F487392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 981 | 385 | 954 | 380 |
Family's Representative Sequence
| Representative Sequence | 3300025961|Ga0207712_10000196|Ga0207712_1000019626 |
| Length | 417 |
| Sequence | MNGSMNGITGGIAGTGPTRKVTAKRIGFAARSLGGRGDRTLIGTWFWEIDRVLLMLALGLIAVAGASPAAAQRYSGGGITFAPLHYFWRQLIWVAASLPVMVAVSMLPKGAARRFALAGAAFFTVMLAVVPLVGSEVNGAVRWIGFGFAQFQPSEFLKPMFVVSMAWLLSLKAHDPGLPVVPLTGLLTGAIAVLLMNQPDLGQTIIFAVMWFSLLMISGVSSRALGTLIGGGLAGLVAAYFFYPVANQRINGWLGIGVTAGQGADTYQTDMAHATLTAGGFFGTGPGGGTMKFKLPEAHTDYIFSVIGEEFGLIACLAIAIVFLAIVVRVFVKLLDEEDHFTVLAAAGLTVQFGAQALINMAVNVQMAPSKGMTLPFISYGGSSMLALSIGFGLLLAFTRRNPFLTRSPYVVKWSGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 2 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 5 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 6 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 7 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 8 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 9 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 10 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 11 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 12 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 13 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 14 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 15 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 16 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 17 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 18 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 19 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 20 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 21 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 22 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 23 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 24 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 25 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 26 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 27 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 28 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 29 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 30 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 31 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 32 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 33 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 34 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 35 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 36 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 37 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 38 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 39 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 40 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 41 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 48 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 60 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 83 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 228 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 252 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 253 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 254 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 255 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 256 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 257 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 258 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 259 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 260 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 261 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 322 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 323 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 324 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 327 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 328 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 337 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 342 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 344 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 345 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 347 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 348 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 349 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 350 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 351 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 352 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 353 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 359 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 361 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 362 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 363 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 364 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 365 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 367 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 369 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 371 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 372 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 373 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 375 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 376 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 377 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 380 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 381 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 382 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 383 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 384 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 385 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.15 |
| Metatranscriptomes | 0.1 |
| Isolates | 2.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.51 |
| Bulb | 0 |
| Endosphere | 10.5 |
| Nodule | 0 |
| Rhizoplane | 2.85 |
| Rhizosphere | 78.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000171 | 3300001904 | Bacteria | 11561 |
| 2 | JGI24736J21556_1000449 | 3300001904 | Bacteria | 7725 |
| 3 | JGI24736J21556_1003770 | 3300001904 | Bacteria | 2612 |
| 4 | JGI24736J21556_1006408 | 3300001904 | Bacteria | 1981 |
| 5 | JGI24741J21665_1000309 | 3300001915 | Bacteria | 14619 |
| 6 | JGI24741J21665_1010756 | 3300001915 | Bacteria | 1623 |
| 7 | JGI24752J21851_1002691 | 3300001976 | Bacteria | 2363 |
| 8 | JGI24739J22299_10001503 | 3300001989 | Bacteria | 8795 |
| 9 | JGI24739J22299_10009434 | 3300001989 | Bacteria | 3637 |
| 10 | JGI24737J22298_10000318 | 3300001990 | Bacteria | 16108 |
| 11 | JGI24737J22298_10000409 | 3300001990 | Bacteria | 14680 |
| 12 | JGI24737J22298_10005380 | 3300001990 | Bacteria | 4423 |
| 13 | JGI24735J21928_10001172 | 3300002067 | Bacteria | 9379 |
| 14 | JGI24735J21928_10005978 | 3300002067 | Bacteria | 4021 |
| 15 | JGI24735J21928_10015663 | 3300002067 | Bacteria | 2361 |
| 16 | JGI24735J21928_10026926 | 3300002067 | Bacteria | 1725 |
| 17 | JGI24735J21928_10031245 | 3300002067 | Bacteria | 1579 |
| 18 | JGI24738J21930_10009749 | 3300002075 | Bacteria | 2153 |
| 19 | JGI24738J21930_10012967 | 3300002075 | Bacteria | 1811 |
| 20 | JGI24749J21850_1000015 | 3300002076 | Bacteria | 34487 |
| 21 | JGI24749J21850_1002378 | 3300002076 | Bacteria | 2648 |
| 22 | JGI24744J21845_10002873 | 3300002077 | Bacteria | 3521 |
| 23 | JGI24034J26672_10000040 | 3300002239 | Bacteria | 72195 |
| 24 | JGI24034J26672_10002382 | 3300002239 | Bacteria | 2579 |
| 25 | JGI24751J29686_10000089 | 3300002459 | Bacteria | 50993 |
| 26 | JGI24751J29686_10004260 | 3300002459 | Bacteria | 2904 |
| 27 | JGI25165J46597_1000023 | 3300003214 | Bacteria | 338873 |
| 28 | JGI25153J46596_10000152 | 3300003215 | Bacteria | 70039 |
| 29 | JGI25153J46596_10009386 | 3300003215 | Bacteria | 4555 |
| 30 | rootH2_10060186 | 3300003320 | Bacteria | 2127 |
| 31 | Ga0055525_1000035 | 3300003759 | Bacteria | 300887 |
| 32 | Ga0055542_1000132 | 3300003762 | Bacteria | 96749 |
| 33 | Ga0055529_1000088 | 3300003763 | Bacteria | 139031 |
| 34 | Ga0055526_1007222 | 3300003771 | Bacteria | 5829 |
| 35 | Ga0055537_1004287 | 3300003773 | Bacteria | 4111 |
| 36 | Ga0055537_1006278 | 3300003773 | Bacteria | 3043 |
| 37 | Ga0055536_1000505 | 3300003781 | Bacteria | 26955 |
| 38 | Ga0055536_1001201 | 3300003781 | Bacteria | 16094 |
| 39 | Ga0055536_1010998 | 3300003781 | Bacteria | 3522 |
| 40 | Ga0055534_1012319 | 3300003784 | Bacteria | 1696 |
| 41 | Ga0055530_10000137 | 3300003791 | Bacteria | 64770 |
| 42 | Ga0055530_10000194 | 3300003791 | Bacteria | 54519 |
| 43 | Ga0055530_10000247 | 3300003791 | Bacteria | 48853 |
| 44 | Ga0055530_10019461 | 3300003791 | Bacteria | 2055 |
| 45 | Ga0055531_10000019 | 3300003794 | Bacteria | 170825 |
| 46 | Ga0055531_10001071 | 3300003794 | Bacteria | 21494 |
| 47 | Ga0055531_10001510 | 3300003794 | Bacteria | 17093 |
| 48 | Ga0055531_10012020 | 3300003794 | Bacteria | 4111 |
| 49 | Ga0065704_10125038 | 3300005289 | Bacteria | 1706 |
| 50 | Ga0065715_10008999 | 3300005293 | Bacteria | 3837 |
| 51 | Ga0065707_10084180 | 3300005295 | Bacteria | 7561 |
| 52 | Ga0065707_10085486 | 3300005295 | Bacteria | 6119 |
| 53 | Ga0070658_10000040 | 3300005327 | Bacteria | 136073 |
| 54 | Ga0070658_10000885 | 3300005327 | Bacteria | 25632 |
| 55 | Ga0070658_10003656 | 3300005327 | Bacteria | 12593 |
| 56 | Ga0070658_10005096 | 3300005327 | Bacteria | 10690 |
| 57 | Ga0070658_10021593 | 3300005327 | Bacteria | 5159 |
| 58 | Ga0070658_10028597 | 3300005327 | Bacteria | 4476 |
| 59 | Ga0070658_10055581 | 3300005327 | Bacteria | 3216 |
| 60 | Ga0070658_10077285 | 3300005327 | Bacteria | 2730 |
| 61 | Ga0070658_10179891 | 3300005327 | Bacteria | 1779 |
| 62 | Ga0070658_10181235 | 3300005327 | Bacteria | 1772 |
| 63 | Ga0070676_10000147 | 3300005328 | Bacteria | 27720 |
| 64 | Ga0070676_10003620 | 3300005328 | Bacteria | 8077 |
| 65 | Ga0070683_100125426 | 3300005329 | Bacteria | 2427 |
| 66 | Ga0070690_100000035 | 3300005330 | Bacteria | 62497 |
| 67 | Ga0070670_100000028 | 3300005331 | Bacteria | 184816 |
| 68 | Ga0070670_100000572 | 3300005331 | Bacteria | 29143 |
| 69 | Ga0070670_100004056 | 3300005331 | Bacteria | 12233 |
| 70 | Ga0070670_100007601 | 3300005331 | Bacteria | 9204 |
| 71 | Ga0070670_100018271 | 3300005331 | Bacteria | 6015 |
| 72 | Ga0070670_100175919 | 3300005331 | Bacteria | 1857 |
| 73 | Ga0070677_10002040 | 3300005333 | Bacteria | 6425 |
| 74 | Ga0068869_100000307 | 3300005334 | Bacteria | 26132 |
| 75 | Ga0068869_100011642 | 3300005334 | Bacteria | 5779 |
| 76 | Ga0070666_10000015 | 3300005335 | Bacteria | 208372 |
| 77 | Ga0070666_10000898 | 3300005335 | Bacteria | 18102 |
| 78 | Ga0070666_10111444 | 3300005335 | Bacteria | 1892 |
| 79 | Ga0070680_100000502 | 3300005336 | Bacteria | 26894 |
| 80 | Ga0068868_100000054 | 3300005338 | Bacteria | 64223 |
| 81 | Ga0068868_100000215 | 3300005338 | Bacteria | 38878 |
| 82 | Ga0068868_100002850 | 3300005338 | Bacteria | 11985 |
| 83 | Ga0070660_100000683 | 3300005339 | Bacteria | 22453 |
| 84 | Ga0070660_100001804 | 3300005339 | Bacteria | 14692 |
| 85 | Ga0070660_100003760 | 3300005339 | Bacteria | 10488 |
| 86 | Ga0070660_100010420 | 3300005339 | Bacteria | 6569 |
| 87 | Ga0070660_100011627 | 3300005339 | Bacteria | 6265 |
| 88 | Ga0070660_100011855 | 3300005339 | Bacteria | 6213 |
| 89 | Ga0070660_100036074 | 3300005339 | Bacteria | 3744 |
| 90 | Ga0070660_100100455 | 3300005339 | Bacteria | 2291 |
| 91 | Ga0070689_100024072 | 3300005340 | Bacteria | 4566 |
| 92 | Ga0070689_100065973 | 3300005340 | Bacteria | 2820 |
| 93 | Ga0070687_100073225 | 3300005343 | Bacteria | 1846 |
| 94 | Ga0070661_100000263 | 3300005344 | Bacteria | 43084 |
| 95 | Ga0070661_100003219 | 3300005344 | Bacteria | 11246 |
| 96 | Ga0070661_100022185 | 3300005344 | Bacteria | 4543 |
| 97 | Ga0070661_100025521 | 3300005344 | Bacteria | 4248 |
| 98 | Ga0070692_10000983 | 3300005345 | Bacteria | 9752 |
| 99 | Ga0070668_100000071 | 3300005347 | Bacteria | 62770 |
| 100 | Ga0070668_100000105 | 3300005347 | Bacteria | 51899 |
| 101 | Ga0070668_100006040 | 3300005347 | Bacteria | 8980 |
| 102 | Ga0070668_100015715 | 3300005347 | Bacteria | 5662 |
| 103 | Ga0070668_100243352 | 3300005347 | Bacteria | 1491 |
| 104 | Ga0070669_100000005 | 3300005353 | Bacteria | 309134 |
| 105 | Ga0070669_100000896 | 3300005353 | Bacteria | 21674 |
| 106 | Ga0070669_100001444 | 3300005353 | Bacteria | 17211 |
| 107 | Ga0070675_100006584 | 3300005354 | Bacteria | 8933 |
| 108 | Ga0070671_100000328 | 3300005355 | Bacteria | 32455 |
| 109 | Ga0070671_100001363 | 3300005355 | Bacteria | 18316 |
| 110 | Ga0070671_100018224 | 3300005355 | Bacteria | 5700 |
| 111 | Ga0070671_100163180 | 3300005355 | Bacteria | 1883 |
| 112 | Ga0070674_100001464 | 3300005356 | Bacteria | 12593 |
| 113 | Ga0070674_100005675 | 3300005356 | Bacteria | 7234 |
| 114 | Ga0070674_100047053 | 3300005356 | Bacteria | 2954 |
| 115 | Ga0070674_100229464 | 3300005356 | Bacteria | 1448 |
| 116 | Ga0070673_100000019 | 3300005364 | Bacteria | 107024 |
| 117 | Ga0070673_100004714 | 3300005364 | Bacteria | 8656 |
| 118 | Ga0070673_100207136 | 3300005364 | Bacteria | 1691 |
| 119 | Ga0070688_100008634 | 3300005365 | Bacteria | 5545 |
| 120 | Ga0070659_100000099 | 3300005366 | Bacteria | 63815 |
| 121 | Ga0070659_100009330 | 3300005366 | Bacteria | 7206 |
| 122 | Ga0070659_100092990 | 3300005366 | Bacteria | 2419 |
| 123 | Ga0070659_100145335 | 3300005366 | Bacteria | 1932 |
| 124 | Ga0070667_100000036 | 3300005367 | Bacteria | 172536 |
| 125 | Ga0070667_100000071 | 3300005367 | Bacteria | 125713 |
| 126 | Ga0070667_100000134 | 3300005367 | Bacteria | 94286 |
| 127 | Ga0070667_100000733 | 3300005367 | Bacteria | 31433 |
| 128 | Ga0070667_100000966 | 3300005367 | Bacteria | 26470 |
| 129 | Ga0070667_100005946 | 3300005367 | Bacteria | 10154 |
| 130 | Ga0070667_100006730 | 3300005367 | Bacteria | 9547 |
| 131 | Ga0070667_100055587 | 3300005367 | Bacteria | 3342 |
| 132 | Ga0070667_100061414 | 3300005367 | Bacteria | 3182 |
| 133 | Ga0070714_100027909 | 3300005435 | Bacteria | 4677 |
| 134 | Ga0070714_100097808 | 3300005435 | Bacteria | 2581 |
| 135 | Ga0070700_100014401 | 3300005441 | Bacteria | 4465 |
| 136 | Ga0070663_100047454 | 3300005455 | Bacteria | 3042 |
| 137 | Ga0070663_100140958 | 3300005455 | Bacteria | 1840 |
| 138 | Ga0070678_100001692 | 3300005456 | Bacteria | 11824 |
| 139 | Ga0070678_100022523 | 3300005456 | Bacteria | 4177 |
| 140 | Ga0070662_100000146 | 3300005457 | Bacteria | 40344 |
| 141 | Ga0070662_100009277 | 3300005457 | Bacteria | 6430 |
| 142 | Ga0070662_100065602 | 3300005457 | Bacteria | 2661 |
| 143 | Ga0068867_100000014 | 3300005459 | Bacteria | 112097 |
| 144 | Ga0068867_100017881 | 3300005459 | Bacteria | 5036 |
| 145 | Ga0068867_100030357 | 3300005459 | Bacteria | 3899 |
| 146 | Ga0068867_100142340 | 3300005459 | Bacteria | 1876 |
| 147 | Ga0070685_10000102 | 3300005466 | Bacteria | 53800 |
| 148 | Ga0070698_100117424 | 3300005471 | Bacteria | 2623 |
| 149 | Ga0070679_100000031 | 3300005530 | Bacteria | 107526 |
| 150 | Ga0070679_100105148 | 3300005530 | Bacteria | 2809 |
| 151 | Ga0068853_100001960 | 3300005539 | Bacteria | 15167 |
| 152 | Ga0068853_100110241 | 3300005539 | Bacteria | 2444 |
| 153 | Ga0068853_100282020 | 3300005539 | Bacteria | 1532 |
| 154 | Ga0070672_100002199 | 3300005543 | Bacteria | 12294 |
| 155 | Ga0070672_100051011 | 3300005543 | Bacteria | 3225 |
| 156 | Ga0070686_100000006 | 3300005544 | Bacteria | 243316 |
| 157 | Ga0070686_100000123 | 3300005544 | Bacteria | 55299 |
| 158 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 159 | Ga0070665_100000206 | 3300005548 | Bacteria | 102989 |
| 160 | Ga0070665_100000510 | 3300005548 | Bacteria | 55798 |
| 161 | Ga0070665_100001478 | 3300005548 | Bacteria | 27506 |
| 162 | Ga0070665_100021367 | 3300005548 | Bacteria | 6508 |
| 163 | Ga0070665_100038505 | 3300005548 | Bacteria | 4807 |
| 164 | Ga0068855_100001753 | 3300005563 | Bacteria | 27078 |
| 165 | Ga0068855_100006658 | 3300005563 | Bacteria | 14034 |
| 166 | Ga0068855_100131853 | 3300005563 | Bacteria | 2854 |
| 167 | Ga0068855_100341644 | 3300005563 | Bacteria | 1650 |
| 168 | Ga0070664_100013891 | 3300005564 | Bacteria | 6567 |
| 169 | Ga0070664_100057160 | 3300005564 | Bacteria | 3315 |
| 170 | Ga0070664_100076166 | 3300005564 | Bacteria | 2882 |
| 171 | Ga0070664_100149061 | 3300005564 | Bacteria | 2065 |
| 172 | Ga0068857_100001199 | 3300005577 | Bacteria | 20230 |
| 173 | Ga0068857_100030331 | 3300005577 | Bacteria | 4775 |
| 174 | Ga0068857_100030817 | 3300005577 | Bacteria | 4738 |
| 175 | Ga0068857_100097806 | 3300005577 | Bacteria | 2632 |
| 176 | Ga0068857_100114310 | 3300005577 | Bacteria | 2427 |
| 177 | Ga0068857_100328496 | 3300005577 | Bacteria | 1413 |
| 178 | Ga0068854_100002725 | 3300005578 | Bacteria | 10963 |
| 179 | Ga0068854_100002754 | 3300005578 | Bacteria | 10916 |
| 180 | Ga0068854_100016941 | 3300005578 | Bacteria | 4868 |
| 181 | Ga0068854_100024975 | 3300005578 | Bacteria | 4099 |
| 182 | Ga0068856_100130942 | 3300005614 | Bacteria | 2513 |
| 183 | Ga0068856_100264894 | 3300005614 | Bacteria | 1734 |
| 184 | Ga0068852_100000314 | 3300005616 | Bacteria | 32834 |
| 185 | Ga0068852_100000509 | 3300005616 | Bacteria | 25586 |
| 186 | Ga0068852_100088601 | 3300005616 | Bacteria | 2764 |
| 187 | Ga0068852_100115704 | 3300005616 | Bacteria | 2445 |
| 188 | Ga0068852_100220154 | 3300005616 | Bacteria | 1805 |
| 189 | Ga0068859_100000709 | 3300005617 | Bacteria | 33516 |
| 190 | Ga0068859_100003554 | 3300005617 | Bacteria | 15881 |
| 191 | Ga0068859_100005050 | 3300005617 | Bacteria | 13398 |
| 192 | Ga0068859_100006307 | 3300005617 | Bacteria | 12028 |
| 193 | Ga0068859_100006890 | 3300005617 | Bacteria | 11536 |
| 194 | Ga0068859_100010054 | 3300005617 | Bacteria | 9539 |
| 195 | Ga0068859_100024321 | 3300005617 | Bacteria | 6078 |
| 196 | Ga0068859_100030665 | 3300005617 | Bacteria | 5396 |
| 197 | Ga0068859_100045277 | 3300005617 | Bacteria | 4421 |
| 198 | Ga0068859_100079584 | 3300005617 | Bacteria | 3318 |
| 199 | Ga0068864_100000049 | 3300005618 | Bacteria | 143621 |
| 200 | Ga0068864_100000089 | 3300005618 | Bacteria | 97458 |
| 201 | Ga0068864_100000484 | 3300005618 | Bacteria | 34533 |
| 202 | Ga0068864_100001349 | 3300005618 | Bacteria | 20418 |
| 203 | Ga0068864_100003324 | 3300005618 | Bacteria | 13289 |
| 204 | Ga0068864_100005479 | 3300005618 | Bacteria | 10406 |
| 205 | Ga0068864_100015386 | 3300005618 | Bacteria | 6361 |
| 206 | Ga0068861_100012245 | 3300005719 | Bacteria | 5981 |
| 207 | Ga0068861_100030379 | 3300005719 | Bacteria | 3958 |
| 208 | Ga0068861_100043833 | 3300005719 | Bacteria | 3361 |
| 209 | Ga0068861_100124692 | 3300005719 | Bacteria | 2083 |
| 210 | Ga0068851_10026186 | 3300005834 | Bacteria | 2864 |
| 211 | Ga0068851_10083062 | 3300005834 | Bacteria | 1675 |
| 212 | Ga0068870_10071223 | 3300005840 | Bacteria | 1897 |
| 213 | Ga0068863_100000084 | 3300005841 | Bacteria | 104480 |
| 214 | Ga0068863_100000109 | 3300005841 | Bacteria | 86619 |
| 215 | Ga0068863_100000154 | 3300005841 | Bacteria | 72659 |
| 216 | Ga0068863_100003453 | 3300005841 | Bacteria | 15585 |
| 217 | Ga0068863_100005038 | 3300005841 | Bacteria | 13025 |
| 218 | Ga0068863_100016750 | 3300005841 | Bacteria | 7032 |
| 219 | Ga0068863_100018322 | 3300005841 | Bacteria | 6703 |
| 220 | Ga0068863_100031538 | 3300005841 | Bacteria | 5056 |
| 221 | Ga0068863_100042005 | 3300005841 | Bacteria | 4346 |
| 222 | Ga0068863_100248900 | 3300005841 | Bacteria | 1716 |
| 223 | Ga0068858_100000410 | 3300005842 | Bacteria | 44537 |
| 224 | Ga0068858_100001092 | 3300005842 | Bacteria | 28091 |
| 225 | Ga0068858_100002853 | 3300005842 | Bacteria | 17371 |
| 226 | Ga0068858_100030812 | 3300005842 | Bacteria | 4981 |
| 227 | Ga0068858_100039028 | 3300005842 | Bacteria | 4405 |
| 228 | Ga0068860_100000049 | 3300005843 | Bacteria | 208782 |
| 229 | Ga0068860_100000050 | 3300005843 | Bacteria | 208372 |
| 230 | Ga0068860_100000063 | 3300005843 | Bacteria | 189519 |
| 231 | Ga0068860_100001312 | 3300005843 | Bacteria | 27012 |
| 232 | Ga0068860_100003211 | 3300005843 | Bacteria | 16863 |
| 233 | Ga0068860_100037032 | 3300005843 | Bacteria | 4671 |
| 234 | Ga0068862_100000005 | 3300005844 | Bacteria | 350713 |
| 235 | Ga0068862_100000112 | 3300005844 | Bacteria | 97458 |
| 236 | Ga0068862_100000134 | 3300005844 | Bacteria | 85840 |
| 237 | Ga0068862_100000481 | 3300005844 | Bacteria | 42686 |
| 238 | Ga0068862_100029293 | 3300005844 | Bacteria | 4638 |
| 239 | Ga0068862_100075098 | 3300005844 | Bacteria | 2923 |
| 240 | Ga0068862_100157162 | 3300005844 | Bacteria | 2027 |
| 241 | Ga0081455_10004233 | 3300005937 | Bacteria | 16179 |
| 242 | Ga0081539_10004462 | 3300005985 | Bacteria | 15427 |
| 243 | Ga0068871_100050877 | 3300006358 | Bacteria | 3353 |
| 244 | Ga0068871_100062908 | 3300006358 | Bacteria | 3034 |
| 245 | Ga0075431_100050690 | 3300006847 | Bacteria | 4280 |
| 246 | Ga0068865_100000018 | 3300006881 | Bacteria | 106975 |
| 247 | Ga0068865_100003176 | 3300006881 | Bacteria | 9845 |
| 248 | Ga0097620_100000709 | 3300006931 | Bacteria | 33516 |
| 249 | Ga0097620_100003554 | 3300006931 | Bacteria | 15881 |
| 250 | Ga0097620_100005050 | 3300006931 | Bacteria | 13398 |
| 251 | Ga0097620_100006307 | 3300006931 | Bacteria | 12028 |
| 252 | Ga0097620_100006890 | 3300006931 | Bacteria | 11536 |
| 253 | Ga0097620_100010054 | 3300006931 | Bacteria | 9539 |
| 254 | Ga0097620_100024321 | 3300006931 | Bacteria | 6078 |
| 255 | Ga0097620_100030665 | 3300006931 | Bacteria | 5396 |
| 256 | Ga0097620_100045279 | 3300006931 | Bacteria | 4421 |
| 257 | Ga0097620_100079583 | 3300006931 | Bacteria | 3318 |
| 258 | Ga0105251_10000545 | 3300009011 | Bacteria | 35537 |
| 259 | Ga0105250_10030217 | 3300009092 | Bacteria | 2178 |
| 260 | Ga0105240_10001116 | 3300009093 | Bacteria | 47225 |
| 261 | Ga0105240_10072698 | 3300009093 | Bacteria | 4249 |
| 262 | Ga0105240_10196468 | 3300009093 | Bacteria | 2368 |
| 263 | Ga0105240_10327490 | 3300009093 | Bacteria | 1744 |
| 264 | Ga0105245_10000659 | 3300009098 | Bacteria | 31256 |
| 265 | Ga0105245_10000679 | 3300009098 | Bacteria | 30743 |
| 266 | Ga0105245_10025229 | 3300009098 | Bacteria | 5225 |
| 267 | Ga0105245_10160856 | 3300009098 | Bacteria | 2131 |
| 268 | Ga0105247_10013962 | 3300009101 | Bacteria | 4816 |
| 269 | Ga0105247_10037490 | 3300009101 | Bacteria | 2958 |
| 270 | Ga0105243_10000076 | 3300009148 | Bacteria | 110445 |
| 271 | Ga0105243_10000091 | 3300009148 | Bacteria | 102081 |
| 272 | Ga0105241_10008895 | 3300009174 | Bacteria | 7385 |
| 273 | Ga0105241_10053269 | 3300009174 | Bacteria | 3093 |
| 274 | Ga0105242_10000458 | 3300009176 | Bacteria | 32420 |
| 275 | Ga0105248_10000012 | 3300009177 | Bacteria | 333963 |
| 276 | Ga0105248_10000122 | 3300009177 | Bacteria | 89560 |
| 277 | Ga0105248_10000218 | 3300009177 | Bacteria | 66074 |
| 278 | Ga0105248_10003487 | 3300009177 | Bacteria | 17459 |
| 279 | Ga0105248_10006757 | 3300009177 | Bacteria | 12580 |
| 280 | Ga0105248_10008370 | 3300009177 | Bacteria | 11361 |
| 281 | Ga0105248_10076985 | 3300009177 | Bacteria | 3749 |
| 282 | Ga0105248_10084789 | 3300009177 | Bacteria | 3565 |
| 283 | Ga0105248_10160457 | 3300009177 | Bacteria | 2536 |
| 284 | Ga0105237_10001672 | 3300009545 | Bacteria | 28703 |
| 285 | Ga0105237_10157098 | 3300009545 | Bacteria | 2271 |
| 286 | Ga0105238_10021758 | 3300009551 | Bacteria | 6531 |
| 287 | Ga0105249_10000034 | 3300009553 | Bacteria | 208378 |
| 288 | Ga0105249_10000240 | 3300009553 | Bacteria | 61072 |
| 289 | Ga0105249_10000257 | 3300009553 | Bacteria | 57683 |
| 290 | Ga0105249_10024713 | 3300009553 | Bacteria | 5401 |
| 291 | Ga0105249_10056416 | 3300009553 | Bacteria | 3596 |
| 292 | Ga0105239_10002515 | 3300010375 | Bacteria | 23310 |
| 293 | Ga0105239_10208143 | 3300010375 | Bacteria | 2192 |
| 294 | Ga0105246_10000637 | 3300011119 | Bacteria | 19574 |
| 295 | Ga0157373_10034961 | 3300013100 | Bacteria | 3609 |
| 296 | Ga0157373_10062733 | 3300013100 | Bacteria | 2632 |
| 297 | Ga0157373_10097999 | 3300013100 | Bacteria | 2063 |
| 298 | Ga0157373_10219705 | 3300013100 | Bacteria | 1340 |
| 299 | Ga0157371_10000048 | 3300013102 | Bacteria | 184015 |
| 300 | Ga0157371_10002922 | 3300013102 | Bacteria | 15960 |
| 301 | Ga0157371_10018161 | 3300013102 | Bacteria | 5208 |
| 302 | Ga0157370_10001841 | 3300013104 | Bacteria | 26158 |
| 303 | Ga0157370_10010021 | 3300013104 | Bacteria | 10025 |
| 304 | Ga0157370_10219756 | 3300013104 | Bacteria | 1760 |
| 305 | Ga0157370_10279277 | 3300013104 | Bacteria | 1543 |
| 306 | Ga0157369_10001135 | 3300013105 | Bacteria | 33313 |
| 307 | Ga0157369_10021062 | 3300013105 | Bacteria | 7289 |
| 308 | Ga0157369_10021523 | 3300013105 | Bacteria | 7213 |
| 309 | Ga0157369_10060224 | 3300013105 | Bacteria | 4094 |
| 310 | Ga0157369_10320525 | 3300013105 | Bacteria | 1611 |
| 311 | Ga0157374_10000951 | 3300013296 | Bacteria | 25154 |
| 312 | Ga0157374_10032145 | 3300013296 | Bacteria | 4776 |
| 313 | Ga0157374_10041526 | 3300013296 | Bacteria | 4240 |
| 314 | Ga0157378_10001247 | 3300013297 | Bacteria | 22966 |
| 315 | Ga0163162_10010331 | 3300013306 | Bacteria | 9074 |
| 316 | Ga0163162_10052291 | 3300013306 | Bacteria | 4102 |
| 317 | Ga0163162_10100025 | 3300013306 | Bacteria | 2991 |
| 318 | Ga0163162_10417171 | 3300013306 | Bacteria | 1475 |
| 319 | Ga0157372_10018056 | 3300013307 | Bacteria | 7582 |
| 320 | Ga0157372_10057511 | 3300013307 | Bacteria | 4347 |
| 321 | Ga0157372_10112067 | 3300013307 | Bacteria | 3126 |
| 322 | Ga0157375_10001111 | 3300013308 | Bacteria | 23332 |
| 323 | Ga0157375_10011928 | 3300013308 | Bacteria | 7689 |
| 324 | Ga0163163_10000903 | 3300014325 | Bacteria | 25169 |
| 325 | Ga0163163_10071147 | 3300014325 | Bacteria | 3465 |
| 326 | Ga0157380_10000023 | 3300014326 | Bacteria | 113686 |
| 327 | Ga0157380_10000567 | 3300014326 | Bacteria | 22679 |
| 328 | Ga0157380_10005003 | 3300014326 | Bacteria | 9242 |
| 329 | Ga0157380_10015116 | 3300014326 | Bacteria | 5665 |
| 330 | Ga0157380_10069720 | 3300014326 | Bacteria | 2838 |
| 331 | Ga0157380_10332539 | 3300014326 | Bacteria | 1413 |
| 332 | Ga0157379_10049250 | 3300014968 | Bacteria | 3761 |
| 333 | Ga0157379_10135154 | 3300014968 | Bacteria | 2221 |
| 334 | Ga0157379_10195288 | 3300014968 | Bacteria | 1829 |
| 335 | Ga0183363_1006 | 3300015690 | Bacteria | 400466 |
| 336 | Ga0163161_10000051 | 3300017792 | Bacteria | 122360 |
| 337 | Ga0206353_11456103 | 3300020082 | Bacteria | 4774 |
| 338 | Ga0213873_10000039 | 3300021358 | Bacteria | 32971 |
| 339 | Ga0213876_10000455 | 3300021384 | Bacteria | 32971 |
| 340 | Ga0213875_10000234 | 3300021388 | Bacteria | 56206 |
| 341 | Ga0213875_10007016 | 3300021388 | Bacteria | 5862 |
| 342 | Ga0207672_1000337 | 3300025223 | Bacteria | 6227 |
| 343 | Ga0209563_100047 | 3300025230 | Bacteria | 366620 |
| 344 | Ga0207427_101716 | 3300025231 | Bacteria | 7250 |
| 345 | Ga0207425_1008127 | 3300025245 | Bacteria | 2711 |
| 346 | Ga0209026_1001365 | 3300025250 | Bacteria | 10896 |
| 347 | Ga0209677_105552 | 3300025253 | Bacteria | 3257 |
| 348 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 349 | Ga0209148_1000243 | 3300025254 | Bacteria | 86896 |
| 350 | Ga0209148_1001774 | 3300025254 | Bacteria | 9266 |
| 351 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 352 | Ga0209233_1012861 | 3300025261 | Bacteria | 2410 |
| 353 | Ga0209565_1000012 | 3300025263 | Bacteria | 606500 |
| 354 | Ga0209565_1000135 | 3300025263 | Bacteria | 103272 |
| 355 | Ga0209565_1016198 | 3300025263 | Bacteria | 1663 |
| 356 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 357 | Ga0209455_1002190 | 3300025272 | Bacteria | 7732 |
| 358 | Ga0209673_1011606 | 3300025273 | Bacteria | 3617 |
| 359 | Ga0209675_1000421 | 3300025291 | Bacteria | 34127 |
| 360 | Ga0209675_1009729 | 3300025291 | Bacteria | 3366 |
| 361 | Ga0209676_1000045 | 3300025292 | Bacteria | 412331 |
| 362 | Ga0209676_1000211 | 3300025292 | Bacteria | 129654 |
| 363 | Ga0209676_1000430 | 3300025292 | Bacteria | 72819 |
| 364 | Ga0209025_1002199 | 3300025294 | Bacteria | 21586 |
| 365 | Ga0209564_1007082 | 3300025295 | Bacteria | 5868 |
| 366 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 367 | Ga0209758_1024941 | 3300025297 | Bacteria | 2643 |
| 368 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 369 | Ga0209050_1000047 | 3300025298 | Bacteria | 380561 |
| 370 | Ga0209050_1005991 | 3300025298 | Bacteria | 7377 |
| 371 | Ga0209050_1007931 | 3300025298 | Bacteria | 5816 |
| 372 | Ga0209050_1011536 | 3300025298 | Bacteria | 4171 |
| 373 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 374 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 375 | Ga0209257_1000076 | 3300025304 | Bacteria | 324617 |
| 376 | Ga0209257_1000156 | 3300025304 | Bacteria | 182335 |
| 377 | Ga0209257_1001976 | 3300025304 | Bacteria | 22053 |
| 378 | Ga0209257_1002734 | 3300025304 | Bacteria | 16738 |
| 379 | Ga0207697_10000002 | 3300025315 | Bacteria | 92560 |
| 380 | Ga0207697_10005299 | 3300025315 | Bacteria | 6006 |
| 381 | Ga0207697_10024522 | 3300025315 | Bacteria | 2469 |
| 382 | Ga0207656_10002614 | 3300025321 | Bacteria | 6090 |
| 383 | Ga0207656_10003330 | 3300025321 | Bacteria | 5508 |
| 384 | Ga0207713_1005138 | 3300025735 | Bacteria | 8281 |
| 385 | Ga0207682_10001243 | 3300025893 | Bacteria | 11795 |
| 386 | Ga0207642_10069647 | 3300025899 | Bacteria | 1669 |
| 387 | Ga0207710_10041353 | 3300025900 | Bacteria | 2044 |
| 388 | Ga0207688_10000348 | 3300025901 | Bacteria | 21483 |
| 389 | Ga0207688_10061803 | 3300025901 | Bacteria | 2112 |
| 390 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 391 | Ga0207680_10004744 | 3300025903 | Bacteria | 6471 |
| 392 | Ga0207647_10001020 | 3300025904 | Bacteria | 21763 |
| 393 | Ga0207647_10004952 | 3300025904 | Bacteria | 9819 |
| 394 | Ga0207647_10014553 | 3300025904 | Bacteria | 5422 |
| 395 | Ga0207647_10042571 | 3300025904 | Bacteria | 2848 |
| 396 | Ga0207647_10050143 | 3300025904 | Bacteria | 2586 |
| 397 | Ga0207647_10056850 | 3300025904 | Bacteria | 2400 |
| 398 | Ga0207647_10159653 | 3300025904 | Bacteria | 1315 |
| 399 | Ga0207645_10002499 | 3300025907 | Bacteria | 14432 |
| 400 | Ga0207645_10010987 | 3300025907 | Bacteria | 6195 |
| 401 | Ga0207645_10035093 | 3300025907 | Bacteria | 3221 |
| 402 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 403 | Ga0207705_10000084 | 3300025909 | Bacteria | 116809 |
| 404 | Ga0207705_10000135 | 3300025909 | Bacteria | 79350 |
| 405 | Ga0207705_10000469 | 3300025909 | Bacteria | 34559 |
| 406 | Ga0207705_10000557 | 3300025909 | Bacteria | 31254 |
| 407 | Ga0207705_10001039 | 3300025909 | Bacteria | 22567 |
| 408 | Ga0207705_10013186 | 3300025909 | Bacteria | 5965 |
| 409 | Ga0207705_10013414 | 3300025909 | Bacteria | 5911 |
| 410 | Ga0207705_10015135 | 3300025909 | Bacteria | 5546 |
| 411 | Ga0207705_10027894 | 3300025909 | Bacteria | 4026 |
| 412 | Ga0207705_10034664 | 3300025909 | Bacteria | 3609 |
| 413 | Ga0207705_10043167 | 3300025909 | Bacteria | 3238 |
| 414 | Ga0207705_10241449 | 3300025909 | Bacteria | 1376 |
| 415 | Ga0207654_10000613 | 3300025911 | Bacteria | 20107 |
| 416 | Ga0207654_10029729 | 3300025911 | Bacteria | 2995 |
| 417 | Ga0207707_10085802 | 3300025912 | Bacteria | 2751 |
| 418 | Ga0207695_10000288 | 3300025913 | Bacteria | 125085 |
| 419 | Ga0207695_10003233 | 3300025913 | Bacteria | 23186 |
| 420 | Ga0207695_10003367 | 3300025913 | Bacteria | 22589 |
| 421 | Ga0207695_10024963 | 3300025913 | Bacteria | 6707 |
| 422 | Ga0207695_10028978 | 3300025913 | Bacteria | 6128 |
| 423 | Ga0207695_10126980 | 3300025913 | Bacteria | 2511 |
| 424 | Ga0207671_10002961 | 3300025914 | Bacteria | 17469 |
| 425 | Ga0207671_10006071 | 3300025914 | Bacteria | 10884 |
| 426 | Ga0207671_10104485 | 3300025914 | Bacteria | 2149 |
| 427 | Ga0207660_10002464 | 3300025917 | Bacteria | 12160 |
| 428 | Ga0207657_10000542 | 3300025919 | Bacteria | 40318 |
| 429 | Ga0207657_10000864 | 3300025919 | Bacteria | 31944 |
| 430 | Ga0207657_10001741 | 3300025919 | Bacteria | 23460 |
| 431 | Ga0207657_10001930 | 3300025919 | Bacteria | 22382 |
| 432 | Ga0207657_10002044 | 3300025919 | Bacteria | 21836 |
| 433 | Ga0207657_10004854 | 3300025919 | Bacteria | 14159 |
| 434 | Ga0207657_10018207 | 3300025919 | Bacteria | 6719 |
| 435 | Ga0207657_10023704 | 3300025919 | Bacteria | 5708 |
| 436 | Ga0207657_10082220 | 3300025919 | Bacteria | 2703 |
| 437 | Ga0207657_10094929 | 3300025919 | Bacteria | 2482 |
| 438 | Ga0207649_10000323 | 3300025920 | Bacteria | 36350 |
| 439 | Ga0207649_10000440 | 3300025920 | Bacteria | 30029 |
| 440 | Ga0207649_10038301 | 3300025920 | Bacteria | 2902 |
| 441 | Ga0207652_10000003 | 3300025921 | Bacteria | 502441 |
| 442 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 443 | Ga0207681_10000133 | 3300025923 | Bacteria | 60815 |
| 444 | Ga0207681_10008670 | 3300025923 | Bacteria | 6208 |
| 445 | Ga0207681_10049898 | 3300025923 | Bacteria | 2830 |
| 446 | Ga0207681_10073190 | 3300025923 | Bacteria | 2396 |
| 447 | Ga0207694_10020160 | 3300025924 | Bacteria | 5042 |
| 448 | Ga0207694_10031239 | 3300025924 | Bacteria | 4066 |
| 449 | Ga0207694_10090515 | 3300025924 | Bacteria | 2414 |
| 450 | Ga0207694_10105904 | 3300025924 | Bacteria | 2233 |
| 451 | Ga0207650_10000012 | 3300025925 | Bacteria | 437889 |
| 452 | Ga0207650_10004105 | 3300025925 | Bacteria | 9945 |
| 453 | Ga0207650_10029581 | 3300025925 | Bacteria | 3939 |
| 454 | Ga0207650_10038901 | 3300025925 | Bacteria | 3476 |
| 455 | Ga0207650_10053917 | 3300025925 | Bacteria | 2981 |
| 456 | Ga0207659_10002195 | 3300025926 | Bacteria | 11600 |
| 457 | Ga0207659_10117275 | 3300025926 | Bacteria | 2034 |
| 458 | Ga0207687_10000426 | 3300025927 | Bacteria | 28498 |
| 459 | Ga0207664_10085526 | 3300025929 | Bacteria | 2574 |
| 460 | Ga0207664_10272234 | 3300025929 | Bacteria | 1484 |
| 461 | Ga0207644_10000156 | 3300025931 | Bacteria | 49255 |
| 462 | Ga0207644_10000443 | 3300025931 | Bacteria | 26768 |
| 463 | Ga0207644_10003165 | 3300025931 | Bacteria | 10587 |
| 464 | Ga0207644_10025324 | 3300025931 | Bacteria | 4080 |
| 465 | Ga0207644_10078156 | 3300025931 | Bacteria | 2438 |
| 466 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 467 | Ga0207690_10003555 | 3300025932 | Bacteria | 9279 |
| 468 | Ga0207690_10010280 | 3300025932 | Bacteria | 5557 |
| 469 | Ga0207690_10065188 | 3300025932 | Bacteria | 2490 |
| 470 | Ga0207690_10087863 | 3300025932 | Bacteria | 2188 |
| 471 | Ga0207690_10123424 | 3300025932 | Bacteria | 1885 |
| 472 | Ga0207706_10000461 | 3300025933 | Bacteria | 43387 |
| 473 | Ga0207706_10001316 | 3300025933 | Bacteria | 24902 |
| 474 | Ga0207706_10017362 | 3300025933 | Bacteria | 6483 |
| 475 | Ga0207706_10023849 | 3300025933 | Bacteria | 5488 |
| 476 | Ga0207706_10057322 | 3300025933 | Bacteria | 3432 |
| 477 | Ga0207706_10057949 | 3300025933 | Bacteria | 3412 |
| 478 | Ga0207706_10074451 | 3300025933 | Bacteria | 2986 |
| 479 | Ga0207706_10075509 | 3300025933 | Bacteria | 2964 |
| 480 | Ga0207686_10000518 | 3300025934 | Bacteria | 24936 |
| 481 | Ga0207709_10000018 | 3300025935 | Bacteria | 431545 |
| 482 | Ga0207709_10000114 | 3300025935 | Bacteria | 124672 |
| 483 | Ga0207670_10073401 | 3300025936 | Bacteria | 2372 |
| 484 | Ga0207669_10000084 | 3300025937 | Bacteria | 47546 |
| 485 | Ga0207669_10001886 | 3300025937 | Bacteria | 8885 |
| 486 | Ga0207704_10000008 | 3300025938 | Bacteria | 204682 |
| 487 | Ga0207704_10031091 | 3300025938 | Bacteria | 3002 |
| 488 | Ga0207691_10001615 | 3300025940 | Bacteria | 22399 |
| 489 | Ga0207691_10016302 | 3300025940 | Bacteria | 7054 |
| 490 | Ga0207691_10024681 | 3300025940 | Bacteria | 5653 |
| 491 | Ga0207691_10034126 | 3300025940 | Bacteria | 4734 |
| 492 | Ga0207691_10126496 | 3300025940 | Bacteria | 2261 |
| 493 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 494 | Ga0207711_10001538 | 3300025941 | Bacteria | 21392 |
| 495 | Ga0207711_10001807 | 3300025941 | Bacteria | 19556 |
| 496 | Ga0207711_10001929 | 3300025941 | Bacteria | 18836 |
| 497 | Ga0207711_10005875 | 3300025941 | Bacteria | 10362 |
| 498 | Ga0207711_10006791 | 3300025941 | Bacteria | 9614 |
| 499 | Ga0207711_10127820 | 3300025941 | Bacteria | 2275 |
| 500 | Ga0207689_10000086 | 3300025942 | Bacteria | 75369 |
| 501 | Ga0207689_10000125 | 3300025942 | Bacteria | 64633 |
| 502 | Ga0207689_10115344 | 3300025942 | Bacteria | 2208 |
| 503 | Ga0207679_10005298 | 3300025945 | Bacteria | 8091 |
| 504 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 505 | Ga0207667_10000024 | 3300025949 | Bacteria | 355874 |
| 506 | Ga0207667_10000829 | 3300025949 | Bacteria | 39957 |
| 507 | Ga0207667_10001485 | 3300025949 | Bacteria | 29439 |
| 508 | Ga0207667_10035664 | 3300025949 | Bacteria | 5335 |
| 509 | Ga0207667_10045189 | 3300025949 | Bacteria | 4666 |
| 510 | Ga0207667_10148485 | 3300025949 | Bacteria | 2413 |
| 511 | Ga0207667_10204668 | 3300025949 | Bacteria | 2024 |
| 512 | Ga0207667_10330939 | 3300025949 | Bacteria | 1555 |
| 513 | Ga0207651_10000008 | 3300025960 | Bacteria | 204538 |
| 514 | Ga0207651_10000306 | 3300025960 | Bacteria | 21046 |
| 515 | Ga0207651_10010568 | 3300025960 | Bacteria | 5122 |
| 516 | Ga0207651_10012180 | 3300025960 | Bacteria | 4853 |
| 517 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 518 | Ga0207712_10000196 | 3300025961 | Bacteria | 61501 |
| 519 | Ga0207712_10000324 | 3300025961 | Bacteria | 43682 |
| 520 | Ga0207712_10017468 | 3300025961 | Bacteria | 4660 |
| 521 | Ga0207668_10000011 | 3300025972 | Bacteria | 184484 |
| 522 | Ga0207668_10000039 | 3300025972 | Bacteria | 110049 |
| 523 | Ga0207668_10001189 | 3300025972 | Bacteria | 15470 |
| 524 | Ga0207668_10001788 | 3300025972 | Bacteria | 12554 |
| 525 | Ga0207668_10138178 | 3300025972 | Bacteria | 1870 |
| 526 | Ga0207640_10000229 | 3300025981 | Bacteria | 39028 |
| 527 | Ga0207640_10000349 | 3300025981 | Bacteria | 30129 |
| 528 | Ga0207640_10000513 | 3300025981 | Bacteria | 23367 |
| 529 | Ga0207640_10007638 | 3300025981 | Bacteria | 5971 |
| 530 | Ga0207640_10008252 | 3300025981 | Bacteria | 5777 |
| 531 | Ga0207640_10022420 | 3300025981 | Bacteria | 3779 |
| 532 | Ga0207658_10000014 | 3300025986 | Bacteria | 218248 |
| 533 | Ga0207658_10000082 | 3300025986 | Bacteria | 105161 |
| 534 | Ga0207658_10000083 | 3300025986 | Bacteria | 104502 |
| 535 | Ga0207658_10000617 | 3300025986 | Bacteria | 31548 |
| 536 | Ga0207658_10000711 | 3300025986 | Bacteria | 28834 |
| 537 | Ga0207658_10008242 | 3300025986 | Bacteria | 7099 |
| 538 | Ga0207677_10000074 | 3300026023 | Bacteria | 83468 |
| 539 | Ga0207677_10000321 | 3300026023 | Bacteria | 34946 |
| 540 | Ga0207677_10024714 | 3300026023 | Bacteria | 3737 |
| 541 | Ga0207703_10000402 | 3300026035 | Bacteria | 46561 |
| 542 | Ga0207703_10000732 | 3300026035 | Bacteria | 32270 |
| 543 | Ga0207703_10002306 | 3300026035 | Bacteria | 16649 |
| 544 | Ga0207703_10003797 | 3300026035 | Bacteria | 12553 |
| 545 | Ga0207703_10021411 | 3300026035 | Bacteria | 5062 |
| 546 | Ga0207639_10000400 | 3300026041 | Bacteria | 29922 |
| 547 | Ga0207639_10002804 | 3300026041 | Bacteria | 11694 |
| 548 | Ga0207639_10025867 | 3300026041 | Bacteria | 4259 |
| 549 | Ga0207639_10067999 | 3300026041 | Bacteria | 2774 |
| 550 | Ga0207639_10070086 | 3300026041 | Bacteria | 2738 |
| 551 | Ga0207639_10079196 | 3300026041 | Bacteria | 2596 |
| 552 | Ga0207678_10003023 | 3300026067 | Bacteria | 15215 |
| 553 | Ga0207678_10003861 | 3300026067 | Bacteria | 13472 |
| 554 | Ga0207678_10036208 | 3300026067 | Bacteria | 4296 |
| 555 | Ga0207678_10063521 | 3300026067 | Bacteria | 3173 |
| 556 | Ga0207678_10068658 | 3300026067 | Bacteria | 3040 |
| 557 | Ga0207678_10080609 | 3300026067 | Bacteria | 2786 |
| 558 | Ga0207678_10096724 | 3300026067 | Bacteria | 2523 |
| 559 | Ga0207708_10025680 | 3300026075 | Bacteria | 4458 |
| 560 | Ga0207702_10000708 | 3300026078 | Bacteria | 35874 |
| 561 | Ga0207702_10011116 | 3300026078 | Bacteria | 7513 |
| 562 | Ga0207702_10013160 | 3300026078 | Bacteria | 6880 |
| 563 | Ga0207702_10013509 | 3300026078 | Bacteria | 6783 |
| 564 | Ga0207702_10027861 | 3300026078 | Bacteria | 4693 |
| 565 | Ga0207702_10058852 | 3300026078 | Bacteria | 3271 |
| 566 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 567 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 568 | Ga0207641_10000274 | 3300026088 | Bacteria | 65428 |
| 569 | Ga0207641_10000292 | 3300026088 | Bacteria | 62689 |
| 570 | Ga0207641_10000477 | 3300026088 | Bacteria | 45337 |
| 571 | Ga0207641_10003899 | 3300026088 | Bacteria | 13055 |
| 572 | Ga0207641_10021464 | 3300026088 | Bacteria | 5306 |
| 573 | Ga0207641_10026594 | 3300026088 | Bacteria | 4776 |
| 574 | Ga0207641_10032055 | 3300026088 | Bacteria | 4362 |
| 575 | Ga0207641_10197547 | 3300026088 | Bacteria | 1852 |
| 576 | Ga0207648_10000009 | 3300026089 | Bacteria | 204229 |
| 577 | Ga0207648_10085821 | 3300026089 | Bacteria | 2746 |
| 578 | Ga0207676_10000009 | 3300026095 | Bacteria | 545256 |
| 579 | Ga0207676_10000051 | 3300026095 | Bacteria | 132645 |
| 580 | Ga0207676_10000759 | 3300026095 | Bacteria | 25256 |
| 581 | Ga0207676_10002928 | 3300026095 | Bacteria | 12165 |
| 582 | Ga0207676_10002984 | 3300026095 | Bacteria | 12062 |
| 583 | Ga0207676_10004634 | 3300026095 | Bacteria | 9730 |
| 584 | Ga0207676_10008960 | 3300026095 | Bacteria | 7119 |
| 585 | Ga0207676_10219809 | 3300026095 | Bacteria | 1691 |
| 586 | Ga0207674_10002496 | 3300026116 | Bacteria | 23202 |
| 587 | Ga0207674_10007688 | 3300026116 | Bacteria | 12548 |
| 588 | Ga0207674_10012789 | 3300026116 | Bacteria | 9372 |
| 589 | Ga0207674_10016393 | 3300026116 | Bacteria | 8112 |
| 590 | Ga0207674_10121495 | 3300026116 | Bacteria | 2579 |
| 591 | Ga0207674_10131784 | 3300026116 | Bacteria | 2462 |
| 592 | Ga0207674_10139136 | 3300026116 | Bacteria | 2388 |
| 593 | Ga0207675_100000049 | 3300026118 | Bacteria | 84016 |
| 594 | Ga0207675_100000350 | 3300026118 | Bacteria | 43897 |
| 595 | Ga0207675_100032909 | 3300026118 | Bacteria | 4830 |
| 596 | Ga0207675_100033960 | 3300026118 | Bacteria | 4754 |
| 597 | Ga0207675_100172796 | 3300026118 | Bacteria | 2066 |
| 598 | Ga0207683_10007669 | 3300026121 | Bacteria | 9239 |
| 599 | Ga0207683_10023514 | 3300026121 | Bacteria | 5302 |
| 600 | Ga0207683_10033449 | 3300026121 | Bacteria | 4465 |
| 601 | Ga0207683_10049118 | 3300026121 | Bacteria | 3693 |
| 602 | Ga0207698_10004747 | 3300026142 | Bacteria | 8312 |
| 603 | Ga0207698_10016934 | 3300026142 | Bacteria | 4930 |
| 604 | Ga0207698_10025984 | 3300026142 | Bacteria | 4136 |
| 605 | Ga0207698_10028904 | 3300026142 | Bacteria | 3961 |
| 606 | Ga0209974_10025610 | 3300027876 | Bacteria | 1953 |
| 607 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 608 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 609 | Ga0268266_10000058 | 3300028379 | Bacteria | 277346 |
| 610 | Ga0268266_10000875 | 3300028379 | Bacteria | 39015 |
| 611 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 612 | Ga0268265_10000026 | 3300028380 | Bacteria | 246653 |
| 613 | Ga0268265_10000086 | 3300028380 | Bacteria | 119049 |
| 614 | Ga0268265_10000228 | 3300028380 | Bacteria | 64301 |
| 615 | Ga0268265_10000309 | 3300028380 | Bacteria | 54201 |
| 616 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 617 | Ga0268264_10000083 | 3300028381 | Bacteria | 245366 |
| 618 | Ga0268264_10000121 | 3300028381 | Bacteria | 190368 |
| 619 | Ga0268264_10001117 | 3300028381 | Bacteria | 26438 |
| 620 | Ga0268264_10032566 | 3300028381 | Bacteria | 4277 |
| 621 | Ga0268264_10046983 | 3300028381 | Bacteria | 3588 |
| 622 | Ga0268264_10389184 | 3300028381 | Bacteria | 1337 |
| 623 | Ga0307517_10037646 | 3300028786 | Bacteria | 5393 |
| 624 | Ga0307517_10049716 | 3300028786 | Bacteria | 4282 |
| 625 | Ga0307513_10020531 | 3300031456 | Bacteria | 7833 |
| 626 | Ga0307513_10076661 | 3300031456 | Bacteria | 3466 |
| 627 | Ga0307513_10095623 | 3300031456 | Bacteria | 3011 |
| 628 | Ga0307408_100136920 | 3300031548 | Bacteria | 1917 |
| 629 | Ga0307405_10038268 | 3300031731 | Bacteria | 2890 |
| 630 | Ga0307410_10006628 | 3300031852 | Bacteria | 6267 |
| 631 | Ga0307410_10010799 | 3300031852 | Bacteria | 5195 |
| 632 | Ga0307410_10020750 | 3300031852 | Bacteria | 4027 |
| 633 | Ga0307410_10197254 | 3300031852 | Bacteria | 1535 |
| 634 | Ga0307406_10067160 | 3300031901 | Bacteria | 2337 |
| 635 | Ga0307406_10085323 | 3300031901 | Bacteria | 2111 |
| 636 | Ga0307406_10119703 | 3300031901 | Bacteria | 1828 |
| 637 | Ga0307407_10025234 | 3300031903 | Bacteria | 3130 |
| 638 | Ga0307407_10097785 | 3300031903 | Bacteria | 1815 |
| 639 | Ga0307412_10007500 | 3300031911 | Bacteria | 6193 |
| 640 | Ga0307412_10011418 | 3300031911 | Bacteria | 5147 |
| 641 | Ga0307412_10042123 | 3300031911 | Bacteria | 2964 |
| 642 | Ga0307412_10059177 | 3300031911 | Bacteria | 2566 |
| 643 | Ga0307412_10123369 | 3300031911 | Bacteria | 1869 |
| 644 | Ga0307409_100059744 | 3300031995 | Bacteria | 2968 |
| 645 | Ga0307409_100090402 | 3300031995 | Bacteria | 2506 |
| 646 | Ga0307409_100119509 | 3300031995 | Bacteria | 2228 |
| 647 | Ga0307409_100190927 | 3300031995 | Bacteria | 1823 |
| 648 | Ga0307416_100017660 | 3300032002 | Bacteria | 5000 |
| 649 | Ga0307416_100152556 | 3300032002 | Bacteria | 2121 |
| 650 | Ga0307414_10000282 | 3300032004 | Bacteria | 29952 |
| 651 | Ga0307414_10005141 | 3300032004 | Bacteria | 7178 |
| 652 | Ga0307414_10024308 | 3300032004 | Bacteria | 3862 |
| 653 | Ga0307414_10076696 | 3300032004 | Bacteria | 2430 |
| 654 | Ga0307414_10144718 | 3300032004 | Bacteria | 1866 |
| 655 | Ga0307411_10003502 | 3300032005 | Bacteria | 7293 |
| 656 | Ga0307411_10010029 | 3300032005 | Bacteria | 5022 |
| 657 | Ga0307411_10029816 | 3300032005 | Bacteria | 3337 |
| 658 | Ga0307411_10068249 | 3300032005 | Bacteria | 2396 |
| 659 | Ga0307411_10118260 | 3300032005 | Bacteria | 1911 |
| 660 | Ga0307411_10163783 | 3300032005 | Bacteria | 1669 |
| 661 | Ga0307510_10023125 | 3300033180 | Bacteria | 7210 |
| 662 | Ga0373923_0003840 | 3300035111 | Bacteria | 4891 |
| 663 | Ga0373954_0036329 | 3300035118 | Bacteria | 2287 |
| 664 | Ga0373957_0059298 | 3300035120 | Bacteria | 1480 |
| 665 | Ga0373943_0004396 | 3300035170 | Bacteria | 6383 |
| 666 | Ga0373933_0031231 | 3300035724 | Bacteria | 3090 |
| 667 | Ga0373947_0052311 | 3300035725 | Bacteria | 2460 |
| 668 | Ga0373925_0081558 | 3300037068 | Bacteria | 2460 |
| 669 | Ga0395899_0000352 | 3300037312 | Bacteria | 56166 |
| 670 | Ga0395899_0001871 | 3300037312 | Bacteria | 17377 |
| 671 | Ga0395899_0011391 | 3300037312 | Bacteria | 6809 |
| 672 | Ga0395899_0033670 | 3300037312 | Bacteria | 3847 |
| 673 | Ga0395899_0197483 | 3300037312 | Bacteria | 1404 |
| 674 | Ga0395900_0001013 | 3300037418 | Bacteria | 36249 |
| 675 | Ga0395900_0010908 | 3300037418 | Bacteria | 9292 |
| 676 | Ga0395900_0013797 | 3300037418 | Bacteria | 8246 |
| 677 | Ga0395900_0032067 | 3300037418 | Bacteria | 5402 |
| 678 | Ga0395900_0040109 | 3300037418 | Bacteria | 4825 |
| 679 | Ga0395900_0087116 | 3300037418 | Bacteria | 3209 |
| 680 | Ga0395900_0369404 | 3300037418 | Bacteria | 1404 |
| 681 | Ga0395900_0378945 | 3300037418 | Bacteria | 1383 |
| 682 | Ga0395898_0007714 | 3300037466 | Bacteria | 11426 |
| 683 | Ga0395898_0031262 | 3300037466 | Bacteria | 5321 |
| 684 | Ga0395898_0054381 | 3300037466 | Bacteria | 3906 |
| 685 | Ga0395898_0086996 | 3300037466 | Bacteria | 3011 |
| 686 | Ga0395898_0156445 | 3300037466 | Bacteria | 2180 |
| 687 | Ga0395905_0010264 | 3300037471 | Bacteria | 9119 |
| 688 | Ga0395905_0025207 | 3300037471 | Bacteria | 5609 |
| 689 | Ga0395905_0029740 | 3300037471 | Bacteria | 5149 |
| 690 | Ga0395905_0072740 | 3300037471 | Bacteria | 3223 |
| 691 | Ga0395905_0073194 | 3300037471 | Bacteria | 3212 |
| 692 | Ga0395905_0100192 | 3300037471 | Bacteria | 2720 |
| 693 | Ga0395905_0340424 | 3300037471 | Bacteria | 1391 |
| 694 | Ga0436364_0154840 | 3300037853 | Bacteria | 188668 |
| 695 | Ga0436364_0643906 | 3300037853 | Bacteria | 1614 |
| 696 | Ga0436364_1253462 | 3300037853 | Bacteria | 1104 |
| 697 | Ga0436364_1258768 | 3300037853 | Bacteria | 24526 |
| 698 | Ga0395901_0000047 | 3300038443 | Bacteria | 175221 |
| 699 | Ga0395901_0012089 | 3300038443 | Bacteria | 8758 |
| 700 | Ga0395901_0020559 | 3300038443 | Bacteria | 6755 |
| 701 | Ga0395901_0031102 | 3300038443 | Bacteria | 5504 |
| 702 | Ga0395901_0058555 | 3300038443 | Bacteria | 4007 |
| 703 | Ga0395901_0081838 | 3300038443 | Bacteria | 3372 |
| 704 | Ga0395901_0132205 | 3300038443 | Bacteria | 2622 |
| 705 | Ga0395901_0132454 | 3300038443 | Bacteria | 2619 |
| 706 | Ga0395901_0245337 | 3300038443 | Bacteria | 1867 |
| 707 | Ga0395901_0372707 | 3300038443 | Bacteria | 1470 |
| 708 | Ga0237819_00349 | 3300038705 | Bacteria | 16648 |
| 709 | Ga0436365_0168572 | 3300039437 | Bacteria | 1944 |
| 710 | Ga0436365_0328398 | 3300039437 | Bacteria | 22219 |
| 711 | Ga0436365_0563507 | 3300039437 | Bacteria | 8333 |
| 712 | Ga0436365_1424167 | 3300039437 | Bacteria | 1438 |
| 713 | Ga0436363_0178057 | 3300039450 | Bacteria | 1531 |
| 714 | Ga0436362_1186234 | 3300039453 | Bacteria | 18309 |
| 715 | Ga0439461_0000726 | 3300041410 | Bacteria | 4800 |
| 716 | Ga0439465_0011633 | 3300041413 | Bacteria | 2761 |
| 717 | Ga0439465_0017815 | 3300041413 | Bacteria | 2219 |
| 718 | Ga0451849_1186291 | 3300041505 | Bacteria | 2004 |
| 719 | Ga0439448_0009079 | 3300042005 | Bacteria | 2925 |
| 720 | Ga0439432_000890 | 3300042006 | Bacteria | 11210 |
| 721 | Ga0439449_0067989 | 3300042007 | Bacteria | 1313 |
| 722 | Ga0439455_0006607 | 3300042012 | Bacteria | 2415 |
| 723 | Ga0439455_0012199 | 3300042012 | Bacteria | 1925 |
| 724 | Ga0439457_008051 | 3300042014 | Bacteria | 2501 |
| 725 | Ga0439458_0000132 | 3300042157 | Bacteria | 15763 |
| 726 | Ga0439434_0013839 | 3300042435 | Bacteria | 2397 |
| 727 | Ga0451577_0180355 | 3300042876 | Bacteria | 1904 |
| 728 | Ga0466969_0001195 | 3300044656 | Bacteria | 14022 |
| 729 | Ga0466972_0002734 | 3300044658 | Bacteria | 8729 |
| 730 | Ga0466973_0060404 | 3300044659 | Bacteria | 3437 |
| 731 | Ga0466966_0000077 | 3300044684 | Bacteria | 62463 |
| 732 | Ga0466966_0000965 | 3300044684 | Bacteria | 18464 |
| 733 | Ga0466966_0039103 | 3300044684 | Bacteria | 3055 |
| 734 | Ga0466961_0002009 | 3300044693 | Bacteria | 12653 |
| 735 | Ga0466961_0019991 | 3300044693 | Bacteria | 4308 |
| 736 | Ga0466961_0022497 | 3300044693 | Bacteria | 4055 |
| 737 | Ga0466963_0000618 | 3300044694 | Bacteria | 17054 |
| 738 | Ga0466963_0047048 | 3300044694 | Bacteria | 2846 |
| 739 | Ga0466963_0189062 | 3300044694 | Bacteria | 1439 |
| 740 | Ga0466971_0006686 | 3300044719 | Bacteria | 5018 |
| 741 | Ga0466968_0014273 | 3300044735 | Bacteria | 3137 |
| 742 | Ga0466970_0006019 | 3300044765 | Bacteria | 6048 |
| 743 | Ga0466957_0001231 | 3300044842 | Bacteria | 13363 |
| 744 | Ga0466959_0022715 | 3300045049 | Bacteria | 4637 |
| 745 | Ga0466959_0052349 | 3300045049 | Bacteria | 2990 |
| 746 | Ga0466958_0000370 | 3300045836 | Bacteria | 18214 |
| 747 | Ga0466958_0028656 | 3300045836 | Bacteria | 3302 |
| 748 | Ga0466967_0183055 | 3300045976 | Bacteria | 1977 |
| 749 | Ga0495638_0000689 | 3300046460 | Bacteria | 36627 |
| 750 | Ga0495650_0000158 | 3300046471 | Bacteria | 154681 |
| 751 | Ga0495584_0040483 | 3300046491 | Bacteria | 2353 |
| 752 | Ga0495585_0011237 | 3300046492 | Bacteria | 5304 |
| 753 | Ga0495583_0000023 | 3300046506 | Bacteria | 280019 |
| 754 | Ga0495583_0002516 | 3300046506 | Bacteria | 15513 |
| 755 | Ga0495583_0009695 | 3300046506 | Bacteria | 5721 |
| 756 | Ga0495583_0014626 | 3300046506 | Bacteria | 4317 |
| 757 | Ga0495606_0000795 | 3300046507 | Bacteria | 48219 |
| 758 | Ga0495643_0001769 | 3300046522 | Bacteria | 18567 |
| 759 | Ga0495643_0004776 | 3300046522 | Bacteria | 9352 |
| 760 | Ga0495648_0000537 | 3300046524 | Bacteria | 40955 |
| 761 | Ga0495648_0035561 | 3300046524 | Bacteria | 3228 |
| 762 | Ga0495648_0043111 | 3300046524 | Bacteria | 2832 |
| 763 | Ga0495663_0000478 | 3300046525 | Bacteria | 14573 |
| 764 | Ga0495663_0005034 | 3300046525 | Bacteria | 3692 |
| 765 | Ga0495654_0001314 | 3300046530 | Bacteria | 17382 |
| 766 | Ga0495621_0000160 | 3300046539 | Bacteria | 15007 |
| 767 | Ga0495622_0020294 | 3300046557 | Bacteria | 3094 |
| 768 | Ga0495633_0001403 | 3300046558 | Bacteria | 18789 |
| 769 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 770 | Ga0495668_0000090 | 3300046616 | Bacteria | 144763 |
| 771 | Ga0495668_0003961 | 3300046616 | Bacteria | 10794 |
| 772 | Ga0495668_0010901 | 3300046616 | Bacteria | 5474 |
| 773 | Ga0495668_0021700 | 3300046616 | Bacteria | 3678 |
| 774 | Ga0495668_0037700 | 3300046616 | Bacteria | 2704 |
| 775 | Ga0495611_0010335 | 3300046648 | Bacteria | 3949 |
| 776 | Ga0495625_0000153 | 3300046660 | Bacteria | 105123 |
| 777 | Ga0495625_0000722 | 3300046660 | Bacteria | 46349 |
| 778 | Ga0495625_0000740 | 3300046660 | Bacteria | 45562 |
| 779 | Ga0495625_0039622 | 3300046660 | Bacteria | 3439 |
| 780 | Ga0495661_0038173 | 3300046665 | Bacteria | 2994 |
| 781 | Ga0495669_0000262 | 3300046684 | Bacteria | 30336 |
| 782 | Ga0495670_0000005 | 3300046691 | Bacteria | 289725 |
| 783 | Ga0495671_0044356 | 3300046692 | Bacteria | 2230 |
| 784 | Ga0495589_0026704 | 3300046794 | Bacteria | 2924 |
| 785 | Ga0495600_0064333 | 3300046809 | Bacteria | 2397 |
| 786 | Ga0495683_0004126 | 3300047323 | Bacteria | 8316 |
| 787 | Ga0495687_000434 | 3300047443 | Bacteria | 51724 |
| 788 | Ga0495687_001237 | 3300047443 | Bacteria | 24378 |
| 789 | Ga0495681_0002298 | 3300047470 | Bacteria | 13742 |
| 790 | Ga0495681_0029178 | 3300047470 | Bacteria | 2827 |
| 791 | Ga0495686_0000340 | 3300047472 | Bacteria | 76984 |
| 792 | Ga0495686_0000363 | 3300047472 | Bacteria | 73366 |
| 793 | Ga0495686_0000383 | 3300047472 | Bacteria | 70528 |
| 794 | Ga0495686_0009061 | 3300047472 | Bacteria | 7219 |
| 795 | Ga0495686_0009245 | 3300047472 | Bacteria | 7128 |
| 796 | Ga0495686_0026459 | 3300047472 | Bacteria | 3795 |
| 797 | Ga0495686_0068818 | 3300047472 | Bacteria | 2184 |
| 798 | Ga0495602_0035210 | 3300048088 | Bacteria | 4671 |
| 799 | Ga0496101_0101789 | 3300048904 | Bacteria | 2151 |
| 800 | Ga0496101_0125751 | 3300048904 | Bacteria | 1942 |
| 801 | Ga0496102_0000034 | 3300048905 | Bacteria | 213826 |
| 802 | Ga0496102_0000125 | 3300048905 | Bacteria | 109075 |
| 803 | Ga0496102_0001152 | 3300048905 | Bacteria | 24155 |
| 804 | Ga0496103_0000026 | 3300048906 | Bacteria | 213826 |
| 805 | Ga0496103_0000972 | 3300048906 | Bacteria | 20284 |
| 806 | Ga0496103_0005595 | 3300048906 | Bacteria | 7516 |
| 807 | Ga0496104_0068659 | 3300048907 | Bacteria | 3368 |
| 808 | Ga0496104_0081383 | 3300048907 | Bacteria | 3088 |
| 809 | Ga0496104_0199707 | 3300048907 | Bacteria | 1912 |
| 810 | Ga0496105_0001064 | 3300048908 | Bacteria | 19031 |
| 811 | Ga0496105_0052708 | 3300048908 | Bacteria | 3360 |
| 812 | Ga0496106_0025607 | 3300048909 | Bacteria | 4392 |
| 813 | Ga0496107_0129957 | 3300048910 | Bacteria | 1859 |
| 814 | Ga0496108_0000529 | 3300048911 | Bacteria | 29960 |
| 815 | Ga0496108_0000634 | 3300048911 | Bacteria | 27402 |
| 816 | Ga0496109_0051650 | 3300048912 | Bacteria | 3744 |
| 817 | Ga0496111_0090443 | 3300048914 | Bacteria | 2242 |
| 818 | Ga0496111_0103463 | 3300048914 | Bacteria | 2094 |
| 819 | Ga0496111_0154382 | 3300048914 | Bacteria | 1703 |
| 820 | Ga0496113_0006759 | 3300048916 | Bacteria | 7312 |
| 821 | Ga0496114_0033893 | 3300048917 | Bacteria | 4210 |
| 822 | Ga0496114_0226548 | 3300048917 | Bacteria | 1642 |
| 823 | Ga0496115_0000142 | 3300048918 | Bacteria | 65915 |
| 824 | Ga0496115_0000711 | 3300048918 | Bacteria | 24655 |
| 825 | Ga0496116_0000926 | 3300048919 | Bacteria | 36211 |
| 826 | Ga0496116_0012425 | 3300048919 | Bacteria | 6958 |
| 827 | Ga0496116_0062550 | 3300048919 | Bacteria | 2403 |
| 828 | Ga0496117_0000072 | 3300048920 | Bacteria | 238366 |
| 829 | Ga0496117_0001219 | 3300048920 | Bacteria | 38563 |
| 830 | Ga0496117_0024330 | 3300048920 | Bacteria | 4793 |
| 831 | Ga0496117_0024346 | 3300048920 | Bacteria | 4791 |
| 832 | Ga0496117_0025509 | 3300048920 | Bacteria | 4647 |
| 833 | Ga0496117_0089906 | 3300048920 | Bacteria | 1981 |
| 834 | Ga0496118_0000030 | 3300048921 | Bacteria | 339946 |
| 835 | Ga0496118_0000285 | 3300048921 | Bacteria | 88805 |
| 836 | Ga0496118_0000946 | 3300048921 | Bacteria | 45410 |
| 837 | Ga0496118_0032325 | 3300048921 | Bacteria | 4313 |
| 838 | Ga0496118_0035080 | 3300048921 | Bacteria | 4080 |
| 839 | Ga0496118_0067799 | 3300048921 | Bacteria | 2595 |
| 840 | Ga0496118_0230009 | 3300048921 | Bacteria | 1071 |
| 841 | Ga0496119_0018557 | 3300048922 | Bacteria | 5171 |
| 842 | Ga0496119_0020782 | 3300048922 | Bacteria | 4770 |
| 843 | Ga0496119_0118603 | 3300048922 | Bacteria | 1458 |
| 844 | Ga0496121_0000296 | 3300048924 | Bacteria | 103215 |
| 845 | Ga0496121_0004218 | 3300048924 | Bacteria | 19590 |
| 846 | Ga0496121_0006365 | 3300048924 | Bacteria | 14711 |
| 847 | Ga0496121_0038748 | 3300048924 | Bacteria | 4213 |
| 848 | Ga0496121_0045897 | 3300048924 | Bacteria | 3747 |
| 849 | Ga0496121_0154125 | 3300048924 | Bacteria | 1687 |
| 850 | Ga0496122_0002487 | 3300048925 | Bacteria | 26053 |
| 851 | Ga0496122_0005545 | 3300048925 | Bacteria | 14960 |
| 852 | Ga0496123_0001967 | 3300048926 | Bacteria | 26671 |
| 853 | Ga0496123_0016038 | 3300048926 | Bacteria | 6109 |
| 854 | Ga0496123_0039606 | 3300048926 | Bacteria | 3294 |
| 855 | Ga0496123_0057850 | 3300048926 | Bacteria | 2520 |
| 856 | Ga0496124_0000061 | 3300048927 | Bacteria | 238225 |
| 857 | Ga0496124_0000320 | 3300048927 | Bacteria | 88704 |
| 858 | Ga0496124_0000328 | 3300048927 | Bacteria | 87848 |
| 859 | Ga0496124_0002196 | 3300048927 | Bacteria | 26040 |
| 860 | Ga0496124_0008089 | 3300048927 | Bacteria | 11053 |
| 861 | Ga0496124_0244087 | 3300048927 | Bacteria | 1333 |
| 862 | Ga0496125_0001234 | 3300048928 | Bacteria | 38266 |
| 863 | Ga0496125_0014557 | 3300048928 | Bacteria | 7657 |
| 864 | Ga0496125_0170682 | 3300048928 | Bacteria | 1463 |
| 865 | Ga0496126_0000655 | 3300048929 | Bacteria | 64225 |
| 866 | Ga0496126_0006832 | 3300048929 | Bacteria | 12660 |
| 867 | Ga0496126_0071545 | 3300048929 | Bacteria | 3087 |
| 868 | Ga0501292_000040 | 3300049515 | Bacteria | 31058 |
| 869 | Ga0501294_000062 | 3300049517 | Bacteria | 11348 |
| 870 | Ga0501033_0017961 | 3300049570 | Bacteria | 5340 |
| 871 | Ga0501033_0073568 | 3300049570 | Bacteria | 2509 |
| 872 | Ga0501036_0384890 | 3300049572 | Bacteria | 1170 |
| 873 | Ga0501037_0031601 | 3300049573 | Bacteria | 3909 |
| 874 | Ga0501038_0179252 | 3300049574 | Bacteria | 1710 |
| 875 | Ga0501039_0013849 | 3300049575 | Bacteria | 6170 |
| 876 | Ga0501043_0014561 | 3300049579 | Bacteria | 6158 |
| 877 | Ga0501043_0078505 | 3300049579 | Bacteria | 2594 |
| 878 | Ga0501046_0083082 | 3300049580 | Bacteria | 2473 |
| 879 | Ga0501047_0000938 | 3300049581 | Bacteria | 29563 |
| 880 | Ga0501047_0065045 | 3300049581 | Bacteria | 3516 |
| 881 | Ga0501047_0250643 | 3300049581 | Bacteria | 1619 |
| 882 | Ga0501202_004956 | 3300049652 | Bacteria | 2345 |
| 883 | Ga0501223_000541 | 3300049663 | Bacteria | 9113 |
| 884 | Ga0501223_008904 | 3300049663 | Bacteria | 2041 |
| 885 | Ga0501224_000457 | 3300049664 | Bacteria | 4923 |
| 886 | Ga0501227_003138 | 3300049665 | Bacteria | 3592 |
| 887 | Ga0501235_010333 | 3300049669 | Bacteria | 2041 |
| 888 | Ga0501257_000053 | 3300049686 | Bacteria | 31509 |
| 889 | Ga0501259_001047 | 3300049688 | Bacteria | 4609 |
| 890 | Ga0501261_000079 | 3300049690 | Bacteria | 16304 |
| 891 | Ga0501221_001486 | 3300049704 | Bacteria | 3885 |
| 892 | Ga0501225_0006238 | 3300049705 | Bacteria | 3483 |
| 893 | Ga0501245_002056 | 3300049708 | Bacteria | 2668 |
| 894 | Ga0501241_009043 | 3300049758 | Bacteria | 1815 |
| 895 | Ga0501276_002049 | 3300049773 | Bacteria | 1405 |
| 896 | Ga0501279_000008 | 3300049775 | Bacteria | 125267 |
| 897 | Ga0501280_000013 | 3300049776 | Bacteria | 59205 |
| 898 | Ga0501280_004421 | 3300049776 | Bacteria | 2070 |
| 899 | Ga0501281_00139 | 3300049777 | Bacteria | 8549 |
| 900 | Ga0501282_000442 | 3300049778 | Bacteria | 4934 |
| 901 | Ga0501283_000845 | 3300049779 | Bacteria | 4028 |
| 902 | Ga0501035_0040305 | 3300049822 | Bacteria | 4221 |
| 903 | Ga0501044_0080878 | 3300049823 | Bacteria | 3290 |
| 904 | Ga0501044_0220053 | 3300049823 | Bacteria | 1849 |
| 905 | nmdc:mga06r32_4589_c1 | 3300050510 | Bacteria | 12385 |
| 906 | Ga0500610_0000036 | 3300053079 | Bacteria | 46301 |
| 907 | Ga0500643_000066 | 3300053087 | Bacteria | 119317 |
| 908 | Ga0500643_000766 | 3300053087 | Bacteria | 20969 |
| 909 | Ga0500643_004056 | 3300053087 | Bacteria | 6755 |
| 910 | Ga0500643_004883 | 3300053087 | Bacteria | 5911 |
| 911 | Ga0500643_006378 | 3300053087 | Bacteria | 4935 |
| 912 | Ga0500643_010962 | 3300053087 | Bacteria | 3340 |
| 913 | Ga0500643_017880 | 3300053087 | Bacteria | 2363 |
| 914 | Ga0500566_0007018 | 3300053094 | Bacteria | 6665 |
| 915 | Ga0500641_0016772 | 3300053096 | Bacteria | 2730 |
| 916 | Ga0500641_0023393 | 3300053096 | Bacteria | 2376 |
| 917 | Ga0500641_0024501 | 3300053096 | Bacteria | 2327 |
| 918 | Ga0500555_001230 | 3300053103 | Bacteria | 8238 |
| 919 | Ga0500562_034585 | 3300053108 | Bacteria | 1337 |
| 920 | Ga0500592_000093 | 3300053116 | Bacteria | 20146 |
| 921 | Ga0500592_001148 | 3300053116 | Bacteria | 4308 |
| 922 | Ga0500595_000411 | 3300053119 | Bacteria | 27292 |
| 923 | Ga0500595_002272 | 3300053119 | Bacteria | 9682 |
| 924 | Ga0500597_003737 | 3300053120 | Bacteria | 4564 |
| 925 | Ga0500642_0007206 | 3300053130 | Bacteria | 3721 |
| 926 | Ga0500658_0001013 | 3300053134 | Bacteria | 11466 |
| 927 | Ga0500658_0003056 | 3300053134 | Bacteria | 6405 |
| 928 | Ga0500658_0008975 | 3300053134 | Bacteria | 3689 |
| 929 | Ga0500559_0026779 | 3300053136 | Bacteria | 2458 |
| 930 | Ga0500568_0001671 | 3300053139 | Bacteria | 13891 |
| 931 | Ga0500568_0004177 | 3300053139 | Bacteria | 7793 |
| 932 | Ga0500568_0019020 | 3300053139 | Bacteria | 2995 |
| 933 | Ga0500573_0001728 | 3300053140 | Bacteria | 10606 |
| 934 | Ga0500577_0014755 | 3300053142 | Bacteria | 2424 |
| 935 | Ga0500590_000428 | 3300053148 | Bacteria | 14129 |
| 936 | Ga0500604_0000240 | 3300053151 | Bacteria | 15732 |
| 937 | Ga0500604_0010303 | 3300053151 | Bacteria | 2499 |
| 938 | Ga0500604_0013841 | 3300053151 | Bacteria | 2190 |
| 939 | Ga0500616_0001040 | 3300053153 | Bacteria | 29324 |
| 940 | Ga0500616_0008125 | 3300053153 | Bacteria | 6560 |
| 941 | Ga0500622_0003987 | 3300053156 | Bacteria | 9523 |
| 942 | Ga0500624_000074 | 3300053157 | Bacteria | 57107 |
| 943 | Ga0500627_0000010 | 3300053158 | Bacteria | 152372 |
| 944 | Ga0500627_0000117 | 3300053158 | Bacteria | 25223 |
| 945 | Ga0500627_0000417 | 3300053158 | Bacteria | 11494 |
| 946 | Ga0500636_0008119 | 3300053177 | Bacteria | 6081 |
| 947 | Ga0500637_0000261 | 3300053178 | Bacteria | 19714 |
| 948 | Ga0500570_020728 | 3300053724 | Bacteria | 3667 |
| 949 | Ga0500645_000005 | 3300053730 | Bacteria | 284466 |
| 950 | Ga0500645_001004 | 3300053730 | Bacteria | 15898 |
| 951 | Ga0500552_002023 | 3300053733 | Bacteria | 1954 |
| 952 | Ga0500596_002871 | 3300053735 | Bacteria | 3356 |
| 953 | Ga0466962_0000478 | 3300061719 | Bacteria | 17336 |
| 954 | Ga0466962_0002189 | 3300061719 | Bacteria | 9244 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048921 | Ga0496118_0230009 | Ga0496118_0230009_179_1057 | 284 |
| 2 | 3300005459 | Ga0068867_100142340 | Ga0068867_1001423402 | 295 |
| 3 | 3300037853 | Ga0436364_1253462 | Ga0436364_1253462_162_1094 | 306 |
| 4 | 3300049581 | Ga0501047_0250643 | Ga0501047_0250643_10_951 | 311 |
| 5 | 3300049704 | Ga0501221_001486 | Ga0501221_001486_1361_2317 | 318 |
| 6 | 3300049773 | Ga0501276_002049 | Ga0501276_002049_439_1395 | 318 |
| 7 | 3300042876 | Ga0451577_0180355 | Ga0451577_0180355_186_1370 | 329 |
| 8 | 3300025919 | Ga0207657_10094929 | Ga0207657_100949291 | 331 |
| 9 | 3300042012 | Ga0439455_0012199 | Ga0439455_0012199_13_1026 | 331 |
| 10 | 3300031456 | Ga0307513_10020531 | Ga0307513_100205316 | 337 |
| 11 | 3300025940 | Ga0207691_10126496 | Ga0207691_101264962 | 339 |
| 12 | 3300028786 | Ga0307517_10037646 | Ga0307517_100376462 | 339 |
| 13 | 3300003320 | rootH2_10060186 | rootH2_100601861 | 343 |
| 14 | 3300028786 | Ga0307517_10049716 | Ga0307517_100497162 | 343 |
| 15 | 3300032002 | Ga0307416_100152556 | Ga0307416_1001525562 | 343 |
| 16 | 3300047472 | Ga0495686_0000383 | Ga0495686_0000383_1305_2549 | 343 |
| 17 | 3300053139 | Ga0500568_0019020 | Ga0500568_0019020_435_1658 | 343 |
| 18 | 3300003215 | JGI25153J46596_10000152 | JGI25153J46596_1000015242 | 344 |
| 19 | 3300025297 | Ga0209758_1000035 | Ga0209758_100003543 | 344 |
| 20 | 3300046491 | Ga0495584_0040483 | Ga0495584_0040483_874_2097 | 344 |
| 21 | 3300046522 | Ga0495643_0004776 | Ga0495643_0004776_5269_6492 | 344 |
| 22 | 3300048924 | Ga0496121_0000296 | Ga0496121_0000296_65783_67006 | 345 |
| 23 | 3300027876 | Ga0209974_10025610 | Ga0209974_100256102 | 346 |
| 24 | 3300001915 | JGI24741J21665_1000309 | JGI24741J21665_10003092 | 348 |
| 25 | 3300001990 | JGI24737J22298_10000409 | JGI24737J22298_100004094 | 348 |
| 26 | 3300003759 | Ga0055525_1000035 | Ga0055525_1000035237 | 348 |
| 27 | 3300003762 | Ga0055542_1000132 | Ga0055542_100013298 | 348 |
| 28 | 3300003763 | Ga0055529_1000088 | Ga0055529_100008862 | 348 |
| 29 | 3300005327 | Ga0070658_10005096 | Ga0070658_100050967 | 348 |
| 30 | 3300005331 | Ga0070670_100175919 | Ga0070670_1001759192 | 348 |
| 31 | 3300005344 | Ga0070661_100003219 | Ga0070661_1000032198 | 348 |
| 32 | 3300005356 | Ga0070674_100001464 | Ga0070674_1000014646 | 348 |
| 33 | 3300005356 | Ga0070674_100005675 | Ga0070674_1000056752 | 348 |
| 34 | 3300005456 | Ga0070678_100001692 | Ga0070678_1000016924 | 348 |
| 35 | 3300005457 | Ga0070662_100065602 | Ga0070662_1000656022 | 348 |
| 36 | 3300005564 | Ga0070664_100149061 | Ga0070664_1001490612 | 348 |
| 37 | 3300005834 | Ga0068851_10083062 | Ga0068851_100830622 | 348 |
| 38 | 3300006358 | Ga0068871_100062908 | Ga0068871_1000629082 | 348 |
| 39 | 3300009148 | Ga0105243_10000091 | Ga0105243_1000009162 | 348 |
| 40 | 3300009174 | Ga0105241_10008895 | Ga0105241_100088955 | 348 |
| 41 | 3300013100 | Ga0157373_10097999 | Ga0157373_100979992 | 348 |
| 42 | 3300013102 | Ga0157371_10000048 | Ga0157371_10000048120 | 348 |
| 43 | 3300025230 | Ga0209563_100047 | Ga0209563_100047118 | 348 |
| 44 | 3300025253 | Ga0209677_105552 | Ga0209677_1055523 | 348 |
| 45 | 3300025254 | Ga0209148_1000017 | Ga0209148_100001759 | 348 |
| 46 | 3300025261 | Ga0209233_1012861 | Ga0209233_10128612 | 348 |
| 47 | 3300025272 | Ga0209455_1000005 | Ga0209455_100000559 | 348 |
| 48 | 3300025321 | Ga0207656_10002614 | Ga0207656_100026145 | 348 |
| 49 | 3300025904 | Ga0207647_10050143 | Ga0207647_100501433 | 348 |
| 50 | 3300025909 | Ga0207705_10000557 | Ga0207705_1000055710 | 348 |
| 51 | 3300025911 | Ga0207654_10000613 | Ga0207654_100006136 | 348 |
| 52 | 3300025914 | Ga0207671_10104485 | Ga0207671_101044852 | 348 |
| 53 | 3300025919 | Ga0207657_10082220 | Ga0207657_100822202 | 348 |
| 54 | 3300025920 | Ga0207649_10000440 | Ga0207649_100004403 | 348 |
| 55 | 3300025924 | Ga0207694_10031239 | Ga0207694_100312392 | 348 |
| 56 | 3300025932 | Ga0207690_10087863 | Ga0207690_100878632 | 348 |
| 57 | 3300025933 | Ga0207706_10023849 | Ga0207706_100238493 | 348 |
| 58 | 3300025935 | Ga0207709_10000018 | Ga0207709_10000018195 | 348 |
| 59 | 3300025937 | Ga0207669_10000084 | Ga0207669_1000008422 | 348 |
| 60 | 3300025937 | Ga0207669_10001886 | Ga0207669_100018864 | 348 |
| 61 | 3300025949 | Ga0207667_10000004 | Ga0207667_1000000454 | 348 |
| 62 | 3300025960 | Ga0207651_10010568 | Ga0207651_100105682 | 348 |
| 63 | 3300025981 | Ga0207640_10000513 | Ga0207640_100005133 | 348 |
| 64 | 3300026041 | Ga0207639_10002804 | Ga0207639_100028042 | 348 |
| 65 | 3300026067 | Ga0207678_10003023 | Ga0207678_1000302313 | 348 |
| 66 | 3300026078 | Ga0207702_10000708 | Ga0207702_1000070839 | 348 |
| 67 | 3300026116 | Ga0207674_10139136 | Ga0207674_101391362 | 348 |
| 68 | 3300026121 | Ga0207683_10007669 | Ga0207683_100076692 | 348 |
| 69 | 3300026142 | Ga0207698_10016934 | Ga0207698_100169344 | 348 |
| 70 | 3300041505 | Ga0451849_1186291 | Ga0451849_1186291_36_1283 | 348 |
| 71 | 3300046492 | Ga0495585_0011237 | Ga0495585_0011237_1758_2981 | 348 |
| 72 | 3300046506 | Ga0495583_0014626 | Ga0495583_0014626_11_1234 | 348 |
| 73 | 3300046507 | Ga0495606_0000795 | Ga0495606_0000795_3428_4651 | 348 |
| 74 | 3300046522 | Ga0495643_0001769 | Ga0495643_0001769_8324_9547 | 348 |
| 75 | 3300046524 | Ga0495648_0000537 | Ga0495648_0000537_28822_30045 | 348 |
| 76 | 3300046525 | Ga0495663_0000478 | Ga0495663_0000478_9537_10760 | 348 |
| 77 | 3300046558 | Ga0495633_0001403 | Ga0495633_0001403_15795_17018 | 348 |
| 78 | 3300046616 | Ga0495668_0000090 | Ga0495668_0000090_47968_49191 | 348 |
| 79 | 3300046660 | Ga0495625_0000722 | Ga0495625_0000722_20701_21924 | 348 |
| 80 | 3300046660 | Ga0495625_0039622 | Ga0495625_0039622_20_1243 | 348 |
| 81 | 3300046684 | Ga0495669_0000262 | Ga0495669_0000262_1895_3118 | 348 |
| 82 | 3300046692 | Ga0495671_0044356 | Ga0495671_0044356_17_1240 | 348 |
| 83 | 3300047323 | Ga0495683_0004126 | Ga0495683_0004126_4691_5914 | 348 |
| 84 | 3300047443 | Ga0495687_000434 | Ga0495687_000434_39560_40783 | 348 |
| 85 | 3300047443 | Ga0495687_001237 | Ga0495687_001237_10878_12101 | 348 |
| 86 | 3300047470 | Ga0495681_0002298 | Ga0495681_0002298_422_1645 | 348 |
| 87 | 3300048905 | Ga0496102_0000125 | Ga0496102_0000125_52067_53290 | 348 |
| 88 | 3300048906 | Ga0496103_0000972 | Ga0496103_0000972_8198_9421 | 348 |
| 89 | 3300048907 | Ga0496104_0081383 | Ga0496104_0081383_1663_2886 | 348 |
| 90 | 3300048908 | Ga0496105_0001064 | Ga0496105_0001064_12955_14178 | 348 |
| 91 | 3300048917 | Ga0496114_0033893 | Ga0496114_0033893_1642_2865 | 348 |
| 92 | 3300048918 | Ga0496115_0000142 | Ga0496115_0000142_10938_12161 | 348 |
| 93 | 3300048919 | Ga0496116_0012425 | Ga0496116_0012425_4038_5261 | 348 |
| 94 | 3300048920 | Ga0496117_0001219 | Ga0496117_0001219_26440_27663 | 348 |
| 95 | 3300048921 | Ga0496118_0000285 | Ga0496118_0000285_76563_77786 | 348 |
| 96 | 3300048924 | Ga0496121_0004218 | Ga0496121_0004218_7429_8652 | 348 |
| 97 | 3300048925 | Ga0496122_0005545 | Ga0496122_0005545_6186_7409 | 348 |
| 98 | 3300048927 | Ga0496124_0000320 | Ga0496124_0000320_76546_77769 | 348 |
| 99 | 3300048928 | Ga0496125_0001234 | Ga0496125_0001234_10760_11983 | 348 |
| 100 | 3300048929 | Ga0496126_0000655 | Ga0496126_0000655_10933_12156 | 348 |
| 101 | 3300053079 | Ga0500610_0000036 | Ga0500610_0000036_40813_42036 | 348 |
| 102 | 3300053730 | Ga0500645_000005 | Ga0500645_000005_44143_45366 | 348 |
| 103 | 3300005347 | Ga0070668_100243352 | Ga0070668_1002433521 | 350 |
| 104 | 3300046660 | Ga0495625_0000153 | Ga0495625_0000153_3810_5045 | 350 |
| 105 | 3300005617 | Ga0068859_100006890 | Ga0068859_1000068905 | 351 |
| 106 | 3300006931 | Ga0097620_100006890 | Ga0097620_1000068907 | 351 |
| 107 | 3300044656 | Ga0466969_0001195 | Ga0466969_0001195_6737_7957 | 351 |
| 108 | 3300044684 | Ga0466966_0000965 | Ga0466966_0000965_9225_10445 | 351 |
| 109 | 3300044693 | Ga0466961_0002009 | Ga0466961_0002009_7542_8762 | 351 |
| 110 | 3300044694 | Ga0466963_0189062 | Ga0466963_0189062_59_1279 | 351 |
| 111 | 3300044765 | Ga0466970_0006019 | Ga0466970_0006019_1390_2610 | 351 |
| 112 | 3300044842 | Ga0466957_0001231 | Ga0466957_0001231_11238_12458 | 351 |
| 113 | 3300045049 | Ga0466959_0022715 | Ga0466959_0022715_2505_3725 | 351 |
| 114 | 3300045836 | Ga0466958_0000370 | Ga0466958_0000370_9262_10482 | 351 |
| 115 | 3300053108 | Ga0500562_034585 | Ga0500562_034585_28_1203 | 351 |
| 116 | 3300061719 | Ga0466962_0002189 | Ga0466962_0002189_7724_8944 | 351 |
| 117 | 3300001904 | JGI24736J21556_1000449 | JGI24736J21556_10004496 | 352 |
| 118 | 3300005616 | Ga0068852_100088601 | Ga0068852_1000886012 | 352 |
| 119 | 3300013100 | Ga0157373_10219705 | Ga0157373_102197051 | 352 |
| 120 | 3300013102 | Ga0157371_10018161 | Ga0157371_100181614 | 352 |
| 121 | 3300013105 | Ga0157369_10001135 | Ga0157369_1000113519 | 352 |
| 122 | 3300013105 | Ga0157369_10021523 | Ga0157369_100215235 | 352 |
| 123 | 3300013296 | Ga0157374_10032145 | Ga0157374_100321452 | 352 |
| 124 | 3300025909 | Ga0207705_10013186 | Ga0207705_100131865 | 352 |
| 125 | 3300025913 | Ga0207695_10003233 | Ga0207695_1000323315 | 352 |
| 126 | 3300025913 | Ga0207695_10028978 | Ga0207695_100289785 | 352 |
| 127 | 3300025949 | Ga0207667_10045189 | Ga0207667_100451894 | 352 |
| 128 | 3300025949 | Ga0207667_10204668 | Ga0207667_102046682 | 352 |
| 129 | 3300026067 | Ga0207678_10096724 | Ga0207678_100967242 | 352 |
| 130 | 3300026078 | Ga0207702_10011116 | Ga0207702_100111166 | 352 |
| 131 | 3300026078 | Ga0207702_10013509 | Ga0207702_100135095 | 352 |
| 132 | 3300026078 | Ga0207702_10027861 | Ga0207702_100278614 | 352 |
| 133 | 3300026116 | Ga0207674_10131784 | Ga0207674_101317842 | 352 |
| 134 | 3300026142 | Ga0207698_10025984 | Ga0207698_100259843 | 352 |
| 135 | 3300037312 | Ga0395899_0001871 | Ga0395899_0001871_10770_11990 | 352 |
| 136 | 3300037312 | Ga0395899_0197483 | Ga0395899_0197483_72_1292 | 352 |
| 137 | 3300037418 | Ga0395900_0087116 | Ga0395900_0087116_1055_2275 | 352 |
| 138 | 3300037418 | Ga0395900_0369404 | Ga0395900_0369404_113_1333 | 352 |
| 139 | 3300037466 | Ga0395898_0031262 | Ga0395898_0031262_1755_2975 | 352 |
| 140 | 3300037466 | Ga0395898_0054381 | Ga0395898_0054381_2574_3794 | 352 |
| 141 | 3300037466 | Ga0395898_0086996 | Ga0395898_0086996_1330_2553 | 352 |
| 142 | 3300038443 | Ga0395901_0012089 | Ga0395901_0012089_235_1455 | 352 |
| 143 | 3300038443 | Ga0395901_0081838 | Ga0395901_0081838_1468_2688 | 352 |
| 144 | 3300044693 | Ga0466961_0022497 | Ga0466961_0022497_624_1844 | 352 |
| 145 | 3300044694 | Ga0466963_0047048 | Ga0466963_0047048_862_2082 | 352 |
| 146 | 3300005329 | Ga0070683_100125426 | Ga0070683_1001254261 | 353 |
| 147 | 3300005548 | Ga0070665_100000206 | Ga0070665_10000020682 | 353 |
| 148 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021649 | 353 |
| 149 | 3300046471 | Ga0495650_0000158 | Ga0495650_0000158_97848_99071 | 353 |
| 150 | 3300046506 | Ga0495583_0002516 | Ga0495583_0002516_6861_8084 | 353 |
| 151 | 3300046557 | Ga0495622_0020294 | Ga0495622_0020294_1828_3051 | 353 |
| 152 | 3300046665 | Ga0495661_0038173 | Ga0495661_0038173_1255_2478 | 353 |
| 153 | 3300046809 | Ga0495600_0064333 | Ga0495600_0064333_798_2021 | 353 |
| 154 | 3300047472 | Ga0495686_0000340 | Ga0495686_0000340_49548_50768 | 353 |
| 155 | 3300049572 | Ga0501036_0384890 | Ga0501036_0384890_20_1096 | 353 |
| 156 | 3300053119 | Ga0500595_000411 | Ga0500595_000411_18578_19801 | 353 |
| 157 | 3300053177 | Ga0500636_0008119 | Ga0500636_0008119_3587_4807 | 353 |
| 158 | 3300053735 | Ga0500596_002871 | Ga0500596_002871_1291_2511 | 353 |
| 159 | 3300046506 | Ga0495583_0000023 | Ga0495583_0000023_20393_21637 | 354 |
| 160 | 3300046648 | Ga0495611_0010335 | Ga0495611_0010335_1226_2470 | 354 |
| 161 | 3300053103 | Ga0500555_001230 | Ga0500555_001230_3961_5205 | 354 |
| 162 | 3300021388 | Ga0213875_10007016 | Ga0213875_100070162 | 355 |
| 163 | 3300037853 | Ga0436364_1258768 | Ga0436364_1258768_6898_8121 | 355 |
| 164 | 3300048926 | Ga0496123_0057850 | Ga0496123_0057850_52_1296 | 355 |
| 165 | 3300049688 | Ga0501259_001047 | Ga0501259_001047_1228_2418 | 355 |
| 166 | 3300005548 | Ga0070665_100000011 | Ga0070665_100000011357 | 356 |
| 167 | 3300028379 | Ga0268266_10000058 | Ga0268266_10000058172 | 356 |
| 168 | 3300033180 | Ga0307510_10023125 | Ga0307510_100231252 | 356 |
| 169 | 3300037853 | Ga0436364_0643906 | Ga0436364_0643906_276_1496 | 356 |
| 170 | 3300031995 | Ga0307409_100119509 | Ga0307409_1001195092 | 357 |
| 171 | 3300038443 | Ga0395901_0058555 | Ga0395901_0058555_2093_3316 | 357 |
| 172 | 3300005327 | Ga0070658_10179891 | Ga0070658_101798912 | 358 |
| 173 | 3300005338 | Ga0068868_100000054 | Ga0068868_10000005412 | 358 |
| 174 | 3300005339 | Ga0070660_100010420 | Ga0070660_1000104203 | 358 |
| 175 | 3300005366 | Ga0070659_100000099 | Ga0070659_10000009935 | 358 |
| 176 | 3300009098 | Ga0105245_10160856 | Ga0105245_101608562 | 358 |
| 177 | 3300025909 | Ga0207705_10013414 | Ga0207705_100134142 | 358 |
| 178 | 3300025919 | Ga0207657_10018207 | Ga0207657_100182074 | 358 |
| 179 | 3300025932 | Ga0207690_10000005 | Ga0207690_10000005557 | 358 |
| 180 | 3300026023 | Ga0207677_10000074 | Ga0207677_1000007451 | 358 |
| 181 | 3300035118 | Ga0373954_0036329 | Ga0373954_0036329_764_1987 | 358 |
| 182 | 3300038443 | Ga0395901_0372707 | Ga0395901_0372707_132_1370 | 358 |
| 183 | 3300039437 | Ga0436365_1424167 | Ga0436365_1424167_146_1321 | 358 |
| 184 | 3300047472 | Ga0495686_0009245 | Ga0495686_0009245_1755_3029 | 358 |
| 185 | 3300049758 | Ga0501241_009043 | Ga0501241_009043_20_1246 | 358 |
| 186 | 3300005327 | Ga0070658_10181235 | Ga0070658_101812352 | 359 |
| 187 | 3300005564 | Ga0070664_100013891 | Ga0070664_1000138913 | 359 |
| 188 | 3300025945 | Ga0207679_10005298 | Ga0207679_100052986 | 359 |
| 189 | 3300031456 | Ga0307513_10095623 | Ga0307513_100956232 | 359 |
| 190 | 3300031852 | Ga0307410_10020750 | Ga0307410_100207503 | 359 |
| 191 | 3300031995 | Ga0307409_100059744 | Ga0307409_1000597442 | 359 |
| 192 | 3300032005 | Ga0307411_10003502 | Ga0307411_100035022 | 359 |
| 193 | 3300044684 | Ga0466966_0000077 | Ga0466966_0000077_18295_19518 | 359 |
| 194 | 3300046506 | Ga0495583_0009695 | Ga0495583_0009695_3149_4372 | 359 |
| 195 | 3300046616 | Ga0495668_0021700 | Ga0495668_0021700_1145_2368 | 359 |
| 196 | 3300047470 | Ga0495681_0029178 | Ga0495681_0029178_765_1994 | 359 |
| 197 | 3300053087 | Ga0500643_004883 | Ga0500643_004883_4331_5560 | 359 |
| 198 | 3300053087 | Ga0500643_006378 | Ga0500643_006378_1062_2285 | 359 |
| 199 | 3300053094 | Ga0500566_0007018 | Ga0500566_0007018_2735_3964 | 359 |
| 200 | 3300003215 | JGI25153J46596_10009386 | JGI25153J46596_100093863 | 360 |
| 201 | 3300003773 | Ga0055537_1006278 | Ga0055537_10062782 | 360 |
| 202 | 3300003791 | Ga0055530_10019461 | Ga0055530_100194612 | 360 |
| 203 | 3300003794 | Ga0055531_10012020 | Ga0055531_100120203 | 360 |
| 204 | 3300005435 | Ga0070714_100097808 | Ga0070714_1000978082 | 360 |
| 205 | 3300005618 | Ga0068864_100003324 | Ga0068864_1000033246 | 360 |
| 206 | 3300005842 | Ga0068858_100039028 | Ga0068858_1000390283 | 360 |
| 207 | 3300009177 | Ga0105248_10006757 | Ga0105248_100067573 | 360 |
| 208 | 3300025245 | Ga0207425_1008127 | Ga0207425_10081272 | 360 |
| 209 | 3300025263 | Ga0209565_1000012 | Ga0209565_1000012453 | 360 |
| 210 | 3300025273 | Ga0209673_1011606 | Ga0209673_10116063 | 360 |
| 211 | 3300025291 | Ga0209675_1009729 | Ga0209675_10097293 | 360 |
| 212 | 3300025297 | Ga0209758_1024941 | Ga0209758_10249413 | 360 |
| 213 | 3300025298 | Ga0209050_1007931 | Ga0209050_10079317 | 360 |
| 214 | 3300025299 | Ga0209256_1000012 | Ga0209256_1000012644 | 360 |
| 215 | 3300025304 | Ga0209257_1002734 | Ga0209257_100273415 | 360 |
| 216 | 3300025929 | Ga0207664_10085526 | Ga0207664_100855262 | 360 |
| 217 | 3300025941 | Ga0207711_10001929 | Ga0207711_100019295 | 360 |
| 218 | 3300026035 | Ga0207703_10002306 | Ga0207703_100023062 | 360 |
| 219 | 3300026095 | Ga0207676_10002984 | Ga0207676_100029844 | 360 |
| 220 | 3300037418 | Ga0395900_0032067 | Ga0395900_0032067_836_2059 | 360 |
| 221 | 3300005364 | Ga0070673_100207136 | Ga0070673_1002071362 | 361 |
| 222 | 3300025315 | Ga0207697_10024522 | Ga0207697_100245222 | 361 |
| 223 | 3300025926 | Ga0207659_10117275 | Ga0207659_101172752 | 361 |
| 224 | 3300025960 | Ga0207651_10012180 | Ga0207651_100121801 | 361 |
| 225 | 3300031911 | Ga0307412_10011418 | Ga0307412_100114184 | 361 |
| 226 | 3300037466 | Ga0395898_0156445 | Ga0395898_0156445_916_2136 | 361 |
| 227 | 3300053134 | Ga0500658_0001013 | Ga0500658_0001013_1858_3087 | 361 |
| 228 | 3300053140 | Ga0500573_0001728 | Ga0500573_0001728_1986_3203 | 361 |
| 229 | 3300001904 | JGI24736J21556_1003770 | JGI24736J21556_10037702 | 362 |
| 230 | 3300001990 | JGI24737J22298_10000318 | JGI24737J22298_100003184 | 362 |
| 231 | 3300002239 | JGI24034J26672_10002382 | JGI24034J26672_100023822 | 362 |
| 232 | 3300005327 | Ga0070658_10055581 | Ga0070658_100555813 | 362 |
| 233 | 3300005334 | Ga0068869_100011642 | Ga0068869_1000116423 | 362 |
| 234 | 3300005338 | Ga0068868_100002850 | Ga0068868_10000285010 | 362 |
| 235 | 3300005339 | Ga0070660_100011855 | Ga0070660_1000118552 | 362 |
| 236 | 3300005340 | Ga0070689_100065973 | Ga0070689_1000659732 | 362 |
| 237 | 3300005344 | Ga0070661_100022185 | Ga0070661_1000221853 | 362 |
| 238 | 3300005353 | Ga0070669_100001444 | Ga0070669_10000144417 | 362 |
| 239 | 3300005367 | Ga0070667_100000966 | Ga0070667_10000096623 | 362 |
| 240 | 3300005459 | Ga0068867_100030357 | Ga0068867_1000303571 | 362 |
| 241 | 3300005539 | Ga0068853_100001960 | Ga0068853_10000196014 | 362 |
| 242 | 3300005543 | Ga0070672_100002199 | Ga0070672_10000219912 | 362 |
| 243 | 3300005577 | Ga0068857_100001199 | Ga0068857_1000011997 | 362 |
| 244 | 3300005578 | Ga0068854_100016941 | Ga0068854_1000169413 | 362 |
| 245 | 3300005616 | Ga0068852_100000509 | Ga0068852_1000005096 | 362 |
| 246 | 3300005617 | Ga0068859_100000709 | Ga0068859_10000070935 | 362 |
| 247 | 3300005618 | Ga0068864_100000484 | Ga0068864_10000048435 | 362 |
| 248 | 3300005719 | Ga0068861_100124692 | Ga0068861_1001246922 | 362 |
| 249 | 3300005841 | Ga0068863_100016750 | Ga0068863_1000167506 | 362 |
| 250 | 3300005842 | Ga0068858_100030812 | Ga0068858_1000308123 | 362 |
| 251 | 3300005843 | Ga0068860_100003211 | Ga0068860_10000321114 | 362 |
| 252 | 3300006881 | Ga0068865_100003176 | Ga0068865_1000031762 | 362 |
| 253 | 3300006931 | Ga0097620_100000709 | Ga0097620_10000070935 | 362 |
| 254 | 3300009098 | Ga0105245_10000679 | Ga0105245_1000067918 | 362 |
| 255 | 3300009177 | Ga0105248_10000122 | Ga0105248_1000012265 | 362 |
| 256 | 3300013102 | Ga0157371_10002922 | Ga0157371_100029227 | 362 |
| 257 | 3300013104 | Ga0157370_10219756 | Ga0157370_102197562 | 362 |
| 258 | 3300013306 | Ga0163162_10010331 | Ga0163162_100103317 | 362 |
| 259 | 3300013307 | Ga0157372_10057511 | Ga0157372_100575113 | 362 |
| 260 | 3300015690 | Ga0183363_1006 | Ga0183363_1006142 | 362 |
| 261 | 3300025315 | Ga0207697_10000002 | Ga0207697_1000000221 | 362 |
| 262 | 3300025899 | Ga0207642_10069647 | Ga0207642_100696472 | 362 |
| 263 | 3300025901 | Ga0207688_10000348 | Ga0207688_1000034815 | 362 |
| 264 | 3300025907 | Ga0207645_10035093 | Ga0207645_100350933 | 362 |
| 265 | 3300025909 | Ga0207705_10043167 | Ga0207705_100431672 | 362 |
| 266 | 3300025919 | Ga0207657_10000542 | Ga0207657_1000054222 | 362 |
| 267 | 3300025923 | Ga0207681_10049898 | Ga0207681_100498982 | 362 |
| 268 | 3300025927 | Ga0207687_10000426 | Ga0207687_100004266 | 362 |
| 269 | 3300025932 | Ga0207690_10003555 | Ga0207690_100035555 | 362 |
| 270 | 3300025932 | Ga0207690_10123424 | Ga0207690_101234242 | 362 |
| 271 | 3300025936 | Ga0207670_10073401 | Ga0207670_100734012 | 362 |
| 272 | 3300025938 | Ga0207704_10031091 | Ga0207704_100310912 | 362 |
| 273 | 3300025940 | Ga0207691_10034126 | Ga0207691_100341264 | 362 |
| 274 | 3300025941 | Ga0207711_10001807 | Ga0207711_1000180713 | 362 |
| 275 | 3300025942 | Ga0207689_10000125 | Ga0207689_100001258 | 362 |
| 276 | 3300025949 | Ga0207667_10001485 | Ga0207667_1000148513 | 362 |
| 277 | 3300025960 | Ga0207651_10000306 | Ga0207651_100003065 | 362 |
| 278 | 3300025981 | Ga0207640_10000349 | Ga0207640_100003495 | 362 |
| 279 | 3300025986 | Ga0207658_10008242 | Ga0207658_100082425 | 362 |
| 280 | 3300026023 | Ga0207677_10024714 | Ga0207677_100247142 | 362 |
| 281 | 3300026035 | Ga0207703_10003797 | Ga0207703_100037974 | 362 |
| 282 | 3300026041 | Ga0207639_10000400 | Ga0207639_1000040025 | 362 |
| 283 | 3300026088 | Ga0207641_10032055 | Ga0207641_100320554 | 362 |
| 284 | 3300026118 | Ga0207675_100172796 | Ga0207675_1001727962 | 362 |
| 285 | 3300026142 | Ga0207698_10004747 | Ga0207698_100047474 | 362 |
| 286 | 3300039450 | Ga0436363_0178057 | Ga0436363_0178057_210_1406 | 362 |
| 287 | 3300053142 | Ga0500577_0014755 | Ga0500577_0014755_693_1952 | 362 |
| 288 | 3300005327 | Ga0070658_10003656 | Ga0070658_100036562 | 363 |
| 289 | 3300005336 | Ga0070680_100000502 | Ga0070680_1000005022 | 363 |
| 290 | 3300005563 | Ga0068855_100341644 | Ga0068855_1003416441 | 363 |
| 291 | 3300025904 | Ga0207647_10159653 | Ga0207647_101596532 | 363 |
| 292 | 3300025909 | Ga0207705_10000469 | Ga0207705_1000046924 | 363 |
| 293 | 3300025917 | Ga0207660_10002464 | Ga0207660_100024642 | 363 |
| 294 | 3300025919 | Ga0207657_10000864 | Ga0207657_1000086424 | 363 |
| 295 | 3300026067 | Ga0207678_10003861 | Ga0207678_100038612 | 363 |
| 296 | 3300032005 | Ga0307411_10118260 | Ga0307411_101182602 | 363 |
| 297 | 3300037312 | Ga0395899_0000352 | Ga0395899_0000352_32825_34045 | 363 |
| 298 | 3300037418 | Ga0395900_0001013 | Ga0395900_0001013_23479_24699 | 363 |
| 299 | 3300037466 | Ga0395898_0007714 | Ga0395898_0007714_905_2125 | 363 |
| 300 | 3300037471 | Ga0395905_0025207 | Ga0395905_0025207_419_1642 | 363 |
| 301 | 3300037471 | Ga0395905_0073194 | Ga0395905_0073194_1192_2415 | 363 |
| 302 | 3300038443 | Ga0395901_0000047 | Ga0395901_0000047_106344_107564 | 363 |
| 303 | 3300042007 | Ga0439449_0067989 | Ga0439449_0067989_30_1208 | 363 |
| 304 | 3300046691 | Ga0495670_0000005 | Ga0495670_0000005_229309_230541 | 363 |
| 305 | 3300002067 | JGI24735J21928_10015663 | JGI24735J21928_100156632 | 364 |
| 306 | 3300005331 | Ga0070670_100004056 | Ga0070670_1000040569 | 364 |
| 307 | 3300005335 | Ga0070666_10000898 | Ga0070666_1000089815 | 364 |
| 308 | 3300005344 | Ga0070661_100025521 | Ga0070661_1000255212 | 364 |
| 309 | 3300005364 | Ga0070673_100004714 | Ga0070673_1000047145 | 364 |
| 310 | 3300005367 | Ga0070667_100055587 | Ga0070667_1000555872 | 364 |
| 311 | 3300005548 | Ga0070665_100021367 | Ga0070665_1000213673 | 364 |
| 312 | 3300005564 | Ga0070664_100057160 | Ga0070664_1000571603 | 364 |
| 313 | 3300005618 | Ga0068864_100015386 | Ga0068864_1000153863 | 364 |
| 314 | 3300005841 | Ga0068863_100248900 | Ga0068863_1002489002 | 364 |
| 315 | 3300005842 | Ga0068858_100001092 | Ga0068858_10000109215 | 364 |
| 316 | 3300006358 | Ga0068871_100050877 | Ga0068871_1000508772 | 364 |
| 317 | 3300013296 | Ga0157374_10041526 | Ga0157374_100415262 | 364 |
| 318 | 3300013306 | Ga0163162_10052291 | Ga0163162_100522913 | 364 |
| 319 | 3300013308 | Ga0157375_10011928 | Ga0157375_100119285 | 364 |
| 320 | 3300014325 | Ga0163163_10000903 | Ga0163163_100009033 | 364 |
| 321 | 3300025903 | Ga0207680_10004744 | Ga0207680_100047443 | 364 |
| 322 | 3300025909 | Ga0207705_10034664 | Ga0207705_100346642 | 364 |
| 323 | 3300025909 | Ga0207705_10241449 | Ga0207705_102414492 | 364 |
| 324 | 3300025925 | Ga0207650_10029581 | Ga0207650_100295812 | 364 |
| 325 | 3300025931 | Ga0207644_10003165 | Ga0207644_100031657 | 364 |
| 326 | 3300025933 | Ga0207706_10017362 | Ga0207706_100173624 | 364 |
| 327 | 3300025940 | Ga0207691_10016302 | Ga0207691_100163023 | 364 |
| 328 | 3300026035 | Ga0207703_10021411 | Ga0207703_100214113 | 364 |
| 329 | 3300026095 | Ga0207676_10008960 | Ga0207676_100089604 | 364 |
| 330 | 3300026121 | Ga0207683_10033449 | Ga0207683_100334492 | 364 |
| 331 | 3300031901 | Ga0307406_10085323 | Ga0307406_100853232 | 364 |
| 332 | 3300031995 | Ga0307409_100190927 | Ga0307409_1001909272 | 364 |
| 333 | 3300032005 | Ga0307411_10010029 | Ga0307411_100100293 | 364 |
| 334 | 3300035111 | Ga0373923_0003840 | Ga0373923_0003840_756_1979 | 364 |
| 335 | 3300035120 | Ga0373957_0059298 | Ga0373957_0059298_126_1349 | 364 |
| 336 | 3300035724 | Ga0373933_0031231 | Ga0373933_0031231_733_1956 | 364 |
| 337 | 3300038443 | Ga0395901_0031102 | Ga0395901_0031102_1262_2461 | 364 |
| 338 | 3300048088 | Ga0495602_0035210 | Ga0495602_0035210_1924_3147 | 364 |
| 339 | 3300048904 | Ga0496101_0125751 | Ga0496101_0125751_59_1282 | 364 |
| 340 | 3300048911 | Ga0496108_0000634 | Ga0496108_0000634_22549_23772 | 364 |
| 341 | 3300048912 | Ga0496109_0051650 | Ga0496109_0051650_182_1405 | 364 |
| 342 | 3300048914 | Ga0496111_0154382 | Ga0496111_0154382_22_1245 | 364 |
| 343 | 3300048916 | Ga0496113_0006759 | Ga0496113_0006759_3686_4909 | 364 |
| 344 | 3300048917 | Ga0496114_0226548 | Ga0496114_0226548_335_1558 | 364 |
| 345 | 3300049515 | Ga0501292_000040 | Ga0501292_000040_7275_8492 | 364 |
| 346 | 3300049517 | Ga0501294_000062 | Ga0501294_000062_2870_4087 | 364 |
| 347 | 3300049663 | Ga0501223_000541 | Ga0501223_000541_3136_4353 | 364 |
| 348 | 3300049664 | Ga0501224_000457 | Ga0501224_000457_1222_2439 | 364 |
| 349 | 3300049665 | Ga0501227_003138 | Ga0501227_003138_1649_2866 | 364 |
| 350 | 3300049669 | Ga0501235_010333 | Ga0501235_010333_628_1845 | 364 |
| 351 | 3300049690 | Ga0501261_000079 | Ga0501261_000079_7640_8857 | 364 |
| 352 | 3300049705 | Ga0501225_0006238 | Ga0501225_0006238_1719_2936 | 364 |
| 353 | 3300049708 | Ga0501245_002056 | Ga0501245_002056_676_1893 | 364 |
| 354 | 3300049775 | Ga0501279_000008 | Ga0501279_000008_49172_50389 | 364 |
| 355 | 3300049776 | Ga0501280_000013 | Ga0501280_000013_56851_58068 | 364 |
| 356 | 3300049777 | Ga0501281_00139 | Ga0501281_00139_1575_2792 | 364 |
| 357 | 3300049778 | Ga0501282_000442 | Ga0501282_000442_1422_2639 | 364 |
| 358 | 3300049779 | Ga0501283_000845 | Ga0501283_000845_1097_2314 | 364 |
| 359 | 3300053136 | Ga0500559_0026779 | Ga0500559_0026779_592_1863 | 364 |
| 360 | 3300005435 | Ga0070714_100027909 | Ga0070714_1000279093 | 365 |
| 361 | 3300021388 | Ga0213875_10000234 | Ga0213875_100002342 | 365 |
| 362 | 3300025929 | Ga0207664_10272234 | Ga0207664_102722342 | 365 |
| 363 | 3300037312 | Ga0395899_0033670 | Ga0395899_0033670_2494_3717 | 365 |
| 364 | 3300037418 | Ga0395900_0010908 | Ga0395900_0010908_2564_3787 | 365 |
| 365 | 3300037418 | Ga0395900_0013797 | Ga0395900_0013797_5046_6269 | 365 |
| 366 | 3300037471 | Ga0395905_0010264 | Ga0395905_0010264_2630_3853 | 365 |
| 367 | 3300037471 | Ga0395905_0029740 | Ga0395905_0029740_1934_3157 | 365 |
| 368 | 3300037471 | Ga0395905_0072740 | Ga0395905_0072740_142_1365 | 365 |
| 369 | 3300037853 | Ga0436364_0154840 | Ga0436364_0154840_86084_87310 | 365 |
| 370 | 3300038443 | Ga0395901_0020559 | Ga0395901_0020559_1983_3206 | 365 |
| 371 | 3300038443 | Ga0395901_0132205 | Ga0395901_0132205_661_1884 | 365 |
| 372 | 3300047472 | Ga0495686_0068818 | Ga0495686_0068818_209_1432 | 365 |
| 373 | 3300053730 | Ga0500645_001004 | Ga0500645_001004_13415_14659 | 365 |
| 374 | 3300005339 | Ga0070660_100100455 | Ga0070660_1001004552 | 366 |
| 375 | 3300025949 | Ga0207667_10330939 | Ga0207667_103309391 | 366 |
| 376 | 3300047472 | Ga0495686_0009061 | Ga0495686_0009061_1926_3197 | 366 |
| 377 | 3300005293 | Ga0065715_10008999 | Ga0065715_100089993 | 367 |
| 378 | 3300005327 | Ga0070658_10077285 | Ga0070658_100772851 | 367 |
| 379 | 3300005328 | Ga0070676_10003620 | Ga0070676_100036205 | 367 |
| 380 | 3300005331 | Ga0070670_100018271 | Ga0070670_1000182713 | 367 |
| 381 | 3300005333 | Ga0070677_10002040 | Ga0070677_100020403 | 367 |
| 382 | 3300005343 | Ga0070687_100073225 | Ga0070687_1000732252 | 367 |
| 383 | 3300005347 | Ga0070668_100015715 | Ga0070668_1000157152 | 367 |
| 384 | 3300005354 | Ga0070675_100006584 | Ga0070675_1000065847 | 367 |
| 385 | 3300005355 | Ga0070671_100018224 | Ga0070671_1000182243 | 367 |
| 386 | 3300005356 | Ga0070674_100047053 | Ga0070674_1000470533 | 367 |
| 387 | 3300005367 | Ga0070667_100005946 | Ga0070667_1000059462 | 367 |
| 388 | 3300005441 | Ga0070700_100014401 | Ga0070700_1000144013 | 367 |
| 389 | 3300005455 | Ga0070663_100140958 | Ga0070663_1001409582 | 367 |
| 390 | 3300005457 | Ga0070662_100009277 | Ga0070662_1000092774 | 367 |
| 391 | 3300005459 | Ga0068867_100017881 | Ga0068867_1000178814 | 367 |
| 392 | 3300005543 | Ga0070672_100051011 | Ga0070672_1000510113 | 367 |
| 393 | 3300005564 | Ga0070664_100076166 | Ga0070664_1000761662 | 367 |
| 394 | 3300005577 | Ga0068857_100097806 | Ga0068857_1000978062 | 367 |
| 395 | 3300005617 | Ga0068859_100010054 | Ga0068859_1000100543 | 367 |
| 396 | 3300005719 | Ga0068861_100030379 | Ga0068861_1000303793 | 367 |
| 397 | 3300005840 | Ga0068870_10071223 | Ga0068870_100712232 | 367 |
| 398 | 3300005844 | Ga0068862_100157162 | Ga0068862_1001571622 | 367 |
| 399 | 3300006931 | Ga0097620_100010054 | Ga0097620_1000100547 | 367 |
| 400 | 3300009553 | Ga0105249_10024713 | Ga0105249_100247133 | 367 |
| 401 | 3300014326 | Ga0157380_10015116 | Ga0157380_100151163 | 367 |
| 402 | 3300025315 | Ga0207697_10005299 | Ga0207697_100052993 | 367 |
| 403 | 3300025893 | Ga0207682_10001243 | Ga0207682_100012435 | 367 |
| 404 | 3300025901 | Ga0207688_10061803 | Ga0207688_100618032 | 367 |
| 405 | 3300025907 | Ga0207645_10010987 | Ga0207645_100109872 | 367 |
| 406 | 3300025912 | Ga0207707_10085802 | Ga0207707_100858022 | 367 |
| 407 | 3300025923 | Ga0207681_10008670 | Ga0207681_100086703 | 367 |
| 408 | 3300025926 | Ga0207659_10002195 | Ga0207659_100021959 | 367 |
| 409 | 3300025931 | Ga0207644_10078156 | Ga0207644_100781562 | 367 |
| 410 | 3300025933 | Ga0207706_10001316 | Ga0207706_1000131616 | 367 |
| 411 | 3300025940 | Ga0207691_10001615 | Ga0207691_100016159 | 367 |
| 412 | 3300025972 | Ga0207668_10001189 | Ga0207668_1000118914 | 367 |
| 413 | 3300026067 | Ga0207678_10068658 | Ga0207678_100686582 | 367 |
| 414 | 3300026075 | Ga0207708_10025680 | Ga0207708_100256803 | 367 |
| 415 | 3300026089 | Ga0207648_10085821 | Ga0207648_100858212 | 367 |
| 416 | 3300026116 | Ga0207674_10121495 | Ga0207674_101214952 | 367 |
| 417 | 3300026118 | Ga0207675_100000049 | Ga0207675_10000004911 | 367 |
| 418 | 3300026118 | Ga0207675_100032909 | Ga0207675_1000329094 | 367 |
| 419 | 3300026121 | Ga0207683_10023514 | Ga0207683_100235142 | 367 |
| 420 | 3300005339 | Ga0070660_100000683 | Ga0070660_1000006831 | 368 |
| 421 | 3300005563 | Ga0068855_100001753 | Ga0068855_10000175316 | 368 |
| 422 | 3300013100 | Ga0157373_10062733 | Ga0157373_100627332 | 368 |
| 423 | 3300013104 | Ga0157370_10279277 | Ga0157370_102792772 | 368 |
| 424 | 3300025904 | Ga0207647_10042571 | Ga0207647_100425712 | 368 |
| 425 | 3300025909 | Ga0207705_10000135 | Ga0207705_1000013538 | 368 |
| 426 | 3300025919 | Ga0207657_10001741 | Ga0207657_100017412 | 368 |
| 427 | 3300025949 | Ga0207667_10000829 | Ga0207667_1000082940 | 368 |
| 428 | 3300031911 | Ga0307412_10059177 | Ga0307412_100591772 | 368 |
| 429 | 3300037471 | Ga0395905_0100192 | Ga0395905_0100192_1017_2237 | 368 |
| 430 | 3300038443 | Ga0395901_0132454 | Ga0395901_0132454_464_1684 | 368 |
| 431 | 3300046524 | Ga0495648_0043111 | Ga0495648_0043111_1213_2403 | 368 |
| 432 | iso_pu_bacteria | 2599185354 | 2600201593 | 368 |
| 433 | iso_pu_bacteria | 2751185897 | 2753763327 | 368 |
| 434 | iso_pu_bacteria | 2830075706 | 2830078324 | 368 |
| 435 | 3300046539 | Ga0495621_0000160 | Ga0495621_0000160_8559_9782 | 369 |
| 436 | 3300048911 | Ga0496108_0000529 | Ga0496108_0000529_20200_21423 | 369 |
| 437 | 3300048926 | Ga0496123_0016038 | Ga0496123_0016038_1734_2945 | 369 |
| 438 | 3300048927 | Ga0496124_0002196 | Ga0496124_0002196_1921_3132 | 369 |
| 439 | 3300048927 | Ga0496124_0244087 | Ga0496124_0244087_37_1248 | 369 |
| 440 | 3300005366 | Ga0070659_100145335 | Ga0070659_1001453352 | 370 |
| 441 | 3300005457 | Ga0070662_100000146 | Ga0070662_1000001462 | 370 |
| 442 | 3300005530 | Ga0070679_100105148 | Ga0070679_1001051481 | 370 |
| 443 | 3300005578 | Ga0068854_100024975 | Ga0068854_1000249753 | 370 |
| 444 | 3300009093 | Ga0105240_10001116 | Ga0105240_100011161 | 370 |
| 445 | 3300009093 | Ga0105240_10072698 | Ga0105240_100726983 | 370 |
| 446 | 3300009545 | Ga0105237_10001672 | Ga0105237_1000167222 | 370 |
| 447 | 3300010375 | Ga0105239_10002515 | Ga0105239_1000251518 | 370 |
| 448 | 3300013100 | Ga0157373_10034961 | Ga0157373_100349612 | 370 |
| 449 | 3300014326 | Ga0157380_10069720 | Ga0157380_100697202 | 370 |
| 450 | 3300025913 | Ga0207695_10000288 | Ga0207695_1000028871 | 370 |
| 451 | 3300025913 | Ga0207695_10126980 | Ga0207695_101269802 | 370 |
| 452 | 3300025914 | Ga0207671_10002961 | Ga0207671_1000296111 | 370 |
| 453 | 3300025924 | Ga0207694_10090515 | Ga0207694_100905152 | 370 |
| 454 | 3300025932 | Ga0207690_10065188 | Ga0207690_100651882 | 370 |
| 455 | 3300025933 | Ga0207706_10000461 | Ga0207706_1000046141 | 370 |
| 456 | 3300025981 | Ga0207640_10007638 | Ga0207640_100076383 | 370 |
| 457 | 3300048920 | Ga0496117_0089906 | Ga0496117_0089906_750_1961 | 370 |
| 458 | 3300048921 | Ga0496118_0035080 | Ga0496118_0035080_1738_2949 | 370 |
| 459 | 3300048921 | Ga0496118_0067799 | Ga0496118_0067799_797_2008 | 370 |
| 460 | 3300048924 | Ga0496121_0006365 | Ga0496121_0006365_1369_2580 | 370 |
| 461 | 3300048924 | Ga0496121_0045897 | Ga0496121_0045897_891_2102 | 370 |
| 462 | 3300048929 | Ga0496126_0006832 | Ga0496126_0006832_10044_11255 | 370 |
| 463 | 3300049652 | Ga0501202_004956 | Ga0501202_004956_192_1400 | 370 |
| 464 | 3300053096 | Ga0500641_0023393 | Ga0500641_0023393_105_1328 | 370 |
| 465 | 3300005331 | Ga0070670_100007601 | Ga0070670_1000076015 | 371 |
| 466 | 3300005843 | Ga0068860_100037032 | Ga0068860_1000370323 | 371 |
| 467 | 3300025924 | Ga0207694_10105904 | Ga0207694_101059042 | 371 |
| 468 | 3300028381 | Ga0268264_10032566 | Ga0268264_100325663 | 371 |
| 469 | 3300031731 | Ga0307405_10038268 | Ga0307405_100382682 | 371 |
| 470 | 3300031995 | Ga0307409_100090402 | Ga0307409_1000904022 | 371 |
| 471 | 3300032002 | Ga0307416_100017660 | Ga0307416_1000176602 | 371 |
| 472 | 3300032004 | Ga0307414_10144718 | Ga0307414_101447182 | 371 |
| 473 | 3300046460 | Ga0495638_0000689 | Ga0495638_0000689_30869_32092 | 371 |
| 474 | 3300053096 | Ga0500641_0024501 | Ga0500641_0024501_290_1543 | 371 |
| 475 | 3300053134 | Ga0500658_0003056 | Ga0500658_0003056_3517_4740 | 371 |
| 476 | iso_pu_bacteria | 2928027323 | 2928029681 | 371 |
| 477 | iso_pu_bacteria | 2984555340 | 2984555684 | 371 |
| 478 | iso_pu_bacteria | 2984564862 | 2984566204 | 371 |
| 479 | iso_pu_bacteria | 2993356040 | 2993357218 | 371 |
| 480 | iso_pu_bacteria | 8057101203 | 8057102093 | 371 |
| 481 | 3300005578 | Ga0068854_100002725 | Ga0068854_1000027253 | 372 |
| 482 | 3300005617 | Ga0068859_100024321 | Ga0068859_1000243215 | 372 |
| 483 | 3300005841 | Ga0068863_100018322 | Ga0068863_1000183225 | 372 |
| 484 | 3300006931 | Ga0097620_100024321 | Ga0097620_1000243215 | 372 |
| 485 | 3300009177 | Ga0105248_10160457 | Ga0105248_101604572 | 372 |
| 486 | 3300025942 | Ga0207689_10115344 | Ga0207689_101153442 | 372 |
| 487 | 3300025981 | Ga0207640_10008252 | Ga0207640_100082522 | 372 |
| 488 | 3300026041 | Ga0207639_10067999 | Ga0207639_100679991 | 372 |
| 489 | 3300026041 | Ga0207639_10070086 | Ga0207639_100700862 | 372 |
| 490 | 3300026088 | Ga0207641_10026594 | Ga0207641_100265944 | 372 |
| 491 | 3300026095 | Ga0207676_10004634 | Ga0207676_100046349 | 372 |
| 492 | 3300026116 | Ga0207674_10002496 | Ga0207674_1000249612 | 372 |
| 493 | 3300047472 | Ga0495686_0000363 | Ga0495686_0000363_11926_13143 | 372 |
| 494 | 3300048929 | Ga0496126_0071545 | Ga0496126_0071545_396_1592 | 372 |
| 495 | 3300053087 | Ga0500643_000066 | Ga0500643_000066_118002_119219 | 372 |
| 496 | 3300053120 | Ga0500597_003737 | Ga0500597_003737_1647_2837 | 372 |
| 497 | 3300053157 | Ga0500624_000074 | Ga0500624_000074_42133_43323 | 372 |
| 498 | 3300053178 | Ga0500637_0000261 | Ga0500637_0000261_11717_12907 | 372 |
| 499 | iso_pu_bacteria | 2599185359 | 2600227860 | 372 |
| 500 | iso_pu_bacteria | 2643221622 | 2644127240 | 372 |
| 501 | iso_pu_bacteria | 2818991466 | 2819714296 | 372 |
| 502 | iso_pu_bacteria | 2879163058 | 2879166415 | 372 |
| 503 | iso_pu_bacteria | 2928526807 | 2928530513 | 372 |
| 504 | iso_pu_bacteria | 2928968154 | 2928968310 | 372 |
| 505 | 3300003781 | Ga0055536_1001201 | Ga0055536_10012014 | 373 |
| 506 | 3300005366 | Ga0070659_100092990 | Ga0070659_1000929902 | 373 |
| 507 | 3300005544 | Ga0070686_100000123 | Ga0070686_1000001237 | 373 |
| 508 | 3300048905 | Ga0496102_0000034 | Ga0496102_0000034_62465_63679 | 373 |
| 509 | 3300048906 | Ga0496103_0000026 | Ga0496103_0000026_62465_63679 | 373 |
| 510 | 3300048907 | Ga0496104_0199707 | Ga0496104_0199707_156_1370 | 373 |
| 511 | 3300048919 | Ga0496116_0000926 | Ga0496116_0000926_16942_18156 | 373 |
| 512 | 3300048920 | Ga0496117_0000072 | Ga0496117_0000072_87005_88219 | 373 |
| 513 | 3300048921 | Ga0496118_0000030 | Ga0496118_0000030_150148_151362 | 373 |
| 514 | 3300048922 | Ga0496119_0020782 | Ga0496119_0020782_2968_4182 | 373 |
| 515 | 3300048927 | Ga0496124_0000061 | Ga0496124_0000061_150148_151362 | 373 |
| 516 | 3300005327 | Ga0070658_10000040 | Ga0070658_1000004068 | 374 |
| 517 | 3300005339 | Ga0070660_100003760 | Ga0070660_1000037607 | 374 |
| 518 | 3300005339 | Ga0070660_100011627 | Ga0070660_1000116273 | 374 |
| 519 | 3300005344 | Ga0070661_100000263 | Ga0070661_10000026322 | 374 |
| 520 | 3300005345 | Ga0070692_10000983 | Ga0070692_100009834 | 374 |
| 521 | 3300005366 | Ga0070659_100009330 | Ga0070659_1000093306 | 374 |
| 522 | 3300005530 | Ga0070679_100000031 | Ga0070679_10000003123 | 374 |
| 523 | 3300009177 | Ga0105248_10084789 | Ga0105248_100847892 | 374 |
| 524 | 3300020082 | Ga0206353_11456103 | Ga0206353_114561032 | 374 |
| 525 | 3300021358 | Ga0213873_10000039 | Ga0213873_1000003913 | 374 |
| 526 | 3300021384 | Ga0213876_10000455 | Ga0213876_1000045513 | 374 |
| 527 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002206 | 374 |
| 528 | 3300025919 | Ga0207657_10002044 | Ga0207657_1000204415 | 374 |
| 529 | 3300025919 | Ga0207657_10023704 | Ga0207657_100237045 | 374 |
| 530 | 3300025920 | Ga0207649_10000323 | Ga0207649_1000032317 | 374 |
| 531 | 3300025921 | Ga0207652_10000003 | Ga0207652_10000003382 | 374 |
| 532 | 3300025923 | Ga0207681_10073190 | Ga0207681_100731902 | 374 |
| 533 | 3300025932 | Ga0207690_10010280 | Ga0207690_100102802 | 374 |
| 534 | 3300031456 | Ga0307513_10076661 | Ga0307513_100766612 | 374 |
| 535 | 3300038705 | Ga0237819_00349 | Ga0237819_00349_15378_16577 | 374 |
| 536 | 3300039437 | Ga0436365_0168572 | Ga0436365_0168572_399_1592 | 374 |
| 537 | 3300039437 | Ga0436365_0328398 | Ga0436365_0328398_8262_9455 | 374 |
| 538 | 3300039437 | Ga0436365_0563507 | Ga0436365_0563507_4442_5638 | 374 |
| 539 | 3300039453 | Ga0436362_1186234 | Ga0436362_1186234_12765_13958 | 374 |
| 540 | 3300044735 | Ga0466968_0014273 | Ga0466968_0014273_540_1763 | 374 |
| 541 | 3300048920 | Ga0496117_0024330 | Ga0496117_0024330_1744_2964 | 374 |
| 542 | 3300048921 | Ga0496118_0032325 | Ga0496118_0032325_1790_3010 | 374 |
| 543 | 3300048922 | Ga0496119_0018557 | Ga0496119_0018557_2576_3799 | 374 |
| 544 | 3300049570 | Ga0501033_0073568 | Ga0501033_0073568_1151_2374 | 374 |
| 545 | 3300049579 | Ga0501043_0078505 | Ga0501043_0078505_1350_2573 | 374 |
| 546 | 3300053116 | Ga0500592_000093 | Ga0500592_000093_11793_13010 | 374 |
| 547 | 3300053151 | Ga0500604_0013841 | Ga0500604_0013841_198_1415 | 374 |
| 548 | 3300053158 | Ga0500627_0000117 | Ga0500627_0000117_7245_8462 | 374 |
| 549 | 3300003771 | Ga0055526_1007222 | Ga0055526_10072223 | 375 |
| 550 | 3300003773 | Ga0055537_1004287 | Ga0055537_10042873 | 375 |
| 551 | 3300003784 | Ga0055534_1012319 | Ga0055534_10123191 | 375 |
| 552 | 3300003791 | Ga0055530_10000137 | Ga0055530_1000013723 | 375 |
| 553 | 3300003791 | Ga0055530_10000194 | Ga0055530_1000019445 | 375 |
| 554 | 3300003791 | Ga0055530_10000247 | Ga0055530_1000024710 | 375 |
| 555 | 3300003794 | Ga0055531_10000019 | Ga0055531_10000019100 | 375 |
| 556 | 3300003794 | Ga0055531_10001510 | Ga0055531_100015108 | 375 |
| 557 | 3300005347 | Ga0070668_100006040 | Ga0070668_1000060402 | 375 |
| 558 | 3300005367 | Ga0070667_100061414 | Ga0070667_1000614142 | 375 |
| 559 | 3300005841 | Ga0068863_100005038 | Ga0068863_10000503811 | 375 |
| 560 | 3300005843 | Ga0068860_100001312 | Ga0068860_10000131223 | 375 |
| 561 | 3300005844 | Ga0068862_100000481 | Ga0068862_10000048121 | 375 |
| 562 | 3300005844 | Ga0068862_100029293 | Ga0068862_1000292932 | 375 |
| 563 | 3300009098 | Ga0105245_10025229 | Ga0105245_100252295 | 375 |
| 564 | 3300025263 | Ga0209565_1000135 | Ga0209565_100013542 | 375 |
| 565 | 3300025291 | Ga0209675_1000421 | Ga0209675_100042123 | 375 |
| 566 | 3300025292 | Ga0209676_1000211 | Ga0209676_100021187 | 375 |
| 567 | 3300025294 | Ga0209025_1002199 | Ga0209025_10021998 | 375 |
| 568 | 3300025295 | Ga0209564_1007082 | Ga0209564_10070823 | 375 |
| 569 | 3300025298 | Ga0209050_1000010 | Ga0209050_1000010100 | 375 |
| 570 | 3300025298 | Ga0209050_1000047 | Ga0209050_1000047272 | 375 |
| 571 | 3300025304 | Ga0209257_1000009 | Ga0209257_10000091016 | 375 |
| 572 | 3300025304 | Ga0209257_1000076 | Ga0209257_1000076228 | 375 |
| 573 | 3300025900 | Ga0207710_10041353 | Ga0207710_100413532 | 375 |
| 574 | 3300025972 | Ga0207668_10001788 | Ga0207668_100017882 | 375 |
| 575 | 3300026088 | Ga0207641_10003899 | Ga0207641_100038992 | 375 |
| 576 | 3300028380 | Ga0268265_10000309 | Ga0268265_1000030928 | 375 |
| 577 | 3300028381 | Ga0268264_10001117 | Ga0268264_1000111723 | 375 |
| 578 | 3300031903 | Ga0307407_10025234 | Ga0307407_100252343 | 375 |
| 579 | 3300031911 | Ga0307412_10042123 | Ga0307412_100421232 | 375 |
| 580 | 3300032005 | Ga0307411_10068249 | Ga0307411_100682492 | 375 |
| 581 | 3300041410 | Ga0439461_0000726 | Ga0439461_0000726_2040_3266 | 375 |
| 582 | 3300041413 | Ga0439465_0011633 | Ga0439465_0011633_593_1819 | 375 |
| 583 | 3300042006 | Ga0439432_000890 | Ga0439432_000890_1752_2978 | 375 |
| 584 | 3300042435 | Ga0439434_0013839 | Ga0439434_0013839_763_1989 | 375 |
| 585 | 3300049663 | Ga0501223_008904 | Ga0501223_008904_533_1750 | 375 |
| 586 | 3300049686 | Ga0501257_000053 | Ga0501257_000053_7435_8652 | 375 |
| 587 | 3300049776 | Ga0501280_004421 | Ga0501280_004421_162_1379 | 375 |
| 588 | 3300053119 | Ga0500595_002272 | Ga0500595_002272_6797_8035 | 375 |
| 589 | 3300053139 | Ga0500568_0001671 | Ga0500568_0001671_3695_4912 | 375 |
| 590 | iso_pu_bacteria | 2643221563 | 2643833708 | 375 |
| 591 | iso_pu_bacteria | 2643221608 | 2644054634 | 375 |
| 592 | iso_pu_bacteria | 2990265787 | 2990268781 | 375 |
| 593 | iso_pu_bacteria | 2993693658 | 2993694512 | 375 |
| 594 | 3300005289 | Ga0065704_10125038 | Ga0065704_101250382 | 376 |
| 595 | 3300005331 | Ga0070670_100000572 | Ga0070670_1000005724 | 376 |
| 596 | 3300005367 | Ga0070667_100000134 | Ga0070667_10000013420 | 376 |
| 597 | 3300005577 | Ga0068857_100030817 | Ga0068857_1000308174 | 376 |
| 598 | 3300005577 | Ga0068857_100328496 | Ga0068857_1003284961 | 376 |
| 599 | 3300005617 | Ga0068859_100005050 | Ga0068859_1000050506 | 376 |
| 600 | 3300005617 | Ga0068859_100079584 | Ga0068859_1000795842 | 376 |
| 601 | 3300005618 | Ga0068864_100000089 | Ga0068864_10000008974 | 376 |
| 602 | 3300005841 | Ga0068863_100000084 | Ga0068863_10000008474 | 376 |
| 603 | 3300005844 | Ga0068862_100000112 | Ga0068862_10000011226 | 376 |
| 604 | 3300006931 | Ga0097620_100005050 | Ga0097620_1000050506 | 376 |
| 605 | 3300006931 | Ga0097620_100079583 | Ga0097620_1000795833 | 376 |
| 606 | 3300009177 | Ga0105248_10003487 | Ga0105248_100034876 | 376 |
| 607 | 3300009551 | Ga0105238_10021758 | Ga0105238_100217584 | 376 |
| 608 | 3300014326 | Ga0157380_10332539 | Ga0157380_103325392 | 376 |
| 609 | 3300014968 | Ga0157379_10195288 | Ga0157379_101952881 | 376 |
| 610 | 3300025735 | Ga0207713_1005138 | Ga0207713_10051386 | 376 |
| 611 | 3300025925 | Ga0207650_10004105 | Ga0207650_100041054 | 376 |
| 612 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004730 | 376 |
| 613 | 3300025941 | Ga0207711_10005875 | Ga0207711_100058752 | 376 |
| 614 | 3300025961 | Ga0207712_10000324 | Ga0207712_1000032426 | 376 |
| 615 | 3300025986 | Ga0207658_10000711 | Ga0207658_1000071128 | 376 |
| 616 | 3300026088 | Ga0207641_10000010 | Ga0207641_10000010375 | 376 |
| 617 | 3300026095 | Ga0207676_10000051 | Ga0207676_1000005126 | 376 |
| 618 | 3300026095 | Ga0207676_10219809 | Ga0207676_102198092 | 376 |
| 619 | 3300028380 | Ga0268265_10000026 | Ga0268265_1000002626 | 376 |
| 620 | 3300031548 | Ga0307408_100136920 | Ga0307408_1001369202 | 376 |
| 621 | 3300031852 | Ga0307410_10197254 | Ga0307410_101972541 | 376 |
| 622 | 3300031901 | Ga0307406_10067160 | Ga0307406_100671602 | 376 |
| 623 | 3300031901 | Ga0307406_10119703 | Ga0307406_101197032 | 376 |
| 624 | 3300031903 | Ga0307407_10097785 | Ga0307407_100977852 | 376 |
| 625 | 3300032005 | Ga0307411_10163783 | Ga0307411_101637832 | 376 |
| 626 | 3300041413 | Ga0439465_0017815 | Ga0439465_0017815_727_1956 | 376 |
| 627 | 3300042014 | Ga0439457_008051 | Ga0439457_008051_748_1977 | 376 |
| 628 | 3300048927 | Ga0496124_0000328 | Ga0496124_0000328_60639_61871 | 376 |
| 629 | 3300053116 | Ga0500592_001148 | Ga0500592_001148_892_2109 | 376 |
| 630 | 3300053158 | Ga0500627_0000010 | Ga0500627_0000010_53304_54521 | 376 |
| 631 | 3300001915 | JGI24741J21665_1010756 | JGI24741J21665_10107562 | 377 |
| 632 | 3300005471 | Ga0070698_100117424 | Ga0070698_1001174242 | 377 |
| 633 | 3300005548 | Ga0070665_100001478 | Ga0070665_1000014784 | 377 |
| 634 | 3300005985 | Ga0081539_10004462 | Ga0081539_100044623 | 377 |
| 635 | 3300006847 | Ga0075431_100050690 | Ga0075431_1000506902 | 377 |
| 636 | 3300009101 | Ga0105247_10013962 | Ga0105247_100139624 | 377 |
| 637 | 3300009553 | Ga0105249_10000240 | Ga0105249_1000024041 | 377 |
| 638 | 3300028379 | Ga0268266_10000875 | Ga0268266_1000087538 | 377 |
| 639 | 3300031852 | Ga0307410_10006628 | Ga0307410_100066285 | 377 |
| 640 | 3300031852 | Ga0307410_10010799 | Ga0307410_100107992 | 377 |
| 641 | 3300032004 | Ga0307414_10024308 | Ga0307414_100243083 | 377 |
| 642 | 3300032005 | Ga0307411_10029816 | Ga0307411_100298162 | 377 |
| 643 | 3300035170 | Ga0373943_0004396 | Ga0373943_0004396_4973_6217 | 377 |
| 644 | 3300045976 | Ga0466967_0183055 | Ga0466967_0183055_505_1728 | 377 |
| 645 | 3300048918 | Ga0496115_0000711 | Ga0496115_0000711_3667_4896 | 377 |
| 646 | 3300049581 | Ga0501047_0065045 | Ga0501047_0065045_1879_3096 | 377 |
| 647 | 3300050510 | nmdc:mga06r32_4589_c1 | nmdc:mga06r32_4589_c1_9555_10778 | 377 |
| 648 | iso_pu_bacteria | 2643221605 | 2644038854 | 377 |
| 649 | iso_pu_bacteria | 2946787523 | 2946787784 | 377 |
| 650 | 3300005327 | Ga0070658_10021593 | Ga0070658_100215933 | 378 |
| 651 | 3300025254 | Ga0209148_1001774 | Ga0209148_10017744 | 378 |
| 652 | 3300025272 | Ga0209455_1002190 | Ga0209455_10021902 | 378 |
| 653 | 3300025909 | Ga0207705_10015135 | Ga0207705_100151352 | 378 |
| 654 | 3300032004 | Ga0307414_10005141 | Ga0307414_100051412 | 378 |
| 655 | 3300046660 | Ga0495625_0000740 | Ga0495625_0000740_21291_22511 | 378 |
| 656 | 3300053087 | Ga0500643_000766 | Ga0500643_000766_17988_19208 | 378 |
| 657 | 3300053139 | Ga0500568_0004177 | Ga0500568_0004177_1715_2929 | 378 |
| 658 | 3300053151 | Ga0500604_0000240 | Ga0500604_0000240_7086_8300 | 378 |
| 659 | 3300053153 | Ga0500616_0001040 | Ga0500616_0001040_7589_8803 | 378 |
| 660 | iso_pu_bacteria | 2643221541 | 2643728177 | 378 |
| 661 | iso_pu_bacteria | 2643221606 | 2644042874 | 378 |
| 662 | iso_pu_bacteria | 2643221671 | 2644395695 | 378 |
| 663 | 3300003781 | Ga0055536_1000505 | Ga0055536_100050522 | 379 |
| 664 | 3300025292 | Ga0209676_1000045 | Ga0209676_1000045163 | 379 |
| 665 | 3300025298 | Ga0209050_1011536 | Ga0209050_10115363 | 379 |
| 666 | 3300031911 | Ga0307412_10007500 | Ga0307412_100075003 | 379 |
| 667 | 3300046524 | Ga0495648_0035561 | Ga0495648_0035561_842_2047 | 379 |
| 668 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_27573_28793 | 379 |
| 669 | 3300048914 | Ga0496111_0090443 | Ga0496111_0090443_387_1640 | 379 |
| 670 | 3300048925 | Ga0496122_0002487 | Ga0496122_0002487_16376_17629 | 379 |
| 671 | 3300048926 | Ga0496123_0001967 | Ga0496123_0001967_11660_12913 | 379 |
| 672 | 3300048927 | Ga0496124_0008089 | Ga0496124_0008089_8608_9861 | 379 |
| 673 | 3300053153 | Ga0500616_0008125 | Ga0500616_0008125_4064_5332 | 379 |
| 674 | iso_pu_bacteria | 2582581305 | 2585261245 | 379 |
| 675 | 3300001904 | JGI24736J21556_1006408 | JGI24736J21556_10064082 | 380 |
| 676 | 3300002067 | JGI24735J21928_10005978 | JGI24735J21928_100059783 | 380 |
| 677 | 3300002067 | JGI24735J21928_10026926 | JGI24735J21928_100269262 | 380 |
| 678 | 3300002067 | JGI24735J21928_10031245 | JGI24735J21928_100312452 | 380 |
| 679 | 3300002075 | JGI24738J21930_10009749 | JGI24738J21930_100097492 | 380 |
| 680 | 3300002075 | JGI24738J21930_10012967 | JGI24738J21930_100129672 | 380 |
| 681 | 3300002077 | JGI24744J21845_10002873 | JGI24744J21845_100028732 | 380 |
| 682 | 3300003214 | JGI25165J46597_1000023 | JGI25165J46597_1000023163 | 380 |
| 683 | 3300003794 | Ga0055531_10001071 | Ga0055531_100010716 | 380 |
| 684 | 3300005327 | Ga0070658_10000885 | Ga0070658_1000088517 | 380 |
| 685 | 3300005328 | Ga0070676_10000147 | Ga0070676_1000014724 | 380 |
| 686 | 3300005334 | Ga0068869_100000307 | Ga0068869_10000030720 | 380 |
| 687 | 3300005338 | Ga0068868_100000215 | Ga0068868_10000021539 | 380 |
| 688 | 3300005339 | Ga0070660_100001804 | Ga0070660_1000018046 | 380 |
| 689 | 3300005347 | Ga0070668_100000071 | Ga0070668_10000007145 | 380 |
| 690 | 3300005355 | Ga0070671_100000328 | Ga0070671_10000032831 | 380 |
| 691 | 3300005356 | Ga0070674_100229464 | Ga0070674_1002294641 | 380 |
| 692 | 3300005364 | Ga0070673_100000019 | Ga0070673_10000001970 | 380 |
| 693 | 3300005367 | Ga0070667_100000036 | Ga0070667_100000036128 | 380 |
| 694 | 3300005456 | Ga0070678_100022523 | Ga0070678_1000225232 | 380 |
| 695 | 3300005459 | Ga0068867_100000014 | Ga0068867_10000001474 | 380 |
| 696 | 3300005539 | Ga0068853_100282020 | Ga0068853_1002820201 | 380 |
| 697 | 3300005548 | Ga0070665_100038505 | Ga0070665_1000385052 | 380 |
| 698 | 3300005563 | Ga0068855_100006658 | Ga0068855_1000066585 | 380 |
| 699 | 3300005563 | Ga0068855_100131853 | Ga0068855_1001318532 | 380 |
| 700 | 3300005577 | Ga0068857_100030331 | Ga0068857_1000303312 | 380 |
| 701 | 3300005578 | Ga0068854_100002754 | Ga0068854_1000027541 | 380 |
| 702 | 3300005616 | Ga0068852_100000314 | Ga0068852_10000031418 | 380 |
| 703 | 3300005617 | Ga0068859_100030665 | Ga0068859_1000306654 | 380 |
| 704 | 3300005841 | Ga0068863_100000154 | Ga0068863_10000015446 | 380 |
| 705 | 3300005841 | Ga0068863_100003453 | Ga0068863_1000034536 | 380 |
| 706 | 3300005843 | Ga0068860_100000063 | Ga0068860_10000006337 | 380 |
| 707 | 3300005844 | Ga0068862_100075098 | Ga0068862_1000750982 | 380 |
| 708 | 3300006881 | Ga0068865_100000018 | Ga0068865_10000001845 | 380 |
| 709 | 3300006931 | Ga0097620_100030665 | Ga0097620_1000306654 | 380 |
| 710 | 3300009098 | Ga0105245_10000659 | Ga0105245_1000065921 | 380 |
| 711 | 3300009148 | Ga0105243_10000076 | Ga0105243_1000007654 | 380 |
| 712 | 3300009176 | Ga0105242_10000458 | Ga0105242_1000045833 | 380 |
| 713 | 3300009553 | Ga0105249_10056416 | Ga0105249_100564163 | 380 |
| 714 | 3300011119 | Ga0105246_10000637 | Ga0105246_1000063716 | 380 |
| 715 | 3300013104 | Ga0157370_10001841 | Ga0157370_100018412 | 380 |
| 716 | 3300013105 | Ga0157369_10060224 | Ga0157369_100602242 | 380 |
| 717 | 3300013105 | Ga0157369_10320525 | Ga0157369_103205252 | 380 |
| 718 | 3300013296 | Ga0157374_10000951 | Ga0157374_1000095115 | 380 |
| 719 | 3300013297 | Ga0157378_10001247 | Ga0157378_1000124711 | 380 |
| 720 | 3300013307 | Ga0157372_10018056 | Ga0157372_100180562 | 380 |
| 721 | 3300013307 | Ga0157372_10112067 | Ga0157372_101120672 | 380 |
| 722 | 3300013308 | Ga0157375_10001111 | Ga0157375_1000111121 | 380 |
| 723 | 3300025231 | Ga0207427_101716 | Ga0207427_1017162 | 380 |
| 724 | 3300025250 | Ga0209026_1001365 | Ga0209026_10013658 | 380 |
| 725 | 3300025254 | Ga0209148_1000243 | Ga0209148_100024334 | 380 |
| 726 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031002 | 380 |
| 727 | 3300025304 | Ga0209257_1000156 | Ga0209257_100015696 | 380 |
| 728 | 3300025904 | Ga0207647_10004952 | Ga0207647_100049528 | 380 |
| 729 | 3300025904 | Ga0207647_10014553 | Ga0207647_100145533 | 380 |
| 730 | 3300025907 | Ga0207645_10002499 | Ga0207645_100024998 | 380 |
| 731 | 3300025909 | Ga0207705_10000084 | Ga0207705_1000008477 | 380 |
| 732 | 3300025909 | Ga0207705_10001039 | Ga0207705_100010394 | 380 |
| 733 | 3300025913 | Ga0207695_10024963 | Ga0207695_100249635 | 380 |
| 734 | 3300025919 | Ga0207657_10001930 | Ga0207657_100019304 | 380 |
| 735 | 3300025919 | Ga0207657_10004854 | Ga0207657_100048548 | 380 |
| 736 | 3300025931 | Ga0207644_10000156 | Ga0207644_1000015619 | 380 |
| 737 | 3300025933 | Ga0207706_10075509 | Ga0207706_100755092 | 380 |
| 738 | 3300025934 | Ga0207686_10000518 | Ga0207686_1000051810 | 380 |
| 739 | 3300025935 | Ga0207709_10000114 | Ga0207709_1000011471 | 380 |
| 740 | 3300025938 | Ga0207704_10000008 | Ga0207704_1000000871 | 380 |
| 741 | 3300025940 | Ga0207691_10024681 | Ga0207691_100246813 | 380 |
| 742 | 3300025942 | Ga0207689_10000086 | Ga0207689_100000867 | 380 |
| 743 | 3300025949 | Ga0207667_10000024 | Ga0207667_10000024298 | 380 |
| 744 | 3300025949 | Ga0207667_10148485 | Ga0207667_101484852 | 380 |
| 745 | 3300025960 | Ga0207651_10000008 | Ga0207651_10000008153 | 380 |
| 746 | 3300025961 | Ga0207712_10017468 | Ga0207712_100174683 | 380 |
| 747 | 3300025972 | Ga0207668_10000039 | Ga0207668_1000003930 | 380 |
| 748 | 3300025981 | Ga0207640_10000229 | Ga0207640_1000022917 | 380 |
| 749 | 3300025986 | Ga0207658_10000083 | Ga0207658_1000008372 | 380 |
| 750 | 3300026023 | Ga0207677_10000321 | Ga0207677_1000032126 | 380 |
| 751 | 3300026041 | Ga0207639_10025867 | Ga0207639_100258673 | 380 |
| 752 | 3300026067 | Ga0207678_10036208 | Ga0207678_100362083 | 380 |
| 753 | 3300026067 | Ga0207678_10080609 | Ga0207678_100806092 | 380 |
| 754 | 3300026078 | Ga0207702_10058852 | Ga0207702_100588523 | 380 |
| 755 | 3300026088 | Ga0207641_10000001 | Ga0207641_100000011209 | 380 |
| 756 | 3300026088 | Ga0207641_10000477 | Ga0207641_1000047725 | 380 |
| 757 | 3300026089 | Ga0207648_10000009 | Ga0207648_10000009153 | 380 |
| 758 | 3300026116 | Ga0207674_10012789 | Ga0207674_100127897 | 380 |
| 759 | 3300026116 | Ga0207674_10016393 | Ga0207674_100163932 | 380 |
| 760 | 3300026121 | Ga0207683_10049118 | Ga0207683_100491183 | 380 |
| 761 | 3300028381 | Ga0268264_10000083 | Ga0268264_1000008392 | 380 |
| 762 | 3300028381 | Ga0268264_10046983 | Ga0268264_100469832 | 380 |
| 763 | 3300032004 | Ga0307414_10000282 | Ga0307414_100002829 | 380 |
| 764 | 3300037312 | Ga0395899_0011391 | Ga0395899_0011391_4420_5676 | 380 |
| 765 | 3300037418 | Ga0395900_0040109 | Ga0395900_0040109_2403_3659 | 380 |
| 766 | 3300037418 | Ga0395900_0378945 | Ga0395900_0378945_25_1278 | 380 |
| 767 | 3300037471 | Ga0395905_0340424 | Ga0395905_0340424_47_1303 | 380 |
| 768 | 3300038443 | Ga0395901_0245337 | Ga0395901_0245337_129_1385 | 380 |
| 769 | 3300042005 | Ga0439448_0009079 | Ga0439448_0009079_34_1278 | 380 |
| 770 | 3300042012 | Ga0439455_0006607 | Ga0439455_0006607_1104_2360 | 380 |
| 771 | 3300042157 | Ga0439458_0000132 | Ga0439458_0000132_5656_6912 | 380 |
| 772 | 3300044658 | Ga0466972_0002734 | Ga0466972_0002734_4597_5850 | 380 |
| 773 | 3300044659 | Ga0466973_0060404 | Ga0466973_0060404_524_1741 | 380 |
| 774 | 3300044684 | Ga0466966_0039103 | Ga0466966_0039103_912_2165 | 380 |
| 775 | 3300044694 | Ga0466963_0000618 | Ga0466963_0000618_3999_5252 | 380 |
| 776 | 3300044719 | Ga0466971_0006686 | Ga0466971_0006686_2104_3357 | 380 |
| 777 | 3300047472 | Ga0495686_0026459 | Ga0495686_0026459_652_1923 | 380 |
| 778 | 3300048920 | Ga0496117_0025509 | Ga0496117_0025509_2075_3331 | 380 |
| 779 | 3300048924 | Ga0496121_0038748 | Ga0496121_0038748_1188_2438 | 380 |
| 780 | 3300048924 | Ga0496121_0154125 | Ga0496121_0154125_254_1510 | 380 |
| 781 | 3300048926 | Ga0496123_0039606 | Ga0496123_0039606_1103_2359 | 380 |
| 782 | 3300049570 | Ga0501033_0017961 | Ga0501033_0017961_2204_3499 | 380 |
| 783 | 3300049573 | Ga0501037_0031601 | Ga0501037_0031601_2003_3298 | 380 |
| 784 | 3300049574 | Ga0501038_0179252 | Ga0501038_0179252_90_1385 | 380 |
| 785 | 3300049575 | Ga0501039_0013849 | Ga0501039_0013849_1188_2483 | 380 |
| 786 | 3300049579 | Ga0501043_0014561 | Ga0501043_0014561_839_2056 | 380 |
| 787 | 3300049580 | Ga0501046_0083082 | Ga0501046_0083082_831_2126 | 380 |
| 788 | 3300049581 | Ga0501047_0000938 | Ga0501047_0000938_24164_25381 | 380 |
| 789 | 3300049822 | Ga0501035_0040305 | Ga0501035_0040305_854_2149 | 380 |
| 790 | 3300049823 | Ga0501044_0080878 | Ga0501044_0080878_1471_2688 | 380 |
| 791 | 3300049823 | Ga0501044_0220053 | Ga0501044_0220053_465_1712 | 380 |
| 792 | 3300053087 | Ga0500643_017880 | Ga0500643_017880_733_2001 | 380 |
| 793 | 3300061719 | Ga0466962_0000478 | Ga0466962_0000478_3005_4258 | 380 |
| 794 | iso_pu_bacteria | 2852653556 | 2852657382 | 380 |
| 795 | 3300001989 | JGI24739J22299_10001503 | JGI24739J22299_100015037 | 381 |
| 796 | 3300002067 | JGI24735J21928_10001172 | JGI24735J21928_100011727 | 381 |
| 797 | 3300002076 | JGI24749J21850_1000015 | JGI24749J21850_100001510 | 381 |
| 798 | 3300002459 | JGI24751J29686_10000089 | JGI24751J29686_1000008950 | 381 |
| 799 | 3300003781 | Ga0055536_1010998 | Ga0055536_10109982 | 381 |
| 800 | 3300005295 | Ga0065707_10085486 | Ga0065707_100854862 | 381 |
| 801 | 3300005331 | Ga0070670_100000028 | Ga0070670_100000028136 | 381 |
| 802 | 3300005335 | Ga0070666_10111444 | Ga0070666_101114442 | 381 |
| 803 | 3300005353 | Ga0070669_100000005 | Ga0070669_100000005175 | 381 |
| 804 | 3300005367 | Ga0070667_100000733 | Ga0070667_10000073323 | 381 |
| 805 | 3300005614 | Ga0068856_100130942 | Ga0068856_1001309422 | 381 |
| 806 | 3300005616 | Ga0068852_100220154 | Ga0068852_1002201542 | 381 |
| 807 | 3300005617 | Ga0068859_100003554 | Ga0068859_1000035545 | 381 |
| 808 | 3300005618 | Ga0068864_100000049 | Ga0068864_1000000498 | 381 |
| 809 | 3300005719 | Ga0068861_100012245 | Ga0068861_1000122452 | 381 |
| 810 | 3300005844 | Ga0068862_100000005 | Ga0068862_100000005251 | 381 |
| 811 | 3300006931 | Ga0097620_100003554 | Ga0097620_10000355413 | 381 |
| 812 | 3300009177 | Ga0105248_10000218 | Ga0105248_1000021831 | 381 |
| 813 | 3300014326 | Ga0157380_10000023 | Ga0157380_1000002377 | 381 |
| 814 | 3300025263 | Ga0209565_1016198 | Ga0209565_10161982 | 381 |
| 815 | 3300025292 | Ga0209676_1000430 | Ga0209676_100043050 | 381 |
| 816 | 3300025298 | Ga0209050_1005991 | Ga0209050_10059917 | 381 |
| 817 | 3300025904 | Ga0207647_10056850 | Ga0207647_100568502 | 381 |
| 818 | 3300025923 | Ga0207681_10000003 | Ga0207681_10000003137 | 381 |
| 819 | 3300025925 | Ga0207650_10000012 | Ga0207650_10000012144 | 381 |
| 820 | 3300025933 | Ga0207706_10074451 | Ga0207706_100744512 | 381 |
| 821 | 3300025941 | Ga0207711_10001538 | Ga0207711_100015384 | 381 |
| 822 | 3300025961 | Ga0207712_10000196 | Ga0207712_1000019626 | 381 |
| 823 | 3300025986 | Ga0207658_10000617 | Ga0207658_1000061723 | 381 |
| 824 | 3300026095 | Ga0207676_10000009 | Ga0207676_10000009133 | 381 |
| 825 | 3300026118 | Ga0207675_100000350 | Ga0207675_1000003508 | 381 |
| 826 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001340 | 381 |
| 827 | 3300028381 | Ga0268264_10389184 | Ga0268264_103891841 | 381 |
| 828 | 3300031911 | Ga0307412_10123369 | Ga0307412_101233691 | 381 |
| 829 | 3300044693 | Ga0466961_0019991 | Ga0466961_0019991_1598_2851 | 381 |
| 830 | 3300045049 | Ga0466959_0052349 | Ga0466959_0052349_1679_2932 | 381 |
| 831 | 3300045836 | Ga0466958_0028656 | Ga0466958_0028656_85_1338 | 381 |
| 832 | 3300046616 | Ga0495668_0010901 | Ga0495668_0010901_4106_5326 | 381 |
| 833 | 3300053134 | Ga0500658_0008975 | Ga0500658_0008975_46_1275 | 381 |
| 834 | 3300002459 | JGI24751J29686_10004260 | JGI24751J29686_100042603 | 382 |
| 835 | 3300005295 | Ga0065707_10084180 | Ga0065707_100841805 | 382 |
| 836 | 3300005347 | Ga0070668_100000105 | Ga0070668_10000010557 | 382 |
| 837 | 3300005355 | Ga0070671_100001363 | Ga0070671_10000136310 | 382 |
| 838 | 3300005367 | Ga0070667_100000071 | Ga0070667_10000007156 | 382 |
| 839 | 3300005617 | Ga0068859_100045277 | Ga0068859_1000452773 | 382 |
| 840 | 3300005618 | Ga0068864_100001349 | Ga0068864_10000134918 | 382 |
| 841 | 3300005719 | Ga0068861_100043833 | Ga0068861_1000438333 | 382 |
| 842 | 3300005841 | Ga0068863_100031538 | Ga0068863_1000315383 | 382 |
| 843 | 3300005841 | Ga0068863_100042005 | Ga0068863_1000420053 | 382 |
| 844 | 3300005842 | Ga0068858_100000410 | Ga0068858_10000041038 | 382 |
| 845 | 3300005843 | Ga0068860_100000049 | Ga0068860_100000049161 | 382 |
| 846 | 3300005844 | Ga0068862_100000134 | Ga0068862_10000013439 | 382 |
| 847 | 3300006931 | Ga0097620_100045279 | Ga0097620_1000452793 | 382 |
| 848 | 3300009092 | Ga0105250_10030217 | Ga0105250_100302172 | 382 |
| 849 | 3300009177 | Ga0105248_10008370 | Ga0105248_100083709 | 382 |
| 850 | 3300009177 | Ga0105248_10076985 | Ga0105248_100769852 | 382 |
| 851 | 3300014326 | Ga0157380_10005003 | Ga0157380_100050036 | 382 |
| 852 | 3300025925 | Ga0207650_10038901 | Ga0207650_100389013 | 382 |
| 853 | 3300025925 | Ga0207650_10053917 | Ga0207650_100539172 | 382 |
| 854 | 3300025931 | Ga0207644_10000443 | Ga0207644_1000044322 | 382 |
| 855 | 3300025941 | Ga0207711_10006791 | Ga0207711_100067914 | 382 |
| 856 | 3300025972 | Ga0207668_10000011 | Ga0207668_1000001159 | 382 |
| 857 | 3300025986 | Ga0207658_10000014 | Ga0207658_10000014168 | 382 |
| 858 | 3300026035 | Ga0207703_10000402 | Ga0207703_1000040214 | 382 |
| 859 | 3300026088 | Ga0207641_10000292 | Ga0207641_100002925 | 382 |
| 860 | 3300026088 | Ga0207641_10021464 | Ga0207641_100214643 | 382 |
| 861 | 3300026088 | Ga0207641_10197547 | Ga0207641_101975472 | 382 |
| 862 | 3300026095 | Ga0207676_10000759 | Ga0207676_100007592 | 382 |
| 863 | 3300028380 | Ga0268265_10000228 | Ga0268265_1000022814 | 382 |
| 864 | 3300028381 | Ga0268264_10000121 | Ga0268264_10000121147 | 382 |
| 865 | 3300048919 | Ga0496116_0062550 | Ga0496116_0062550_549_1763 | 382 |
| 866 | 3300048922 | Ga0496119_0118603 | Ga0496119_0118603_37_1251 | 382 |
| 867 | 3300048928 | Ga0496125_0014557 | Ga0496125_0014557_1173_2393 | 382 |
| 868 | 3300053087 | Ga0500643_004056 | Ga0500643_004056_560_1780 | 382 |
| 869 | 3300053087 | Ga0500643_010962 | Ga0500643_010962_367_1587 | 382 |
| 870 | iso_pu_bacteria | 2643221560 | 2643821339 | 382 |
| 871 | iso_pu_bacteria | 2852680915 | 2852682193 | 382 |
| 872 | 3300005937 | Ga0081455_10004233 | Ga0081455_1000423315 | 383 |
| 873 | 3300009011 | Ga0105251_10000545 | Ga0105251_1000054528 | 383 |
| 874 | 3300009177 | Ga0105248_10000012 | Ga0105248_10000012223 | 383 |
| 875 | 3300009553 | Ga0105249_10000257 | Ga0105249_1000025725 | 383 |
| 876 | 3300013306 | Ga0163162_10100025 | Ga0163162_101000252 | 383 |
| 877 | 3300014968 | Ga0157379_10135154 | Ga0157379_101351542 | 383 |
| 878 | 3300025304 | Ga0209257_1001976 | Ga0209257_100197620 | 383 |
| 879 | 3300032004 | Ga0307414_10076696 | Ga0307414_100766962 | 383 |
| 880 | 3300035725 | Ga0373947_0052311 | Ga0373947_0052311_426_1649 | 383 |
| 881 | 3300037068 | Ga0373925_0081558 | Ga0373925_0081558_676_1899 | 383 |
| 882 | 3300048921 | Ga0496118_0000946 | Ga0496118_0000946_30892_32109 | 383 |
| 883 | 3300053096 | Ga0500641_0016772 | Ga0500641_0016772_1074_2297 | 383 |
| 884 | 3300053130 | Ga0500642_0007206 | Ga0500642_0007206_1212_2435 | 383 |
| 885 | 3300053148 | Ga0500590_000428 | Ga0500590_000428_11287_12510 | 383 |
| 886 | 3300053156 | Ga0500622_0003987 | Ga0500622_0003987_1128_2351 | 383 |
| 887 | 3300053724 | Ga0500570_020728 | Ga0500570_020728_1173_2396 | 383 |
| 888 | 3300053733 | Ga0500552_002023 | Ga0500552_002023_88_1311 | 383 |
| 889 | 3300001904 | JGI24736J21556_1000171 | JGI24736J21556_10001718 | 384 |
| 890 | 3300001976 | JGI24752J21851_1002691 | JGI24752J21851_10026912 | 384 |
| 891 | 3300001989 | JGI24739J22299_10009434 | JGI24739J22299_100094342 | 384 |
| 892 | 3300001990 | JGI24737J22298_10005380 | JGI24737J22298_100053802 | 384 |
| 893 | 3300002076 | JGI24749J21850_1002378 | JGI24749J21850_10023782 | 384 |
| 894 | 3300002239 | JGI24034J26672_10000040 | JGI24034J26672_1000004053 | 384 |
| 895 | 3300005327 | Ga0070658_10028597 | Ga0070658_100285973 | 384 |
| 896 | 3300005330 | Ga0070690_100000035 | Ga0070690_10000003564 | 384 |
| 897 | 3300005335 | Ga0070666_10000015 | Ga0070666_1000001585 | 384 |
| 898 | 3300005339 | Ga0070660_100036074 | Ga0070660_1000360742 | 384 |
| 899 | 3300005340 | Ga0070689_100024072 | Ga0070689_1000240724 | 384 |
| 900 | 3300005353 | Ga0070669_100000896 | Ga0070669_10000089613 | 384 |
| 901 | 3300005355 | Ga0070671_100163180 | Ga0070671_1001631802 | 384 |
| 902 | 3300005365 | Ga0070688_100008634 | Ga0070688_1000086346 | 384 |
| 903 | 3300005367 | Ga0070667_100006730 | Ga0070667_1000067309 | 384 |
| 904 | 3300005455 | Ga0070663_100047454 | Ga0070663_1000474542 | 384 |
| 905 | 3300005466 | Ga0070685_10000102 | Ga0070685_1000010241 | 384 |
| 906 | 3300005539 | Ga0068853_100110241 | Ga0068853_1001102412 | 384 |
| 907 | 3300005544 | Ga0070686_100000006 | Ga0070686_100000006167 | 384 |
| 908 | 3300005548 | Ga0070665_100000510 | Ga0070665_10000051024 | 384 |
| 909 | 3300005577 | Ga0068857_100114310 | Ga0068857_1001143102 | 384 |
| 910 | 3300005614 | Ga0068856_100264894 | Ga0068856_1002648942 | 384 |
| 911 | 3300005616 | Ga0068852_100115704 | Ga0068852_1001157042 | 384 |
| 912 | 3300005617 | Ga0068859_100006307 | Ga0068859_1000063075 | 384 |
| 913 | 3300005618 | Ga0068864_100005479 | Ga0068864_1000054792 | 384 |
| 914 | 3300005834 | Ga0068851_10026186 | Ga0068851_100261862 | 384 |
| 915 | 3300005841 | Ga0068863_100000109 | Ga0068863_10000010960 | 384 |
| 916 | 3300005842 | Ga0068858_100002853 | Ga0068858_10000285317 | 384 |
| 917 | 3300005843 | Ga0068860_100000050 | Ga0068860_10000005085 | 384 |
| 918 | 3300006931 | Ga0097620_100006307 | Ga0097620_1000063075 | 384 |
| 919 | 3300009093 | Ga0105240_10196468 | Ga0105240_101964682 | 384 |
| 920 | 3300009093 | Ga0105240_10327490 | Ga0105240_103274902 | 384 |
| 921 | 3300009101 | Ga0105247_10037490 | Ga0105247_100374902 | 384 |
| 922 | 3300009174 | Ga0105241_10053269 | Ga0105241_100532692 | 384 |
| 923 | 3300009545 | Ga0105237_10157098 | Ga0105237_101570982 | 384 |
| 924 | 3300009553 | Ga0105249_10000034 | Ga0105249_10000034137 | 384 |
| 925 | 3300010375 | Ga0105239_10208143 | Ga0105239_102081432 | 384 |
| 926 | 3300013104 | Ga0157370_10010021 | Ga0157370_100100215 | 384 |
| 927 | 3300013105 | Ga0157369_10021062 | Ga0157369_100210623 | 384 |
| 928 | 3300013306 | Ga0163162_10417171 | Ga0163162_104171712 | 384 |
| 929 | 3300014325 | Ga0163163_10071147 | Ga0163163_100711473 | 384 |
| 930 | 3300014326 | Ga0157380_10000567 | Ga0157380_100005679 | 384 |
| 931 | 3300014968 | Ga0157379_10049250 | Ga0157379_100492503 | 384 |
| 932 | 3300017792 | Ga0163161_10000051 | Ga0163161_1000005113 | 384 |
| 933 | 3300025223 | Ga0207672_1000337 | Ga0207672_10003373 | 384 |
| 934 | 3300025321 | Ga0207656_10003330 | Ga0207656_100033302 | 384 |
| 935 | 3300025903 | Ga0207680_10000007 | Ga0207680_10000007541 | 384 |
| 936 | 3300025904 | Ga0207647_10001020 | Ga0207647_100010208 | 384 |
| 937 | 3300025909 | Ga0207705_10027894 | Ga0207705_100278943 | 384 |
| 938 | 3300025911 | Ga0207654_10029729 | Ga0207654_100297292 | 384 |
| 939 | 3300025913 | Ga0207695_10003367 | Ga0207695_100033675 | 384 |
| 940 | 3300025914 | Ga0207671_10006071 | Ga0207671_1000607112 | 384 |
| 941 | 3300025920 | Ga0207649_10038301 | Ga0207649_100383012 | 384 |
| 942 | 3300025923 | Ga0207681_10000133 | Ga0207681_1000013332 | 384 |
| 943 | 3300025924 | Ga0207694_10020160 | Ga0207694_100201605 | 384 |
| 944 | 3300025931 | Ga0207644_10025324 | Ga0207644_100253242 | 384 |
| 945 | 3300025933 | Ga0207706_10057322 | Ga0207706_100573223 | 384 |
| 946 | 3300025933 | Ga0207706_10057949 | Ga0207706_100579492 | 384 |
| 947 | 3300025941 | Ga0207711_10127820 | Ga0207711_101278202 | 384 |
| 948 | 3300025949 | Ga0207667_10035664 | Ga0207667_100356642 | 384 |
| 949 | 3300025961 | Ga0207712_10000004 | Ga0207712_10000004529 | 384 |
| 950 | 3300025972 | Ga0207668_10138178 | Ga0207668_101381782 | 384 |
| 951 | 3300025981 | Ga0207640_10022420 | Ga0207640_100224203 | 384 |
| 952 | 3300025986 | Ga0207658_10000082 | Ga0207658_1000008223 | 384 |
| 953 | 3300026035 | Ga0207703_10000732 | Ga0207703_1000073229 | 384 |
| 954 | 3300026041 | Ga0207639_10079196 | Ga0207639_100791962 | 384 |
| 955 | 3300026067 | Ga0207678_10063521 | Ga0207678_100635212 | 384 |
| 956 | 3300026078 | Ga0207702_10013160 | Ga0207702_100131606 | 384 |
| 957 | 3300026088 | Ga0207641_10000274 | Ga0207641_1000027423 | 384 |
| 958 | 3300026095 | Ga0207676_10002928 | Ga0207676_100029283 | 384 |
| 959 | 3300026116 | Ga0207674_10007688 | Ga0207674_100076884 | 384 |
| 960 | 3300026118 | Ga0207675_100033960 | Ga0207675_1000339604 | 384 |
| 961 | 3300026142 | Ga0207698_10028904 | Ga0207698_100289043 | 384 |
| 962 | 3300028379 | Ga0268266_10000009 | Ga0268266_100000091089 | 384 |
| 963 | 3300028380 | Ga0268265_10000086 | Ga0268265_100000866 | 384 |
| 964 | 3300028381 | Ga0268264_10000003 | Ga0268264_10000003543 | 384 |
| 965 | 3300046525 | Ga0495663_0005034 | Ga0495663_0005034_1355_2575 | 384 |
| 966 | 3300046530 | Ga0495654_0001314 | Ga0495654_0001314_4652_5872 | 384 |
| 967 | 3300046616 | Ga0495668_0003961 | Ga0495668_0003961_9058_10278 | 384 |
| 968 | 3300046616 | Ga0495668_0037700 | Ga0495668_0037700_125_1345 | 384 |
| 969 | 3300046794 | Ga0495589_0026704 | Ga0495589_0026704_1145_2365 | 384 |
| 970 | 3300048904 | Ga0496101_0101789 | Ga0496101_0101789_819_2039 | 384 |
| 971 | 3300048905 | Ga0496102_0001152 | Ga0496102_0001152_8177_9397 | 384 |
| 972 | 3300048906 | Ga0496103_0005595 | Ga0496103_0005595_2563_3783 | 384 |
| 973 | 3300048907 | Ga0496104_0068659 | Ga0496104_0068659_1616_2836 | 384 |
| 974 | 3300048908 | Ga0496105_0052708 | Ga0496105_0052708_1737_2957 | 384 |
| 975 | 3300048909 | Ga0496106_0025607 | Ga0496106_0025607_1965_3185 | 384 |
| 976 | 3300048910 | Ga0496107_0129957 | Ga0496107_0129957_478_1698 | 384 |
| 977 | 3300048914 | Ga0496111_0103463 | Ga0496111_0103463_571_1791 | 384 |
| 978 | 3300048920 | Ga0496117_0024346 | Ga0496117_0024346_2341_3561 | 384 |
| 979 | 3300048928 | Ga0496125_0170682 | Ga0496125_0170682_96_1316 | 384 |
| 980 | 3300053151 | Ga0500604_0010303 | Ga0500604_0010303_58_1278 | 384 |
| 981 | 3300053158 | Ga0500627_0000417 | Ga0500627_0000417_8775_9995 | 384 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bh1-assembly1.cif.gz_A | core divisome complex ftswiqbl from pseudomonas aeruginosa | 0.8361 | 35 | 365 |
| 6bar-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) | 0.7866 | 32 | 367 |
| 6bas-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) | 0.7786 | 34 | 367 |
| 8bh1-assembly1.cif.gz_A | core divisome complex ftswiqbl from pseudomonas aeruginosa | 0.7743 | 35 | 365 |
| 6pl5-assembly1.cif.gz_A | structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex | 0.7701 | 34 | 367 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54WP0_36_278_1.20.190.10 | Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1;Pesticidal crystal protein, N-terminal domain | 0.3134 | 63 | 219 | 1.20.190.10 |
| af_Q23135_5_217_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2484 | 128 | 365 | 1.20.1070.10 |
| af_Q23135_5_217_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2397 | 128 | 365 | 1.20.1070.10 |
| af_I1JDS7_107_301_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.2388 | 128 | 366 | 1.20.1510.10 |
| af_Q9ATN2_41_273_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.237 | 127 | 366 | 1.20.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1N1Q1-F1-model_v4 | deleted | 0.9286 | 77 | 372 |
|
| AF-A0A2S6S9Y6-F1-model_v4 | Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) | 0.917 | 70 | 369 |
GO:0005886
GO:0008360 GO:0009252 GO:0015648 GO:0016757 GO:0032153 GO:0051301 |
| AF-A0A537Q160-F1-model_v4 | Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) | 0.9142 | 38 | 372 |
GO:0005886
GO:0008360 GO:0009252 GO:0015648 GO:0016757 GO:0032153 GO:0051301 |
| AF-A0A539CWB4-F1-model_v4 | Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) | 0.909 | 70 | 372 |
GO:0005886
GO:0008360 GO:0009252 GO:0015648 GO:0016757 GO:0032153 GO:0051301 |
| AF-A0A2S6S9Y6-F1-model_v4 | Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) | 0.9084 | 70 | 369 |
GO:0005886
GO:0008360 GO:0009252 GO:0015648 GO:0016757 GO:0032153 GO:0051301 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar