F487392

General Info

Members Datasets Scaffolds Average Seq Length
981 385 954 380

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10000196|Ga0207712_1000019626
Length 417
Sequence MNGSMNGITGGIAGTGPTRKVTAKRIGFAARSLGGRGDRTLIGTWFWEIDRVLLMLALGLIAVAGASPAAAQRYSGGGITFAPLHYFWRQLIWVAASLPVMVAVSMLPKGAARRFALAGAAFFTVMLAVVPLVGSEVNGAVRWIGFGFAQFQPSEFLKPMFVVSMAWLLSLKAHDPGLPVVPLTGLLTGAIAVLLMNQPDLGQTIIFAVMWFSLLMISGVSSRALGTLIGGGLAGLVAAYFFYPVANQRINGWLGIGVTAGQGADTYQTDMAHATLTAGGFFGTGPGGGTMKFKLPEAHTDYIFSVIGEEFGLIACLAIAIVFLAIVVRVFVKLLDEEDHFTVLAAAGLTVQFGAQALINMAVNVQMAPSKGMTLPFISYGGSSMLALSIGFGLLLAFTRRNPFLTRSPYVVKWSGR

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
7 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
13 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
14 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
15 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
16 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
17 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
18 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
19 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
20 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
21 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
22 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
23 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
24 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
25 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
26 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
27 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
28 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
29 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
34 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
35 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
36 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
37 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
43 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
147 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
151 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
253 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
254 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
255 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
258 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
259 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
260 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
261 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
327 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
337 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
338 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
339 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
340 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
341 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
342 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
343 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
344 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
345 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
346 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
347 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
348 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
349 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
350 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
351 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
352 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
353 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
358 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
359 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
360 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
361 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
362 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
363 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
364 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
365 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
368 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
369 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
370 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
371 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
372 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
373 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
376 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
377 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
380 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
381 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
382 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
383 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 0.1
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 10.5
Nodule 0
Rhizoplane 2.85
Rhizosphere 78.19
Stem 0
Stem Tuber 0
Unclassified 7.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000171 3300001904 Bacteria 11561
2 JGI24736J21556_1000449 3300001904 Bacteria 7725
3 JGI24736J21556_1003770 3300001904 Bacteria 2612
4 JGI24736J21556_1006408 3300001904 Bacteria 1981
5 JGI24741J21665_1000309 3300001915 Bacteria 14619
6 JGI24741J21665_1010756 3300001915 Bacteria 1623
7 JGI24752J21851_1002691 3300001976 Bacteria 2363
8 JGI24739J22299_10001503 3300001989 Bacteria 8795
9 JGI24739J22299_10009434 3300001989 Bacteria 3637
10 JGI24737J22298_10000318 3300001990 Bacteria 16108
11 JGI24737J22298_10000409 3300001990 Bacteria 14680
12 JGI24737J22298_10005380 3300001990 Bacteria 4423
13 JGI24735J21928_10001172 3300002067 Bacteria 9379
14 JGI24735J21928_10005978 3300002067 Bacteria 4021
15 JGI24735J21928_10015663 3300002067 Bacteria 2361
16 JGI24735J21928_10026926 3300002067 Bacteria 1725
17 JGI24735J21928_10031245 3300002067 Bacteria 1579
18 JGI24738J21930_10009749 3300002075 Bacteria 2153
19 JGI24738J21930_10012967 3300002075 Bacteria 1811
20 JGI24749J21850_1000015 3300002076 Bacteria 34487
21 JGI24749J21850_1002378 3300002076 Bacteria 2648
22 JGI24744J21845_10002873 3300002077 Bacteria 3521
23 JGI24034J26672_10000040 3300002239 Bacteria 72195
24 JGI24034J26672_10002382 3300002239 Bacteria 2579
25 JGI24751J29686_10000089 3300002459 Bacteria 50993
26 JGI24751J29686_10004260 3300002459 Bacteria 2904
27 JGI25165J46597_1000023 3300003214 Bacteria 338873
28 JGI25153J46596_10000152 3300003215 Bacteria 70039
29 JGI25153J46596_10009386 3300003215 Bacteria 4555
30 rootH2_10060186 3300003320 Bacteria 2127
31 Ga0055525_1000035 3300003759 Bacteria 300887
32 Ga0055542_1000132 3300003762 Bacteria 96749
33 Ga0055529_1000088 3300003763 Bacteria 139031
34 Ga0055526_1007222 3300003771 Bacteria 5829
35 Ga0055537_1004287 3300003773 Bacteria 4111
36 Ga0055537_1006278 3300003773 Bacteria 3043
37 Ga0055536_1000505 3300003781 Bacteria 26955
38 Ga0055536_1001201 3300003781 Bacteria 16094
39 Ga0055536_1010998 3300003781 Bacteria 3522
40 Ga0055534_1012319 3300003784 Bacteria 1696
41 Ga0055530_10000137 3300003791 Bacteria 64770
42 Ga0055530_10000194 3300003791 Bacteria 54519
43 Ga0055530_10000247 3300003791 Bacteria 48853
44 Ga0055530_10019461 3300003791 Bacteria 2055
45 Ga0055531_10000019 3300003794 Bacteria 170825
46 Ga0055531_10001071 3300003794 Bacteria 21494
47 Ga0055531_10001510 3300003794 Bacteria 17093
48 Ga0055531_10012020 3300003794 Bacteria 4111
49 Ga0065704_10125038 3300005289 Bacteria 1706
50 Ga0065715_10008999 3300005293 Bacteria 3837
51 Ga0065707_10084180 3300005295 Bacteria 7561
52 Ga0065707_10085486 3300005295 Bacteria 6119
53 Ga0070658_10000040 3300005327 Bacteria 136073
54 Ga0070658_10000885 3300005327 Bacteria 25632
55 Ga0070658_10003656 3300005327 Bacteria 12593
56 Ga0070658_10005096 3300005327 Bacteria 10690
57 Ga0070658_10021593 3300005327 Bacteria 5159
58 Ga0070658_10028597 3300005327 Bacteria 4476
59 Ga0070658_10055581 3300005327 Bacteria 3216
60 Ga0070658_10077285 3300005327 Bacteria 2730
61 Ga0070658_10179891 3300005327 Bacteria 1779
62 Ga0070658_10181235 3300005327 Bacteria 1772
63 Ga0070676_10000147 3300005328 Bacteria 27720
64 Ga0070676_10003620 3300005328 Bacteria 8077
65 Ga0070683_100125426 3300005329 Bacteria 2427
66 Ga0070690_100000035 3300005330 Bacteria 62497
67 Ga0070670_100000028 3300005331 Bacteria 184816
68 Ga0070670_100000572 3300005331 Bacteria 29143
69 Ga0070670_100004056 3300005331 Bacteria 12233
70 Ga0070670_100007601 3300005331 Bacteria 9204
71 Ga0070670_100018271 3300005331 Bacteria 6015
72 Ga0070670_100175919 3300005331 Bacteria 1857
73 Ga0070677_10002040 3300005333 Bacteria 6425
74 Ga0068869_100000307 3300005334 Bacteria 26132
75 Ga0068869_100011642 3300005334 Bacteria 5779
76 Ga0070666_10000015 3300005335 Bacteria 208372
77 Ga0070666_10000898 3300005335 Bacteria 18102
78 Ga0070666_10111444 3300005335 Bacteria 1892
79 Ga0070680_100000502 3300005336 Bacteria 26894
80 Ga0068868_100000054 3300005338 Bacteria 64223
81 Ga0068868_100000215 3300005338 Bacteria 38878
82 Ga0068868_100002850 3300005338 Bacteria 11985
83 Ga0070660_100000683 3300005339 Bacteria 22453
84 Ga0070660_100001804 3300005339 Bacteria 14692
85 Ga0070660_100003760 3300005339 Bacteria 10488
86 Ga0070660_100010420 3300005339 Bacteria 6569
87 Ga0070660_100011627 3300005339 Bacteria 6265
88 Ga0070660_100011855 3300005339 Bacteria 6213
89 Ga0070660_100036074 3300005339 Bacteria 3744
90 Ga0070660_100100455 3300005339 Bacteria 2291
91 Ga0070689_100024072 3300005340 Bacteria 4566
92 Ga0070689_100065973 3300005340 Bacteria 2820
93 Ga0070687_100073225 3300005343 Bacteria 1846
94 Ga0070661_100000263 3300005344 Bacteria 43084
95 Ga0070661_100003219 3300005344 Bacteria 11246
96 Ga0070661_100022185 3300005344 Bacteria 4543
97 Ga0070661_100025521 3300005344 Bacteria 4248
98 Ga0070692_10000983 3300005345 Bacteria 9752
99 Ga0070668_100000071 3300005347 Bacteria 62770
100 Ga0070668_100000105 3300005347 Bacteria 51899
101 Ga0070668_100006040 3300005347 Bacteria 8980
102 Ga0070668_100015715 3300005347 Bacteria 5662
103 Ga0070668_100243352 3300005347 Bacteria 1491
104 Ga0070669_100000005 3300005353 Bacteria 309134
105 Ga0070669_100000896 3300005353 Bacteria 21674
106 Ga0070669_100001444 3300005353 Bacteria 17211
107 Ga0070675_100006584 3300005354 Bacteria 8933
108 Ga0070671_100000328 3300005355 Bacteria 32455
109 Ga0070671_100001363 3300005355 Bacteria 18316
110 Ga0070671_100018224 3300005355 Bacteria 5700
111 Ga0070671_100163180 3300005355 Bacteria 1883
112 Ga0070674_100001464 3300005356 Bacteria 12593
113 Ga0070674_100005675 3300005356 Bacteria 7234
114 Ga0070674_100047053 3300005356 Bacteria 2954
115 Ga0070674_100229464 3300005356 Bacteria 1448
116 Ga0070673_100000019 3300005364 Bacteria 107024
117 Ga0070673_100004714 3300005364 Bacteria 8656
118 Ga0070673_100207136 3300005364 Bacteria 1691
119 Ga0070688_100008634 3300005365 Bacteria 5545
120 Ga0070659_100000099 3300005366 Bacteria 63815
121 Ga0070659_100009330 3300005366 Bacteria 7206
122 Ga0070659_100092990 3300005366 Bacteria 2419
123 Ga0070659_100145335 3300005366 Bacteria 1932
124 Ga0070667_100000036 3300005367 Bacteria 172536
125 Ga0070667_100000071 3300005367 Bacteria 125713
126 Ga0070667_100000134 3300005367 Bacteria 94286
127 Ga0070667_100000733 3300005367 Bacteria 31433
128 Ga0070667_100000966 3300005367 Bacteria 26470
129 Ga0070667_100005946 3300005367 Bacteria 10154
130 Ga0070667_100006730 3300005367 Bacteria 9547
131 Ga0070667_100055587 3300005367 Bacteria 3342
132 Ga0070667_100061414 3300005367 Bacteria 3182
133 Ga0070714_100027909 3300005435 Bacteria 4677
134 Ga0070714_100097808 3300005435 Bacteria 2581
135 Ga0070700_100014401 3300005441 Bacteria 4465
136 Ga0070663_100047454 3300005455 Bacteria 3042
137 Ga0070663_100140958 3300005455 Bacteria 1840
138 Ga0070678_100001692 3300005456 Bacteria 11824
139 Ga0070678_100022523 3300005456 Bacteria 4177
140 Ga0070662_100000146 3300005457 Bacteria 40344
141 Ga0070662_100009277 3300005457 Bacteria 6430
142 Ga0070662_100065602 3300005457 Bacteria 2661
143 Ga0068867_100000014 3300005459 Bacteria 112097
144 Ga0068867_100017881 3300005459 Bacteria 5036
145 Ga0068867_100030357 3300005459 Bacteria 3899
146 Ga0068867_100142340 3300005459 Bacteria 1876
147 Ga0070685_10000102 3300005466 Bacteria 53800
148 Ga0070698_100117424 3300005471 Bacteria 2623
149 Ga0070679_100000031 3300005530 Bacteria 107526
150 Ga0070679_100105148 3300005530 Bacteria 2809
151 Ga0068853_100001960 3300005539 Bacteria 15167
152 Ga0068853_100110241 3300005539 Bacteria 2444
153 Ga0068853_100282020 3300005539 Bacteria 1532
154 Ga0070672_100002199 3300005543 Bacteria 12294
155 Ga0070672_100051011 3300005543 Bacteria 3225
156 Ga0070686_100000006 3300005544 Bacteria 243316
157 Ga0070686_100000123 3300005544 Bacteria 55299
158 Ga0070665_100000011 3300005548 Bacteria 525539
159 Ga0070665_100000206 3300005548 Bacteria 102989
160 Ga0070665_100000510 3300005548 Bacteria 55798
161 Ga0070665_100001478 3300005548 Bacteria 27506
162 Ga0070665_100021367 3300005548 Bacteria 6508
163 Ga0070665_100038505 3300005548 Bacteria 4807
164 Ga0068855_100001753 3300005563 Bacteria 27078
165 Ga0068855_100006658 3300005563 Bacteria 14034
166 Ga0068855_100131853 3300005563 Bacteria 2854
167 Ga0068855_100341644 3300005563 Bacteria 1650
168 Ga0070664_100013891 3300005564 Bacteria 6567
169 Ga0070664_100057160 3300005564 Bacteria 3315
170 Ga0070664_100076166 3300005564 Bacteria 2882
171 Ga0070664_100149061 3300005564 Bacteria 2065
172 Ga0068857_100001199 3300005577 Bacteria 20230
173 Ga0068857_100030331 3300005577 Bacteria 4775
174 Ga0068857_100030817 3300005577 Bacteria 4738
175 Ga0068857_100097806 3300005577 Bacteria 2632
176 Ga0068857_100114310 3300005577 Bacteria 2427
177 Ga0068857_100328496 3300005577 Bacteria 1413
178 Ga0068854_100002725 3300005578 Bacteria 10963
179 Ga0068854_100002754 3300005578 Bacteria 10916
180 Ga0068854_100016941 3300005578 Bacteria 4868
181 Ga0068854_100024975 3300005578 Bacteria 4099
182 Ga0068856_100130942 3300005614 Bacteria 2513
183 Ga0068856_100264894 3300005614 Bacteria 1734
184 Ga0068852_100000314 3300005616 Bacteria 32834
185 Ga0068852_100000509 3300005616 Bacteria 25586
186 Ga0068852_100088601 3300005616 Bacteria 2764
187 Ga0068852_100115704 3300005616 Bacteria 2445
188 Ga0068852_100220154 3300005616 Bacteria 1805
189 Ga0068859_100000709 3300005617 Bacteria 33516
190 Ga0068859_100003554 3300005617 Bacteria 15881
191 Ga0068859_100005050 3300005617 Bacteria 13398
192 Ga0068859_100006307 3300005617 Bacteria 12028
193 Ga0068859_100006890 3300005617 Bacteria 11536
194 Ga0068859_100010054 3300005617 Bacteria 9539
195 Ga0068859_100024321 3300005617 Bacteria 6078
196 Ga0068859_100030665 3300005617 Bacteria 5396
197 Ga0068859_100045277 3300005617 Bacteria 4421
198 Ga0068859_100079584 3300005617 Bacteria 3318
199 Ga0068864_100000049 3300005618 Bacteria 143621
200 Ga0068864_100000089 3300005618 Bacteria 97458
201 Ga0068864_100000484 3300005618 Bacteria 34533
202 Ga0068864_100001349 3300005618 Bacteria 20418
203 Ga0068864_100003324 3300005618 Bacteria 13289
204 Ga0068864_100005479 3300005618 Bacteria 10406
205 Ga0068864_100015386 3300005618 Bacteria 6361
206 Ga0068861_100012245 3300005719 Bacteria 5981
207 Ga0068861_100030379 3300005719 Bacteria 3958
208 Ga0068861_100043833 3300005719 Bacteria 3361
209 Ga0068861_100124692 3300005719 Bacteria 2083
210 Ga0068851_10026186 3300005834 Bacteria 2864
211 Ga0068851_10083062 3300005834 Bacteria 1675
212 Ga0068870_10071223 3300005840 Bacteria 1897
213 Ga0068863_100000084 3300005841 Bacteria 104480
214 Ga0068863_100000109 3300005841 Bacteria 86619
215 Ga0068863_100000154 3300005841 Bacteria 72659
216 Ga0068863_100003453 3300005841 Bacteria 15585
217 Ga0068863_100005038 3300005841 Bacteria 13025
218 Ga0068863_100016750 3300005841 Bacteria 7032
219 Ga0068863_100018322 3300005841 Bacteria 6703
220 Ga0068863_100031538 3300005841 Bacteria 5056
221 Ga0068863_100042005 3300005841 Bacteria 4346
222 Ga0068863_100248900 3300005841 Bacteria 1716
223 Ga0068858_100000410 3300005842 Bacteria 44537
224 Ga0068858_100001092 3300005842 Bacteria 28091
225 Ga0068858_100002853 3300005842 Bacteria 17371
226 Ga0068858_100030812 3300005842 Bacteria 4981
227 Ga0068858_100039028 3300005842 Bacteria 4405
228 Ga0068860_100000049 3300005843 Bacteria 208782
229 Ga0068860_100000050 3300005843 Bacteria 208372
230 Ga0068860_100000063 3300005843 Bacteria 189519
231 Ga0068860_100001312 3300005843 Bacteria 27012
232 Ga0068860_100003211 3300005843 Bacteria 16863
233 Ga0068860_100037032 3300005843 Bacteria 4671
234 Ga0068862_100000005 3300005844 Bacteria 350713
235 Ga0068862_100000112 3300005844 Bacteria 97458
236 Ga0068862_100000134 3300005844 Bacteria 85840
237 Ga0068862_100000481 3300005844 Bacteria 42686
238 Ga0068862_100029293 3300005844 Bacteria 4638
239 Ga0068862_100075098 3300005844 Bacteria 2923
240 Ga0068862_100157162 3300005844 Bacteria 2027
241 Ga0081455_10004233 3300005937 Bacteria 16179
242 Ga0081539_10004462 3300005985 Bacteria 15427
243 Ga0068871_100050877 3300006358 Bacteria 3353
244 Ga0068871_100062908 3300006358 Bacteria 3034
245 Ga0075431_100050690 3300006847 Bacteria 4280
246 Ga0068865_100000018 3300006881 Bacteria 106975
247 Ga0068865_100003176 3300006881 Bacteria 9845
248 Ga0097620_100000709 3300006931 Bacteria 33516
249 Ga0097620_100003554 3300006931 Bacteria 15881
250 Ga0097620_100005050 3300006931 Bacteria 13398
251 Ga0097620_100006307 3300006931 Bacteria 12028
252 Ga0097620_100006890 3300006931 Bacteria 11536
253 Ga0097620_100010054 3300006931 Bacteria 9539
254 Ga0097620_100024321 3300006931 Bacteria 6078
255 Ga0097620_100030665 3300006931 Bacteria 5396
256 Ga0097620_100045279 3300006931 Bacteria 4421
257 Ga0097620_100079583 3300006931 Bacteria 3318
258 Ga0105251_10000545 3300009011 Bacteria 35537
259 Ga0105250_10030217 3300009092 Bacteria 2178
260 Ga0105240_10001116 3300009093 Bacteria 47225
261 Ga0105240_10072698 3300009093 Bacteria 4249
262 Ga0105240_10196468 3300009093 Bacteria 2368
263 Ga0105240_10327490 3300009093 Bacteria 1744
264 Ga0105245_10000659 3300009098 Bacteria 31256
265 Ga0105245_10000679 3300009098 Bacteria 30743
266 Ga0105245_10025229 3300009098 Bacteria 5225
267 Ga0105245_10160856 3300009098 Bacteria 2131
268 Ga0105247_10013962 3300009101 Bacteria 4816
269 Ga0105247_10037490 3300009101 Bacteria 2958
270 Ga0105243_10000076 3300009148 Bacteria 110445
271 Ga0105243_10000091 3300009148 Bacteria 102081
272 Ga0105241_10008895 3300009174 Bacteria 7385
273 Ga0105241_10053269 3300009174 Bacteria 3093
274 Ga0105242_10000458 3300009176 Bacteria 32420
275 Ga0105248_10000012 3300009177 Bacteria 333963
276 Ga0105248_10000122 3300009177 Bacteria 89560
277 Ga0105248_10000218 3300009177 Bacteria 66074
278 Ga0105248_10003487 3300009177 Bacteria 17459
279 Ga0105248_10006757 3300009177 Bacteria 12580
280 Ga0105248_10008370 3300009177 Bacteria 11361
281 Ga0105248_10076985 3300009177 Bacteria 3749
282 Ga0105248_10084789 3300009177 Bacteria 3565
283 Ga0105248_10160457 3300009177 Bacteria 2536
284 Ga0105237_10001672 3300009545 Bacteria 28703
285 Ga0105237_10157098 3300009545 Bacteria 2271
286 Ga0105238_10021758 3300009551 Bacteria 6531
287 Ga0105249_10000034 3300009553 Bacteria 208378
288 Ga0105249_10000240 3300009553 Bacteria 61072
289 Ga0105249_10000257 3300009553 Bacteria 57683
290 Ga0105249_10024713 3300009553 Bacteria 5401
291 Ga0105249_10056416 3300009553 Bacteria 3596
292 Ga0105239_10002515 3300010375 Bacteria 23310
293 Ga0105239_10208143 3300010375 Bacteria 2192
294 Ga0105246_10000637 3300011119 Bacteria 19574
295 Ga0157373_10034961 3300013100 Bacteria 3609
296 Ga0157373_10062733 3300013100 Bacteria 2632
297 Ga0157373_10097999 3300013100 Bacteria 2063
298 Ga0157373_10219705 3300013100 Bacteria 1340
299 Ga0157371_10000048 3300013102 Bacteria 184015
300 Ga0157371_10002922 3300013102 Bacteria 15960
301 Ga0157371_10018161 3300013102 Bacteria 5208
302 Ga0157370_10001841 3300013104 Bacteria 26158
303 Ga0157370_10010021 3300013104 Bacteria 10025
304 Ga0157370_10219756 3300013104 Bacteria 1760
305 Ga0157370_10279277 3300013104 Bacteria 1543
306 Ga0157369_10001135 3300013105 Bacteria 33313
307 Ga0157369_10021062 3300013105 Bacteria 7289
308 Ga0157369_10021523 3300013105 Bacteria 7213
309 Ga0157369_10060224 3300013105 Bacteria 4094
310 Ga0157369_10320525 3300013105 Bacteria 1611
311 Ga0157374_10000951 3300013296 Bacteria 25154
312 Ga0157374_10032145 3300013296 Bacteria 4776
313 Ga0157374_10041526 3300013296 Bacteria 4240
314 Ga0157378_10001247 3300013297 Bacteria 22966
315 Ga0163162_10010331 3300013306 Bacteria 9074
316 Ga0163162_10052291 3300013306 Bacteria 4102
317 Ga0163162_10100025 3300013306 Bacteria 2991
318 Ga0163162_10417171 3300013306 Bacteria 1475
319 Ga0157372_10018056 3300013307 Bacteria 7582
320 Ga0157372_10057511 3300013307 Bacteria 4347
321 Ga0157372_10112067 3300013307 Bacteria 3126
322 Ga0157375_10001111 3300013308 Bacteria 23332
323 Ga0157375_10011928 3300013308 Bacteria 7689
324 Ga0163163_10000903 3300014325 Bacteria 25169
325 Ga0163163_10071147 3300014325 Bacteria 3465
326 Ga0157380_10000023 3300014326 Bacteria 113686
327 Ga0157380_10000567 3300014326 Bacteria 22679
328 Ga0157380_10005003 3300014326 Bacteria 9242
329 Ga0157380_10015116 3300014326 Bacteria 5665
330 Ga0157380_10069720 3300014326 Bacteria 2838
331 Ga0157380_10332539 3300014326 Bacteria 1413
332 Ga0157379_10049250 3300014968 Bacteria 3761
333 Ga0157379_10135154 3300014968 Bacteria 2221
334 Ga0157379_10195288 3300014968 Bacteria 1829
335 Ga0183363_1006 3300015690 Bacteria 400466
336 Ga0163161_10000051 3300017792 Bacteria 122360
337 Ga0206353_11456103 3300020082 Bacteria 4774
338 Ga0213873_10000039 3300021358 Bacteria 32971
339 Ga0213876_10000455 3300021384 Bacteria 32971
340 Ga0213875_10000234 3300021388 Bacteria 56206
341 Ga0213875_10007016 3300021388 Bacteria 5862
342 Ga0207672_1000337 3300025223 Bacteria 6227
343 Ga0209563_100047 3300025230 Bacteria 366620
344 Ga0207427_101716 3300025231 Bacteria 7250
345 Ga0207425_1008127 3300025245 Bacteria 2711
346 Ga0209026_1001365 3300025250 Bacteria 10896
347 Ga0209677_105552 3300025253 Bacteria 3257
348 Ga0209148_1000017 3300025254 Bacteria 787064
349 Ga0209148_1000243 3300025254 Bacteria 86896
350 Ga0209148_1001774 3300025254 Bacteria 9266
351 Ga0209233_1000003 3300025261 Bacteria 1607366
352 Ga0209233_1012861 3300025261 Bacteria 2410
353 Ga0209565_1000012 3300025263 Bacteria 606500
354 Ga0209565_1000135 3300025263 Bacteria 103272
355 Ga0209565_1016198 3300025263 Bacteria 1663
356 Ga0209455_1000005 3300025272 Bacteria 1416756
357 Ga0209455_1002190 3300025272 Bacteria 7732
358 Ga0209673_1011606 3300025273 Bacteria 3617
359 Ga0209675_1000421 3300025291 Bacteria 34127
360 Ga0209675_1009729 3300025291 Bacteria 3366
361 Ga0209676_1000045 3300025292 Bacteria 412331
362 Ga0209676_1000211 3300025292 Bacteria 129654
363 Ga0209676_1000430 3300025292 Bacteria 72819
364 Ga0209025_1002199 3300025294 Bacteria 21586
365 Ga0209564_1007082 3300025295 Bacteria 5868
366 Ga0209758_1000035 3300025297 Bacteria 448190
367 Ga0209758_1024941 3300025297 Bacteria 2643
368 Ga0209050_1000010 3300025298 Bacteria 980454
369 Ga0209050_1000047 3300025298 Bacteria 380561
370 Ga0209050_1005991 3300025298 Bacteria 7377
371 Ga0209050_1007931 3300025298 Bacteria 5816
372 Ga0209050_1011536 3300025298 Bacteria 4171
373 Ga0209256_1000012 3300025299 Bacteria 790371
374 Ga0209257_1000009 3300025304 Bacteria 1205047
375 Ga0209257_1000076 3300025304 Bacteria 324617
376 Ga0209257_1000156 3300025304 Bacteria 182335
377 Ga0209257_1001976 3300025304 Bacteria 22053
378 Ga0209257_1002734 3300025304 Bacteria 16738
379 Ga0207697_10000002 3300025315 Bacteria 92560
380 Ga0207697_10005299 3300025315 Bacteria 6006
381 Ga0207697_10024522 3300025315 Bacteria 2469
382 Ga0207656_10002614 3300025321 Bacteria 6090
383 Ga0207656_10003330 3300025321 Bacteria 5508
384 Ga0207713_1005138 3300025735 Bacteria 8281
385 Ga0207682_10001243 3300025893 Bacteria 11795
386 Ga0207642_10069647 3300025899 Bacteria 1669
387 Ga0207710_10041353 3300025900 Bacteria 2044
388 Ga0207688_10000348 3300025901 Bacteria 21483
389 Ga0207688_10061803 3300025901 Bacteria 2112
390 Ga0207680_10000007 3300025903 Bacteria 623574
391 Ga0207680_10004744 3300025903 Bacteria 6471
392 Ga0207647_10001020 3300025904 Bacteria 21763
393 Ga0207647_10004952 3300025904 Bacteria 9819
394 Ga0207647_10014553 3300025904 Bacteria 5422
395 Ga0207647_10042571 3300025904 Bacteria 2848
396 Ga0207647_10050143 3300025904 Bacteria 2586
397 Ga0207647_10056850 3300025904 Bacteria 2400
398 Ga0207647_10159653 3300025904 Bacteria 1315
399 Ga0207645_10002499 3300025907 Bacteria 14432
400 Ga0207645_10010987 3300025907 Bacteria 6195
401 Ga0207645_10035093 3300025907 Bacteria 3221
402 Ga0207705_10000002 3300025909 Bacteria 2046852
403 Ga0207705_10000084 3300025909 Bacteria 116809
404 Ga0207705_10000135 3300025909 Bacteria 79350
405 Ga0207705_10000469 3300025909 Bacteria 34559
406 Ga0207705_10000557 3300025909 Bacteria 31254
407 Ga0207705_10001039 3300025909 Bacteria 22567
408 Ga0207705_10013186 3300025909 Bacteria 5965
409 Ga0207705_10013414 3300025909 Bacteria 5911
410 Ga0207705_10015135 3300025909 Bacteria 5546
411 Ga0207705_10027894 3300025909 Bacteria 4026
412 Ga0207705_10034664 3300025909 Bacteria 3609
413 Ga0207705_10043167 3300025909 Bacteria 3238
414 Ga0207705_10241449 3300025909 Bacteria 1376
415 Ga0207654_10000613 3300025911 Bacteria 20107
416 Ga0207654_10029729 3300025911 Bacteria 2995
417 Ga0207707_10085802 3300025912 Bacteria 2751
418 Ga0207695_10000288 3300025913 Bacteria 125085
419 Ga0207695_10003233 3300025913 Bacteria 23186
420 Ga0207695_10003367 3300025913 Bacteria 22589
421 Ga0207695_10024963 3300025913 Bacteria 6707
422 Ga0207695_10028978 3300025913 Bacteria 6128
423 Ga0207695_10126980 3300025913 Bacteria 2511
424 Ga0207671_10002961 3300025914 Bacteria 17469
425 Ga0207671_10006071 3300025914 Bacteria 10884
426 Ga0207671_10104485 3300025914 Bacteria 2149
427 Ga0207660_10002464 3300025917 Bacteria 12160
428 Ga0207657_10000542 3300025919 Bacteria 40318
429 Ga0207657_10000864 3300025919 Bacteria 31944
430 Ga0207657_10001741 3300025919 Bacteria 23460
431 Ga0207657_10001930 3300025919 Bacteria 22382
432 Ga0207657_10002044 3300025919 Bacteria 21836
433 Ga0207657_10004854 3300025919 Bacteria 14159
434 Ga0207657_10018207 3300025919 Bacteria 6719
435 Ga0207657_10023704 3300025919 Bacteria 5708
436 Ga0207657_10082220 3300025919 Bacteria 2703
437 Ga0207657_10094929 3300025919 Bacteria 2482
438 Ga0207649_10000323 3300025920 Bacteria 36350
439 Ga0207649_10000440 3300025920 Bacteria 30029
440 Ga0207649_10038301 3300025920 Bacteria 2902
441 Ga0207652_10000003 3300025921 Bacteria 502441
442 Ga0207681_10000003 3300025923 Bacteria 713245
443 Ga0207681_10000133 3300025923 Bacteria 60815
444 Ga0207681_10008670 3300025923 Bacteria 6208
445 Ga0207681_10049898 3300025923 Bacteria 2830
446 Ga0207681_10073190 3300025923 Bacteria 2396
447 Ga0207694_10020160 3300025924 Bacteria 5042
448 Ga0207694_10031239 3300025924 Bacteria 4066
449 Ga0207694_10090515 3300025924 Bacteria 2414
450 Ga0207694_10105904 3300025924 Bacteria 2233
451 Ga0207650_10000012 3300025925 Bacteria 437889
452 Ga0207650_10004105 3300025925 Bacteria 9945
453 Ga0207650_10029581 3300025925 Bacteria 3939
454 Ga0207650_10038901 3300025925 Bacteria 3476
455 Ga0207650_10053917 3300025925 Bacteria 2981
456 Ga0207659_10002195 3300025926 Bacteria 11600
457 Ga0207659_10117275 3300025926 Bacteria 2034
458 Ga0207687_10000426 3300025927 Bacteria 28498
459 Ga0207664_10085526 3300025929 Bacteria 2574
460 Ga0207664_10272234 3300025929 Bacteria 1484
461 Ga0207644_10000156 3300025931 Bacteria 49255
462 Ga0207644_10000443 3300025931 Bacteria 26768
463 Ga0207644_10003165 3300025931 Bacteria 10587
464 Ga0207644_10025324 3300025931 Bacteria 4080
465 Ga0207644_10078156 3300025931 Bacteria 2438
466 Ga0207690_10000005 3300025932 Bacteria 581199
467 Ga0207690_10003555 3300025932 Bacteria 9279
468 Ga0207690_10010280 3300025932 Bacteria 5557
469 Ga0207690_10065188 3300025932 Bacteria 2490
470 Ga0207690_10087863 3300025932 Bacteria 2188
471 Ga0207690_10123424 3300025932 Bacteria 1885
472 Ga0207706_10000461 3300025933 Bacteria 43387
473 Ga0207706_10001316 3300025933 Bacteria 24902
474 Ga0207706_10017362 3300025933 Bacteria 6483
475 Ga0207706_10023849 3300025933 Bacteria 5488
476 Ga0207706_10057322 3300025933 Bacteria 3432
477 Ga0207706_10057949 3300025933 Bacteria 3412
478 Ga0207706_10074451 3300025933 Bacteria 2986
479 Ga0207706_10075509 3300025933 Bacteria 2964
480 Ga0207686_10000518 3300025934 Bacteria 24936
481 Ga0207709_10000018 3300025935 Bacteria 431545
482 Ga0207709_10000114 3300025935 Bacteria 124672
483 Ga0207670_10073401 3300025936 Bacteria 2372
484 Ga0207669_10000084 3300025937 Bacteria 47546
485 Ga0207669_10001886 3300025937 Bacteria 8885
486 Ga0207704_10000008 3300025938 Bacteria 204682
487 Ga0207704_10031091 3300025938 Bacteria 3002
488 Ga0207691_10001615 3300025940 Bacteria 22399
489 Ga0207691_10016302 3300025940 Bacteria 7054
490 Ga0207691_10024681 3300025940 Bacteria 5653
491 Ga0207691_10034126 3300025940 Bacteria 4734
492 Ga0207691_10126496 3300025940 Bacteria 2261
493 Ga0207711_10000004 3300025941 Bacteria 870636
494 Ga0207711_10001538 3300025941 Bacteria 21392
495 Ga0207711_10001807 3300025941 Bacteria 19556
496 Ga0207711_10001929 3300025941 Bacteria 18836
497 Ga0207711_10005875 3300025941 Bacteria 10362
498 Ga0207711_10006791 3300025941 Bacteria 9614
499 Ga0207711_10127820 3300025941 Bacteria 2275
500 Ga0207689_10000086 3300025942 Bacteria 75369
501 Ga0207689_10000125 3300025942 Bacteria 64633
502 Ga0207689_10115344 3300025942 Bacteria 2208
503 Ga0207679_10005298 3300025945 Bacteria 8091
504 Ga0207667_10000004 3300025949 Bacteria 737718
505 Ga0207667_10000024 3300025949 Bacteria 355874
506 Ga0207667_10000829 3300025949 Bacteria 39957
507 Ga0207667_10001485 3300025949 Bacteria 29439
508 Ga0207667_10035664 3300025949 Bacteria 5335
509 Ga0207667_10045189 3300025949 Bacteria 4666
510 Ga0207667_10148485 3300025949 Bacteria 2413
511 Ga0207667_10204668 3300025949 Bacteria 2024
512 Ga0207667_10330939 3300025949 Bacteria 1555
513 Ga0207651_10000008 3300025960 Bacteria 204538
514 Ga0207651_10000306 3300025960 Bacteria 21046
515 Ga0207651_10010568 3300025960 Bacteria 5122
516 Ga0207651_10012180 3300025960 Bacteria 4853
517 Ga0207712_10000004 3300025961 Bacteria 614655
518 Ga0207712_10000196 3300025961 Bacteria 61501
519 Ga0207712_10000324 3300025961 Bacteria 43682
520 Ga0207712_10017468 3300025961 Bacteria 4660
521 Ga0207668_10000011 3300025972 Bacteria 184484
522 Ga0207668_10000039 3300025972 Bacteria 110049
523 Ga0207668_10001189 3300025972 Bacteria 15470
524 Ga0207668_10001788 3300025972 Bacteria 12554
525 Ga0207668_10138178 3300025972 Bacteria 1870
526 Ga0207640_10000229 3300025981 Bacteria 39028
527 Ga0207640_10000349 3300025981 Bacteria 30129
528 Ga0207640_10000513 3300025981 Bacteria 23367
529 Ga0207640_10007638 3300025981 Bacteria 5971
530 Ga0207640_10008252 3300025981 Bacteria 5777
531 Ga0207640_10022420 3300025981 Bacteria 3779
532 Ga0207658_10000014 3300025986 Bacteria 218248
533 Ga0207658_10000082 3300025986 Bacteria 105161
534 Ga0207658_10000083 3300025986 Bacteria 104502
535 Ga0207658_10000617 3300025986 Bacteria 31548
536 Ga0207658_10000711 3300025986 Bacteria 28834
537 Ga0207658_10008242 3300025986 Bacteria 7099
538 Ga0207677_10000074 3300026023 Bacteria 83468
539 Ga0207677_10000321 3300026023 Bacteria 34946
540 Ga0207677_10024714 3300026023 Bacteria 3737
541 Ga0207703_10000402 3300026035 Bacteria 46561
542 Ga0207703_10000732 3300026035 Bacteria 32270
543 Ga0207703_10002306 3300026035 Bacteria 16649
544 Ga0207703_10003797 3300026035 Bacteria 12553
545 Ga0207703_10021411 3300026035 Bacteria 5062
546 Ga0207639_10000400 3300026041 Bacteria 29922
547 Ga0207639_10002804 3300026041 Bacteria 11694
548 Ga0207639_10025867 3300026041 Bacteria 4259
549 Ga0207639_10067999 3300026041 Bacteria 2774
550 Ga0207639_10070086 3300026041 Bacteria 2738
551 Ga0207639_10079196 3300026041 Bacteria 2596
552 Ga0207678_10003023 3300026067 Bacteria 15215
553 Ga0207678_10003861 3300026067 Bacteria 13472
554 Ga0207678_10036208 3300026067 Bacteria 4296
555 Ga0207678_10063521 3300026067 Bacteria 3173
556 Ga0207678_10068658 3300026067 Bacteria 3040
557 Ga0207678_10080609 3300026067 Bacteria 2786
558 Ga0207678_10096724 3300026067 Bacteria 2523
559 Ga0207708_10025680 3300026075 Bacteria 4458
560 Ga0207702_10000708 3300026078 Bacteria 35874
561 Ga0207702_10011116 3300026078 Bacteria 7513
562 Ga0207702_10013160 3300026078 Bacteria 6880
563 Ga0207702_10013509 3300026078 Bacteria 6783
564 Ga0207702_10027861 3300026078 Bacteria 4693
565 Ga0207702_10058852 3300026078 Bacteria 3271
566 Ga0207641_10000001 3300026088 Bacteria 1180841
567 Ga0207641_10000010 3300026088 Bacteria 402193
568 Ga0207641_10000274 3300026088 Bacteria 65428
569 Ga0207641_10000292 3300026088 Bacteria 62689
570 Ga0207641_10000477 3300026088 Bacteria 45337
571 Ga0207641_10003899 3300026088 Bacteria 13055
572 Ga0207641_10021464 3300026088 Bacteria 5306
573 Ga0207641_10026594 3300026088 Bacteria 4776
574 Ga0207641_10032055 3300026088 Bacteria 4362
575 Ga0207641_10197547 3300026088 Bacteria 1852
576 Ga0207648_10000009 3300026089 Bacteria 204229
577 Ga0207648_10085821 3300026089 Bacteria 2746
578 Ga0207676_10000009 3300026095 Bacteria 545256
579 Ga0207676_10000051 3300026095 Bacteria 132645
580 Ga0207676_10000759 3300026095 Bacteria 25256
581 Ga0207676_10002928 3300026095 Bacteria 12165
582 Ga0207676_10002984 3300026095 Bacteria 12062
583 Ga0207676_10004634 3300026095 Bacteria 9730
584 Ga0207676_10008960 3300026095 Bacteria 7119
585 Ga0207676_10219809 3300026095 Bacteria 1691
586 Ga0207674_10002496 3300026116 Bacteria 23202
587 Ga0207674_10007688 3300026116 Bacteria 12548
588 Ga0207674_10012789 3300026116 Bacteria 9372
589 Ga0207674_10016393 3300026116 Bacteria 8112
590 Ga0207674_10121495 3300026116 Bacteria 2579
591 Ga0207674_10131784 3300026116 Bacteria 2462
592 Ga0207674_10139136 3300026116 Bacteria 2388
593 Ga0207675_100000049 3300026118 Bacteria 84016
594 Ga0207675_100000350 3300026118 Bacteria 43897
595 Ga0207675_100032909 3300026118 Bacteria 4830
596 Ga0207675_100033960 3300026118 Bacteria 4754
597 Ga0207675_100172796 3300026118 Bacteria 2066
598 Ga0207683_10007669 3300026121 Bacteria 9239
599 Ga0207683_10023514 3300026121 Bacteria 5302
600 Ga0207683_10033449 3300026121 Bacteria 4465
601 Ga0207683_10049118 3300026121 Bacteria 3693
602 Ga0207698_10004747 3300026142 Bacteria 8312
603 Ga0207698_10016934 3300026142 Bacteria 4930
604 Ga0207698_10025984 3300026142 Bacteria 4136
605 Ga0207698_10028904 3300026142 Bacteria 3961
606 Ga0209974_10025610 3300027876 Bacteria 1953
607 Ga0268266_10000002 3300028379 Bacteria 3059047
608 Ga0268266_10000009 3300028379 Bacteria 1097737
609 Ga0268266_10000058 3300028379 Bacteria 277346
610 Ga0268266_10000875 3300028379 Bacteria 39015
611 Ga0268265_10000001 3300028380 Bacteria 1230727
612 Ga0268265_10000026 3300028380 Bacteria 246653
613 Ga0268265_10000086 3300028380 Bacteria 119049
614 Ga0268265_10000228 3300028380 Bacteria 64301
615 Ga0268265_10000309 3300028380 Bacteria 54201
616 Ga0268264_10000003 3300028381 Bacteria 1141976
617 Ga0268264_10000083 3300028381 Bacteria 245366
618 Ga0268264_10000121 3300028381 Bacteria 190368
619 Ga0268264_10001117 3300028381 Bacteria 26438
620 Ga0268264_10032566 3300028381 Bacteria 4277
621 Ga0268264_10046983 3300028381 Bacteria 3588
622 Ga0268264_10389184 3300028381 Bacteria 1337
623 Ga0307517_10037646 3300028786 Bacteria 5393
624 Ga0307517_10049716 3300028786 Bacteria 4282
625 Ga0307513_10020531 3300031456 Bacteria 7833
626 Ga0307513_10076661 3300031456 Bacteria 3466
627 Ga0307513_10095623 3300031456 Bacteria 3011
628 Ga0307408_100136920 3300031548 Bacteria 1917
629 Ga0307405_10038268 3300031731 Bacteria 2890
630 Ga0307410_10006628 3300031852 Bacteria 6267
631 Ga0307410_10010799 3300031852 Bacteria 5195
632 Ga0307410_10020750 3300031852 Bacteria 4027
633 Ga0307410_10197254 3300031852 Bacteria 1535
634 Ga0307406_10067160 3300031901 Bacteria 2337
635 Ga0307406_10085323 3300031901 Bacteria 2111
636 Ga0307406_10119703 3300031901 Bacteria 1828
637 Ga0307407_10025234 3300031903 Bacteria 3130
638 Ga0307407_10097785 3300031903 Bacteria 1815
639 Ga0307412_10007500 3300031911 Bacteria 6193
640 Ga0307412_10011418 3300031911 Bacteria 5147
641 Ga0307412_10042123 3300031911 Bacteria 2964
642 Ga0307412_10059177 3300031911 Bacteria 2566
643 Ga0307412_10123369 3300031911 Bacteria 1869
644 Ga0307409_100059744 3300031995 Bacteria 2968
645 Ga0307409_100090402 3300031995 Bacteria 2506
646 Ga0307409_100119509 3300031995 Bacteria 2228
647 Ga0307409_100190927 3300031995 Bacteria 1823
648 Ga0307416_100017660 3300032002 Bacteria 5000
649 Ga0307416_100152556 3300032002 Bacteria 2121
650 Ga0307414_10000282 3300032004 Bacteria 29952
651 Ga0307414_10005141 3300032004 Bacteria 7178
652 Ga0307414_10024308 3300032004 Bacteria 3862
653 Ga0307414_10076696 3300032004 Bacteria 2430
654 Ga0307414_10144718 3300032004 Bacteria 1866
655 Ga0307411_10003502 3300032005 Bacteria 7293
656 Ga0307411_10010029 3300032005 Bacteria 5022
657 Ga0307411_10029816 3300032005 Bacteria 3337
658 Ga0307411_10068249 3300032005 Bacteria 2396
659 Ga0307411_10118260 3300032005 Bacteria 1911
660 Ga0307411_10163783 3300032005 Bacteria 1669
661 Ga0307510_10023125 3300033180 Bacteria 7210
662 Ga0373923_0003840 3300035111 Bacteria 4891
663 Ga0373954_0036329 3300035118 Bacteria 2287
664 Ga0373957_0059298 3300035120 Bacteria 1480
665 Ga0373943_0004396 3300035170 Bacteria 6383
666 Ga0373933_0031231 3300035724 Bacteria 3090
667 Ga0373947_0052311 3300035725 Bacteria 2460
668 Ga0373925_0081558 3300037068 Bacteria 2460
669 Ga0395899_0000352 3300037312 Bacteria 56166
670 Ga0395899_0001871 3300037312 Bacteria 17377
671 Ga0395899_0011391 3300037312 Bacteria 6809
672 Ga0395899_0033670 3300037312 Bacteria 3847
673 Ga0395899_0197483 3300037312 Bacteria 1404
674 Ga0395900_0001013 3300037418 Bacteria 36249
675 Ga0395900_0010908 3300037418 Bacteria 9292
676 Ga0395900_0013797 3300037418 Bacteria 8246
677 Ga0395900_0032067 3300037418 Bacteria 5402
678 Ga0395900_0040109 3300037418 Bacteria 4825
679 Ga0395900_0087116 3300037418 Bacteria 3209
680 Ga0395900_0369404 3300037418 Bacteria 1404
681 Ga0395900_0378945 3300037418 Bacteria 1383
682 Ga0395898_0007714 3300037466 Bacteria 11426
683 Ga0395898_0031262 3300037466 Bacteria 5321
684 Ga0395898_0054381 3300037466 Bacteria 3906
685 Ga0395898_0086996 3300037466 Bacteria 3011
686 Ga0395898_0156445 3300037466 Bacteria 2180
687 Ga0395905_0010264 3300037471 Bacteria 9119
688 Ga0395905_0025207 3300037471 Bacteria 5609
689 Ga0395905_0029740 3300037471 Bacteria 5149
690 Ga0395905_0072740 3300037471 Bacteria 3223
691 Ga0395905_0073194 3300037471 Bacteria 3212
692 Ga0395905_0100192 3300037471 Bacteria 2720
693 Ga0395905_0340424 3300037471 Bacteria 1391
694 Ga0436364_0154840 3300037853 Bacteria 188668
695 Ga0436364_0643906 3300037853 Bacteria 1614
696 Ga0436364_1253462 3300037853 Bacteria 1104
697 Ga0436364_1258768 3300037853 Bacteria 24526
698 Ga0395901_0000047 3300038443 Bacteria 175221
699 Ga0395901_0012089 3300038443 Bacteria 8758
700 Ga0395901_0020559 3300038443 Bacteria 6755
701 Ga0395901_0031102 3300038443 Bacteria 5504
702 Ga0395901_0058555 3300038443 Bacteria 4007
703 Ga0395901_0081838 3300038443 Bacteria 3372
704 Ga0395901_0132205 3300038443 Bacteria 2622
705 Ga0395901_0132454 3300038443 Bacteria 2619
706 Ga0395901_0245337 3300038443 Bacteria 1867
707 Ga0395901_0372707 3300038443 Bacteria 1470
708 Ga0237819_00349 3300038705 Bacteria 16648
709 Ga0436365_0168572 3300039437 Bacteria 1944
710 Ga0436365_0328398 3300039437 Bacteria 22219
711 Ga0436365_0563507 3300039437 Bacteria 8333
712 Ga0436365_1424167 3300039437 Bacteria 1438
713 Ga0436363_0178057 3300039450 Bacteria 1531
714 Ga0436362_1186234 3300039453 Bacteria 18309
715 Ga0439461_0000726 3300041410 Bacteria 4800
716 Ga0439465_0011633 3300041413 Bacteria 2761
717 Ga0439465_0017815 3300041413 Bacteria 2219
718 Ga0451849_1186291 3300041505 Bacteria 2004
719 Ga0439448_0009079 3300042005 Bacteria 2925
720 Ga0439432_000890 3300042006 Bacteria 11210
721 Ga0439449_0067989 3300042007 Bacteria 1313
722 Ga0439455_0006607 3300042012 Bacteria 2415
723 Ga0439455_0012199 3300042012 Bacteria 1925
724 Ga0439457_008051 3300042014 Bacteria 2501
725 Ga0439458_0000132 3300042157 Bacteria 15763
726 Ga0439434_0013839 3300042435 Bacteria 2397
727 Ga0451577_0180355 3300042876 Bacteria 1904
728 Ga0466969_0001195 3300044656 Bacteria 14022
729 Ga0466972_0002734 3300044658 Bacteria 8729
730 Ga0466973_0060404 3300044659 Bacteria 3437
731 Ga0466966_0000077 3300044684 Bacteria 62463
732 Ga0466966_0000965 3300044684 Bacteria 18464
733 Ga0466966_0039103 3300044684 Bacteria 3055
734 Ga0466961_0002009 3300044693 Bacteria 12653
735 Ga0466961_0019991 3300044693 Bacteria 4308
736 Ga0466961_0022497 3300044693 Bacteria 4055
737 Ga0466963_0000618 3300044694 Bacteria 17054
738 Ga0466963_0047048 3300044694 Bacteria 2846
739 Ga0466963_0189062 3300044694 Bacteria 1439
740 Ga0466971_0006686 3300044719 Bacteria 5018
741 Ga0466968_0014273 3300044735 Bacteria 3137
742 Ga0466970_0006019 3300044765 Bacteria 6048
743 Ga0466957_0001231 3300044842 Bacteria 13363
744 Ga0466959_0022715 3300045049 Bacteria 4637
745 Ga0466959_0052349 3300045049 Bacteria 2990
746 Ga0466958_0000370 3300045836 Bacteria 18214
747 Ga0466958_0028656 3300045836 Bacteria 3302
748 Ga0466967_0183055 3300045976 Bacteria 1977
749 Ga0495638_0000689 3300046460 Bacteria 36627
750 Ga0495650_0000158 3300046471 Bacteria 154681
751 Ga0495584_0040483 3300046491 Bacteria 2353
752 Ga0495585_0011237 3300046492 Bacteria 5304
753 Ga0495583_0000023 3300046506 Bacteria 280019
754 Ga0495583_0002516 3300046506 Bacteria 15513
755 Ga0495583_0009695 3300046506 Bacteria 5721
756 Ga0495583_0014626 3300046506 Bacteria 4317
757 Ga0495606_0000795 3300046507 Bacteria 48219
758 Ga0495643_0001769 3300046522 Bacteria 18567
759 Ga0495643_0004776 3300046522 Bacteria 9352
760 Ga0495648_0000537 3300046524 Bacteria 40955
761 Ga0495648_0035561 3300046524 Bacteria 3228
762 Ga0495648_0043111 3300046524 Bacteria 2832
763 Ga0495663_0000478 3300046525 Bacteria 14573
764 Ga0495663_0005034 3300046525 Bacteria 3692
765 Ga0495654_0001314 3300046530 Bacteria 17382
766 Ga0495621_0000160 3300046539 Bacteria 15007
767 Ga0495622_0020294 3300046557 Bacteria 3094
768 Ga0495633_0001403 3300046558 Bacteria 18789
769 Ga0495668_0000002 3300046616 Bacteria 763179
770 Ga0495668_0000090 3300046616 Bacteria 144763
771 Ga0495668_0003961 3300046616 Bacteria 10794
772 Ga0495668_0010901 3300046616 Bacteria 5474
773 Ga0495668_0021700 3300046616 Bacteria 3678
774 Ga0495668_0037700 3300046616 Bacteria 2704
775 Ga0495611_0010335 3300046648 Bacteria 3949
776 Ga0495625_0000153 3300046660 Bacteria 105123
777 Ga0495625_0000722 3300046660 Bacteria 46349
778 Ga0495625_0000740 3300046660 Bacteria 45562
779 Ga0495625_0039622 3300046660 Bacteria 3439
780 Ga0495661_0038173 3300046665 Bacteria 2994
781 Ga0495669_0000262 3300046684 Bacteria 30336
782 Ga0495670_0000005 3300046691 Bacteria 289725
783 Ga0495671_0044356 3300046692 Bacteria 2230
784 Ga0495589_0026704 3300046794 Bacteria 2924
785 Ga0495600_0064333 3300046809 Bacteria 2397
786 Ga0495683_0004126 3300047323 Bacteria 8316
787 Ga0495687_000434 3300047443 Bacteria 51724
788 Ga0495687_001237 3300047443 Bacteria 24378
789 Ga0495681_0002298 3300047470 Bacteria 13742
790 Ga0495681_0029178 3300047470 Bacteria 2827
791 Ga0495686_0000340 3300047472 Bacteria 76984
792 Ga0495686_0000363 3300047472 Bacteria 73366
793 Ga0495686_0000383 3300047472 Bacteria 70528
794 Ga0495686_0009061 3300047472 Bacteria 7219
795 Ga0495686_0009245 3300047472 Bacteria 7128
796 Ga0495686_0026459 3300047472 Bacteria 3795
797 Ga0495686_0068818 3300047472 Bacteria 2184
798 Ga0495602_0035210 3300048088 Bacteria 4671
799 Ga0496101_0101789 3300048904 Bacteria 2151
800 Ga0496101_0125751 3300048904 Bacteria 1942
801 Ga0496102_0000034 3300048905 Bacteria 213826
802 Ga0496102_0000125 3300048905 Bacteria 109075
803 Ga0496102_0001152 3300048905 Bacteria 24155
804 Ga0496103_0000026 3300048906 Bacteria 213826
805 Ga0496103_0000972 3300048906 Bacteria 20284
806 Ga0496103_0005595 3300048906 Bacteria 7516
807 Ga0496104_0068659 3300048907 Bacteria 3368
808 Ga0496104_0081383 3300048907 Bacteria 3088
809 Ga0496104_0199707 3300048907 Bacteria 1912
810 Ga0496105_0001064 3300048908 Bacteria 19031
811 Ga0496105_0052708 3300048908 Bacteria 3360
812 Ga0496106_0025607 3300048909 Bacteria 4392
813 Ga0496107_0129957 3300048910 Bacteria 1859
814 Ga0496108_0000529 3300048911 Bacteria 29960
815 Ga0496108_0000634 3300048911 Bacteria 27402
816 Ga0496109_0051650 3300048912 Bacteria 3744
817 Ga0496111_0090443 3300048914 Bacteria 2242
818 Ga0496111_0103463 3300048914 Bacteria 2094
819 Ga0496111_0154382 3300048914 Bacteria 1703
820 Ga0496113_0006759 3300048916 Bacteria 7312
821 Ga0496114_0033893 3300048917 Bacteria 4210
822 Ga0496114_0226548 3300048917 Bacteria 1642
823 Ga0496115_0000142 3300048918 Bacteria 65915
824 Ga0496115_0000711 3300048918 Bacteria 24655
825 Ga0496116_0000926 3300048919 Bacteria 36211
826 Ga0496116_0012425 3300048919 Bacteria 6958
827 Ga0496116_0062550 3300048919 Bacteria 2403
828 Ga0496117_0000072 3300048920 Bacteria 238366
829 Ga0496117_0001219 3300048920 Bacteria 38563
830 Ga0496117_0024330 3300048920 Bacteria 4793
831 Ga0496117_0024346 3300048920 Bacteria 4791
832 Ga0496117_0025509 3300048920 Bacteria 4647
833 Ga0496117_0089906 3300048920 Bacteria 1981
834 Ga0496118_0000030 3300048921 Bacteria 339946
835 Ga0496118_0000285 3300048921 Bacteria 88805
836 Ga0496118_0000946 3300048921 Bacteria 45410
837 Ga0496118_0032325 3300048921 Bacteria 4313
838 Ga0496118_0035080 3300048921 Bacteria 4080
839 Ga0496118_0067799 3300048921 Bacteria 2595
840 Ga0496118_0230009 3300048921 Bacteria 1071
841 Ga0496119_0018557 3300048922 Bacteria 5171
842 Ga0496119_0020782 3300048922 Bacteria 4770
843 Ga0496119_0118603 3300048922 Bacteria 1458
844 Ga0496121_0000296 3300048924 Bacteria 103215
845 Ga0496121_0004218 3300048924 Bacteria 19590
846 Ga0496121_0006365 3300048924 Bacteria 14711
847 Ga0496121_0038748 3300048924 Bacteria 4213
848 Ga0496121_0045897 3300048924 Bacteria 3747
849 Ga0496121_0154125 3300048924 Bacteria 1687
850 Ga0496122_0002487 3300048925 Bacteria 26053
851 Ga0496122_0005545 3300048925 Bacteria 14960
852 Ga0496123_0001967 3300048926 Bacteria 26671
853 Ga0496123_0016038 3300048926 Bacteria 6109
854 Ga0496123_0039606 3300048926 Bacteria 3294
855 Ga0496123_0057850 3300048926 Bacteria 2520
856 Ga0496124_0000061 3300048927 Bacteria 238225
857 Ga0496124_0000320 3300048927 Bacteria 88704
858 Ga0496124_0000328 3300048927 Bacteria 87848
859 Ga0496124_0002196 3300048927 Bacteria 26040
860 Ga0496124_0008089 3300048927 Bacteria 11053
861 Ga0496124_0244087 3300048927 Bacteria 1333
862 Ga0496125_0001234 3300048928 Bacteria 38266
863 Ga0496125_0014557 3300048928 Bacteria 7657
864 Ga0496125_0170682 3300048928 Bacteria 1463
865 Ga0496126_0000655 3300048929 Bacteria 64225
866 Ga0496126_0006832 3300048929 Bacteria 12660
867 Ga0496126_0071545 3300048929 Bacteria 3087
868 Ga0501292_000040 3300049515 Bacteria 31058
869 Ga0501294_000062 3300049517 Bacteria 11348
870 Ga0501033_0017961 3300049570 Bacteria 5340
871 Ga0501033_0073568 3300049570 Bacteria 2509
872 Ga0501036_0384890 3300049572 Bacteria 1170
873 Ga0501037_0031601 3300049573 Bacteria 3909
874 Ga0501038_0179252 3300049574 Bacteria 1710
875 Ga0501039_0013849 3300049575 Bacteria 6170
876 Ga0501043_0014561 3300049579 Bacteria 6158
877 Ga0501043_0078505 3300049579 Bacteria 2594
878 Ga0501046_0083082 3300049580 Bacteria 2473
879 Ga0501047_0000938 3300049581 Bacteria 29563
880 Ga0501047_0065045 3300049581 Bacteria 3516
881 Ga0501047_0250643 3300049581 Bacteria 1619
882 Ga0501202_004956 3300049652 Bacteria 2345
883 Ga0501223_000541 3300049663 Bacteria 9113
884 Ga0501223_008904 3300049663 Bacteria 2041
885 Ga0501224_000457 3300049664 Bacteria 4923
886 Ga0501227_003138 3300049665 Bacteria 3592
887 Ga0501235_010333 3300049669 Bacteria 2041
888 Ga0501257_000053 3300049686 Bacteria 31509
889 Ga0501259_001047 3300049688 Bacteria 4609
890 Ga0501261_000079 3300049690 Bacteria 16304
891 Ga0501221_001486 3300049704 Bacteria 3885
892 Ga0501225_0006238 3300049705 Bacteria 3483
893 Ga0501245_002056 3300049708 Bacteria 2668
894 Ga0501241_009043 3300049758 Bacteria 1815
895 Ga0501276_002049 3300049773 Bacteria 1405
896 Ga0501279_000008 3300049775 Bacteria 125267
897 Ga0501280_000013 3300049776 Bacteria 59205
898 Ga0501280_004421 3300049776 Bacteria 2070
899 Ga0501281_00139 3300049777 Bacteria 8549
900 Ga0501282_000442 3300049778 Bacteria 4934
901 Ga0501283_000845 3300049779 Bacteria 4028
902 Ga0501035_0040305 3300049822 Bacteria 4221
903 Ga0501044_0080878 3300049823 Bacteria 3290
904 Ga0501044_0220053 3300049823 Bacteria 1849
905 nmdc:mga06r32_4589_c1 3300050510 Bacteria 12385
906 Ga0500610_0000036 3300053079 Bacteria 46301
907 Ga0500643_000066 3300053087 Bacteria 119317
908 Ga0500643_000766 3300053087 Bacteria 20969
909 Ga0500643_004056 3300053087 Bacteria 6755
910 Ga0500643_004883 3300053087 Bacteria 5911
911 Ga0500643_006378 3300053087 Bacteria 4935
912 Ga0500643_010962 3300053087 Bacteria 3340
913 Ga0500643_017880 3300053087 Bacteria 2363
914 Ga0500566_0007018 3300053094 Bacteria 6665
915 Ga0500641_0016772 3300053096 Bacteria 2730
916 Ga0500641_0023393 3300053096 Bacteria 2376
917 Ga0500641_0024501 3300053096 Bacteria 2327
918 Ga0500555_001230 3300053103 Bacteria 8238
919 Ga0500562_034585 3300053108 Bacteria 1337
920 Ga0500592_000093 3300053116 Bacteria 20146
921 Ga0500592_001148 3300053116 Bacteria 4308
922 Ga0500595_000411 3300053119 Bacteria 27292
923 Ga0500595_002272 3300053119 Bacteria 9682
924 Ga0500597_003737 3300053120 Bacteria 4564
925 Ga0500642_0007206 3300053130 Bacteria 3721
926 Ga0500658_0001013 3300053134 Bacteria 11466
927 Ga0500658_0003056 3300053134 Bacteria 6405
928 Ga0500658_0008975 3300053134 Bacteria 3689
929 Ga0500559_0026779 3300053136 Bacteria 2458
930 Ga0500568_0001671 3300053139 Bacteria 13891
931 Ga0500568_0004177 3300053139 Bacteria 7793
932 Ga0500568_0019020 3300053139 Bacteria 2995
933 Ga0500573_0001728 3300053140 Bacteria 10606
934 Ga0500577_0014755 3300053142 Bacteria 2424
935 Ga0500590_000428 3300053148 Bacteria 14129
936 Ga0500604_0000240 3300053151 Bacteria 15732
937 Ga0500604_0010303 3300053151 Bacteria 2499
938 Ga0500604_0013841 3300053151 Bacteria 2190
939 Ga0500616_0001040 3300053153 Bacteria 29324
940 Ga0500616_0008125 3300053153 Bacteria 6560
941 Ga0500622_0003987 3300053156 Bacteria 9523
942 Ga0500624_000074 3300053157 Bacteria 57107
943 Ga0500627_0000010 3300053158 Bacteria 152372
944 Ga0500627_0000117 3300053158 Bacteria 25223
945 Ga0500627_0000417 3300053158 Bacteria 11494
946 Ga0500636_0008119 3300053177 Bacteria 6081
947 Ga0500637_0000261 3300053178 Bacteria 19714
948 Ga0500570_020728 3300053724 Bacteria 3667
949 Ga0500645_000005 3300053730 Bacteria 284466
950 Ga0500645_001004 3300053730 Bacteria 15898
951 Ga0500552_002023 3300053733 Bacteria 1954
952 Ga0500596_002871 3300053735 Bacteria 3356
953 Ga0466962_0000478 3300061719 Bacteria 17336
954 Ga0466962_0002189 3300061719 Bacteria 9244

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0230009 Ga0496118_0230009_179_1057 284
2 3300005459 Ga0068867_100142340 Ga0068867_1001423402 295
3 3300037853 Ga0436364_1253462 Ga0436364_1253462_162_1094 306
4 3300049581 Ga0501047_0250643 Ga0501047_0250643_10_951 311
5 3300049704 Ga0501221_001486 Ga0501221_001486_1361_2317 318
6 3300049773 Ga0501276_002049 Ga0501276_002049_439_1395 318
7 3300042876 Ga0451577_0180355 Ga0451577_0180355_186_1370 329
8 3300025919 Ga0207657_10094929 Ga0207657_100949291 331
9 3300042012 Ga0439455_0012199 Ga0439455_0012199_13_1026 331
10 3300031456 Ga0307513_10020531 Ga0307513_100205316 337
11 3300025940 Ga0207691_10126496 Ga0207691_101264962 339
12 3300028786 Ga0307517_10037646 Ga0307517_100376462 339
13 3300003320 rootH2_10060186 rootH2_100601861 343
14 3300028786 Ga0307517_10049716 Ga0307517_100497162 343
15 3300032002 Ga0307416_100152556 Ga0307416_1001525562 343
16 3300047472 Ga0495686_0000383 Ga0495686_0000383_1305_2549 343
17 3300053139 Ga0500568_0019020 Ga0500568_0019020_435_1658 343
18 3300003215 JGI25153J46596_10000152 JGI25153J46596_1000015242 344
19 3300025297 Ga0209758_1000035 Ga0209758_100003543 344
20 3300046491 Ga0495584_0040483 Ga0495584_0040483_874_2097 344
21 3300046522 Ga0495643_0004776 Ga0495643_0004776_5269_6492 344
22 3300048924 Ga0496121_0000296 Ga0496121_0000296_65783_67006 345
23 3300027876 Ga0209974_10025610 Ga0209974_100256102 346
24 3300001915 JGI24741J21665_1000309 JGI24741J21665_10003092 348
25 3300001990 JGI24737J22298_10000409 JGI24737J22298_100004094 348
26 3300003759 Ga0055525_1000035 Ga0055525_1000035237 348
27 3300003762 Ga0055542_1000132 Ga0055542_100013298 348
28 3300003763 Ga0055529_1000088 Ga0055529_100008862 348
29 3300005327 Ga0070658_10005096 Ga0070658_100050967 348
30 3300005331 Ga0070670_100175919 Ga0070670_1001759192 348
31 3300005344 Ga0070661_100003219 Ga0070661_1000032198 348
32 3300005356 Ga0070674_100001464 Ga0070674_1000014646 348
33 3300005356 Ga0070674_100005675 Ga0070674_1000056752 348
34 3300005456 Ga0070678_100001692 Ga0070678_1000016924 348
35 3300005457 Ga0070662_100065602 Ga0070662_1000656022 348
36 3300005564 Ga0070664_100149061 Ga0070664_1001490612 348
37 3300005834 Ga0068851_10083062 Ga0068851_100830622 348
38 3300006358 Ga0068871_100062908 Ga0068871_1000629082 348
39 3300009148 Ga0105243_10000091 Ga0105243_1000009162 348
40 3300009174 Ga0105241_10008895 Ga0105241_100088955 348
41 3300013100 Ga0157373_10097999 Ga0157373_100979992 348
42 3300013102 Ga0157371_10000048 Ga0157371_10000048120 348
43 3300025230 Ga0209563_100047 Ga0209563_100047118 348
44 3300025253 Ga0209677_105552 Ga0209677_1055523 348
45 3300025254 Ga0209148_1000017 Ga0209148_100001759 348
46 3300025261 Ga0209233_1012861 Ga0209233_10128612 348
47 3300025272 Ga0209455_1000005 Ga0209455_100000559 348
48 3300025321 Ga0207656_10002614 Ga0207656_100026145 348
49 3300025904 Ga0207647_10050143 Ga0207647_100501433 348
50 3300025909 Ga0207705_10000557 Ga0207705_1000055710 348
51 3300025911 Ga0207654_10000613 Ga0207654_100006136 348
52 3300025914 Ga0207671_10104485 Ga0207671_101044852 348
53 3300025919 Ga0207657_10082220 Ga0207657_100822202 348
54 3300025920 Ga0207649_10000440 Ga0207649_100004403 348
55 3300025924 Ga0207694_10031239 Ga0207694_100312392 348
56 3300025932 Ga0207690_10087863 Ga0207690_100878632 348
57 3300025933 Ga0207706_10023849 Ga0207706_100238493 348
58 3300025935 Ga0207709_10000018 Ga0207709_10000018195 348
59 3300025937 Ga0207669_10000084 Ga0207669_1000008422 348
60 3300025937 Ga0207669_10001886 Ga0207669_100018864 348
61 3300025949 Ga0207667_10000004 Ga0207667_1000000454 348
62 3300025960 Ga0207651_10010568 Ga0207651_100105682 348
63 3300025981 Ga0207640_10000513 Ga0207640_100005133 348
64 3300026041 Ga0207639_10002804 Ga0207639_100028042 348
65 3300026067 Ga0207678_10003023 Ga0207678_1000302313 348
66 3300026078 Ga0207702_10000708 Ga0207702_1000070839 348
67 3300026116 Ga0207674_10139136 Ga0207674_101391362 348
68 3300026121 Ga0207683_10007669 Ga0207683_100076692 348
69 3300026142 Ga0207698_10016934 Ga0207698_100169344 348
70 3300041505 Ga0451849_1186291 Ga0451849_1186291_36_1283 348
71 3300046492 Ga0495585_0011237 Ga0495585_0011237_1758_2981 348
72 3300046506 Ga0495583_0014626 Ga0495583_0014626_11_1234 348
73 3300046507 Ga0495606_0000795 Ga0495606_0000795_3428_4651 348
74 3300046522 Ga0495643_0001769 Ga0495643_0001769_8324_9547 348
75 3300046524 Ga0495648_0000537 Ga0495648_0000537_28822_30045 348
76 3300046525 Ga0495663_0000478 Ga0495663_0000478_9537_10760 348
77 3300046558 Ga0495633_0001403 Ga0495633_0001403_15795_17018 348
78 3300046616 Ga0495668_0000090 Ga0495668_0000090_47968_49191 348
79 3300046660 Ga0495625_0000722 Ga0495625_0000722_20701_21924 348
80 3300046660 Ga0495625_0039622 Ga0495625_0039622_20_1243 348
81 3300046684 Ga0495669_0000262 Ga0495669_0000262_1895_3118 348
82 3300046692 Ga0495671_0044356 Ga0495671_0044356_17_1240 348
83 3300047323 Ga0495683_0004126 Ga0495683_0004126_4691_5914 348
84 3300047443 Ga0495687_000434 Ga0495687_000434_39560_40783 348
85 3300047443 Ga0495687_001237 Ga0495687_001237_10878_12101 348
86 3300047470 Ga0495681_0002298 Ga0495681_0002298_422_1645 348
87 3300048905 Ga0496102_0000125 Ga0496102_0000125_52067_53290 348
88 3300048906 Ga0496103_0000972 Ga0496103_0000972_8198_9421 348
89 3300048907 Ga0496104_0081383 Ga0496104_0081383_1663_2886 348
90 3300048908 Ga0496105_0001064 Ga0496105_0001064_12955_14178 348
91 3300048917 Ga0496114_0033893 Ga0496114_0033893_1642_2865 348
92 3300048918 Ga0496115_0000142 Ga0496115_0000142_10938_12161 348
93 3300048919 Ga0496116_0012425 Ga0496116_0012425_4038_5261 348
94 3300048920 Ga0496117_0001219 Ga0496117_0001219_26440_27663 348
95 3300048921 Ga0496118_0000285 Ga0496118_0000285_76563_77786 348
96 3300048924 Ga0496121_0004218 Ga0496121_0004218_7429_8652 348
97 3300048925 Ga0496122_0005545 Ga0496122_0005545_6186_7409 348
98 3300048927 Ga0496124_0000320 Ga0496124_0000320_76546_77769 348
99 3300048928 Ga0496125_0001234 Ga0496125_0001234_10760_11983 348
100 3300048929 Ga0496126_0000655 Ga0496126_0000655_10933_12156 348
101 3300053079 Ga0500610_0000036 Ga0500610_0000036_40813_42036 348
102 3300053730 Ga0500645_000005 Ga0500645_000005_44143_45366 348
103 3300005347 Ga0070668_100243352 Ga0070668_1002433521 350
104 3300046660 Ga0495625_0000153 Ga0495625_0000153_3810_5045 350
105 3300005617 Ga0068859_100006890 Ga0068859_1000068905 351
106 3300006931 Ga0097620_100006890 Ga0097620_1000068907 351
107 3300044656 Ga0466969_0001195 Ga0466969_0001195_6737_7957 351
108 3300044684 Ga0466966_0000965 Ga0466966_0000965_9225_10445 351
109 3300044693 Ga0466961_0002009 Ga0466961_0002009_7542_8762 351
110 3300044694 Ga0466963_0189062 Ga0466963_0189062_59_1279 351
111 3300044765 Ga0466970_0006019 Ga0466970_0006019_1390_2610 351
112 3300044842 Ga0466957_0001231 Ga0466957_0001231_11238_12458 351
113 3300045049 Ga0466959_0022715 Ga0466959_0022715_2505_3725 351
114 3300045836 Ga0466958_0000370 Ga0466958_0000370_9262_10482 351
115 3300053108 Ga0500562_034585 Ga0500562_034585_28_1203 351
116 3300061719 Ga0466962_0002189 Ga0466962_0002189_7724_8944 351
117 3300001904 JGI24736J21556_1000449 JGI24736J21556_10004496 352
118 3300005616 Ga0068852_100088601 Ga0068852_1000886012 352
119 3300013100 Ga0157373_10219705 Ga0157373_102197051 352
120 3300013102 Ga0157371_10018161 Ga0157371_100181614 352
121 3300013105 Ga0157369_10001135 Ga0157369_1000113519 352
122 3300013105 Ga0157369_10021523 Ga0157369_100215235 352
123 3300013296 Ga0157374_10032145 Ga0157374_100321452 352
124 3300025909 Ga0207705_10013186 Ga0207705_100131865 352
125 3300025913 Ga0207695_10003233 Ga0207695_1000323315 352
126 3300025913 Ga0207695_10028978 Ga0207695_100289785 352
127 3300025949 Ga0207667_10045189 Ga0207667_100451894 352
128 3300025949 Ga0207667_10204668 Ga0207667_102046682 352
129 3300026067 Ga0207678_10096724 Ga0207678_100967242 352
130 3300026078 Ga0207702_10011116 Ga0207702_100111166 352
131 3300026078 Ga0207702_10013509 Ga0207702_100135095 352
132 3300026078 Ga0207702_10027861 Ga0207702_100278614 352
133 3300026116 Ga0207674_10131784 Ga0207674_101317842 352
134 3300026142 Ga0207698_10025984 Ga0207698_100259843 352
135 3300037312 Ga0395899_0001871 Ga0395899_0001871_10770_11990 352
136 3300037312 Ga0395899_0197483 Ga0395899_0197483_72_1292 352
137 3300037418 Ga0395900_0087116 Ga0395900_0087116_1055_2275 352
138 3300037418 Ga0395900_0369404 Ga0395900_0369404_113_1333 352
139 3300037466 Ga0395898_0031262 Ga0395898_0031262_1755_2975 352
140 3300037466 Ga0395898_0054381 Ga0395898_0054381_2574_3794 352
141 3300037466 Ga0395898_0086996 Ga0395898_0086996_1330_2553 352
142 3300038443 Ga0395901_0012089 Ga0395901_0012089_235_1455 352
143 3300038443 Ga0395901_0081838 Ga0395901_0081838_1468_2688 352
144 3300044693 Ga0466961_0022497 Ga0466961_0022497_624_1844 352
145 3300044694 Ga0466963_0047048 Ga0466963_0047048_862_2082 352
146 3300005329 Ga0070683_100125426 Ga0070683_1001254261 353
147 3300005548 Ga0070665_100000206 Ga0070665_10000020682 353
148 3300028379 Ga0268266_10000002 Ga0268266_100000021649 353
149 3300046471 Ga0495650_0000158 Ga0495650_0000158_97848_99071 353
150 3300046506 Ga0495583_0002516 Ga0495583_0002516_6861_8084 353
151 3300046557 Ga0495622_0020294 Ga0495622_0020294_1828_3051 353
152 3300046665 Ga0495661_0038173 Ga0495661_0038173_1255_2478 353
153 3300046809 Ga0495600_0064333 Ga0495600_0064333_798_2021 353
154 3300047472 Ga0495686_0000340 Ga0495686_0000340_49548_50768 353
155 3300049572 Ga0501036_0384890 Ga0501036_0384890_20_1096 353
156 3300053119 Ga0500595_000411 Ga0500595_000411_18578_19801 353
157 3300053177 Ga0500636_0008119 Ga0500636_0008119_3587_4807 353
158 3300053735 Ga0500596_002871 Ga0500596_002871_1291_2511 353
159 3300046506 Ga0495583_0000023 Ga0495583_0000023_20393_21637 354
160 3300046648 Ga0495611_0010335 Ga0495611_0010335_1226_2470 354
161 3300053103 Ga0500555_001230 Ga0500555_001230_3961_5205 354
162 3300021388 Ga0213875_10007016 Ga0213875_100070162 355
163 3300037853 Ga0436364_1258768 Ga0436364_1258768_6898_8121 355
164 3300048926 Ga0496123_0057850 Ga0496123_0057850_52_1296 355
165 3300049688 Ga0501259_001047 Ga0501259_001047_1228_2418 355
166 3300005548 Ga0070665_100000011 Ga0070665_100000011357 356
167 3300028379 Ga0268266_10000058 Ga0268266_10000058172 356
168 3300033180 Ga0307510_10023125 Ga0307510_100231252 356
169 3300037853 Ga0436364_0643906 Ga0436364_0643906_276_1496 356
170 3300031995 Ga0307409_100119509 Ga0307409_1001195092 357
171 3300038443 Ga0395901_0058555 Ga0395901_0058555_2093_3316 357
172 3300005327 Ga0070658_10179891 Ga0070658_101798912 358
173 3300005338 Ga0068868_100000054 Ga0068868_10000005412 358
174 3300005339 Ga0070660_100010420 Ga0070660_1000104203 358
175 3300005366 Ga0070659_100000099 Ga0070659_10000009935 358
176 3300009098 Ga0105245_10160856 Ga0105245_101608562 358
177 3300025909 Ga0207705_10013414 Ga0207705_100134142 358
178 3300025919 Ga0207657_10018207 Ga0207657_100182074 358
179 3300025932 Ga0207690_10000005 Ga0207690_10000005557 358
180 3300026023 Ga0207677_10000074 Ga0207677_1000007451 358
181 3300035118 Ga0373954_0036329 Ga0373954_0036329_764_1987 358
182 3300038443 Ga0395901_0372707 Ga0395901_0372707_132_1370 358
183 3300039437 Ga0436365_1424167 Ga0436365_1424167_146_1321 358
184 3300047472 Ga0495686_0009245 Ga0495686_0009245_1755_3029 358
185 3300049758 Ga0501241_009043 Ga0501241_009043_20_1246 358
186 3300005327 Ga0070658_10181235 Ga0070658_101812352 359
187 3300005564 Ga0070664_100013891 Ga0070664_1000138913 359
188 3300025945 Ga0207679_10005298 Ga0207679_100052986 359
189 3300031456 Ga0307513_10095623 Ga0307513_100956232 359
190 3300031852 Ga0307410_10020750 Ga0307410_100207503 359
191 3300031995 Ga0307409_100059744 Ga0307409_1000597442 359
192 3300032005 Ga0307411_10003502 Ga0307411_100035022 359
193 3300044684 Ga0466966_0000077 Ga0466966_0000077_18295_19518 359
194 3300046506 Ga0495583_0009695 Ga0495583_0009695_3149_4372 359
195 3300046616 Ga0495668_0021700 Ga0495668_0021700_1145_2368 359
196 3300047470 Ga0495681_0029178 Ga0495681_0029178_765_1994 359
197 3300053087 Ga0500643_004883 Ga0500643_004883_4331_5560 359
198 3300053087 Ga0500643_006378 Ga0500643_006378_1062_2285 359
199 3300053094 Ga0500566_0007018 Ga0500566_0007018_2735_3964 359
200 3300003215 JGI25153J46596_10009386 JGI25153J46596_100093863 360
201 3300003773 Ga0055537_1006278 Ga0055537_10062782 360
202 3300003791 Ga0055530_10019461 Ga0055530_100194612 360
203 3300003794 Ga0055531_10012020 Ga0055531_100120203 360
204 3300005435 Ga0070714_100097808 Ga0070714_1000978082 360
205 3300005618 Ga0068864_100003324 Ga0068864_1000033246 360
206 3300005842 Ga0068858_100039028 Ga0068858_1000390283 360
207 3300009177 Ga0105248_10006757 Ga0105248_100067573 360
208 3300025245 Ga0207425_1008127 Ga0207425_10081272 360
209 3300025263 Ga0209565_1000012 Ga0209565_1000012453 360
210 3300025273 Ga0209673_1011606 Ga0209673_10116063 360
211 3300025291 Ga0209675_1009729 Ga0209675_10097293 360
212 3300025297 Ga0209758_1024941 Ga0209758_10249413 360
213 3300025298 Ga0209050_1007931 Ga0209050_10079317 360
214 3300025299 Ga0209256_1000012 Ga0209256_1000012644 360
215 3300025304 Ga0209257_1002734 Ga0209257_100273415 360
216 3300025929 Ga0207664_10085526 Ga0207664_100855262 360
217 3300025941 Ga0207711_10001929 Ga0207711_100019295 360
218 3300026035 Ga0207703_10002306 Ga0207703_100023062 360
219 3300026095 Ga0207676_10002984 Ga0207676_100029844 360
220 3300037418 Ga0395900_0032067 Ga0395900_0032067_836_2059 360
221 3300005364 Ga0070673_100207136 Ga0070673_1002071362 361
222 3300025315 Ga0207697_10024522 Ga0207697_100245222 361
223 3300025926 Ga0207659_10117275 Ga0207659_101172752 361
224 3300025960 Ga0207651_10012180 Ga0207651_100121801 361
225 3300031911 Ga0307412_10011418 Ga0307412_100114184 361
226 3300037466 Ga0395898_0156445 Ga0395898_0156445_916_2136 361
227 3300053134 Ga0500658_0001013 Ga0500658_0001013_1858_3087 361
228 3300053140 Ga0500573_0001728 Ga0500573_0001728_1986_3203 361
229 3300001904 JGI24736J21556_1003770 JGI24736J21556_10037702 362
230 3300001990 JGI24737J22298_10000318 JGI24737J22298_100003184 362
231 3300002239 JGI24034J26672_10002382 JGI24034J26672_100023822 362
232 3300005327 Ga0070658_10055581 Ga0070658_100555813 362
233 3300005334 Ga0068869_100011642 Ga0068869_1000116423 362
234 3300005338 Ga0068868_100002850 Ga0068868_10000285010 362
235 3300005339 Ga0070660_100011855 Ga0070660_1000118552 362
236 3300005340 Ga0070689_100065973 Ga0070689_1000659732 362
237 3300005344 Ga0070661_100022185 Ga0070661_1000221853 362
238 3300005353 Ga0070669_100001444 Ga0070669_10000144417 362
239 3300005367 Ga0070667_100000966 Ga0070667_10000096623 362
240 3300005459 Ga0068867_100030357 Ga0068867_1000303571 362
241 3300005539 Ga0068853_100001960 Ga0068853_10000196014 362
242 3300005543 Ga0070672_100002199 Ga0070672_10000219912 362
243 3300005577 Ga0068857_100001199 Ga0068857_1000011997 362
244 3300005578 Ga0068854_100016941 Ga0068854_1000169413 362
245 3300005616 Ga0068852_100000509 Ga0068852_1000005096 362
246 3300005617 Ga0068859_100000709 Ga0068859_10000070935 362
247 3300005618 Ga0068864_100000484 Ga0068864_10000048435 362
248 3300005719 Ga0068861_100124692 Ga0068861_1001246922 362
249 3300005841 Ga0068863_100016750 Ga0068863_1000167506 362
250 3300005842 Ga0068858_100030812 Ga0068858_1000308123 362
251 3300005843 Ga0068860_100003211 Ga0068860_10000321114 362
252 3300006881 Ga0068865_100003176 Ga0068865_1000031762 362
253 3300006931 Ga0097620_100000709 Ga0097620_10000070935 362
254 3300009098 Ga0105245_10000679 Ga0105245_1000067918 362
255 3300009177 Ga0105248_10000122 Ga0105248_1000012265 362
256 3300013102 Ga0157371_10002922 Ga0157371_100029227 362
257 3300013104 Ga0157370_10219756 Ga0157370_102197562 362
258 3300013306 Ga0163162_10010331 Ga0163162_100103317 362
259 3300013307 Ga0157372_10057511 Ga0157372_100575113 362
260 3300015690 Ga0183363_1006 Ga0183363_1006142 362
261 3300025315 Ga0207697_10000002 Ga0207697_1000000221 362
262 3300025899 Ga0207642_10069647 Ga0207642_100696472 362
263 3300025901 Ga0207688_10000348 Ga0207688_1000034815 362
264 3300025907 Ga0207645_10035093 Ga0207645_100350933 362
265 3300025909 Ga0207705_10043167 Ga0207705_100431672 362
266 3300025919 Ga0207657_10000542 Ga0207657_1000054222 362
267 3300025923 Ga0207681_10049898 Ga0207681_100498982 362
268 3300025927 Ga0207687_10000426 Ga0207687_100004266 362
269 3300025932 Ga0207690_10003555 Ga0207690_100035555 362
270 3300025932 Ga0207690_10123424 Ga0207690_101234242 362
271 3300025936 Ga0207670_10073401 Ga0207670_100734012 362
272 3300025938 Ga0207704_10031091 Ga0207704_100310912 362
273 3300025940 Ga0207691_10034126 Ga0207691_100341264 362
274 3300025941 Ga0207711_10001807 Ga0207711_1000180713 362
275 3300025942 Ga0207689_10000125 Ga0207689_100001258 362
276 3300025949 Ga0207667_10001485 Ga0207667_1000148513 362
277 3300025960 Ga0207651_10000306 Ga0207651_100003065 362
278 3300025981 Ga0207640_10000349 Ga0207640_100003495 362
279 3300025986 Ga0207658_10008242 Ga0207658_100082425 362
280 3300026023 Ga0207677_10024714 Ga0207677_100247142 362
281 3300026035 Ga0207703_10003797 Ga0207703_100037974 362
282 3300026041 Ga0207639_10000400 Ga0207639_1000040025 362
283 3300026088 Ga0207641_10032055 Ga0207641_100320554 362
284 3300026118 Ga0207675_100172796 Ga0207675_1001727962 362
285 3300026142 Ga0207698_10004747 Ga0207698_100047474 362
286 3300039450 Ga0436363_0178057 Ga0436363_0178057_210_1406 362
287 3300053142 Ga0500577_0014755 Ga0500577_0014755_693_1952 362
288 3300005327 Ga0070658_10003656 Ga0070658_100036562 363
289 3300005336 Ga0070680_100000502 Ga0070680_1000005022 363
290 3300005563 Ga0068855_100341644 Ga0068855_1003416441 363
291 3300025904 Ga0207647_10159653 Ga0207647_101596532 363
292 3300025909 Ga0207705_10000469 Ga0207705_1000046924 363
293 3300025917 Ga0207660_10002464 Ga0207660_100024642 363
294 3300025919 Ga0207657_10000864 Ga0207657_1000086424 363
295 3300026067 Ga0207678_10003861 Ga0207678_100038612 363
296 3300032005 Ga0307411_10118260 Ga0307411_101182602 363
297 3300037312 Ga0395899_0000352 Ga0395899_0000352_32825_34045 363
298 3300037418 Ga0395900_0001013 Ga0395900_0001013_23479_24699 363
299 3300037466 Ga0395898_0007714 Ga0395898_0007714_905_2125 363
300 3300037471 Ga0395905_0025207 Ga0395905_0025207_419_1642 363
301 3300037471 Ga0395905_0073194 Ga0395905_0073194_1192_2415 363
302 3300038443 Ga0395901_0000047 Ga0395901_0000047_106344_107564 363
303 3300042007 Ga0439449_0067989 Ga0439449_0067989_30_1208 363
304 3300046691 Ga0495670_0000005 Ga0495670_0000005_229309_230541 363
305 3300002067 JGI24735J21928_10015663 JGI24735J21928_100156632 364
306 3300005331 Ga0070670_100004056 Ga0070670_1000040569 364
307 3300005335 Ga0070666_10000898 Ga0070666_1000089815 364
308 3300005344 Ga0070661_100025521 Ga0070661_1000255212 364
309 3300005364 Ga0070673_100004714 Ga0070673_1000047145 364
310 3300005367 Ga0070667_100055587 Ga0070667_1000555872 364
311 3300005548 Ga0070665_100021367 Ga0070665_1000213673 364
312 3300005564 Ga0070664_100057160 Ga0070664_1000571603 364
313 3300005618 Ga0068864_100015386 Ga0068864_1000153863 364
314 3300005841 Ga0068863_100248900 Ga0068863_1002489002 364
315 3300005842 Ga0068858_100001092 Ga0068858_10000109215 364
316 3300006358 Ga0068871_100050877 Ga0068871_1000508772 364
317 3300013296 Ga0157374_10041526 Ga0157374_100415262 364
318 3300013306 Ga0163162_10052291 Ga0163162_100522913 364
319 3300013308 Ga0157375_10011928 Ga0157375_100119285 364
320 3300014325 Ga0163163_10000903 Ga0163163_100009033 364
321 3300025903 Ga0207680_10004744 Ga0207680_100047443 364
322 3300025909 Ga0207705_10034664 Ga0207705_100346642 364
323 3300025909 Ga0207705_10241449 Ga0207705_102414492 364
324 3300025925 Ga0207650_10029581 Ga0207650_100295812 364
325 3300025931 Ga0207644_10003165 Ga0207644_100031657 364
326 3300025933 Ga0207706_10017362 Ga0207706_100173624 364
327 3300025940 Ga0207691_10016302 Ga0207691_100163023 364
328 3300026035 Ga0207703_10021411 Ga0207703_100214113 364
329 3300026095 Ga0207676_10008960 Ga0207676_100089604 364
330 3300026121 Ga0207683_10033449 Ga0207683_100334492 364
331 3300031901 Ga0307406_10085323 Ga0307406_100853232 364
332 3300031995 Ga0307409_100190927 Ga0307409_1001909272 364
333 3300032005 Ga0307411_10010029 Ga0307411_100100293 364
334 3300035111 Ga0373923_0003840 Ga0373923_0003840_756_1979 364
335 3300035120 Ga0373957_0059298 Ga0373957_0059298_126_1349 364
336 3300035724 Ga0373933_0031231 Ga0373933_0031231_733_1956 364
337 3300038443 Ga0395901_0031102 Ga0395901_0031102_1262_2461 364
338 3300048088 Ga0495602_0035210 Ga0495602_0035210_1924_3147 364
339 3300048904 Ga0496101_0125751 Ga0496101_0125751_59_1282 364
340 3300048911 Ga0496108_0000634 Ga0496108_0000634_22549_23772 364
341 3300048912 Ga0496109_0051650 Ga0496109_0051650_182_1405 364
342 3300048914 Ga0496111_0154382 Ga0496111_0154382_22_1245 364
343 3300048916 Ga0496113_0006759 Ga0496113_0006759_3686_4909 364
344 3300048917 Ga0496114_0226548 Ga0496114_0226548_335_1558 364
345 3300049515 Ga0501292_000040 Ga0501292_000040_7275_8492 364
346 3300049517 Ga0501294_000062 Ga0501294_000062_2870_4087 364
347 3300049663 Ga0501223_000541 Ga0501223_000541_3136_4353 364
348 3300049664 Ga0501224_000457 Ga0501224_000457_1222_2439 364
349 3300049665 Ga0501227_003138 Ga0501227_003138_1649_2866 364
350 3300049669 Ga0501235_010333 Ga0501235_010333_628_1845 364
351 3300049690 Ga0501261_000079 Ga0501261_000079_7640_8857 364
352 3300049705 Ga0501225_0006238 Ga0501225_0006238_1719_2936 364
353 3300049708 Ga0501245_002056 Ga0501245_002056_676_1893 364
354 3300049775 Ga0501279_000008 Ga0501279_000008_49172_50389 364
355 3300049776 Ga0501280_000013 Ga0501280_000013_56851_58068 364
356 3300049777 Ga0501281_00139 Ga0501281_00139_1575_2792 364
357 3300049778 Ga0501282_000442 Ga0501282_000442_1422_2639 364
358 3300049779 Ga0501283_000845 Ga0501283_000845_1097_2314 364
359 3300053136 Ga0500559_0026779 Ga0500559_0026779_592_1863 364
360 3300005435 Ga0070714_100027909 Ga0070714_1000279093 365
361 3300021388 Ga0213875_10000234 Ga0213875_100002342 365
362 3300025929 Ga0207664_10272234 Ga0207664_102722342 365
363 3300037312 Ga0395899_0033670 Ga0395899_0033670_2494_3717 365
364 3300037418 Ga0395900_0010908 Ga0395900_0010908_2564_3787 365
365 3300037418 Ga0395900_0013797 Ga0395900_0013797_5046_6269 365
366 3300037471 Ga0395905_0010264 Ga0395905_0010264_2630_3853 365
367 3300037471 Ga0395905_0029740 Ga0395905_0029740_1934_3157 365
368 3300037471 Ga0395905_0072740 Ga0395905_0072740_142_1365 365
369 3300037853 Ga0436364_0154840 Ga0436364_0154840_86084_87310 365
370 3300038443 Ga0395901_0020559 Ga0395901_0020559_1983_3206 365
371 3300038443 Ga0395901_0132205 Ga0395901_0132205_661_1884 365
372 3300047472 Ga0495686_0068818 Ga0495686_0068818_209_1432 365
373 3300053730 Ga0500645_001004 Ga0500645_001004_13415_14659 365
374 3300005339 Ga0070660_100100455 Ga0070660_1001004552 366
375 3300025949 Ga0207667_10330939 Ga0207667_103309391 366
376 3300047472 Ga0495686_0009061 Ga0495686_0009061_1926_3197 366
377 3300005293 Ga0065715_10008999 Ga0065715_100089993 367
378 3300005327 Ga0070658_10077285 Ga0070658_100772851 367
379 3300005328 Ga0070676_10003620 Ga0070676_100036205 367
380 3300005331 Ga0070670_100018271 Ga0070670_1000182713 367
381 3300005333 Ga0070677_10002040 Ga0070677_100020403 367
382 3300005343 Ga0070687_100073225 Ga0070687_1000732252 367
383 3300005347 Ga0070668_100015715 Ga0070668_1000157152 367
384 3300005354 Ga0070675_100006584 Ga0070675_1000065847 367
385 3300005355 Ga0070671_100018224 Ga0070671_1000182243 367
386 3300005356 Ga0070674_100047053 Ga0070674_1000470533 367
387 3300005367 Ga0070667_100005946 Ga0070667_1000059462 367
388 3300005441 Ga0070700_100014401 Ga0070700_1000144013 367
389 3300005455 Ga0070663_100140958 Ga0070663_1001409582 367
390 3300005457 Ga0070662_100009277 Ga0070662_1000092774 367
391 3300005459 Ga0068867_100017881 Ga0068867_1000178814 367
392 3300005543 Ga0070672_100051011 Ga0070672_1000510113 367
393 3300005564 Ga0070664_100076166 Ga0070664_1000761662 367
394 3300005577 Ga0068857_100097806 Ga0068857_1000978062 367
395 3300005617 Ga0068859_100010054 Ga0068859_1000100543 367
396 3300005719 Ga0068861_100030379 Ga0068861_1000303793 367
397 3300005840 Ga0068870_10071223 Ga0068870_100712232 367
398 3300005844 Ga0068862_100157162 Ga0068862_1001571622 367
399 3300006931 Ga0097620_100010054 Ga0097620_1000100547 367
400 3300009553 Ga0105249_10024713 Ga0105249_100247133 367
401 3300014326 Ga0157380_10015116 Ga0157380_100151163 367
402 3300025315 Ga0207697_10005299 Ga0207697_100052993 367
403 3300025893 Ga0207682_10001243 Ga0207682_100012435 367
404 3300025901 Ga0207688_10061803 Ga0207688_100618032 367
405 3300025907 Ga0207645_10010987 Ga0207645_100109872 367
406 3300025912 Ga0207707_10085802 Ga0207707_100858022 367
407 3300025923 Ga0207681_10008670 Ga0207681_100086703 367
408 3300025926 Ga0207659_10002195 Ga0207659_100021959 367
409 3300025931 Ga0207644_10078156 Ga0207644_100781562 367
410 3300025933 Ga0207706_10001316 Ga0207706_1000131616 367
411 3300025940 Ga0207691_10001615 Ga0207691_100016159 367
412 3300025972 Ga0207668_10001189 Ga0207668_1000118914 367
413 3300026067 Ga0207678_10068658 Ga0207678_100686582 367
414 3300026075 Ga0207708_10025680 Ga0207708_100256803 367
415 3300026089 Ga0207648_10085821 Ga0207648_100858212 367
416 3300026116 Ga0207674_10121495 Ga0207674_101214952 367
417 3300026118 Ga0207675_100000049 Ga0207675_10000004911 367
418 3300026118 Ga0207675_100032909 Ga0207675_1000329094 367
419 3300026121 Ga0207683_10023514 Ga0207683_100235142 367
420 3300005339 Ga0070660_100000683 Ga0070660_1000006831 368
421 3300005563 Ga0068855_100001753 Ga0068855_10000175316 368
422 3300013100 Ga0157373_10062733 Ga0157373_100627332 368
423 3300013104 Ga0157370_10279277 Ga0157370_102792772 368
424 3300025904 Ga0207647_10042571 Ga0207647_100425712 368
425 3300025909 Ga0207705_10000135 Ga0207705_1000013538 368
426 3300025919 Ga0207657_10001741 Ga0207657_100017412 368
427 3300025949 Ga0207667_10000829 Ga0207667_1000082940 368
428 3300031911 Ga0307412_10059177 Ga0307412_100591772 368
429 3300037471 Ga0395905_0100192 Ga0395905_0100192_1017_2237 368
430 3300038443 Ga0395901_0132454 Ga0395901_0132454_464_1684 368
431 3300046524 Ga0495648_0043111 Ga0495648_0043111_1213_2403 368
432 iso_pu_bacteria 2599185354 2600201593 368
433 iso_pu_bacteria 2751185897 2753763327 368
434 iso_pu_bacteria 2830075706 2830078324 368
435 3300046539 Ga0495621_0000160 Ga0495621_0000160_8559_9782 369
436 3300048911 Ga0496108_0000529 Ga0496108_0000529_20200_21423 369
437 3300048926 Ga0496123_0016038 Ga0496123_0016038_1734_2945 369
438 3300048927 Ga0496124_0002196 Ga0496124_0002196_1921_3132 369
439 3300048927 Ga0496124_0244087 Ga0496124_0244087_37_1248 369
440 3300005366 Ga0070659_100145335 Ga0070659_1001453352 370
441 3300005457 Ga0070662_100000146 Ga0070662_1000001462 370
442 3300005530 Ga0070679_100105148 Ga0070679_1001051481 370
443 3300005578 Ga0068854_100024975 Ga0068854_1000249753 370
444 3300009093 Ga0105240_10001116 Ga0105240_100011161 370
445 3300009093 Ga0105240_10072698 Ga0105240_100726983 370
446 3300009545 Ga0105237_10001672 Ga0105237_1000167222 370
447 3300010375 Ga0105239_10002515 Ga0105239_1000251518 370
448 3300013100 Ga0157373_10034961 Ga0157373_100349612 370
449 3300014326 Ga0157380_10069720 Ga0157380_100697202 370
450 3300025913 Ga0207695_10000288 Ga0207695_1000028871 370
451 3300025913 Ga0207695_10126980 Ga0207695_101269802 370
452 3300025914 Ga0207671_10002961 Ga0207671_1000296111 370
453 3300025924 Ga0207694_10090515 Ga0207694_100905152 370
454 3300025932 Ga0207690_10065188 Ga0207690_100651882 370
455 3300025933 Ga0207706_10000461 Ga0207706_1000046141 370
456 3300025981 Ga0207640_10007638 Ga0207640_100076383 370
457 3300048920 Ga0496117_0089906 Ga0496117_0089906_750_1961 370
458 3300048921 Ga0496118_0035080 Ga0496118_0035080_1738_2949 370
459 3300048921 Ga0496118_0067799 Ga0496118_0067799_797_2008 370
460 3300048924 Ga0496121_0006365 Ga0496121_0006365_1369_2580 370
461 3300048924 Ga0496121_0045897 Ga0496121_0045897_891_2102 370
462 3300048929 Ga0496126_0006832 Ga0496126_0006832_10044_11255 370
463 3300049652 Ga0501202_004956 Ga0501202_004956_192_1400 370
464 3300053096 Ga0500641_0023393 Ga0500641_0023393_105_1328 370
465 3300005331 Ga0070670_100007601 Ga0070670_1000076015 371
466 3300005843 Ga0068860_100037032 Ga0068860_1000370323 371
467 3300025924 Ga0207694_10105904 Ga0207694_101059042 371
468 3300028381 Ga0268264_10032566 Ga0268264_100325663 371
469 3300031731 Ga0307405_10038268 Ga0307405_100382682 371
470 3300031995 Ga0307409_100090402 Ga0307409_1000904022 371
471 3300032002 Ga0307416_100017660 Ga0307416_1000176602 371
472 3300032004 Ga0307414_10144718 Ga0307414_101447182 371
473 3300046460 Ga0495638_0000689 Ga0495638_0000689_30869_32092 371
474 3300053096 Ga0500641_0024501 Ga0500641_0024501_290_1543 371
475 3300053134 Ga0500658_0003056 Ga0500658_0003056_3517_4740 371
476 iso_pu_bacteria 2928027323 2928029681 371
477 iso_pu_bacteria 2984555340 2984555684 371
478 iso_pu_bacteria 2984564862 2984566204 371
479 iso_pu_bacteria 2993356040 2993357218 371
480 iso_pu_bacteria 8057101203 8057102093 371
481 3300005578 Ga0068854_100002725 Ga0068854_1000027253 372
482 3300005617 Ga0068859_100024321 Ga0068859_1000243215 372
483 3300005841 Ga0068863_100018322 Ga0068863_1000183225 372
484 3300006931 Ga0097620_100024321 Ga0097620_1000243215 372
485 3300009177 Ga0105248_10160457 Ga0105248_101604572 372
486 3300025942 Ga0207689_10115344 Ga0207689_101153442 372
487 3300025981 Ga0207640_10008252 Ga0207640_100082522 372
488 3300026041 Ga0207639_10067999 Ga0207639_100679991 372
489 3300026041 Ga0207639_10070086 Ga0207639_100700862 372
490 3300026088 Ga0207641_10026594 Ga0207641_100265944 372
491 3300026095 Ga0207676_10004634 Ga0207676_100046349 372
492 3300026116 Ga0207674_10002496 Ga0207674_1000249612 372
493 3300047472 Ga0495686_0000363 Ga0495686_0000363_11926_13143 372
494 3300048929 Ga0496126_0071545 Ga0496126_0071545_396_1592 372
495 3300053087 Ga0500643_000066 Ga0500643_000066_118002_119219 372
496 3300053120 Ga0500597_003737 Ga0500597_003737_1647_2837 372
497 3300053157 Ga0500624_000074 Ga0500624_000074_42133_43323 372
498 3300053178 Ga0500637_0000261 Ga0500637_0000261_11717_12907 372
499 iso_pu_bacteria 2599185359 2600227860 372
500 iso_pu_bacteria 2643221622 2644127240 372
501 iso_pu_bacteria 2818991466 2819714296 372
502 iso_pu_bacteria 2879163058 2879166415 372
503 iso_pu_bacteria 2928526807 2928530513 372
504 iso_pu_bacteria 2928968154 2928968310 372
505 3300003781 Ga0055536_1001201 Ga0055536_10012014 373
506 3300005366 Ga0070659_100092990 Ga0070659_1000929902 373
507 3300005544 Ga0070686_100000123 Ga0070686_1000001237 373
508 3300048905 Ga0496102_0000034 Ga0496102_0000034_62465_63679 373
509 3300048906 Ga0496103_0000026 Ga0496103_0000026_62465_63679 373
510 3300048907 Ga0496104_0199707 Ga0496104_0199707_156_1370 373
511 3300048919 Ga0496116_0000926 Ga0496116_0000926_16942_18156 373
512 3300048920 Ga0496117_0000072 Ga0496117_0000072_87005_88219 373
513 3300048921 Ga0496118_0000030 Ga0496118_0000030_150148_151362 373
514 3300048922 Ga0496119_0020782 Ga0496119_0020782_2968_4182 373
515 3300048927 Ga0496124_0000061 Ga0496124_0000061_150148_151362 373
516 3300005327 Ga0070658_10000040 Ga0070658_1000004068 374
517 3300005339 Ga0070660_100003760 Ga0070660_1000037607 374
518 3300005339 Ga0070660_100011627 Ga0070660_1000116273 374
519 3300005344 Ga0070661_100000263 Ga0070661_10000026322 374
520 3300005345 Ga0070692_10000983 Ga0070692_100009834 374
521 3300005366 Ga0070659_100009330 Ga0070659_1000093306 374
522 3300005530 Ga0070679_100000031 Ga0070679_10000003123 374
523 3300009177 Ga0105248_10084789 Ga0105248_100847892 374
524 3300020082 Ga0206353_11456103 Ga0206353_114561032 374
525 3300021358 Ga0213873_10000039 Ga0213873_1000003913 374
526 3300021384 Ga0213876_10000455 Ga0213876_1000045513 374
527 3300025909 Ga0207705_10000002 Ga0207705_10000002206 374
528 3300025919 Ga0207657_10002044 Ga0207657_1000204415 374
529 3300025919 Ga0207657_10023704 Ga0207657_100237045 374
530 3300025920 Ga0207649_10000323 Ga0207649_1000032317 374
531 3300025921 Ga0207652_10000003 Ga0207652_10000003382 374
532 3300025923 Ga0207681_10073190 Ga0207681_100731902 374
533 3300025932 Ga0207690_10010280 Ga0207690_100102802 374
534 3300031456 Ga0307513_10076661 Ga0307513_100766612 374
535 3300038705 Ga0237819_00349 Ga0237819_00349_15378_16577 374
536 3300039437 Ga0436365_0168572 Ga0436365_0168572_399_1592 374
537 3300039437 Ga0436365_0328398 Ga0436365_0328398_8262_9455 374
538 3300039437 Ga0436365_0563507 Ga0436365_0563507_4442_5638 374
539 3300039453 Ga0436362_1186234 Ga0436362_1186234_12765_13958 374
540 3300044735 Ga0466968_0014273 Ga0466968_0014273_540_1763 374
541 3300048920 Ga0496117_0024330 Ga0496117_0024330_1744_2964 374
542 3300048921 Ga0496118_0032325 Ga0496118_0032325_1790_3010 374
543 3300048922 Ga0496119_0018557 Ga0496119_0018557_2576_3799 374
544 3300049570 Ga0501033_0073568 Ga0501033_0073568_1151_2374 374
545 3300049579 Ga0501043_0078505 Ga0501043_0078505_1350_2573 374
546 3300053116 Ga0500592_000093 Ga0500592_000093_11793_13010 374
547 3300053151 Ga0500604_0013841 Ga0500604_0013841_198_1415 374
548 3300053158 Ga0500627_0000117 Ga0500627_0000117_7245_8462 374
549 3300003771 Ga0055526_1007222 Ga0055526_10072223 375
550 3300003773 Ga0055537_1004287 Ga0055537_10042873 375
551 3300003784 Ga0055534_1012319 Ga0055534_10123191 375
552 3300003791 Ga0055530_10000137 Ga0055530_1000013723 375
553 3300003791 Ga0055530_10000194 Ga0055530_1000019445 375
554 3300003791 Ga0055530_10000247 Ga0055530_1000024710 375
555 3300003794 Ga0055531_10000019 Ga0055531_10000019100 375
556 3300003794 Ga0055531_10001510 Ga0055531_100015108 375
557 3300005347 Ga0070668_100006040 Ga0070668_1000060402 375
558 3300005367 Ga0070667_100061414 Ga0070667_1000614142 375
559 3300005841 Ga0068863_100005038 Ga0068863_10000503811 375
560 3300005843 Ga0068860_100001312 Ga0068860_10000131223 375
561 3300005844 Ga0068862_100000481 Ga0068862_10000048121 375
562 3300005844 Ga0068862_100029293 Ga0068862_1000292932 375
563 3300009098 Ga0105245_10025229 Ga0105245_100252295 375
564 3300025263 Ga0209565_1000135 Ga0209565_100013542 375
565 3300025291 Ga0209675_1000421 Ga0209675_100042123 375
566 3300025292 Ga0209676_1000211 Ga0209676_100021187 375
567 3300025294 Ga0209025_1002199 Ga0209025_10021998 375
568 3300025295 Ga0209564_1007082 Ga0209564_10070823 375
569 3300025298 Ga0209050_1000010 Ga0209050_1000010100 375
570 3300025298 Ga0209050_1000047 Ga0209050_1000047272 375
571 3300025304 Ga0209257_1000009 Ga0209257_10000091016 375
572 3300025304 Ga0209257_1000076 Ga0209257_1000076228 375
573 3300025900 Ga0207710_10041353 Ga0207710_100413532 375
574 3300025972 Ga0207668_10001788 Ga0207668_100017882 375
575 3300026088 Ga0207641_10003899 Ga0207641_100038992 375
576 3300028380 Ga0268265_10000309 Ga0268265_1000030928 375
577 3300028381 Ga0268264_10001117 Ga0268264_1000111723 375
578 3300031903 Ga0307407_10025234 Ga0307407_100252343 375
579 3300031911 Ga0307412_10042123 Ga0307412_100421232 375
580 3300032005 Ga0307411_10068249 Ga0307411_100682492 375
581 3300041410 Ga0439461_0000726 Ga0439461_0000726_2040_3266 375
582 3300041413 Ga0439465_0011633 Ga0439465_0011633_593_1819 375
583 3300042006 Ga0439432_000890 Ga0439432_000890_1752_2978 375
584 3300042435 Ga0439434_0013839 Ga0439434_0013839_763_1989 375
585 3300049663 Ga0501223_008904 Ga0501223_008904_533_1750 375
586 3300049686 Ga0501257_000053 Ga0501257_000053_7435_8652 375
587 3300049776 Ga0501280_004421 Ga0501280_004421_162_1379 375
588 3300053119 Ga0500595_002272 Ga0500595_002272_6797_8035 375
589 3300053139 Ga0500568_0001671 Ga0500568_0001671_3695_4912 375
590 iso_pu_bacteria 2643221563 2643833708 375
591 iso_pu_bacteria 2643221608 2644054634 375
592 iso_pu_bacteria 2990265787 2990268781 375
593 iso_pu_bacteria 2993693658 2993694512 375
594 3300005289 Ga0065704_10125038 Ga0065704_101250382 376
595 3300005331 Ga0070670_100000572 Ga0070670_1000005724 376
596 3300005367 Ga0070667_100000134 Ga0070667_10000013420 376
597 3300005577 Ga0068857_100030817 Ga0068857_1000308174 376
598 3300005577 Ga0068857_100328496 Ga0068857_1003284961 376
599 3300005617 Ga0068859_100005050 Ga0068859_1000050506 376
600 3300005617 Ga0068859_100079584 Ga0068859_1000795842 376
601 3300005618 Ga0068864_100000089 Ga0068864_10000008974 376
602 3300005841 Ga0068863_100000084 Ga0068863_10000008474 376
603 3300005844 Ga0068862_100000112 Ga0068862_10000011226 376
604 3300006931 Ga0097620_100005050 Ga0097620_1000050506 376
605 3300006931 Ga0097620_100079583 Ga0097620_1000795833 376
606 3300009177 Ga0105248_10003487 Ga0105248_100034876 376
607 3300009551 Ga0105238_10021758 Ga0105238_100217584 376
608 3300014326 Ga0157380_10332539 Ga0157380_103325392 376
609 3300014968 Ga0157379_10195288 Ga0157379_101952881 376
610 3300025735 Ga0207713_1005138 Ga0207713_10051386 376
611 3300025925 Ga0207650_10004105 Ga0207650_100041054 376
612 3300025941 Ga0207711_10000004 Ga0207711_10000004730 376
613 3300025941 Ga0207711_10005875 Ga0207711_100058752 376
614 3300025961 Ga0207712_10000324 Ga0207712_1000032426 376
615 3300025986 Ga0207658_10000711 Ga0207658_1000071128 376
616 3300026088 Ga0207641_10000010 Ga0207641_10000010375 376
617 3300026095 Ga0207676_10000051 Ga0207676_1000005126 376
618 3300026095 Ga0207676_10219809 Ga0207676_102198092 376
619 3300028380 Ga0268265_10000026 Ga0268265_1000002626 376
620 3300031548 Ga0307408_100136920 Ga0307408_1001369202 376
621 3300031852 Ga0307410_10197254 Ga0307410_101972541 376
622 3300031901 Ga0307406_10067160 Ga0307406_100671602 376
623 3300031901 Ga0307406_10119703 Ga0307406_101197032 376
624 3300031903 Ga0307407_10097785 Ga0307407_100977852 376
625 3300032005 Ga0307411_10163783 Ga0307411_101637832 376
626 3300041413 Ga0439465_0017815 Ga0439465_0017815_727_1956 376
627 3300042014 Ga0439457_008051 Ga0439457_008051_748_1977 376
628 3300048927 Ga0496124_0000328 Ga0496124_0000328_60639_61871 376
629 3300053116 Ga0500592_001148 Ga0500592_001148_892_2109 376
630 3300053158 Ga0500627_0000010 Ga0500627_0000010_53304_54521 376
631 3300001915 JGI24741J21665_1010756 JGI24741J21665_10107562 377
632 3300005471 Ga0070698_100117424 Ga0070698_1001174242 377
633 3300005548 Ga0070665_100001478 Ga0070665_1000014784 377
634 3300005985 Ga0081539_10004462 Ga0081539_100044623 377
635 3300006847 Ga0075431_100050690 Ga0075431_1000506902 377
636 3300009101 Ga0105247_10013962 Ga0105247_100139624 377
637 3300009553 Ga0105249_10000240 Ga0105249_1000024041 377
638 3300028379 Ga0268266_10000875 Ga0268266_1000087538 377
639 3300031852 Ga0307410_10006628 Ga0307410_100066285 377
640 3300031852 Ga0307410_10010799 Ga0307410_100107992 377
641 3300032004 Ga0307414_10024308 Ga0307414_100243083 377
642 3300032005 Ga0307411_10029816 Ga0307411_100298162 377
643 3300035170 Ga0373943_0004396 Ga0373943_0004396_4973_6217 377
644 3300045976 Ga0466967_0183055 Ga0466967_0183055_505_1728 377
645 3300048918 Ga0496115_0000711 Ga0496115_0000711_3667_4896 377
646 3300049581 Ga0501047_0065045 Ga0501047_0065045_1879_3096 377
647 3300050510 nmdc:mga06r32_4589_c1 nmdc:mga06r32_4589_c1_9555_10778 377
648 iso_pu_bacteria 2643221605 2644038854 377
649 iso_pu_bacteria 2946787523 2946787784 377
650 3300005327 Ga0070658_10021593 Ga0070658_100215933 378
651 3300025254 Ga0209148_1001774 Ga0209148_10017744 378
652 3300025272 Ga0209455_1002190 Ga0209455_10021902 378
653 3300025909 Ga0207705_10015135 Ga0207705_100151352 378
654 3300032004 Ga0307414_10005141 Ga0307414_100051412 378
655 3300046660 Ga0495625_0000740 Ga0495625_0000740_21291_22511 378
656 3300053087 Ga0500643_000766 Ga0500643_000766_17988_19208 378
657 3300053139 Ga0500568_0004177 Ga0500568_0004177_1715_2929 378
658 3300053151 Ga0500604_0000240 Ga0500604_0000240_7086_8300 378
659 3300053153 Ga0500616_0001040 Ga0500616_0001040_7589_8803 378
660 iso_pu_bacteria 2643221541 2643728177 378
661 iso_pu_bacteria 2643221606 2644042874 378
662 iso_pu_bacteria 2643221671 2644395695 378
663 3300003781 Ga0055536_1000505 Ga0055536_100050522 379
664 3300025292 Ga0209676_1000045 Ga0209676_1000045163 379
665 3300025298 Ga0209050_1011536 Ga0209050_10115363 379
666 3300031911 Ga0307412_10007500 Ga0307412_100075003 379
667 3300046524 Ga0495648_0035561 Ga0495648_0035561_842_2047 379
668 3300046616 Ga0495668_0000002 Ga0495668_0000002_27573_28793 379
669 3300048914 Ga0496111_0090443 Ga0496111_0090443_387_1640 379
670 3300048925 Ga0496122_0002487 Ga0496122_0002487_16376_17629 379
671 3300048926 Ga0496123_0001967 Ga0496123_0001967_11660_12913 379
672 3300048927 Ga0496124_0008089 Ga0496124_0008089_8608_9861 379
673 3300053153 Ga0500616_0008125 Ga0500616_0008125_4064_5332 379
674 iso_pu_bacteria 2582581305 2585261245 379
675 3300001904 JGI24736J21556_1006408 JGI24736J21556_10064082 380
676 3300002067 JGI24735J21928_10005978 JGI24735J21928_100059783 380
677 3300002067 JGI24735J21928_10026926 JGI24735J21928_100269262 380
678 3300002067 JGI24735J21928_10031245 JGI24735J21928_100312452 380
679 3300002075 JGI24738J21930_10009749 JGI24738J21930_100097492 380
680 3300002075 JGI24738J21930_10012967 JGI24738J21930_100129672 380
681 3300002077 JGI24744J21845_10002873 JGI24744J21845_100028732 380
682 3300003214 JGI25165J46597_1000023 JGI25165J46597_1000023163 380
683 3300003794 Ga0055531_10001071 Ga0055531_100010716 380
684 3300005327 Ga0070658_10000885 Ga0070658_1000088517 380
685 3300005328 Ga0070676_10000147 Ga0070676_1000014724 380
686 3300005334 Ga0068869_100000307 Ga0068869_10000030720 380
687 3300005338 Ga0068868_100000215 Ga0068868_10000021539 380
688 3300005339 Ga0070660_100001804 Ga0070660_1000018046 380
689 3300005347 Ga0070668_100000071 Ga0070668_10000007145 380
690 3300005355 Ga0070671_100000328 Ga0070671_10000032831 380
691 3300005356 Ga0070674_100229464 Ga0070674_1002294641 380
692 3300005364 Ga0070673_100000019 Ga0070673_10000001970 380
693 3300005367 Ga0070667_100000036 Ga0070667_100000036128 380
694 3300005456 Ga0070678_100022523 Ga0070678_1000225232 380
695 3300005459 Ga0068867_100000014 Ga0068867_10000001474 380
696 3300005539 Ga0068853_100282020 Ga0068853_1002820201 380
697 3300005548 Ga0070665_100038505 Ga0070665_1000385052 380
698 3300005563 Ga0068855_100006658 Ga0068855_1000066585 380
699 3300005563 Ga0068855_100131853 Ga0068855_1001318532 380
700 3300005577 Ga0068857_100030331 Ga0068857_1000303312 380
701 3300005578 Ga0068854_100002754 Ga0068854_1000027541 380
702 3300005616 Ga0068852_100000314 Ga0068852_10000031418 380
703 3300005617 Ga0068859_100030665 Ga0068859_1000306654 380
704 3300005841 Ga0068863_100000154 Ga0068863_10000015446 380
705 3300005841 Ga0068863_100003453 Ga0068863_1000034536 380
706 3300005843 Ga0068860_100000063 Ga0068860_10000006337 380
707 3300005844 Ga0068862_100075098 Ga0068862_1000750982 380
708 3300006881 Ga0068865_100000018 Ga0068865_10000001845 380
709 3300006931 Ga0097620_100030665 Ga0097620_1000306654 380
710 3300009098 Ga0105245_10000659 Ga0105245_1000065921 380
711 3300009148 Ga0105243_10000076 Ga0105243_1000007654 380
712 3300009176 Ga0105242_10000458 Ga0105242_1000045833 380
713 3300009553 Ga0105249_10056416 Ga0105249_100564163 380
714 3300011119 Ga0105246_10000637 Ga0105246_1000063716 380
715 3300013104 Ga0157370_10001841 Ga0157370_100018412 380
716 3300013105 Ga0157369_10060224 Ga0157369_100602242 380
717 3300013105 Ga0157369_10320525 Ga0157369_103205252 380
718 3300013296 Ga0157374_10000951 Ga0157374_1000095115 380
719 3300013297 Ga0157378_10001247 Ga0157378_1000124711 380
720 3300013307 Ga0157372_10018056 Ga0157372_100180562 380
721 3300013307 Ga0157372_10112067 Ga0157372_101120672 380
722 3300013308 Ga0157375_10001111 Ga0157375_1000111121 380
723 3300025231 Ga0207427_101716 Ga0207427_1017162 380
724 3300025250 Ga0209026_1001365 Ga0209026_10013658 380
725 3300025254 Ga0209148_1000243 Ga0209148_100024334 380
726 3300025261 Ga0209233_1000003 Ga0209233_10000031002 380
727 3300025304 Ga0209257_1000156 Ga0209257_100015696 380
728 3300025904 Ga0207647_10004952 Ga0207647_100049528 380
729 3300025904 Ga0207647_10014553 Ga0207647_100145533 380
730 3300025907 Ga0207645_10002499 Ga0207645_100024998 380
731 3300025909 Ga0207705_10000084 Ga0207705_1000008477 380
732 3300025909 Ga0207705_10001039 Ga0207705_100010394 380
733 3300025913 Ga0207695_10024963 Ga0207695_100249635 380
734 3300025919 Ga0207657_10001930 Ga0207657_100019304 380
735 3300025919 Ga0207657_10004854 Ga0207657_100048548 380
736 3300025931 Ga0207644_10000156 Ga0207644_1000015619 380
737 3300025933 Ga0207706_10075509 Ga0207706_100755092 380
738 3300025934 Ga0207686_10000518 Ga0207686_1000051810 380
739 3300025935 Ga0207709_10000114 Ga0207709_1000011471 380
740 3300025938 Ga0207704_10000008 Ga0207704_1000000871 380
741 3300025940 Ga0207691_10024681 Ga0207691_100246813 380
742 3300025942 Ga0207689_10000086 Ga0207689_100000867 380
743 3300025949 Ga0207667_10000024 Ga0207667_10000024298 380
744 3300025949 Ga0207667_10148485 Ga0207667_101484852 380
745 3300025960 Ga0207651_10000008 Ga0207651_10000008153 380
746 3300025961 Ga0207712_10017468 Ga0207712_100174683 380
747 3300025972 Ga0207668_10000039 Ga0207668_1000003930 380
748 3300025981 Ga0207640_10000229 Ga0207640_1000022917 380
749 3300025986 Ga0207658_10000083 Ga0207658_1000008372 380
750 3300026023 Ga0207677_10000321 Ga0207677_1000032126 380
751 3300026041 Ga0207639_10025867 Ga0207639_100258673 380
752 3300026067 Ga0207678_10036208 Ga0207678_100362083 380
753 3300026067 Ga0207678_10080609 Ga0207678_100806092 380
754 3300026078 Ga0207702_10058852 Ga0207702_100588523 380
755 3300026088 Ga0207641_10000001 Ga0207641_100000011209 380
756 3300026088 Ga0207641_10000477 Ga0207641_1000047725 380
757 3300026089 Ga0207648_10000009 Ga0207648_10000009153 380
758 3300026116 Ga0207674_10012789 Ga0207674_100127897 380
759 3300026116 Ga0207674_10016393 Ga0207674_100163932 380
760 3300026121 Ga0207683_10049118 Ga0207683_100491183 380
761 3300028381 Ga0268264_10000083 Ga0268264_1000008392 380
762 3300028381 Ga0268264_10046983 Ga0268264_100469832 380
763 3300032004 Ga0307414_10000282 Ga0307414_100002829 380
764 3300037312 Ga0395899_0011391 Ga0395899_0011391_4420_5676 380
765 3300037418 Ga0395900_0040109 Ga0395900_0040109_2403_3659 380
766 3300037418 Ga0395900_0378945 Ga0395900_0378945_25_1278 380
767 3300037471 Ga0395905_0340424 Ga0395905_0340424_47_1303 380
768 3300038443 Ga0395901_0245337 Ga0395901_0245337_129_1385 380
769 3300042005 Ga0439448_0009079 Ga0439448_0009079_34_1278 380
770 3300042012 Ga0439455_0006607 Ga0439455_0006607_1104_2360 380
771 3300042157 Ga0439458_0000132 Ga0439458_0000132_5656_6912 380
772 3300044658 Ga0466972_0002734 Ga0466972_0002734_4597_5850 380
773 3300044659 Ga0466973_0060404 Ga0466973_0060404_524_1741 380
774 3300044684 Ga0466966_0039103 Ga0466966_0039103_912_2165 380
775 3300044694 Ga0466963_0000618 Ga0466963_0000618_3999_5252 380
776 3300044719 Ga0466971_0006686 Ga0466971_0006686_2104_3357 380
777 3300047472 Ga0495686_0026459 Ga0495686_0026459_652_1923 380
778 3300048920 Ga0496117_0025509 Ga0496117_0025509_2075_3331 380
779 3300048924 Ga0496121_0038748 Ga0496121_0038748_1188_2438 380
780 3300048924 Ga0496121_0154125 Ga0496121_0154125_254_1510 380
781 3300048926 Ga0496123_0039606 Ga0496123_0039606_1103_2359 380
782 3300049570 Ga0501033_0017961 Ga0501033_0017961_2204_3499 380
783 3300049573 Ga0501037_0031601 Ga0501037_0031601_2003_3298 380
784 3300049574 Ga0501038_0179252 Ga0501038_0179252_90_1385 380
785 3300049575 Ga0501039_0013849 Ga0501039_0013849_1188_2483 380
786 3300049579 Ga0501043_0014561 Ga0501043_0014561_839_2056 380
787 3300049580 Ga0501046_0083082 Ga0501046_0083082_831_2126 380
788 3300049581 Ga0501047_0000938 Ga0501047_0000938_24164_25381 380
789 3300049822 Ga0501035_0040305 Ga0501035_0040305_854_2149 380
790 3300049823 Ga0501044_0080878 Ga0501044_0080878_1471_2688 380
791 3300049823 Ga0501044_0220053 Ga0501044_0220053_465_1712 380
792 3300053087 Ga0500643_017880 Ga0500643_017880_733_2001 380
793 3300061719 Ga0466962_0000478 Ga0466962_0000478_3005_4258 380
794 iso_pu_bacteria 2852653556 2852657382 380
795 3300001989 JGI24739J22299_10001503 JGI24739J22299_100015037 381
796 3300002067 JGI24735J21928_10001172 JGI24735J21928_100011727 381
797 3300002076 JGI24749J21850_1000015 JGI24749J21850_100001510 381
798 3300002459 JGI24751J29686_10000089 JGI24751J29686_1000008950 381
799 3300003781 Ga0055536_1010998 Ga0055536_10109982 381
800 3300005295 Ga0065707_10085486 Ga0065707_100854862 381
801 3300005331 Ga0070670_100000028 Ga0070670_100000028136 381
802 3300005335 Ga0070666_10111444 Ga0070666_101114442 381
803 3300005353 Ga0070669_100000005 Ga0070669_100000005175 381
804 3300005367 Ga0070667_100000733 Ga0070667_10000073323 381
805 3300005614 Ga0068856_100130942 Ga0068856_1001309422 381
806 3300005616 Ga0068852_100220154 Ga0068852_1002201542 381
807 3300005617 Ga0068859_100003554 Ga0068859_1000035545 381
808 3300005618 Ga0068864_100000049 Ga0068864_1000000498 381
809 3300005719 Ga0068861_100012245 Ga0068861_1000122452 381
810 3300005844 Ga0068862_100000005 Ga0068862_100000005251 381
811 3300006931 Ga0097620_100003554 Ga0097620_10000355413 381
812 3300009177 Ga0105248_10000218 Ga0105248_1000021831 381
813 3300014326 Ga0157380_10000023 Ga0157380_1000002377 381
814 3300025263 Ga0209565_1016198 Ga0209565_10161982 381
815 3300025292 Ga0209676_1000430 Ga0209676_100043050 381
816 3300025298 Ga0209050_1005991 Ga0209050_10059917 381
817 3300025904 Ga0207647_10056850 Ga0207647_100568502 381
818 3300025923 Ga0207681_10000003 Ga0207681_10000003137 381
819 3300025925 Ga0207650_10000012 Ga0207650_10000012144 381
820 3300025933 Ga0207706_10074451 Ga0207706_100744512 381
821 3300025941 Ga0207711_10001538 Ga0207711_100015384 381
822 3300025961 Ga0207712_10000196 Ga0207712_1000019626 381
823 3300025986 Ga0207658_10000617 Ga0207658_1000061723 381
824 3300026095 Ga0207676_10000009 Ga0207676_10000009133 381
825 3300026118 Ga0207675_100000350 Ga0207675_1000003508 381
826 3300028380 Ga0268265_10000001 Ga0268265_10000001340 381
827 3300028381 Ga0268264_10389184 Ga0268264_103891841 381
828 3300031911 Ga0307412_10123369 Ga0307412_101233691 381
829 3300044693 Ga0466961_0019991 Ga0466961_0019991_1598_2851 381
830 3300045049 Ga0466959_0052349 Ga0466959_0052349_1679_2932 381
831 3300045836 Ga0466958_0028656 Ga0466958_0028656_85_1338 381
832 3300046616 Ga0495668_0010901 Ga0495668_0010901_4106_5326 381
833 3300053134 Ga0500658_0008975 Ga0500658_0008975_46_1275 381
834 3300002459 JGI24751J29686_10004260 JGI24751J29686_100042603 382
835 3300005295 Ga0065707_10084180 Ga0065707_100841805 382
836 3300005347 Ga0070668_100000105 Ga0070668_10000010557 382
837 3300005355 Ga0070671_100001363 Ga0070671_10000136310 382
838 3300005367 Ga0070667_100000071 Ga0070667_10000007156 382
839 3300005617 Ga0068859_100045277 Ga0068859_1000452773 382
840 3300005618 Ga0068864_100001349 Ga0068864_10000134918 382
841 3300005719 Ga0068861_100043833 Ga0068861_1000438333 382
842 3300005841 Ga0068863_100031538 Ga0068863_1000315383 382
843 3300005841 Ga0068863_100042005 Ga0068863_1000420053 382
844 3300005842 Ga0068858_100000410 Ga0068858_10000041038 382
845 3300005843 Ga0068860_100000049 Ga0068860_100000049161 382
846 3300005844 Ga0068862_100000134 Ga0068862_10000013439 382
847 3300006931 Ga0097620_100045279 Ga0097620_1000452793 382
848 3300009092 Ga0105250_10030217 Ga0105250_100302172 382
849 3300009177 Ga0105248_10008370 Ga0105248_100083709 382
850 3300009177 Ga0105248_10076985 Ga0105248_100769852 382
851 3300014326 Ga0157380_10005003 Ga0157380_100050036 382
852 3300025925 Ga0207650_10038901 Ga0207650_100389013 382
853 3300025925 Ga0207650_10053917 Ga0207650_100539172 382
854 3300025931 Ga0207644_10000443 Ga0207644_1000044322 382
855 3300025941 Ga0207711_10006791 Ga0207711_100067914 382
856 3300025972 Ga0207668_10000011 Ga0207668_1000001159 382
857 3300025986 Ga0207658_10000014 Ga0207658_10000014168 382
858 3300026035 Ga0207703_10000402 Ga0207703_1000040214 382
859 3300026088 Ga0207641_10000292 Ga0207641_100002925 382
860 3300026088 Ga0207641_10021464 Ga0207641_100214643 382
861 3300026088 Ga0207641_10197547 Ga0207641_101975472 382
862 3300026095 Ga0207676_10000759 Ga0207676_100007592 382
863 3300028380 Ga0268265_10000228 Ga0268265_1000022814 382
864 3300028381 Ga0268264_10000121 Ga0268264_10000121147 382
865 3300048919 Ga0496116_0062550 Ga0496116_0062550_549_1763 382
866 3300048922 Ga0496119_0118603 Ga0496119_0118603_37_1251 382
867 3300048928 Ga0496125_0014557 Ga0496125_0014557_1173_2393 382
868 3300053087 Ga0500643_004056 Ga0500643_004056_560_1780 382
869 3300053087 Ga0500643_010962 Ga0500643_010962_367_1587 382
870 iso_pu_bacteria 2643221560 2643821339 382
871 iso_pu_bacteria 2852680915 2852682193 382
872 3300005937 Ga0081455_10004233 Ga0081455_1000423315 383
873 3300009011 Ga0105251_10000545 Ga0105251_1000054528 383
874 3300009177 Ga0105248_10000012 Ga0105248_10000012223 383
875 3300009553 Ga0105249_10000257 Ga0105249_1000025725 383
876 3300013306 Ga0163162_10100025 Ga0163162_101000252 383
877 3300014968 Ga0157379_10135154 Ga0157379_101351542 383
878 3300025304 Ga0209257_1001976 Ga0209257_100197620 383
879 3300032004 Ga0307414_10076696 Ga0307414_100766962 383
880 3300035725 Ga0373947_0052311 Ga0373947_0052311_426_1649 383
881 3300037068 Ga0373925_0081558 Ga0373925_0081558_676_1899 383
882 3300048921 Ga0496118_0000946 Ga0496118_0000946_30892_32109 383
883 3300053096 Ga0500641_0016772 Ga0500641_0016772_1074_2297 383
884 3300053130 Ga0500642_0007206 Ga0500642_0007206_1212_2435 383
885 3300053148 Ga0500590_000428 Ga0500590_000428_11287_12510 383
886 3300053156 Ga0500622_0003987 Ga0500622_0003987_1128_2351 383
887 3300053724 Ga0500570_020728 Ga0500570_020728_1173_2396 383
888 3300053733 Ga0500552_002023 Ga0500552_002023_88_1311 383
889 3300001904 JGI24736J21556_1000171 JGI24736J21556_10001718 384
890 3300001976 JGI24752J21851_1002691 JGI24752J21851_10026912 384
891 3300001989 JGI24739J22299_10009434 JGI24739J22299_100094342 384
892 3300001990 JGI24737J22298_10005380 JGI24737J22298_100053802 384
893 3300002076 JGI24749J21850_1002378 JGI24749J21850_10023782 384
894 3300002239 JGI24034J26672_10000040 JGI24034J26672_1000004053 384
895 3300005327 Ga0070658_10028597 Ga0070658_100285973 384
896 3300005330 Ga0070690_100000035 Ga0070690_10000003564 384
897 3300005335 Ga0070666_10000015 Ga0070666_1000001585 384
898 3300005339 Ga0070660_100036074 Ga0070660_1000360742 384
899 3300005340 Ga0070689_100024072 Ga0070689_1000240724 384
900 3300005353 Ga0070669_100000896 Ga0070669_10000089613 384
901 3300005355 Ga0070671_100163180 Ga0070671_1001631802 384
902 3300005365 Ga0070688_100008634 Ga0070688_1000086346 384
903 3300005367 Ga0070667_100006730 Ga0070667_1000067309 384
904 3300005455 Ga0070663_100047454 Ga0070663_1000474542 384
905 3300005466 Ga0070685_10000102 Ga0070685_1000010241 384
906 3300005539 Ga0068853_100110241 Ga0068853_1001102412 384
907 3300005544 Ga0070686_100000006 Ga0070686_100000006167 384
908 3300005548 Ga0070665_100000510 Ga0070665_10000051024 384
909 3300005577 Ga0068857_100114310 Ga0068857_1001143102 384
910 3300005614 Ga0068856_100264894 Ga0068856_1002648942 384
911 3300005616 Ga0068852_100115704 Ga0068852_1001157042 384
912 3300005617 Ga0068859_100006307 Ga0068859_1000063075 384
913 3300005618 Ga0068864_100005479 Ga0068864_1000054792 384
914 3300005834 Ga0068851_10026186 Ga0068851_100261862 384
915 3300005841 Ga0068863_100000109 Ga0068863_10000010960 384
916 3300005842 Ga0068858_100002853 Ga0068858_10000285317 384
917 3300005843 Ga0068860_100000050 Ga0068860_10000005085 384
918 3300006931 Ga0097620_100006307 Ga0097620_1000063075 384
919 3300009093 Ga0105240_10196468 Ga0105240_101964682 384
920 3300009093 Ga0105240_10327490 Ga0105240_103274902 384
921 3300009101 Ga0105247_10037490 Ga0105247_100374902 384
922 3300009174 Ga0105241_10053269 Ga0105241_100532692 384
923 3300009545 Ga0105237_10157098 Ga0105237_101570982 384
924 3300009553 Ga0105249_10000034 Ga0105249_10000034137 384
925 3300010375 Ga0105239_10208143 Ga0105239_102081432 384
926 3300013104 Ga0157370_10010021 Ga0157370_100100215 384
927 3300013105 Ga0157369_10021062 Ga0157369_100210623 384
928 3300013306 Ga0163162_10417171 Ga0163162_104171712 384
929 3300014325 Ga0163163_10071147 Ga0163163_100711473 384
930 3300014326 Ga0157380_10000567 Ga0157380_100005679 384
931 3300014968 Ga0157379_10049250 Ga0157379_100492503 384
932 3300017792 Ga0163161_10000051 Ga0163161_1000005113 384
933 3300025223 Ga0207672_1000337 Ga0207672_10003373 384
934 3300025321 Ga0207656_10003330 Ga0207656_100033302 384
935 3300025903 Ga0207680_10000007 Ga0207680_10000007541 384
936 3300025904 Ga0207647_10001020 Ga0207647_100010208 384
937 3300025909 Ga0207705_10027894 Ga0207705_100278943 384
938 3300025911 Ga0207654_10029729 Ga0207654_100297292 384
939 3300025913 Ga0207695_10003367 Ga0207695_100033675 384
940 3300025914 Ga0207671_10006071 Ga0207671_1000607112 384
941 3300025920 Ga0207649_10038301 Ga0207649_100383012 384
942 3300025923 Ga0207681_10000133 Ga0207681_1000013332 384
943 3300025924 Ga0207694_10020160 Ga0207694_100201605 384
944 3300025931 Ga0207644_10025324 Ga0207644_100253242 384
945 3300025933 Ga0207706_10057322 Ga0207706_100573223 384
946 3300025933 Ga0207706_10057949 Ga0207706_100579492 384
947 3300025941 Ga0207711_10127820 Ga0207711_101278202 384
948 3300025949 Ga0207667_10035664 Ga0207667_100356642 384
949 3300025961 Ga0207712_10000004 Ga0207712_10000004529 384
950 3300025972 Ga0207668_10138178 Ga0207668_101381782 384
951 3300025981 Ga0207640_10022420 Ga0207640_100224203 384
952 3300025986 Ga0207658_10000082 Ga0207658_1000008223 384
953 3300026035 Ga0207703_10000732 Ga0207703_1000073229 384
954 3300026041 Ga0207639_10079196 Ga0207639_100791962 384
955 3300026067 Ga0207678_10063521 Ga0207678_100635212 384
956 3300026078 Ga0207702_10013160 Ga0207702_100131606 384
957 3300026088 Ga0207641_10000274 Ga0207641_1000027423 384
958 3300026095 Ga0207676_10002928 Ga0207676_100029283 384
959 3300026116 Ga0207674_10007688 Ga0207674_100076884 384
960 3300026118 Ga0207675_100033960 Ga0207675_1000339604 384
961 3300026142 Ga0207698_10028904 Ga0207698_100289043 384
962 3300028379 Ga0268266_10000009 Ga0268266_100000091089 384
963 3300028380 Ga0268265_10000086 Ga0268265_100000866 384
964 3300028381 Ga0268264_10000003 Ga0268264_10000003543 384
965 3300046525 Ga0495663_0005034 Ga0495663_0005034_1355_2575 384
966 3300046530 Ga0495654_0001314 Ga0495654_0001314_4652_5872 384
967 3300046616 Ga0495668_0003961 Ga0495668_0003961_9058_10278 384
968 3300046616 Ga0495668_0037700 Ga0495668_0037700_125_1345 384
969 3300046794 Ga0495589_0026704 Ga0495589_0026704_1145_2365 384
970 3300048904 Ga0496101_0101789 Ga0496101_0101789_819_2039 384
971 3300048905 Ga0496102_0001152 Ga0496102_0001152_8177_9397 384
972 3300048906 Ga0496103_0005595 Ga0496103_0005595_2563_3783 384
973 3300048907 Ga0496104_0068659 Ga0496104_0068659_1616_2836 384
974 3300048908 Ga0496105_0052708 Ga0496105_0052708_1737_2957 384
975 3300048909 Ga0496106_0025607 Ga0496106_0025607_1965_3185 384
976 3300048910 Ga0496107_0129957 Ga0496107_0129957_478_1698 384
977 3300048914 Ga0496111_0103463 Ga0496111_0103463_571_1791 384
978 3300048920 Ga0496117_0024346 Ga0496117_0024346_2341_3561 384
979 3300048928 Ga0496125_0170682 Ga0496125_0170682_96_1316 384
980 3300053151 Ga0500604_0010303 Ga0500604_0010303_58_1278 384
981 3300053158 Ga0500627_0000417 Ga0500627_0000417_8775_9995 384

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

47

403

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8361 35 365
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.7866 32 367
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.7786 34 367
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.7743 35 365
6pl5-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.7701 34 367
ID Description Score Start End Superfamily
af_Q54WP0_36_278_1.20.190.10 Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1;Pesticidal crystal protein, N-terminal domain 0.3134 63 219 1.20.190.10
af_Q23135_5_217_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2484 128 365 1.20.1070.10
af_Q23135_5_217_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2397 128 365 1.20.1070.10
af_I1JDS7_107_301_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.2388 128 366 1.20.1510.10
af_Q9ATN2_41_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.237 127 366 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A3S1N1Q1-F1-model_v4 deleted 0.9286 77 372
AF-A0A2S6S9Y6-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.917 70 369 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A537Q160-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9142 38 372 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A539CWB4-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.909 70 372 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A2S6S9Y6-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9084 70 369 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301

Feature Viewer

pLDDT pTM Quality
76.05 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map