0704530 | Ga0501031_0704530_206_514 | 100 |
| 535 | 3300049571 | Ga0501034_0053868 | Ga0501034_0053868_1111_1419 | 100 |
| 536 | 3300049572 | Ga0501036_1745253 | Ga0501036_1745253_137_445 | 100 |
| 537 | 3300049576 | Ga0501040_1403187 | Ga0501040_1403187_101_409 | 100 |
| 538 | 3300049580 | Ga0501046_0657115 | Ga0501046_0657115_185_493 | 100 |
| 539 | 3300049581 | Ga0501047_0175940 | Ga0501047_0175940_985_1293 | 100 |
| 540 | 3300049583 | Ga0501067_0068582 | Ga0501067_0068582_1415_1723 | 100 |
| 541 | 3300049583 | Ga0501067_0492210 | Ga0501067_0492210_71_379 | 100 |
| 542 | 3300049585 | Ga0501069_0033482 | Ga0501069_0033482_1419_1727 | 100 |
| 543 | 3300049585 | Ga0501069_0068700 | Ga0501069_0068700_155_463 | 100 |
| 544 | 3300049586 | Ga0501070_0005016 | Ga0501070_0005016_8825_9133 | 100 |
| 545 | 3300049587 | Ga0501071_0206685 | Ga0501071_0206685_381_701 | 100 |
| 546 | 3300049588 | Ga0501072_0044939 | Ga0501072_0044939_1175_1483 | 100 |
| 547 | 3300049588 | Ga0501072_1566929 | Ga0501072_1566929_61_381 | 100 |
| 548 | 3300049589 | Ga0501073_0126736 | Ga0501073_0126736_1234_1542 | 100 |
| 549 | 3300049590 | Ga0501074_0051011 | Ga0501074_0051011_2644_2952 | 100 |
| 550 | 3300049591 | Ga0501075_0190161 | Ga0501075_0190161_76_384 | 100 |
| 551 | 3300049592 | Ga0501076_0989243 | Ga0501076_0989243_119_427 | 100 |
| 552 | 3300049593 | Ga0501077_0780346 | Ga0501077_0780346_162_470 | 100 |
| 553 | 3300049657 | Ga0501210_041048 | Ga0501210_041048_15_323 | 100 |
| 554 | 3300049741 | Ga0501079_0298026 | Ga0501079_0298026_318_626 | 100 |
| 555 | 3300049742 | Ga0501080_0108918 | Ga0501080_0108918_319_627 | 100 |
| 556 | 3300049744 | Ga0501083_0047000 | Ga0501083_0047000_1023_1331 | 100 |
| 557 | 3300049765 | Ga0501268_162210 | Ga0501268_162210_90_398 | 100 |
| 558 | 3300049822 | Ga0501035_0526722 | Ga0501035_0526722_438_746 | 100 |
| 559 | 3300049822 | Ga0501035_1443530 | Ga0501035_1443530_152_460 | 100 |
| 560 | 3300050507 | nmdc:mga05p37_325958_c1 | nmdc:mga05p37_325958_c1_751_1059 | 100 |
| 561 | 3300050508 | nmdc:mga09592_1739728_c1 | nmdc:mga09592_1739728_c1_109_417 | 100 |
| 562 | 3300050508 | nmdc:mga09592_24148_c1 | nmdc:mga09592_24148_c1_1911_2219 | 100 |
| 563 | 3300050509 | nmdc:mga0qj67_1283043_c1 | nmdc:mga0qj67_1283043_c1_162_497 | 100 |
| 564 | 3300050509 | nmdc:mga0qj67_337701_c1 | nmdc:mga0qj67_337701_c1_291_599 | 100 |
| 565 | 3300050510 | nmdc:mga06r32_42207_c1 | nmdc:mga06r32_42207_c1_3566_3874 | 100 |
| 566 | 3300050511 | nmdc:mga08y16_1265296_c1 | nmdc:mga08y16_1265296_c1_365_673 | 100 |
| 567 | 3300050511 | nmdc:mga08y16_1525026_c1 | nmdc:mga08y16_1525026_c1_186_494 | 100 |
| 568 | 3300050511 | nmdc:mga08y16_775464_c1 | nmdc:mga08y16_775464_c1_475_783 | 100 |
| 569 | 3300050512 | nmdc:mga0n895_157436_c1 | nmdc:mga0n895_157436_c1_289_597 | 100 |
| 570 | 3300050512 | nmdc:mga0n895_18900_c1 | nmdc:mga0n895_18900_c1_5587_5895 | 100 |
| 571 | 3300050512 | nmdc:mga0n895_332007_c1 | nmdc:mga0n895_332007_c1_241_549 | 100 |
| 572 | 3300050513 | nmdc:mga0rr50_265435_c1 | nmdc:mga0rr50_265435_c1_156_464 | 100 |
| 573 | 3300050514 | nmdc:mga08x19_13941_c1 | nmdc:mga08x19_13941_c1_4239_4547 | 100 |
| 574 | 3300050514 | nmdc:mga08x19_367441_c1 | nmdc:mga08x19_367441_c1_138_446 | 100 |
| 575 | 3300050514 | nmdc:mga08x19_4051_c1 | nmdc:mga08x19_4051_c1_7907_8215 | 100 |
| 576 | 3300050514 | nmdc:mga08x19_483065_c1 | nmdc:mga08x19_483065_c1_186_494 | 100 |
| 577 | 3300050514 | nmdc:mga08x19_75883_c1 | nmdc:mga08x19_75883_c1_1210_1518 | 100 |
| 578 | 3300050514 | nmdc:mga08x19_848419_c1 | nmdc:mga08x19_848419_c1_315_623 | 100 |
| 579 | 3300050515 | nmdc:mga0a205_201535_c1 | nmdc:mga0a205_201535_c1_192_500 | 100 |
| 580 | 3300050515 | nmdc:mga0a205_21134_c1 | nmdc:mga0a205_21134_c1_5437_5745 | 100 |
| 581 | 3300053085 | Ga0495619_0370050 | Ga0495619_0370050_583_891 | 100 |
| 582 | 3300053096 | Ga0500641_0226762 | Ga0500641_0226762_120_428 | 100 |
| 583 | 3300054114 | Ga0501084_0081724 | Ga0501084_0081724_2233_2541 | 100 |
| 584 | 3300059421 | Ga0590071_201214 | Ga0590071_201214_61_369 | 100 |
| 585 | 3300060353 | Ga0501082_0093054 | Ga0501082_0093054_1234_1542 | 100 |
| 586 | 3300005295 | Ga0065707_10603957 | Ga0065707_106039572 | 101 |
| 587 | 3300005328 | Ga0070676_10247279 | Ga0070676_102472792 | 101 |
| 588 | 3300005329 | Ga0070683_100069027 | Ga0070683_1000690273 | 101 |
| 589 | 3300005330 | Ga0070690_100776109 | Ga0070690_1007761092 | 101 |
| 590 | 3300005331 | Ga0070670_100261144 | Ga0070670_1002611442 | 101 |
| 591 | 3300005334 | Ga0068869_101066159 | Ga0068869_1010661592 | 101 |
| 592 | 3300005337 | Ga0070682_101119016 | Ga0070682_1011190161 | 101 |
| 593 | 3300005338 | Ga0068868_101003437 | Ga0068868_1010034372 | 101 |
| 594 | 3300005340 | Ga0070689_100233871 | Ga0070689_1002338713 | 101 |
| 595 | 3300005340 | Ga0070689_100372085 | Ga0070689_1003720851 | 101 |
| 596 | 3300005343 | Ga0070687_100105981 | Ga0070687_1001059812 | 101 |
| 597 | 3300005345 | Ga0070692_10007318 | Ga0070692_100073185 | 101 |
| 598 | 3300005347 | Ga0070668_100025704 | Ga0070668_1000257044 | 101 |
| 599 | 3300005353 | Ga0070669_100002973 | Ga0070669_1000029735 | 101 |
| 600 | 3300005354 | Ga0070675_100024736 | Ga0070675_1000247364 | 101 |
| 601 | 3300005364 | Ga0070673_100072629 | Ga0070673_1000726293 | 101 |
| 602 | 3300005406 | Ga0070703_10044843 | Ga0070703_100448431 | 101 |
| 603 | 3300005438 | Ga0070701_10121258 | Ga0070701_101212582 | 101 |
| 604 | 3300005440 | Ga0070705_100036344 | Ga0070705_1000363445 | 101 |
| 605 | 3300005441 | Ga0070700_100001031 | Ga0070700_10000103113 | 101 |
| 606 | 3300005441 | Ga0070700_100365933 | Ga0070700_1003659332 | 101 |
| 607 | 3300005444 | Ga0070694_100809555 | Ga0070694_1008095552 | 101 |
| 608 | 3300005457 | Ga0070662_100374375 | Ga0070662_1003743752 | 101 |
| 609 | 3300005458 | Ga0070681_10685450 | Ga0070681_106854502 | 101 |
| 610 | 3300005459 | Ga0068867_100002138 | Ga0068867_10000213811 | 101 |
| 611 | 3300005459 | Ga0068867_100484352 | Ga0068867_1004843522 | 101 |
| 612 | 3300005518 | Ga0070699_101378827 | Ga0070699_1013788272 | 101 |
| 613 | 3300005535 | Ga0070684_100848038 | Ga0070684_1008480382 | 101 |
| 614 | 3300005543 | Ga0070672_100054860 | Ga0070672_1000548605 | 101 |
| 615 | 3300005546 | Ga0070696_100421529 | Ga0070696_1004215292 | 101 |
| 616 | 3300005547 | Ga0070693_100140515 | Ga0070693_1001405152 | 101 |
| 617 | 3300005547 | Ga0070693_100578294 | Ga0070693_1005782942 | 101 |
| 618 | 3300005547 | Ga0070693_100595189 | Ga0070693_1005951892 | 101 |
| 619 | 3300005549 | Ga0070704_101142662 | Ga0070704_1011426621 | 101 |
| 620 | 3300005564 | Ga0070664_100987814 | Ga0070664_1009878142 | 101 |
| 621 | 3300005577 | Ga0068857_100978731 | Ga0068857_1009787311 | 101 |
| 622 | 3300005578 | Ga0068854_100484517 | Ga0068854_1004845173 | 101 |
| 623 | 3300005614 | Ga0068856_100338379 | Ga0068856_1003383792 | 101 |
| 624 | 3300005615 | Ga0070702_100008243 | Ga0070702_1000082433 | 101 |
| 625 | 3300005615 | Ga0070702_100138509 | Ga0070702_1001385092 | 101 |
| 626 | 3300005615 | Ga0070702_100463840 | Ga0070702_1004638402 | 101 |
| 627 | 3300005617 | Ga0068859_100024361 | Ga0068859_1000243615 | 101 |
| 628 | 3300005617 | Ga0068859_102056068 | Ga0068859_1020560681 | 101 |
| 629 | 3300005617 | Ga0068859_103146018 | Ga0068859_1031460182 | 101 |
| 630 | 3300005718 | Ga0068866_10418662 | Ga0068866_104186622 | 101 |
| 631 | 3300005719 | Ga0068861_100001104 | Ga0068861_10000110413 | 101 |
| 632 | 3300005719 | Ga0068861_100086738 | Ga0068861_1000867383 | 101 |
| 633 | 3300005719 | Ga0068861_100336369 | Ga0068861_1003363692 | 101 |
| 634 | 3300005834 | Ga0068851_10620193 | Ga0068851_106201932 | 101 |
| 635 | 3300005840 | Ga0068870_10072546 | Ga0068870_100725463 | 101 |
| 636 | 3300005841 | Ga0068863_100577917 | Ga0068863_1005779172 | 101 |
| 637 | 3300005842 | Ga0068858_100820756 | Ga0068858_1008207562 | 101 |
| 638 | 3300005844 | Ga0068862_100001798 | Ga0068862_10000179814 | 101 |
| 639 | 3300005844 | Ga0068862_100169713 | Ga0068862_1001697132 | 101 |
| 640 | 3300005844 | Ga0068862_101069913 | Ga0068862_1010699132 | 101 |
| 641 | 3300006195 | Ga0075366_10567510 | Ga0075366_105675102 | 101 |
| 642 | 3300006237 | Ga0097621_100014830 | Ga0097621_1000148304 | 101 |
| 643 | 3300006358 | Ga0068871_100028272 | Ga0068871_1000282723 | 101 |
| 644 | 3300006844 | Ga0075428_100139214 | Ga0075428_1001392144 | 101 |
| 645 | 3300006846 | Ga0075430_100003340 | Ga0075430_1000033408 | 101 |
| 646 | 3300006846 | Ga0075430_101410397 | Ga0075430_1014103972 | 101 |
| 647 | 3300006847 | Ga0075431_100146664 | Ga0075431_1001466642 | 101 |
| 648 | 3300006847 | Ga0075431_100752966 | Ga0075431_1007529662 | 101 |
| 649 | 3300006881 | Ga0068865_100028722 | Ga0068865_1000287221 | 101 |
| 650 | 3300006931 | Ga0097620_100024361 | Ga0097620_1000243615 | 101 |
| 651 | 3300006931 | Ga0097620_102055846 | Ga0097620_1020558461 | 101 |
| 652 | 3300006931 | Ga0097620_103143761 | Ga0097620_1031437612 | 101 |
| 653 | 3300007076 | Ga0075435_100441910 | Ga0075435_1004419102 | 101 |
| 654 | 3300009094 | Ga0111539_10068982 | Ga0111539_100689824 | 101 |
| 655 | 3300009094 | Ga0111539_10169101 | Ga0111539_101691013 | 101 |
| 656 | 3300009094 | Ga0111539_12071521 | Ga0111539_120715212 | 101 |
| 657 | 3300009098 | Ga0105245_10024841 | Ga0105245_100248415 | 101 |
| 658 | 3300009098 | Ga0105245_11322382 | Ga0105245_113223822 | 101 |
| 659 | 3300009147 | Ga0114129_11355901 | Ga0114129_113559012 | 101 |
| 660 | 3300009148 | Ga0105243_10002425 | Ga0105243_100024257 | 101 |
| 661 | 3300009176 | Ga0105242_10006248 | Ga0105242_100062485 | 101 |
| 662 | 3300009176 | Ga0105242_10305091 | Ga0105242_103050913 | 101 |
| 663 | 3300009177 | Ga0105248_10681694 | Ga0105248_106816942 | 101 |
| 664 | 3300009553 | Ga0105249_10049127 | Ga0105249_100491276 | 101 |
| 665 | 3300013306 | Ga0163162_10580090 | Ga0163162_105800902 | 101 |
| 666 | 3300013307 | Ga0157372_10338033 | Ga0157372_103380332 | 101 |
| 667 | 3300013308 | Ga0157375_10826088 | Ga0157375_108260882 | 101 |
| 668 | 3300014326 | Ga0157380_10005801 | Ga0157380_100058012 | 101 |
| 669 | 3300014745 | Ga0157377_10080238 | Ga0157377_100802383 | 101 |
| 670 | 3300014969 | Ga0157376_10079043 | Ga0157376_100790432 | 101 |
| 671 | 3300017792 | Ga0163161_10359575 | Ga0163161_103595751 | 101 |
| 672 | 3300025885 | Ga0207653_10042017 | Ga0207653_100420172 | 101 |
| 673 | 3300025893 | Ga0207682_10026622 | Ga0207682_100266223 | 101 |
| 674 | 3300025899 | Ga0207642_10008609 | Ga0207642_100086093 | 101 |
| 675 | 3300025901 | Ga0207688_10154182 | Ga0207688_101541822 | 101 |
| 676 | 3300025907 | Ga0207645_10054591 | Ga0207645_100545912 | 101 |
| 677 | 3300025908 | Ga0207643_10109580 | Ga0207643_101095802 | 101 |
| 678 | 3300025912 | Ga0207707_11010548 | Ga0207707_110105482 | 101 |
| 679 | 3300025917 | Ga0207660_10489759 | Ga0207660_104897592 | 101 |
| 680 | 3300025918 | Ga0207662_10070919 | Ga0207662_100709193 | 101 |
| 681 | 3300025918 | Ga0207662_10239084 | Ga0207662_102390842 | 101 |
| 682 | 3300025922 | Ga0207646_10470972 | Ga0207646_104709722 | 101 |
| 683 | 3300025923 | Ga0207681_10013210 | Ga0207681_100132103 | 101 |
| 684 | 3300025925 | Ga0207650_11494197 | Ga0207650_114941972 | 101 |
| 685 | 3300025926 | Ga0207659_10047713 | Ga0207659_100477132 | 101 |
| 686 | 3300025927 | Ga0207687_10029887 | Ga0207687_100298874 | 101 |
| 687 | 3300025931 | Ga0207644_11312588 | Ga0207644_113125882 | 101 |
| 688 | 3300025933 | Ga0207706_10307885 | Ga0207706_103078852 | 101 |
| 689 | 3300025935 | Ga0207709_11653259 | Ga0207709_116532592 | 101 |
| 690 | 3300025936 | Ga0207670_10018384 | Ga0207670_100183842 | 101 |
| 691 | 3300025937 | Ga0207669_10104538 | Ga0207669_101045382 | 101 |
| 692 | 3300025937 | Ga0207669_11354190 | Ga0207669_113541902 | 101 |
| 693 | 3300025938 | Ga0207704_10011015 | Ga0207704_100110151 | 101 |
| 694 | 3300025938 | Ga0207704_11904836 | Ga0207704_119048361 | 101 |
| 695 | 3300025940 | Ga0207691_10037545 | Ga0207691_100375456 | 101 |
| 696 | 3300025942 | Ga0207689_10108288 | Ga0207689_101082882 | 101 |
| 697 | 3300025945 | Ga0207679_10544100 | Ga0207679_105441002 | 101 |
| 698 | 3300025960 | Ga0207651_10153936 | Ga0207651_101539362 | 101 |
| 699 | 3300025961 | Ga0207712_12111792 | Ga0207712_121117922 | 101 |
| 700 | 3300025972 | Ga0207668_10007526 | Ga0207668_100075266 | 101 |
| 701 | 3300025981 | Ga0207640_10431519 | Ga0207640_104315191 | 101 |
| 702 | 3300025981 | Ga0207640_11063617 | Ga0207640_110636172 | 101 |
| 703 | 3300026023 | Ga0207677_10513924 | Ga0207677_105139242 | 101 |
| 704 | 3300026035 | Ga0207703_10999934 | Ga0207703_109999341 | 101 |
| 705 | 3300026075 | Ga0207708_10002536 | Ga0207708_100025361 | 101 |
| 706 | 3300026075 | Ga0207708_10159046 | Ga0207708_101590462 | 101 |
| 707 | 3300026075 | Ga0207708_10394572 | Ga0207708_103945721 | 101 |
| 708 | 3300026075 | Ga0207708_10834841 | Ga0207708_108348412 | 101 |
| 709 | 3300026088 | Ga0207641_10871257 | Ga0207641_108712572 | 101 |
| 710 | 3300026088 | Ga0207641_12291666 | Ga0207641_122916662 | 101 |
| 711 | 3300026089 | Ga0207648_10012144 | Ga0207648_100121441 | 101 |
| 712 | 3300026089 | Ga0207648_10891868 | Ga0207648_108918682 | 101 |
| 713 | 3300026116 | Ga0207674_10396770 | Ga0207674_103967702 | 101 |
| 714 | 3300026118 | Ga0207675_100001853 | Ga0207675_10000185312 | 101 |
| 715 | 3300026118 | Ga0207675_100268847 | Ga0207675_1002688472 | 101 |
| 716 | 3300026121 | Ga0207683_10194654 | Ga0207683_101946542 | 101 |
| 717 | 3300027907 | Ga0207428_10008206 | Ga0207428_100082064 | 101 |
| 718 | 3300027907 | Ga0207428_10132309 | Ga0207428_101323092 | 101 |
| 719 | 3300028380 | Ga0268265_10000606 | Ga0268265_1000060637 | 101 |
| 720 | 3300028380 | Ga0268265_10230804 | Ga0268265_102308042 | 101 |
| 721 | 3300031548 | Ga0307408_100181728 | Ga0307408_1001817283 | 101 |
| 722 | 3300031691 | Ga0316579_10000015 | Ga0316579_100000156 | 101 |
| 723 | 3300031728 | Ga0316578_10005745 | Ga0316578_100057458 | 101 |
| 724 | 3300031824 | Ga0307413_10976700 | Ga0307413_109767002 | 101 |
| 725 | 3300031903 | Ga0307407_10500016 | Ga0307407_105000162 | 101 |
| 726 | 3300031911 | Ga0307412_10372141 | Ga0307412_103721412 | 101 |
| 727 | 3300031911 | Ga0307412_10911307 | Ga0307412_109113072 | 101 |
| 728 | 3300032002 | Ga0307416_101562953 | Ga0307416_1015629532 | 101 |
| 729 | 3300032005 | Ga0307411_10125767 | Ga0307411_101257673 | 101 |
| 730 | 3300032005 | Ga0307411_11439750 | Ga0307411_114397502 | 101 |
| 731 | 3300032133 | Ga0316583_10000483 | Ga0316583_100004834 | 101 |
| 732 | 3300032133 | Ga0316583_10004823 | Ga0316583_100048235 | 101 |
| 733 | 3300035085 | Ga0373929_0118124 | Ga0373929_0118124_90_401 | 101 |
| 734 | 3300035086 | Ga0373934_0440898 | Ga0373934_0440898_211_522 | 101 |
| 735 | 3300035113 | Ga0373936_0025745 | Ga0373936_0025745_1952_2272 | 101 |
| 736 | 3300035115 | Ga0373941_0040943 | Ga0373941_0040943_1050_1361 | 101 |
| 737 | 3300035117 | Ga0373953_0140382 | Ga0373953_0140382_147_467 | 101 |
| 738 | 3300035121 | Ga0373960_0051783 | Ga0373960_0051783_821_1132 | 101 |
| 739 | 3300035242 | Ga0373962_0390465 | Ga0373962_0390465_32_343 | 101 |
| 740 | 3300035692 | Ga0373935_0036900 | Ga0373935_0036900_2086_2406 | 101 |
| 741 | 3300035692 | Ga0373935_1004514 | Ga0373935_1004514_188_499 | 101 |
| 742 | 3300035695 | Ga0373927_0018661 | Ga0373927_0018661_730_1050 | 101 |
| 743 | 3300035724 | Ga0373933_0247749 | Ga0373933_0247749_512_823 | 101 |
| 744 | 3300036401 | Ga0373937_0347205 | Ga0373937_0347205_338_658 | 101 |
| 745 | 3300036647 | Ga0316582_0003674 | Ga0316582_0003674_2792_3103 | 101 |
| 746 | 3300036712 | Ga0316584_0514716 | Ga0316584_0514716_142_453 | 101 |
| 747 | 3300037068 | Ga0373925_0071100 | Ga0373925_0071100_270_590 | 101 |
| 748 | 3300037588 | Ga0316581_0001262 | Ga0316581_0001262_159_470 | 101 |
| 749 | 3300041460 | Ga0451802_1603895 | Ga0451802_1603895_138_452 | 101 |
| 750 | 3300041486 | Ga0451807_0680206 | Ga0451807_0680206_1024_1338 | 101 |
| 751 | 3300045051 | Ga0451576_1110250 | Ga0451576_1110250_42_362 | 101 |
| 752 | 3300046528 | Ga0495642_0276100 | Ga0495642_0276100_100_411 | 101 |
| 753 | 3300046539 | Ga0495621_0194908 | Ga0495621_0194908_411_722 | 101 |
| 754 | 3300046684 | Ga0495669_0170482 | Ga0495669_0170482_106_417 | 101 |
| 755 | 3300048090 | Ga0495615_0182378 | Ga0495615_0182378_26_337 | 101 |
| 756 | 3300049514 | Ga0501291_011127 | Ga0501291_011127_167_478 | 101 |
| 757 | 3300049521 | Ga0501298_122829 | Ga0501298_122829_129_440 | 101 |
| 758 | 3300049574 | Ga0501038_0945091 | Ga0501038_0945091_14_325 | 101 |
| 759 | 3300049584 | Ga0501068_0078372 | Ga0501068_0078372_347_658 | 101 |
| 760 | 3300049589 | Ga0501073_0020687 | Ga0501073_0020687_3133_3444 | 101 |
| 761 | 3300049589 | Ga0501073_0044227 | Ga0501073_0044227_1297_1608 | 101 |
| 762 | 3300049589 | Ga0501073_0658564 | Ga0501073_0658564_128_439 | 101 |
| 763 | 3300049665 | Ga0501227_214815 | Ga0501227_214815_91_402 | 101 |
| 764 | 3300049668 | Ga0501233_080143 | Ga0501233_080143_182_493 | 101 |
| 765 | 3300049670 | Ga0501236_108293 | Ga0501236_108293_12_323 | 101 |
| 766 | 3300049706 | Ga0501229_025299 | Ga0501229_025299_298_609 | 101 |
| 767 | 3300049742 | Ga0501080_0440280 | Ga0501080_0440280_809_1120 | 101 |
| 768 | 3300049742 | Ga0501080_0553069 | Ga0501080_0553069_76_387 | 101 |
| 769 | 3300049760 | Ga0501263_030547 | Ga0501263_030547_109_420 | 101 |
| 770 | 3300050508 | nmdc:mga09592_310877_c1 | nmdc:mga09592_310877_c1_879_1190 | 101 |
| 771 | 3300050509 | nmdc:mga0qj67_48258_c1 | nmdc:mga0qj67_48258_c1_108_419 | 101 |
| 772 | 3300050510 | nmdc:mga06r32_45053_c1 | nmdc:mga06r32_45053_c1_2336_2647 | 101 |
| 773 | 3300050510 | nmdc:mga06r32_500298_c1 | nmdc:mga06r32_500298_c1_169_480 | 101 |
| 774 | 3300050511 | nmdc:mga08y16_12222_c1 | nmdc:mga08y16_12222_c1_2314_2625 | 101 |
| 775 | 3300050511 | nmdc:mga08y16_12995_c1 | nmdc:mga08y16_12995_c1_5089_5400 | 101 |
| 776 | 3300050511 | nmdc:mga08y16_594708_c1 | nmdc:mga08y16_594708_c1_110_421 | 101 |
| 777 | 3300050512 | nmdc:mga0n895_2090538_c1 | nmdc:mga0n895_2090538_c1_196_507 | 101 |
| 778 | 3300054114 | Ga0501084_1015371 | Ga0501084_1015371_256_567 | 101 |
| 779 | iso_pu_bacteria | 2510065045 | 2510253128 | 101 |
| 780 | iso_pu_bacteria | 2512047030 | 2512347298 | 101 |
| 781 | iso_pu_bacteria | 2515154122 | 2515681724 | 101 |
| 782 | iso_pu_bacteria | 2718217991 | 2719638918 | 101 |
| 783 | iso_pu_bacteria | 2885270888 | 2885274158 | 101 |
| 784 | iso_pu_bacteria | 2902682994 | 2902689043 | 101 |
| 785 | iso_pu_bacteria | 8055266321 | 8055268098 | 101 |
| 786 | 3300005549 | Ga0070704_102207376 | Ga0070704_1022073761 | 102 |
| 787 | 3300007076 | Ga0075435_100500327 | Ga0075435_1005003272 | 102 |
| 788 | 3300009094 | Ga0111539_10207000 | Ga0111539_102070002 | 102 |
| 789 | 3300026095 | Ga0207676_10202340 | Ga0207676_102023402 | 102 |
| 790 | 3300031548 | Ga0307408_101444943 | Ga0307408_1014449432 | 102 |
| 791 | 3300035111 | Ga0373923_0625352 | Ga0373923_0625352_17_331 | 102 |
| 792 | 3300035118 | Ga0373954_0000002 | Ga0373954_0000002_44670_44984 | 102 |
| 793 | 3300035120 | Ga0373957_0205146 | Ga0373957_0205146_257_571 | 102 |
| 794 | 3300035172 | Ga0373955_0136521 | Ga0373955_0136521_64_378 | 102 |
| 795 | 3300035207 | Ga0373942_0320732 | Ga0373942_0320732_217_531 | 102 |
| 796 | 3300036401 | Ga0373937_0000358 | Ga0373937_0000358_7224_7538 | 102 |
| 797 | 3300036712 | Ga0316584_0099029 | Ga0316584_0099029_750_1067 | 102 |
| 798 | 3300046491 | Ga0495584_0164912 | Ga0495584_0164912_413_727 | 102 |
| 799 | 3300046539 | Ga0495621_0054065 | Ga0495621_0054065_846_1160 | 102 |
| 800 | 3300046539 | Ga0495621_0105592 | Ga0495621_0105592_585_899 | 102 |
| 801 | 3300046557 | Ga0495622_0407801 | Ga0495622_0407801_122_436 | 102 |
| 802 | 3300046559 | Ga0495667_0230855 | Ga0495667_0230855_774_1088 | 102 |
| 803 | 3300046664 | Ga0495659_0394030 | Ga0495659_0394030_23_337 | 102 |
| 804 | 3300049573 | Ga0501037_0918886 | Ga0501037_0918886_53_367 | 102 |
| 805 | 3300049575 | Ga0501039_0020140 | Ga0501039_0020140_244_558 | 102 |
| 806 | 3300049576 | Ga0501040_0609611 | Ga0501040_0609611_287_601 | 102 |
| 807 | 3300049577 | Ga0501041_0063052 | Ga0501041_0063052_311_625 | 102 |
| 808 | 3300049587 | Ga0501071_0000992 | Ga0501071_0000992_9331_9645 | 102 |
| 809 | 3300049588 | Ga0501072_0039301 | Ga0501072_0039301_2857_3171 | 102 |
| 810 | 3300049589 | Ga0501073_0014106 | Ga0501073_0014106_3713_4027 | 102 |
| 811 | 3300049590 | Ga0501074_0613353 | Ga0501074_0613353_169_483 | 102 |
| 812 | 3300049591 | Ga0501075_0004058 | Ga0501075_0004058_2660_2974 | 102 |
| 813 | 3300049592 | Ga0501076_0007046 | Ga0501076_0007046_5277_5591 | 102 |
| 814 | 3300049742 | Ga0501080_0000702 | Ga0501080_0000702_20059_20373 | 102 |
| 815 | 3300049742 | Ga0501080_0165598 | Ga0501080_0165598_1453_1770 | 102 |
| 816 | 3300049743 | Ga0501081_0017373 | Ga0501081_0017373_4411_4725 | 102 |
| 817 | 3300049823 | Ga0501044_0930798 | Ga0501044_0930798_257_571 | 102 |
| 818 | 3300049824 | Ga0501045_0202285 | Ga0501045_0202285_989_1303 | 102 |
| 819 | 3300050511 | nmdc:mga08y16_1773734_c1 | nmdc:mga08y16_1773734_c1_35_349 | 102 |
| 820 | 3300050512 | nmdc:mga0n895_13666_c1 | nmdc:mga0n895_13666_c1_3428_3742 | 102 |
| 821 | 3300050513 | nmdc:mga0rr50_367362_c1 | nmdc:mga0rr50_367362_c1_681_995 | 102 |
| 822 | 3300050515 | nmdc:mga0a205_573741_c1 | nmdc:mga0a205_573741_c1_281_595 | 102 |
| 823 | 3300060353 | Ga0501082_0023335 | Ga0501082_0023335_4387_4701 | 102 |
| 824 | 3300060353 | Ga0501082_1509367 | Ga0501082_1509367_47_361 | 102 |
| 825 | iso_pu_bacteria | 2501025502 | 2501080264 | 102 |
| 826 | iso_pu_bacteria | 2510917013 | 2511089759 | 102 |
| 827 | iso_pu_bacteria | 2510917014 | 2511095156 | 102 |
| 828 | iso_pu_bacteria | 2510917015 | 2511104815 | 102 |
| 829 | iso_pu_bacteria | 2513237082 | 2513551329 | 102 |
| 830 | iso_pu_bacteria | 2513237083 | 2513559971 | 102 |
| 831 | iso_pu_bacteria | 2515154189 | 2516016732 | 102 |
| 832 | iso_pu_bacteria | 2808606384 | 2808968391 | 102 |
| 833 | iso_pu_bacteria | 2808606390 | 2809003222 | 102 |
| 834 | iso_pu_bacteria | 2808606391 | 2809010499 | 102 |
| 835 | iso_pu_bacteria | 2856287931 | 2856293193 | 102 |
| 836 | iso_pu_bacteria | 2857357740 | 2857366690 | 102 |
| 837 | iso_pu_bacteria | 2883087390 | 2883090586 | 102 |
| 838 | iso_pu_bacteria | 8003955200 | 8003957236 | 102 |
| 839 | 3300003771 | Ga0055526_1000149 | Ga0055526_100014914 | 103 |
| 840 | 3300005344 | Ga0070661_101770516 | Ga0070661_1017705161 | 103 |
| 841 | 3300005563 | Ga0068855_102032307 | Ga0068855_1020323071 | 103 |
| 842 | 3300006173 | Ga0070716_100453044 | Ga0070716_1004530441 | 103 |
| 843 | 3300009036 | Ga0105244_10001943 | Ga0105244_100019433 | 103 |
| 844 | 3300015261 | Ga0182006_1000216 | Ga0182006_10002168 | 103 |
| 845 | 3300015265 | Ga0182005_1000119 | Ga0182005_10001198 | 103 |
| 846 | 3300025233 | Ga0209437_101838 | Ga0209437_1018384 | 103 |
| 847 | 3300025246 | Ga0209646_1000384 | Ga0209646_100038413 | 103 |
| 848 | 3300025250 | Ga0209026_1044080 | Ga0209026_10440802 | 103 |
| 849 | 3300025295 | Ga0209564_1000010 | Ga0209564_1000010776 | 103 |
| 850 | 3300025295 | Ga0209564_1001321 | Ga0209564_10013218 | 103 |
| 851 | 3300025728 | Ga0207655_1007846 | Ga0207655_10078467 | 103 |
| 852 | 3300025893 | Ga0207682_10612067 | Ga0207682_106120671 | 103 |
| 853 | 3300027111 | Ga0209281_1004553 | Ga0209281_10045535 | 103 |
| 854 | 3300028794 | Ga0307515_10525023 | Ga0307515_105250232 | 103 |
| 855 | 3300031456 | Ga0307513_10436371 | Ga0307513_104363712 | 103 |
| 856 | 3300035398 | Ga0316574_0225932 | Ga0316574_0225932_296_613 | 103 |
| 857 | 3300035725 | Ga0373947_0838267 | Ga0373947_0838267_65_382 | 103 |
| 858 | 3300036712 | Ga0316584_0188920 | Ga0316584_0188920_104_418 | 103 |
| 859 | 3300037312 | Ga0395899_0004310 | Ga0395899_0004310_1391_1708 | 103 |
| 860 | 3300037418 | Ga0395900_0006117 | Ga0395900_0006117_12133_12450 | 103 |
| 861 | 3300037418 | Ga0395900_0270883 | Ga0395900_0270883_339_656 | 103 |
| 862 | 3300037466 | Ga0395898_0298265 | Ga0395898_0298265_642_959 | 103 |
| 863 | 3300037466 | Ga0395898_1603184 | Ga0395898_1603184_175_492 | 103 |
| 864 | 3300037471 | Ga0395905_0035171 | Ga0395905_0035171_3959_4276 | 103 |
| 865 | 3300038443 | Ga0395901_0085802 | Ga0395901_0085802_23_340 | 103 |
| 866 | 3300038443 | Ga0395901_0255660 | Ga0395901_0255660_1447_1764 | 103 |
| 867 | 3300038443 | Ga0395901_0661644 | Ga0395901_0661644_433_750 | 103 |
| 868 | 3300046452 | Ga0495617_004040 | Ga0495617_004040_1738_2055 | 103 |
| 869 | 3300046471 | Ga0495650_0001544 | Ga0495650_0001544_6584_6901 | 103 |
| 870 | 3300046471 | Ga0495650_0003055 | Ga0495650_0003055_6621_6944 | 103 |
| 871 | 3300046474 | Ga0495605_0000635 | Ga0495605_0000635_20002_20319 | 103 |
| 872 | 3300046506 | Ga0495583_0005068 | Ga0495583_0005068_4374_4691 | 103 |
| 873 | 3300046507 | Ga0495606_0001517 | Ga0495606_0001517_23855_24172 | 103 |
| 874 | 3300046512 | Ga0495610_0003364 | Ga0495610_0003364_907_1224 | 103 |
| 875 | 3300046520 | Ga0495637_0010764 | Ga0495637_0010764_2798_3115 | 103 |
| 876 | 3300046522 | Ga0495643_0000891 | Ga0495643_0000891_20168_20485 | 103 |
| 877 | 3300046524 | Ga0495648_0019571 | Ga0495648_0019571_351_668 | 103 |
| 878 | 3300046542 | Ga0495597_0000288 | Ga0495597_0000288_33731_34048 | 103 |
| 879 | 3300046558 | Ga0495633_0001228 | Ga0495633_0001228_6877_7194 | 103 |
| 880 | 3300046558 | Ga0495633_0001987 | Ga0495633_0001987_6723_7040 | 103 |
| 881 | 3300046616 | Ga0495668_0006127 | Ga0495668_0006127_6586_6903 | 103 |
| 882 | 3300046660 | Ga0495625_0002229 | Ga0495625_0002229_6711_7034 | 103 |
| 883 | 3300046660 | Ga0495625_0426629 | Ga0495625_0426629_318_635 | 103 |
| 884 | 3300046664 | Ga0495659_0214696 | Ga0495659_0214696_130_447 | 103 |
| 885 | 3300046678 | Ga0495599_0798874 | Ga0495599_0798874_59_376 | 103 |
| 886 | 3300046691 | Ga0495670_0484820 | Ga0495670_0484820_128_445 | 103 |
| 887 | 3300046692 | Ga0495671_0069779 | Ga0495671_0069779_619_936 | 103 |
| 888 | 3300046692 | Ga0495671_0134307 | Ga0495671_0134307_64_381 | 103 |
| 889 | 3300046694 | Ga0495649_0001795 | Ga0495649_0001795_5013_5330 | 103 |
| 890 | 3300046694 | Ga0495649_0363175 | Ga0495649_0363175_341_658 | 103 |
| 891 | 3300047318 | Ga0495636_0037440 | Ga0495636_0037440_1655_1972 | 103 |
| 892 | 3300047318 | Ga0495636_0161940 | Ga0495636_0161940_680_997 | 103 |
| 893 | 3300047320 | Ga0495672_0001040 | Ga0495672_0001040_16702_17019 | 103 |
| 894 | 3300047323 | Ga0495683_0071477 | Ga0495683_0071477_1076_1393 | 103 |
| 895 | 3300047445 | Ga0495677_0140460 | Ga0495677_0140460_261_578 | 103 |
| 896 | 3300047445 | Ga0495677_0242725 | Ga0495677_0242725_196_513 | 103 |
| 897 | 3300047472 | Ga0495686_0105936 | Ga0495686_0105936_103_420 | 103 |
| 898 | 3300048905 | Ga0496102_0000082 | Ga0496102_0000082_131986_132303 | 103 |
| 899 | 3300048905 | Ga0496102_0047863 | Ga0496102_0047863_3160_3477 | 103 |
| 900 | 3300048905 | Ga0496102_1062859 | Ga0496102_1062859_310_627 | 103 |
| 901 | 3300048906 | Ga0496103_0066025 | Ga0496103_0066025_933_1250 | 103 |
| 902 | 3300048906 | Ga0496103_0347642 | Ga0496103_0347642_89_406 | 103 |
| 903 | 3300048906 | Ga0496103_0393577 | Ga0496103_0393577_464_781 | 103 |
| 904 | 3300048910 | Ga0496107_0379772 | Ga0496107_0379772_662_979 | 103 |
| 905 | 3300048913 | Ga0496110_0536630 | Ga0496110_0536630_519_836 | 103 |
| 906 | 3300048914 | Ga0496111_0523171 | Ga0496111_0523171_11_328 | 103 |
| 907 | 3300048919 | Ga0496116_0048615 | Ga0496116_0048615_385_702 | 103 |
| 908 | 3300048923 | Ga0496120_0173576 | Ga0496120_0173576_710_1027 | 103 |
| 909 | 3300048925 | Ga0496122_0046444 | Ga0496122_0046444_2558_2875 | 103 |
| 910 | 3300048926 | Ga0496123_0006778 | Ga0496123_0006778_6743_7060 | 103 |
| 911 | 3300048927 | Ga0496124_0358112 | Ga0496124_0358112_209_526 | 103 |
| 912 | 3300048928 | Ga0496125_0040546 | Ga0496125_0040546_605_922 | 103 |
| 913 | 3300049459 | Ga0495678_001082 | Ga0495678_001082_11398_11715 | 103 |
| 914 | 3300049459 | Ga0495678_243424 | Ga0495678_243424_34_351 | 103 |
| 915 | 3300049656 | Ga0501209_120950 | Ga0501209_120950_411_731 | 103 |
| 916 | 3300049671 | Ga0501238_036258 | Ga0501238_036258_169_489 | 103 |
| 917 | 3300053118 | Ga0500594_0081341 | Ga0500594_0081341_495_812 | 103 |
| 918 | 3300053130 | Ga0500642_0294423 | Ga0500642_0294423_222_539 | 103 |
| 919 | 3300053145 | Ga0500586_000619 | Ga0500586_000619_6678_6995 | 103 |
| 920 | 3300059647 | Ga0587079_106088 | Ga0587079_106088_253_570 | 103 |
| 921 | 3300059649 | Ga0587102_016759 | Ga0587102_016759_407_724 | 103 |
| 922 | 3300060346 | Ga0587111_0037126 | Ga0587111_0037126_239_556 | 103 |
| 923 | 3300046455 | Ga0495603_0225283 | Ga0495603_0225283_77_400 | 104 |
| 924 | 3300046491 | Ga0495584_0027265 | Ga0495584_0027265_2504_2827 | 104 |
| 925 | 3300046492 | Ga0495585_0024699 | Ga0495585_0024699_2501_2824 | 104 |
| 926 | 3300046501 | Ga0495607_0249086 | Ga0495607_0249086_126_449 | 104 |
| 927 | 3300046507 | Ga0495606_0352355 | Ga0495606_0352355_137_460 | 104 |
| 928 | 3300046518 | Ga0495631_0017774 | Ga0495631_0017774_2710_3033 | 104 |
| 929 | 3300046542 | Ga0495597_0001250 | Ga0495597_0001250_12277_12600 | 104 |
| 930 | 3300046558 | Ga0495633_0058546 | Ga0495633_0058546_1041_1364 | 104 |
| 931 | 3300046648 | Ga0495611_0011338 | Ga0495611_0011338_2835_3158 | 104 |
| 932 | 3300046691 | Ga0495670_0003908 | Ga0495670_0003908_1701_2024 | 104 |
| 933 | 3300046794 | Ga0495589_0041328 | Ga0495589_0041328_1325_1648 | 104 |
| 934 | 3300047318 | Ga0495636_0001239 | Ga0495636_0001239_2561_2884 | 104 |
| 935 | 3300047323 | Ga0495683_0276296 | Ga0495683_0276296_393_716 | 104 |
| 936 | 3300047445 | Ga0495677_0019685 | Ga0495677_0019685_367_690 | 104 |
| 937 | 3300001989 | JGI24739J22299_10090089 | JGI24739J22299_100900892 | 105 |
| 938 | 3300001990 | JGI24737J22298_10235586 | JGI24737J22298_102355862 | 105 |
| 939 | 3300002705 | JGI25156J39149_1052173 | JGI25156J39149_10521732 | 105 |
| 940 | 3300003316 | rootH1_10054400 | rootH1_100544004 | 105 |
| 941 | 3300003322 | rootL2_10349020 | rootL2_103490202 | 105 |
| 942 | 3300003323 | rootH1_10132885 | rootH1_101328852 | 105 |
| 943 | 3300003760 | Ga0055527_1002500 | Ga0055527_10025002 | 105 |
| 944 | 3300003761 | Ga0055535_1004905 | Ga0055535_10049052 | 105 |
| 945 | 3300003762 | Ga0055542_1035846 | Ga0055542_10358462 | 105 |
| 946 | 3300003763 | Ga0055529_1026361 | Ga0055529_10263611 | 105 |
| 947 | 3300005455 | Ga0070663_100001918 | Ga0070663_1000019183 | 105 |
| 948 | 3300005457 | Ga0070662_101068537 | Ga0070662_1010685372 | 105 |
| 949 | 3300005539 | Ga0068853_100388817 | Ga0068853_1003888172 | 105 |
| 950 | 3300005539 | Ga0068853_101408921 | Ga0068853_1014089212 | 105 |
| 951 | 3300025228 | Ga0209672_100041 | Ga0209672_1000418 | 105 |
| 952 | 3300025229 | Ga0209147_100866 | Ga0209147_10086613 | 105 |
| 953 | 3300025242 | Ga0209258_100822 | Ga0209258_10082213 | 105 |
| 954 | 3300025254 | Ga0209148_1001387 | Ga0209148_10013878 | 105 |
| 955 | 3300025256 | Ga0209759_1056599 | Ga0209759_10565991 | 105 |
| 956 | 3300025272 | Ga0209455_1007106 | Ga0209455_10071064 | 105 |
| 957 | 3300025904 | Ga0207647_10009548 | Ga0207647_100095482 | 105 |
| 958 | 3300025909 | Ga0207705_10875486 | Ga0207705_108754862 | 105 |
| 959 | 3300025914 | Ga0207671_10035591 | Ga0207671_100355914 | 105 |
| 960 | 3300025933 | Ga0207706_10463432 | Ga0207706_104634322 | 105 |
| 961 | 3300025949 | Ga0207667_10131745 | Ga0207667_101317452 | 105 |
| 962 | 3300026067 | Ga0207678_10000013 | Ga0207678_1000001398 | 105 |
| 963 | 3300028800 | Ga0265338_10000344 | Ga0265338_1000034468 | 105 |
| 964 | 3300030083 | Ga0237817_12217 | Ga0237817_122171 | 105 |
| 965 | 3300039438 | Ga0436360_0635523 | Ga0436360_0635523_97_423 | 105 |
| 966 | 3300039447 | Ga0436361_1182555 | Ga0436361_1182555_100_483 | 105 |
| 967 | 3300044706 | Ga0466964_0138052 | Ga0466964_0138052_218_541 | 105 |
| 968 | 3300044842 | Ga0466957_0344334 | Ga0466957_0344334_549_872 | 105 |
| 969 | 3300045976 | Ga0466967_1158875 | Ga0466967_1158875_300_623 | 105 |
| 970 | 3300046463 | Ga0495653_0359564 | Ga0495653_0359564_125_448 | 105 |
| 971 | 3300046471 | Ga0495650_0003627 | Ga0495650_0003627_6070_6393 | 105 |
| 972 | 3300046472 | Ga0495580_0026867 | Ga0495580_0026867_154_477 | 105 |
| 973 | 3300046529 | Ga0495652_0678468 | Ga0495652_0678468_248_571 | 105 |
| 974 | 3300046678 | Ga0495599_0229993 | Ga0495599_0229993_678_1001 | 105 |
| 975 | 3300046680 | Ga0495646_0223782 | Ga0495646_0223782_418_741 | 105 |
| 976 | 3300047317 | Ga0495604_0150888 | Ga0495604_0150888_1312_1635 | 105 |
| 977 | 3300047319 | Ga0495674_0011089 | Ga0495674_0011089_1430_1753 | 105 |
| 978 | 3300047322 | Ga0495680_0284998 | Ga0495680_0284998_693_1016 | 105 |
| 979 | 3300048088 | Ga0495602_0030492 | Ga0495602_0030492_3882_4205 | 105 |
| 980 | 3300048918 | Ga0496115_0471551 | Ga0496115_0471551_322_648 | 105 |
| 981 | 3300049460 | Ga0495682_0080302 | Ga0495682_0080302_713_1036 | 105 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5abr-assembly1.cif.gz_B | structure of fesi protein from azotobacter vinelandii | 0.9382 | 7 | 105 |
| 7p8n-assembly1.cif.gz_b | tmhydabc- t. maritima hydrogenase with bridge closed | 0.9222 | 7 | 103 |
| 7p8n-assembly1.cif.gz_B | tmhydabc- t. maritima hydrogenase with bridge closed | 0.9167 | 7 | 103 |
| 7p92-assembly1.cif.gz_B | tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up | 0.9121 | 7 | 103 |
| 7q4v-assembly1.cif.gz_B | electron bifurcating hydrogenase - hydabc from a. woodii | 0.9107 | 3 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5abrB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9382 | 7 | 105 | 3.40.30.10 |
| 1m2dB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.894 | 7 | 105 | 3.40.30.10 |
| af_Q55BP2_216_308_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8774 | 7 | 105 | 3.40.30.10 |
| 5abrB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.87 | 7 | 105 | 3.40.30.10 |
| 1m2dB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8606 | 7 | 105 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2Z6TL74-F1-model_v4 | deleted | 0.9952 | 34 | 105 |
|
| AF-B9B3A7-F1-model_v4 | deleted | 0.9951 | 1 | 105 |
|
| AF-A2VV29-F1-model_v4 | deleted | 0.9943 | 1 | 105 |
|
| AF-A0A5E4S288-F1-model_v4 | Ferredoxin, 2Fe-2S | 0.9929 | 1 | 105 |
|
| AF-A0A5Q4GE00-F1-model_v4 | (2Fe-2S) ferredoxin domain-containing protein | 0.9927 | 3 | 105 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar