F487322

General Info

Members Datasets Scaffolds Average Seq Length
979 400 979 80

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100822497|Ga0070704_1008224972
Length 96
Sequence MPTAVPSDAFSTFRIAMDKHPSRIDLLELDIDLRLADLWREAADISEWNLEVVAAFMRAAYGKGYCDALTEDSPGSLCLDHGYRVPAPRQQKSLTE

Samples

Sample ID Description Type Environment
1 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
202 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
203 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
204 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
205 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
206 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
207 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
235 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
236 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
237 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
252 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
253 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
254 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
255 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
256 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
257 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
258 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
261 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
262 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
263 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
264 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
265 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
266 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
267 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
268 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
269 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
270 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
271 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
272 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
273 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
274 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
275 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
276 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
279 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
280 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
281 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
282 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
283 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
289 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
290 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
299 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
307 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
308 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
372 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
373 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
374 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
375 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
376 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
377 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
382 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
383 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
384 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
385 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
398 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
399 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
400 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 5.11
Rhizosphere 92.85
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c002016 3300000043 Bacteria 2151
2 ARSoilOldRDRAFT_c002131 3300000044 Bacteria 1782
3 ARCol0yngRDRAFT_1001263 3300000652 Bacteria 2114
4 JGI24743J22301_10050931 3300001991 Bacteria 844
5 JGI24738J21930_10079082 3300002075 Bacteria 687
6 JGI24033J26618_1015690 3300002155 Bacteria 937
7 JGI24034J26672_10019729 3300002239 Bacteria 1053
8 JGI25406J46586_10048652 3300003203 Unclassified 1436
9 JGI25407J50210_10008218 3300003373 Bacteria 2630
10 JGI25407J50210_10064747 3300003373 Bacteria 915
11 JGI25407J50210_10079816 3300003373 Bacteria 814
12 Ga0070658_10146058 3300005327 Bacteria 1978
13 Ga0070658_10174636 3300005327 Bacteria 1806
14 Ga0070658_10614307 3300005327 Bacteria 942
15 Ga0070658_11744570 3300005327 Bacteria 539
16 Ga0070676_11136035 3300005328 Bacteria 591
17 Ga0070683_100078296 3300005329 Bacteria 3092
18 Ga0070683_100199752 3300005329 Unclassified 1899
19 Ga0070683_100214838 3300005329 Bacteria 1827
20 Ga0070690_100014597 3300005330 Bacteria 4662
21 Ga0070670_100075128 3300005331 Bacteria 2904
22 Ga0070670_101057610 3300005331 Unclassified 739
23 Ga0070670_101431423 3300005331 Unclassified 634
24 Ga0070677_10245514 3300005333 Bacteria 886
25 Ga0068869_101950629 3300005334 Bacteria 527
26 Ga0070680_100233246 3300005336 Bacteria 1555
27 Ga0070680_100386592 3300005336 Bacteria 1192
28 Ga0070680_100731041 3300005336 Unclassified 852
29 Ga0070680_101431146 3300005336 Bacteria 598
30 Ga0070682_101528978 3300005337 Bacteria 575
31 Ga0068868_100111612 3300005338 Bacteria 2222
32 Ga0068868_101339369 3300005338 Unclassified 666
33 Ga0070660_100093399 3300005339 Bacteria 2376
34 Ga0070660_100485581 3300005339 Bacteria 1027
35 Ga0070660_101205756 3300005339 Bacteria 642
36 Ga0070689_100070015 3300005340 Bacteria 2738
37 Ga0070687_100018472 3300005343 Bacteria 3227
38 Ga0070687_100218857 3300005343 Bacteria 1165
39 Ga0070661_100047829 3300005344 Bacteria 3131
40 Ga0070661_100355842 3300005344 Bacteria 1150
41 Ga0070661_100481914 3300005344 Bacteria 991
42 Ga0070692_10213118 3300005345 Bacteria 1137
43 Ga0070692_11170817 3300005345 Unclassified 546
44 Ga0070668_100069398 3300005347 Bacteria 2741
45 Ga0070669_100621181 3300005353 Unclassified 907
46 Ga0070669_101170514 3300005353 Bacteria 664
47 Ga0070675_100258983 3300005354 Unclassified 1524
48 Ga0070675_101279942 3300005354 Bacteria 675
49 Ga0070675_102020010 3300005354 Unclassified 532
50 Ga0070671_100065484 3300005355 Bacteria 3027
51 Ga0070671_100205991 3300005355 Bacteria 1668
52 Ga0070674_100377962 3300005356 Bacteria 1152
53 Ga0070674_101962604 3300005356 Bacteria 532
54 Ga0070673_100067521 3300005364 Bacteria 2860
55 Ga0070688_100014456 3300005365 Bacteria 4473
56 Ga0070688_100802816 3300005365 Bacteria 736
57 Ga0070659_100079337 3300005366 Bacteria 2620
58 Ga0070659_100080179 3300005366 Unclassified 2606
59 Ga0070659_101022946 3300005366 Bacteria 726
60 Ga0070709_10039764 3300005434 Unclassified 2888
61 Ga0070714_100170255 3300005435 Bacteria 1976
62 Ga0070714_100244715 3300005435 Unclassified 1656
63 Ga0070714_102209425 3300005435 Unclassified 536
64 Ga0070713_100074912 3300005436 Bacteria 2869
65 Ga0070710_10469624 3300005437 Unclassified 856
66 Ga0070701_10087878 3300005438 Bacteria 1697
67 Ga0070711_100370234 3300005439 Bacteria 1156
68 Ga0070711_100508233 3300005439 Bacteria 994
69 Ga0070711_101071391 3300005439 Unclassified 694
70 Ga0070705_100022413 3300005440 Bacteria 3375
71 Ga0070705_100451126 3300005440 Bacteria 965
72 Ga0070705_101410453 3300005440 Unclassified 581
73 Ga0070700_100011804 3300005441 Bacteria 4849
74 Ga0070700_100112131 3300005441 Unclassified 1815
75 Ga0070694_100174271 3300005444 Bacteria 1587
76 Ga0070694_100517280 3300005444 Unclassified 952
77 Ga0070708_100400602 3300005445 Bacteria 1294
78 Ga0070708_100498547 3300005445 Bacteria 1149
79 Ga0070708_102069855 3300005445 Unclassified 527
80 Ga0070663_100028830 3300005455 Bacteria 3785
81 Ga0070678_100059862 3300005456 Bacteria 2800
82 Ga0070678_100710896 3300005456 Bacteria 906
83 Ga0070678_100834887 3300005456 Unclassified 839
84 Ga0070662_100457237 3300005457 Bacteria 1060
85 Ga0070662_100785549 3300005457 Unclassified 809
86 Ga0070681_10165540 3300005458 Bacteria 2134
87 Ga0070681_10219919 3300005458 Unclassified 1814
88 Ga0070681_10234836 3300005458 Bacteria 1748
89 Ga0068867_100383897 3300005459 Bacteria 1181
90 Ga0068867_100431371 3300005459 Bacteria 1119
91 Ga0070685_10012794 3300005466 Bacteria 4413
92 Ga0070685_10173038 3300005466 Unclassified 1385
93 Ga0070706_100015559 3300005467 Bacteria 7027
94 Ga0070706_102152813 3300005467 Bacteria 504
95 Ga0070707_100044898 3300005468 Bacteria 4231
96 Ga0070707_100303348 3300005468 Bacteria 1552
97 Ga0070707_101345175 3300005468 Bacteria 681
98 Ga0070698_100018972 3300005471 Bacteria 7234
99 Ga0070698_100408244 3300005471 Bacteria 1292
100 Ga0070699_100310349 3300005518 Bacteria 1416
101 Ga0070679_100101819 3300005530 Bacteria 2859
102 Ga0070679_100169595 3300005530 Bacteria 2155
103 Ga0070679_100563865 3300005530 Bacteria 1082
104 Ga0070679_101167763 3300005530 Unclassified 715
105 Ga0070679_101297729 3300005530 Bacteria 674
106 Ga0070679_101382489 3300005530 Unclassified 650
107 Ga0070679_101933021 3300005530 Bacteria 539
108 Ga0070684_100006350 3300005535 Bacteria 9136
109 Ga0070684_100179321 3300005535 Unclassified 1925
110 Ga0070684_100195681 3300005535 Bacteria 1841
111 Ga0070684_100208099 3300005535 Unclassified 1783
112 Ga0070684_100511568 3300005535 Bacteria 1112
113 Ga0070684_100748583 3300005535 Unclassified 912
114 Ga0070684_102358990 3300005535 Unclassified 501
115 Ga0068853_100076074 3300005539 Bacteria 2931
116 Ga0068853_100173046 3300005539 Bacteria 1954
117 Ga0068853_101002024 3300005539 Unclassified 804
118 Ga0070672_100636892 3300005543 Bacteria 931
119 Ga0070686_100313945 3300005544 Bacteria 1166
120 Ga0070686_101270481 3300005544 Bacteria 614
121 Ga0070695_101490806 3300005545 Bacteria 563
122 Ga0070696_100074531 3300005546 Bacteria 2393
123 Ga0070693_100025208 3300005547 Bacteria 3198
124 Ga0070693_100194775 3300005547 Bacteria 1313
125 Ga0070693_100507183 3300005547 Bacteria 857
126 Ga0070665_100147157 3300005548 Bacteria 2358
127 Ga0070704_100138671 3300005549 Unclassified 1896
128 Ga0070704_100822497 3300005549 Bacteria 831
129 Ga0070704_101617351 3300005549 Bacteria 597
130 Ga0068855_100011027 3300005563 Bacteria 10909
131 Ga0068855_100131866 3300005563 Bacteria 2853
132 Ga0068855_100461503 3300005563 Unclassified 1385
133 Ga0068855_100555042 3300005563 Bacteria 1243
134 Ga0070664_100185643 3300005564 Bacteria 1850
135 Ga0068857_100044711 3300005577 Bacteria 3929
136 Ga0068857_100403746 3300005577 Unclassified 1272
137 Ga0068856_100392351 3300005614 Bacteria 1408
138 Ga0070702_100019489 3300005615 Bacteria 3540
139 Ga0068852_100117640 3300005616 Bacteria 2427
140 Ga0068852_100600800 3300005616 Bacteria 1104
141 Ga0068852_100666153 3300005616 Bacteria 1049
142 Ga0068859_100137330 3300005617 Bacteria 2518
143 Ga0068859_102539849 3300005617 Bacteria 564
144 Ga0068864_100011578 3300005618 Bacteria 7283
145 Ga0068864_100035107 3300005618 Bacteria 4267
146 Ga0068864_102693449 3300005618 Unclassified 503
147 Ga0068866_10085005 3300005718 Unclassified 1709
148 Ga0068866_10238039 3300005718 Unclassified 1107
149 Ga0068866_10421434 3300005718 Unclassified 866
150 Ga0068866_10541917 3300005718 Bacteria 777
151 Ga0068861_100295884 3300005719 Unclassified 1400
152 Ga0068861_101396198 3300005719 Unclassified 684
153 Ga0068870_10105171 3300005840 Bacteria 1602
154 Ga0068870_10750587 3300005840 Bacteria 678
155 Ga0068863_100094804 3300005841 Bacteria 2832
156 Ga0068863_100499073 3300005841 Bacteria 1198
157 Ga0068858_100016953 3300005842 Bacteria 6839
158 Ga0068858_100508214 3300005842 Bacteria 1165
159 Ga0068860_100064788 3300005843 Bacteria 3470
160 Ga0068860_101046294 3300005843 Bacteria 835
161 Ga0068862_100646861 3300005844 Bacteria 1019
162 Ga0081455_10021147 3300005937 Bacteria 6110
163 Ga0081455_10038346 3300005937 Bacteria 4243
164 Ga0081455_10128352 3300005937 Unclassified 1986
165 Ga0081455_10171242 3300005937 Bacteria 1654
166 Ga0081538_10000080 3300005981 Bacteria 92392
167 Ga0081538_10001298 3300005981 Bacteria 25847
168 Ga0081538_10002401 3300005981 Bacteria 18381
169 Ga0081538_10004814 3300005981 Bacteria 12303
170 Ga0081540_1020045 3300005983 Bacteria 4037
171 Ga0081539_10000041 3300005985 Bacteria 292660
172 Ga0070717_11065714 3300006028 Bacteria 736
173 Ga0075365_10090351 3300006038 Bacteria 2086
174 Ga0075365_11068499 3300006038 Bacteria 568
175 Ga0075363_100069183 3300006048 Bacteria 1915
176 Ga0075364_10005351 3300006051 Bacteria 7453
177 Ga0075364_10432745 3300006051 Unclassified 898
178 Ga0075364_10912306 3300006051 Unclassified 598
179 Ga0075432_10003333 3300006058 Bacteria 5427
180 Ga0075432_10005420 3300006058 Bacteria 4349
181 Ga0075432_10157126 3300006058 Unclassified 877
182 Ga0070716_100005593 3300006173 Bacteria 6101
183 Ga0070716_100206701 3300006173 Unclassified 1309
184 Ga0070712_100826481 3300006175 Bacteria 796
185 Ga0075362_10228108 3300006177 Bacteria 912
186 Ga0075367_10250342 3300006178 Unclassified 1111
187 Ga0097621_101200189 3300006237 Bacteria 715
188 Ga0068871_100148046 3300006358 Bacteria 2001
189 Ga0075428_100043048 3300006844 Bacteria 4965
190 Ga0075430_100295480 3300006846 Bacteria 1340
191 Ga0075431_100017960 3300006847 Bacteria 7193
192 Ga0075431_101415373 3300006847 Bacteria 655
193 Ga0075433_10138916 3300006852 Bacteria 2160
194 Ga0075433_10207809 3300006852 Unclassified 1740
195 Ga0075433_10531856 3300006852 Bacteria 1034
196 Ga0075434_100098662 3300006871 Bacteria 2926
197 Ga0075434_100306958 3300006871 Unclassified 1607
198 Ga0075434_101142089 3300006871 Bacteria 792
199 Ga0075429_100021894 3300006880 Bacteria 5541
200 Ga0068865_100008633 3300006881 Bacteria 6302
201 Ga0075436_100017712 3300006914 Bacteria 4876
202 Ga0075436_100189612 3300006914 Bacteria 1454
203 Ga0075436_100268101 3300006914 Unclassified 1219
204 Ga0075436_100395493 3300006914 Bacteria 1001
205 Ga0075436_100495782 3300006914 Bacteria 893
206 Ga0097620_100137334 3300006931 Bacteria 2518
207 Ga0097620_102539617 3300006931 Bacteria 564
208 Ga0075435_100081737 3300007076 Unclassified 2654
209 Ga0105251_10392388 3300009011 Unclassified 637
210 Ga0105250_10476070 3300009092 Unclassified 564
211 Ga0105240_10074063 3300009093 Bacteria 4204
212 Ga0105240_10249863 3300009093 Bacteria 2052
213 Ga0111539_10005505 3300009094 Bacteria 16387
214 Ga0111539_10029168 3300009094 Bacteria 6726
215 Ga0111539_10084728 3300009094 Bacteria 3725
216 Ga0111539_10375086 3300009094 Bacteria 1656
217 Ga0111539_10792934 3300009094 Bacteria 1102
218 Ga0111539_10898168 3300009094 Unclassified 1030
219 Ga0111539_11026281 3300009094 Bacteria 959
220 Ga0105245_10065417 3300009098 Bacteria 3288
221 Ga0105245_10160761 3300009098 Unclassified 2131
222 Ga0105245_11014900 3300009098 Bacteria 874
223 Ga0105245_11846125 3300009098 Unclassified 657
224 Ga0105247_10122066 3300009101 Bacteria 1689
225 Ga0114129_10001826 3300009147 Bacteria 28991
226 Ga0114129_10010685 3300009147 Bacteria 13094
227 Ga0114129_10118719 3300009147 Bacteria 3643
228 Ga0114129_10251295 3300009147 Unclassified 2373
229 Ga0114129_10300825 3300009147 Unclassified 2138
230 Ga0114129_11343826 3300009147 Bacteria 884
231 Ga0114129_11650982 3300009147 Bacteria 783
232 Ga0114129_11857136 3300009147 Unclassified 731
233 Ga0114129_12225822 3300009147 Unclassified 659
234 Ga0105243_10016148 3300009148 Bacteria 5647
235 Ga0105243_10109220 3300009148 Bacteria 2310
236 Ga0105243_10384520 3300009148 Bacteria 1299
237 Ga0105243_11295421 3300009148 Bacteria 745
238 Ga0105242_10040403 3300009176 Bacteria 3759
239 Ga0105242_10256909 3300009176 Unclassified 1577
240 Ga0105248_10004837 3300009177 Bacteria 14910
241 Ga0105248_10144247 3300009177 Bacteria 2686
242 Ga0105237_11344400 3300009545 Unclassified 721
243 Ga0105238_10674642 3300009551 Bacteria 1045
244 Ga0105238_10905788 3300009551 Bacteria 900
245 Ga0105238_11834812 3300009551 Unclassified 639
246 Ga0105249_10182214 3300009553 Bacteria 2044
247 Ga0105249_13026524 3300009553 Unclassified 540
248 Ga0105249_13133459 3300009553 Bacteria 531
249 Ga0105239_10341817 3300010375 Bacteria 1689
250 Ga0105246_10166285 3300011119 Bacteria 1685
251 Ga0105246_11584954 3300011119 Unclassified 618
252 Ga0105246_11609011 3300011119 Unclassified 614
253 Ga0105246_11703352 3300011119 Unclassified 599
254 Ga0157327_1065366 3300012512 Unclassified 552
255 Ga0157373_10168724 3300013100 Bacteria 1540
256 Ga0157373_10555221 3300013100 Bacteria 833
257 Ga0157373_10575672 3300013100 Bacteria 818
258 Ga0157371_10445585 3300013102 Bacteria 951
259 Ga0157371_10719774 3300013102 Bacteria 748
260 Ga0157370_10014041 3300013104 Bacteria 8220
261 Ga0157370_10016815 3300013104 Bacteria 7394
262 Ga0157370_10188791 3300013104 Bacteria 1913
263 Ga0157369_10013355 3300013105 Bacteria 9290
264 Ga0157369_10034851 3300013105 Bacteria 5521
265 Ga0157369_11158706 3300013105 Bacteria 789
266 Ga0157369_12304987 3300013105 Unclassified 546
267 Ga0157374_10853487 3300013296 Bacteria 927
268 Ga0157374_12292149 3300013296 Bacteria 567
269 Ga0163162_10180101 3300013306 Bacteria 2239
270 Ga0163162_11176343 3300013306 Bacteria 870
271 Ga0163162_11526124 3300013306 Bacteria 761
272 Ga0163162_11743670 3300013306 Bacteria 711
273 Ga0163162_12899090 3300013306 Unclassified 552
274 Ga0157372_10346817 3300013307 Bacteria 1730
275 Ga0157375_10085146 3300013308 Unclassified 3211
276 Ga0157375_10430495 3300013308 Bacteria 1485
277 Ga0163163_10696609 3300014325 Bacteria 1079
278 Ga0157380_10049133 3300014326 Bacteria 3326
279 Ga0157380_10061007 3300014326 Bacteria 3016
280 Ga0157380_10138713 3300014326 Bacteria 2086
281 Ga0157380_10362572 3300014326 Bacteria 1360
282 Ga0157380_11450248 3300014326 Unclassified 738
283 Ga0182008_10526974 3300014497 Bacteria 653
284 Ga0157377_10238445 3300014745 Unclassified 1173
285 Ga0157377_10552986 3300014745 Bacteria 813
286 Ga0157379_10092357 3300014968 Bacteria 2715
287 Ga0157376_10123997 3300014969 Bacteria 2294
288 Ga0163161_10013589 3300017792 Bacteria 5667
289 Ga0197907_11288220 3300020069 Unclassified 621
290 Ga0206356_10266925 3300020070 Bacteria 1277
291 Ga0206354_10616934 3300020081 Bacteria 1712
292 Ga0206353_11689559 3300020082 Bacteria 731
293 Ga0206353_11915172 3300020082 Bacteria 639
294 Ga0206353_11936762 3300020082 Bacteria 861
295 Ga0206353_12063416 3300020082 Bacteria 6734
296 Ga0207656_10056810 3300025321 Bacteria 1707
297 Ga0207653_10197404 3300025885 Bacteria 758
298 Ga0207682_10527664 3300025893 Bacteria 559
299 Ga0207642_10060998 3300025899 Bacteria 1752
300 Ga0207642_10082979 3300025899 Bacteria 1561
301 Ga0207710_10040328 3300025900 Bacteria 2069
302 Ga0207688_10029283 3300025901 Bacteria 3031
303 Ga0207647_10065508 3300025904 Bacteria 2205
304 Ga0207647_10285508 3300025904 Bacteria 941
305 Ga0207699_10006671 3300025906 Bacteria 5600
306 Ga0207643_10039177 3300025908 Unclassified 2666
307 Ga0207643_11102749 3300025908 Bacteria 512
308 Ga0207705_10116170 3300025909 Bacteria 1981
309 Ga0207705_10395051 3300025909 Bacteria 1069
310 Ga0207684_10014015 3300025910 Bacteria 6925
311 Ga0207684_10162330 3300025910 Bacteria 1924
312 Ga0207707_10241036 3300025912 Unclassified 1572
313 Ga0207707_10289925 3300025912 Bacteria 1416
314 Ga0207707_10862061 3300025912 Bacteria 751
315 Ga0207707_11461162 3300025912 Bacteria 543
316 Ga0207695_10183352 3300025913 Bacteria 2013
317 Ga0207695_10602607 3300025913 Bacteria 980
318 Ga0207663_10478685 3300025916 Bacteria 964
319 Ga0207660_10149117 3300025917 Bacteria 1795
320 Ga0207660_10157117 3300025917 Bacteria 1751
321 Ga0207660_10400285 3300025917 Bacteria 1106
322 Ga0207660_10464053 3300025917 Bacteria 1025
323 Ga0207662_10035141 3300025918 Bacteria 2926
324 Ga0207657_10007923 3300025919 Bacteria 10833
325 Ga0207657_10388064 3300025919 Bacteria 1099
326 Ga0207657_10604150 3300025919 Bacteria 856
327 Ga0207649_10129969 3300025920 Bacteria 1709
328 Ga0207649_10370242 3300025920 Bacteria 1065
329 Ga0207649_11460596 3300025920 Bacteria 541
330 Ga0207652_10026109 3300025921 Bacteria 4861
331 Ga0207652_10080184 3300025921 Bacteria 2853
332 Ga0207652_10182832 3300025921 Bacteria 1884
333 Ga0207652_10730075 3300025921 Bacteria 882
334 Ga0207652_11729890 3300025921 Unclassified 530
335 Ga0207646_10040494 3300025922 Bacteria 4189
336 Ga0207646_10133107 3300025922 Bacteria 2238
337 Ga0207646_11884875 3300025922 Bacteria 510
338 Ga0207694_10594287 3300025924 Bacteria 931
339 Ga0207650_10141985 3300025925 Bacteria 1889
340 Ga0207659_10032967 3300025926 Bacteria 3560
341 Ga0207659_10395197 3300025926 Bacteria 1155
342 Ga0207659_11499064 3300025926 Bacteria 577
343 Ga0207687_10098615 3300025927 Unclassified 2145
344 Ga0207687_11618396 3300025927 Unclassified 556
345 Ga0207700_10000002 3300025928 Bacteria 775978
346 Ga0207700_10314490 3300025928 Unclassified 1355
347 Ga0207700_10867839 3300025928 Unclassified 808
348 Ga0207664_10011931 3300025929 Bacteria 6203
349 Ga0207664_10066261 3300025929 Bacteria 2894
350 Ga0207644_11204391 3300025931 Bacteria 637
351 Ga0207690_10934242 3300025932 Unclassified 720
352 Ga0207706_10116879 3300025933 Bacteria 2346
353 Ga0207706_10219300 3300025933 Bacteria 1666
354 Ga0207686_10424651 3300025934 Bacteria 1017
355 Ga0207709_10054695 3300025935 Bacteria 2462
356 Ga0207709_10492279 3300025935 Bacteria 955
357 Ga0207709_10626051 3300025935 Bacteria 854
358 Ga0207670_10060344 3300025936 Bacteria 2583
359 Ga0207669_10029778 3300025937 Bacteria 3024
360 Ga0207704_10075276 3300025938 Bacteria 2158
361 Ga0207704_10306290 3300025938 Bacteria 1219
362 Ga0207704_10523383 3300025938 Bacteria 959
363 Ga0207665_10017834 3300025939 Unclassified 4666
364 Ga0207691_10039448 3300025940 Bacteria 4369
365 Ga0207711_10122098 3300025941 Bacteria 2327
366 Ga0207711_10345171 3300025941 Bacteria 1378
367 Ga0207711_11405289 3300025941 Bacteria 640
368 Ga0207689_10049158 3300025942 Unclassified 3479
369 Ga0207661_10033451 3300025944 Bacteria 3990
370 Ga0207661_10073039 3300025944 Bacteria 2808
371 Ga0207661_10324746 3300025944 Unclassified 1384
372 Ga0207661_10531338 3300025944 Unclassified 1076
373 Ga0207661_10617671 3300025944 Bacteria 995
374 Ga0207661_10957077 3300025944 Bacteria 789
375 Ga0207679_10126378 3300025945 Bacteria 2044
376 Ga0207667_10033234 3300025949 Bacteria 5549
377 Ga0207667_10376509 3300025949 Unclassified 1447
378 Ga0207667_10820678 3300025949 Bacteria 926
379 Ga0207651_10027189 3300025960 Bacteria 3589
380 Ga0207651_10451447 3300025960 Bacteria 1103
381 Ga0207712_10442720 3300025961 Bacteria 1100
382 Ga0207712_10939251 3300025961 Unclassified 766
383 Ga0207712_11425582 3300025961 Unclassified 620
384 Ga0207668_10169232 3300025972 Bacteria 1712
385 Ga0207668_10256009 3300025972 Bacteria 1424
386 Ga0207640_11033783 3300025981 Unclassified 724
387 Ga0207677_10185133 3300026023 Bacteria 1641
388 Ga0207677_10381887 3300026023 Unclassified 1189
389 Ga0207677_11572826 3300026023 Bacteria 608
390 Ga0207703_11994223 3300026035 Bacteria 557
391 Ga0207639_10149729 3300026041 Unclassified 1953
392 Ga0207639_10367993 3300026041 Bacteria 1288
393 Ga0207678_10008584 3300026067 Bacteria 9001
394 Ga0207708_10040436 3300026075 Bacteria 3555
395 Ga0207708_10489346 3300026075 Unclassified 1029
396 Ga0207702_11166903 3300026078 Bacteria 764
397 Ga0207641_11315378 3300026088 Bacteria 723
398 Ga0207648_10014284 3300026089 Bacteria 7340
399 Ga0207648_10047579 3300026089 Bacteria 3759
400 Ga0207648_10376151 3300026089 Unclassified 1284
401 Ga0207676_10019373 3300026095 Bacteria 4963
402 Ga0207676_12377267 3300026095 Unclassified 527
403 Ga0207674_10007911 3300026116 Bacteria 12348
404 Ga0207674_10015082 3300026116 Bacteria 8506
405 Ga0207674_10117820 3300026116 Bacteria 2626
406 Ga0207674_10720154 3300026116 Bacteria 963
407 Ga0207675_100113029 3300026118 Bacteria 2564
408 Ga0207675_100518491 3300026118 Unclassified 1188
409 Ga0207683_10013801 3300026121 Bacteria 6889
410 Ga0207698_10671757 3300026142 Bacteria 1028
411 Ga0209969_1029806 3300027360 Bacteria 832
412 Ga0209974_10025491 3300027876 Bacteria 1956
413 Ga0207428_10000774 3300027907 Bacteria 36366
414 Ga0207428_10062171 3300027907 Bacteria 2954
415 Ga0207428_10257999 3300027907 Bacteria 1299
416 Ga0268266_10033299 3300028379 Bacteria 4381
417 Ga0268264_10408170 3300028381 Bacteria 1307
418 Ga0265326_10011746 3300028558 Bacteria 2579
419 Ga0265326_10078009 3300028558 Bacteria 937
420 Ga0265319_1003621 3300028563 Bacteria 7992
421 Ga0265334_10006234 3300028573 Bacteria 5155
422 Ga0265318_10000604 3300028577 Bacteria 25020
423 Ga0265323_10081857 3300028653 Bacteria 1090
424 Ga0265322_10011177 3300028654 Bacteria 2604
425 Ga0265336_10058455 3300028666 Bacteria 1157
426 Ga0265338_10004690 3300028800 Bacteria 18320
427 Ga0265338_10016776 3300028800 Bacteria 7934
428 Ga0265324_10060749 3300029957 Bacteria 1292
429 Ga0265330_10014403 3300031235 Bacteria 3670
430 Ga0265332_10034933 3300031238 Bacteria 2184
431 Ga0265328_10000719 3300031239 Bacteria 15346
432 Ga0265325_10002559 3300031241 Bacteria 12232
433 Ga0265329_10022835 3300031242 Bacteria 2088
434 Ga0265340_10002638 3300031247 Bacteria 10198
435 Ga0265339_10014186 3300031249 Bacteria 4808
436 Ga0265316_10002341 3300031344 Bacteria 19753
437 Ga0307408_100165182 3300031548 Bacteria 1762
438 Ga0307408_101234083 3300031548 Unclassified 698
439 Ga0307408_101462892 3300031548 Bacteria 645
440 Ga0265313_10006053 3300031595 Bacteria 8722
441 Ga0265313_10007335 3300031595 Bacteria 7562
442 Ga0265314_10174016 3300031711 Bacteria 1296
443 Ga0265342_10013160 3300031712 Bacteria 5565
444 Ga0307405_11919907 3300031731 Unclassified 528
445 Ga0307413_10610871 3300031824 Bacteria 894
446 Ga0307413_11720936 3300031824 Bacteria 559
447 Ga0307410_10154190 3300031852 Bacteria 1713
448 Ga0307406_10030702 3300031901 Unclassified 3265
449 Ga0307406_10210646 3300031901 Bacteria 1437
450 Ga0307407_10047735 3300031903 Bacteria 2432
451 Ga0307407_10554554 3300031903 Bacteria 850
452 Ga0307412_10052502 3300031911 Bacteria 2700
453 Ga0307412_10473692 3300031911 Bacteria 1037
454 Ga0307412_10746622 3300031911 Unclassified 844
455 Ga0307409_100051043 3300031995 Bacteria 3163
456 Ga0307409_100074201 3300031995 Unclassified 2717
457 Ga0307409_100379052 3300031995 Bacteria 1344
458 Ga0307409_100561599 3300031995 Unclassified 1122
459 Ga0307416_100005741 3300032002 Bacteria 7682
460 Ga0307416_100096804 3300032002 Bacteria 2553
461 Ga0307416_100831913 3300032002 Unclassified 1020
462 Ga0307416_100969902 3300032002 Bacteria 952
463 Ga0307414_10166723 3300032004 Bacteria 1756
464 Ga0307411_10213576 3300032005 Unclassified 1491
465 Ga0307415_100660519 3300032126 Bacteria 938
466 Ga0307415_101301372 3300032126 Bacteria 688
467 Ga0316583_10006849 3300032133 Bacteria 4105
468 Ga0373959_0025311 3300034820 Bacteria 1165
469 Ga0373938_0005578 3300034957 Bacteria 2146
470 Ga0373928_0048236 3300035084 Bacteria 999
471 Ga0373929_0021704 3300035085 Bacteria 1305
472 Ga0373952_0074291 3300035092 Bacteria 856
473 Ga0373939_0037040 3300035114 Bacteria 1447
474 Ga0373941_0027768 3300035115 Bacteria 1655
475 Ga0373960_0303889 3300035121 Bacteria 594
476 Ga0373942_0142612 3300035207 Bacteria 764
477 Ga0373961_0149795 3300035241 Bacteria 794
478 Ga0373962_0083499 3300035242 Bacteria 973
479 Ga0373931_0331785 3300035691 Bacteria 947
480 Ga0395899_0013759 3300037312 Bacteria 6185
481 Ga0395899_0067109 3300037312 Bacteria 2633
482 Ga0395899_0104560 3300037312 Bacteria 2041
483 Ga0395899_0120065 3300037312 Bacteria 1884
484 Ga0395899_0505236 3300037312 Unclassified 784
485 Ga0395899_0529780 3300037312 Unclassified 760
486 Ga0395899_0608879 3300037312 Unclassified 695
487 Ga0395900_0031901 3300037418 Bacteria 5416
488 Ga0395900_0035226 3300037418 Bacteria 5156
489 Ga0395900_0061491 3300037418 Bacteria 3861
490 Ga0395900_0071011 3300037418 Unclassified 3579
491 Ga0395900_0091257 3300037418 Unclassified 3130
492 Ga0395900_0200019 3300037418 Bacteria 2022
493 Ga0395900_0235831 3300037418 Bacteria 1838
494 Ga0395900_0330563 3300037418 Bacteria 1502
495 Ga0395900_0411098 3300037418 Bacteria 1315
496 Ga0395898_0033463 3300037466 Bacteria 5129
497 Ga0395898_0072520 3300037466 Bacteria 3327
498 Ga0395898_0092734 3300037466 Bacteria 2904
499 Ga0395898_0108666 3300037466 Bacteria 2659
500 Ga0395898_0171181 3300037466 Bacteria 2076
501 Ga0395898_0262237 3300037466 Bacteria 1648
502 Ga0395898_0337222 3300037466 Bacteria 1438
503 Ga0395898_1832231 3300037466 Unclassified 528
504 Ga0395905_0031387 3300037471 Bacteria 5001
505 Ga0395905_0059154 3300037471 Bacteria 3583
506 Ga0395905_0063925 3300037471 Bacteria 3443
507 Ga0395905_0161855 3300037471 Bacteria 2103
508 Ga0395905_0590126 3300037471 Bacteria 1013
509 Ga0395905_0599624 3300037471 Bacteria 1003
510 Ga0395905_1013546 3300037471 Bacteria 733
511 Ga0395901_0000559 3300038443 Bacteria 43102
512 Ga0395901_0013278 3300038443 Bacteria 8366
513 Ga0395901_0155561 3300038443 Bacteria 2401
514 Ga0395901_0187193 3300038443 Bacteria 2171
515 Ga0395901_0356132 3300038443 Bacteria 1510
516 Ga0395901_0433892 3300038443 Bacteria 1346
517 Ga0395901_0845163 3300038443 Bacteria 901
518 Ga0395901_0972719 3300038443 Bacteria 826
519 Ga0395901_1652691 3300038443 Unclassified 593
520 Ga0242420_008529 3300038996 Bacteria 1665
521 Ga0439438_133792 3300041405 Unclassified 594
522 Ga0439439_0106883 3300041406 Bacteria 773
523 Ga0439466_0033013 3300041411 Bacteria 1761
524 Ga0439466_0147002 3300041411 Bacteria 722
525 Ga0439466_0216078 3300041411 Bacteria 582
526 Ga0451789_0709166 3300041443 Bacteria 1720
527 Ga0451797_1555583 3300041453 Bacteria 726
528 Ga0451795_0457816 3300041456 Bacteria 1255
529 Ga0451798_0121441 3300041458 Bacteria 726
530 Ga0451802_0203603 3300041460 Bacteria 619
531 Ga0451804_0722354 3300041463 Unclassified 574
532 Ga0451847_0857348 3300041503 Unclassified 530
533 Ga0451843_0196419 3300041509 Bacteria 770
534 Ga0451853_0232164 3300041512 Bacteria 512
535 Ga0439431_0178422 3300041997 Bacteria 612
536 Ga0439433_0064523 3300041999 Bacteria 877
537 Ga0439437_002505 3300042000 Unclassified 1967
538 Ga0439441_024830 3300042001 Bacteria 1128
539 Ga0439442_132617 3300042002 Unclassified 549
540 Ga0439445_0012487 3300042004 Unclassified 2043
541 Ga0439448_0094457 3300042005 Bacteria 1012
542 Ga0439454_071712 3300042011 Unclassified 616
543 Ga0439462_0149285 3300042015 Bacteria 657
544 Ga0450920_056275 3300042122 Unclassified 792
545 Ga0450905_018778 3300042142 Bacteria 1009
546 Ga0450906_022561 3300042145 Unclassified 1122
547 Ga0450910_107162 3300042147 Bacteria 505
548 Ga0439446_0004129 3300042156 Bacteria 3660
549 Ga0450908_043230 3300042184 Bacteria 781
550 Ga0439434_0021832 3300042435 Unclassified 1924
551 Ga0439434_0063821 3300042435 Bacteria 1154
552 Ga0439434_0084434 3300042435 Unclassified 1010
553 Ga0439444_0154187 3300042437 Unclassified 557
554 Ga0450918_041180 3300042531 Unclassified 829
555 Ga0439440_0150583 3300042993 Bacteria 666
556 Ga0466972_0387279 3300044658 Bacteria 655
557 Ga0466965_0231544 3300044683 Bacteria 987
558 Ga0466966_0002463 3300044684 Bacteria 12110
559 Ga0466966_0025242 3300044684 Bacteria 3883
560 Ga0466966_0156545 3300044684 Bacteria 1388
561 Ga0466961_0004872 3300044693 Bacteria 8445
562 Ga0466961_0252431 3300044693 Bacteria 1083
563 Ga0466963_0030174 3300044694 Bacteria 3496
564 Ga0466963_0705779 3300044694 Bacteria 712
565 Ga0466963_0761393 3300044694 Bacteria 683
566 Ga0466964_0041351 3300044706 Bacteria 1864
567 Ga0466964_0045488 3300044706 Bacteria 1786
568 Ga0466971_0016832 3300044719 Bacteria 3230
569 Ga0466970_0032806 3300044765 Bacteria 2744
570 Ga0466957_0024144 3300044842 Bacteria 3597
571 Ga0466957_0130447 3300044842 Bacteria 1610
572 Ga0466957_0547279 3300044842 Bacteria 806
573 Ga0466957_0900858 3300044842 Bacteria 632
574 Ga0466957_0967688 3300044842 Unclassified 610
575 Ga0466960_0025394 3300044901 Bacteria 2681
576 Ga0466960_0085392 3300044901 Bacteria 1599
577 Ga0466960_0210141 3300044901 Bacteria 1067
578 Ga0466960_0396360 3300044901 Bacteria 794
579 Ga0466960_0719853 3300044901 Unclassified 600
580 Ga0466959_0003456 3300045049 Bacteria 10339
581 Ga0466959_0013757 3300045049 Bacteria 5874
582 Ga0466959_1006106 3300045049 Unclassified 555
583 Ga0451576_0709492 3300045051 Bacteria 1057
584 Ga0466958_0028485 3300045836 Bacteria 3312
585 Ga0466958_0168633 3300045836 Bacteria 1386
586 Ga0466958_0722717 3300045836 Bacteria 649
587 Ga0466958_0758186 3300045836 Unclassified 632
588 Ga0466967_0014102 3300045976 Bacteria 6209
589 Ga0466967_0030892 3300045976 Bacteria 4501
590 Ga0466967_0147364 3300045976 Bacteria 2196
591 Ga0466967_0289140 3300045976 Bacteria 1574
592 Ga0466967_0330518 3300045976 Bacteria 1472
593 Ga0466967_2046165 3300045976 Bacteria 569
594 Ga0495592_0543811 3300046454 Bacteria 715
595 Ga0495590_0304996 3300046457 Unclassified 599
596 Ga0495629_0745166 3300046459 Unclassified 649
597 Ga0495641_0063952 3300046461 Bacteria 1657
598 Ga0495653_0132255 3300046463 Bacteria 1765
599 Ga0495580_1013490 3300046472 Unclassified 529
600 Ga0495582_0353018 3300046473 Bacteria 847
601 Ga0495582_0624079 3300046473 Bacteria 624
602 Ga0495605_0187501 3300046474 Bacteria 907
603 Ga0495585_0182029 3300046492 Bacteria 1080
604 Ga0495608_0305205 3300046511 Bacteria 985
605 Ga0495608_0753654 3300046511 Unclassified 577
606 Ga0495618_0198279 3300046514 Bacteria 1271
607 Ga0495620_0394921 3300046515 Unclassified 524
608 Ga0495643_0326367 3300046522 Unclassified 693
609 Ga0495642_0139863 3300046528 Bacteria 1045
610 Ga0495652_0158819 3300046529 Bacteria 1758
611 Ga0495640_0518006 3300046533 Bacteria 725
612 Ga0495586_0829978 3300046535 Bacteria 533
613 Ga0495667_0410687 3300046559 Bacteria 852
614 Ga0495668_0566984 3300046616 Unclassified 627
615 Ga0495634_0341336 3300046642 Unclassified 898
616 Ga0495634_0803522 3300046642 Bacteria 536
617 Ga0495635_0936705 3300046663 Unclassified 553
618 Ga0495659_0019622 3300046664 Unclassified 2262
619 Ga0495659_0033709 3300046664 Bacteria 1799
620 Ga0495661_0441165 3300046665 Unclassified 628
621 Ga0495657_0313282 3300046675 Bacteria 934
622 Ga0495613_0145718 3300046689 Unclassified 1690
623 Ga0495670_0323841 3300046691 Bacteria 828
624 Ga0495670_0799776 3300046691 Bacteria 515
625 Ga0495589_0574270 3300046794 Unclassified 514
626 Ga0495600_0831823 3300046809 Bacteria 548
627 Ga0495581_0894386 3300047315 Unclassified 507
628 Ga0495604_0184102 3300047317 Bacteria 1460
629 Ga0495674_0072947 3300047319 Bacteria 2960
630 Ga0495674_0904912 3300047319 Bacteria 681
631 Ga0495676_0176869 3300047321 Bacteria 1498
632 Ga0495680_0040238 3300047322 Bacteria 3725
633 Ga0495680_0098661 3300047322 Unclassified 2180
634 Ga0495680_0261907 3300047322 Bacteria 1223
635 Ga0495675_0500230 3300047444 Unclassified 698
636 Ga0495684_0160199 3300047471 Bacteria 1679
637 Ga0495684_0436169 3300047471 Bacteria 913
638 Ga0495593_0266044 3300047673 Bacteria 858
639 Ga0496100_0034176 3300048903 Bacteria 3188
640 Ga0496100_0124417 3300048903 Bacteria 1808
641 Ga0496101_1038495 3300048904 Bacteria 644
642 Ga0496101_1196780 3300048904 Unclassified 595
643 Ga0496102_0411868 3300048905 Unclassified 1270
644 Ga0496102_0449371 3300048905 Bacteria 1209
645 Ga0496104_0023751 3300048907 Bacteria 5638
646 Ga0496104_0100569 3300048907 Bacteria 2768
647 Ga0496104_0322637 3300048907 Unclassified 1457
648 Ga0496104_0472891 3300048907 Bacteria 1165
649 Ga0496104_0765140 3300048907 Unclassified 872
650 Ga0496104_1103663 3300048907 Bacteria 697
651 Ga0496105_0056696 3300048908 Bacteria 3234
652 Ga0496105_0074957 3300048908 Bacteria 2795
653 Ga0496105_0558823 3300048908 Bacteria 892
654 Ga0496105_0940145 3300048908 Unclassified 650
655 Ga0496105_1363289 3300048908 Bacteria 515
656 Ga0496106_0013815 3300048909 Bacteria 5967
657 Ga0496106_0262438 3300048909 Bacteria 1382
658 Ga0496107_0019666 3300048910 Bacteria 4764
659 Ga0496107_0063851 3300048910 Bacteria 2669
660 Ga0496108_0019698 3300048911 Bacteria 5541
661 Ga0496108_0050702 3300048911 Bacteria 3475
662 Ga0496108_1005176 3300048911 Bacteria 712
663 Ga0496109_0019278 3300048912 Bacteria 6011
664 Ga0496109_0239526 3300048912 Bacteria 1707
665 Ga0496109_0457059 3300048912 Bacteria 1206
666 Ga0496109_0604575 3300048912 Unclassified 1033
667 Ga0496110_0010426 3300048913 Bacteria 7557
668 Ga0496110_0010563 3300048913 Bacteria 7519
669 Ga0496110_0757735 3300048913 Bacteria 874
670 Ga0496110_1050558 3300048913 Unclassified 722
671 Ga0496111_0080744 3300048914 Bacteria 2373
672 Ga0496111_0295270 3300048914 Unclassified 1201
673 Ga0496111_0302982 3300048914 Unclassified 1185
674 Ga0496111_0393130 3300048914 Unclassified 1025
675 Ga0496111_0808039 3300048914 Bacteria 678
676 Ga0496112_0475528 3300048915 Bacteria 1186
677 Ga0496112_0896769 3300048915 Bacteria 809
678 Ga0496112_1146554 3300048915 Bacteria 695
679 Ga0496113_0268797 3300048916 Unclassified 1362
680 Ga0496113_0293605 3300048916 Unclassified 1301
681 Ga0496114_0081504 3300048917 Bacteria 2733
682 Ga0496114_0681115 3300048917 Bacteria 903
683 Ga0501291_095998 3300049514 Bacteria 612
684 Ga0501031_0044840 3300049568 Bacteria 2885
685 Ga0501031_0045747 3300049568 Bacteria 2855
686 Ga0501031_0278829 3300049568 Bacteria 1084
687 Ga0501031_0341503 3300049568 Bacteria 969
688 Ga0501031_0410563 3300049568 Bacteria 876
689 Ga0501031_0614072 3300049568 Unclassified 699
690 Ga0501031_0626869 3300049568 Bacteria 691
691 Ga0501031_0999247 3300049568 Bacteria 535
692 Ga0501032_0010634 3300049569 Bacteria 6626
693 Ga0501032_0020977 3300049569 Bacteria 4545
694 Ga0501032_0146246 3300049569 Bacteria 1556
695 Ga0501033_0008174 3300049570 Bacteria 8105
696 Ga0501033_0032812 3300049570 Bacteria 3899
697 Ga0501033_0280187 3300049570 Bacteria 1177
698 Ga0501033_0384285 3300049570 Bacteria 980
699 Ga0501033_0758726 3300049570 Bacteria 658
700 Ga0501033_0776939 3300049570 Unclassified 648
701 Ga0501034_0022438 3300049571 Bacteria 6432
702 Ga0501034_0023812 3300049571 Bacteria 6235
703 Ga0501034_0153643 3300049571 Bacteria 2277
704 Ga0501034_0322222 3300049571 Bacteria 1478
705 Ga0501034_0492207 3300049571 Unclassified 1141
706 Ga0501036_0000085 3300049572 Bacteria 58421
707 Ga0501036_0005203 3300049572 Bacteria 10515
708 Ga0501036_0007002 3300049572 Bacteria 9178
709 Ga0501036_0010372 3300049572 Bacteria 7690
710 Ga0501036_0122684 3300049572 Bacteria 2194
711 Ga0501036_0178356 3300049572 Bacteria 1789
712 Ga0501036_0188353 3300049572 Bacteria 1736
713 Ga0501037_0003886 3300049573 Bacteria 10839
714 Ga0501037_0019377 3300049573 Bacteria 5019
715 Ga0501037_0454278 3300049573 Bacteria 873
716 Ga0501038_0010910 3300049574 Bacteria 8298
717 Ga0501038_0045897 3300049574 Bacteria 3790
718 Ga0501038_0059781 3300049574 Bacteria 3263
719 Ga0501038_0377347 3300049574 Bacteria 1100
720 Ga0501038_0634694 3300049574 Bacteria 805
721 Ga0501039_0001894 3300049575 Bacteria 15471
722 Ga0501039_0004981 3300049575 Bacteria 10077
723 Ga0501039_0043970 3300049575 Bacteria 3450
724 Ga0501039_0044514 3300049575 Bacteria 3428
725 Ga0501039_0155483 3300049575 Bacteria 1796
726 Ga0501039_0302011 3300049575 Bacteria 1258
727 Ga0501039_0386889 3300049575 Bacteria 1099
728 Ga0501039_0589518 3300049575 Bacteria 871
729 Ga0501040_0001505 3300049576 Bacteria 14790
730 Ga0501040_0074578 3300049576 Bacteria 2344
731 Ga0501040_0135515 3300049576 Bacteria 1733
732 Ga0501040_0240027 3300049576 Bacteria 1291
733 Ga0501040_0694088 3300049576 Bacteria 736
734 Ga0501041_0001056 3300049577 Bacteria 15063
735 Ga0501041_0025825 3300049577 Bacteria 3531
736 Ga0501041_0046784 3300049577 Bacteria 2632
737 Ga0501041_0051414 3300049577 Bacteria 2512
738 Ga0501041_0088670 3300049577 Bacteria 1909
739 Ga0501041_0276965 3300049577 Bacteria 1055
740 Ga0501041_0522786 3300049577 Bacteria 755
741 Ga0501042_0000066 3300049578 Bacteria 37903
742 Ga0501042_0005607 3300049578 Bacteria 8095
743 Ga0501042_0053729 3300049578 Bacteria 2873
744 Ga0501042_0068462 3300049578 Bacteria 2538
745 Ga0501042_1188070 3300049578 Bacteria 556
746 Ga0501043_0013502 3300049579 Bacteria 6390
747 Ga0501043_0036393 3300049579 Bacteria 3871
748 Ga0501043_0165031 3300049579 Bacteria 1729
749 Ga0501043_0271745 3300049579 Bacteria 1301
750 Ga0501043_0493718 3300049579 Bacteria 915
751 Ga0501043_0780884 3300049579 Bacteria 692
752 Ga0501046_0000352 3300049580 Bacteria 46220
753 Ga0501046_0022182 3300049580 Bacteria 5232
754 Ga0501046_0051601 3300049580 Bacteria 3245
755 Ga0501046_0069698 3300049580 Bacteria 2735
756 Ga0501046_0084831 3300049580 Unclassified 2442
757 Ga0501046_0197252 3300049580 Bacteria 1499
758 Ga0501046_0362881 3300049580 Bacteria 1050
759 Ga0501046_0782058 3300049580 Bacteria 669
760 Ga0501047_0005241 3300049581 Bacteria 12174
761 Ga0501047_0058177 3300049581 Bacteria 3734
762 Ga0501047_0132026 3300049581 Bacteria 2377
763 Ga0501047_0174943 3300049581 Bacteria 2014
764 Ga0501047_0347918 3300049581 Bacteria 1319
765 Ga0501047_0586855 3300049581 Bacteria 937
766 Ga0501047_0896741 3300049581 Unclassified 700
767 Ga0501048_0000212 3300049582 Bacteria 38029
768 Ga0501048_0006478 3300049582 Bacteria 8899
769 Ga0501048_0046714 3300049582 Bacteria 3090
770 Ga0501048_0270755 3300049582 Bacteria 1207
771 Ga0501048_0588755 3300049582 Unclassified 798
772 Ga0501067_0109212 3300049583 Unclassified 1538
773 Ga0501067_0134175 3300049583 Bacteria 1378
774 Ga0501068_0003889 3300049584 Bacteria 8114
775 Ga0501068_0017760 3300049584 Bacteria 4117
776 Ga0501068_0038729 3300049584 Bacteria 2856
777 Ga0501068_0051610 3300049584 Bacteria 2488
778 Ga0501068_0079853 3300049584 Bacteria 2006
779 Ga0501068_0239392 3300049584 Bacteria 1155
780 Ga0501068_0242734 3300049584 Bacteria 1147
781 Ga0501068_0392303 3300049584 Bacteria 894
782 Ga0501069_0115402 3300049585 Unclassified 1532
783 Ga0501069_0167035 3300049585 Bacteria 1268
784 Ga0501069_0224501 3300049585 Unclassified 1092
785 Ga0501069_0376329 3300049585 Bacteria 838
786 Ga0501070_0001060 3300049586 Bacteria 24749
787 Ga0501070_0012020 3300049586 Bacteria 7306
788 Ga0501070_0040880 3300049586 Bacteria 3864
789 Ga0501070_0054282 3300049586 Bacteria 3323
790 Ga0501070_0247007 3300049586 Unclassified 1460
791 Ga0501070_0280477 3300049586 Bacteria 1359
792 Ga0501070_0352174 3300049586 Bacteria 1195
793 Ga0501070_1085914 3300049586 Unclassified 618
794 Ga0501071_0001186 3300049587 Bacteria 14677
795 Ga0501071_0002446 3300049587 Bacteria 11270
796 Ga0501071_0008081 3300049587 Bacteria 6939
797 Ga0501071_0145985 3300049587 Bacteria 1763
798 Ga0501071_0361809 3300049587 Bacteria 1105
799 Ga0501071_1214506 3300049587 Bacteria 582
800 Ga0501071_1250911 3300049587 Bacteria 573
801 Ga0501072_0000072 3300049588 Bacteria 72875
802 Ga0501072_0004289 3300049588 Bacteria 10823
803 Ga0501072_0005411 3300049588 Bacteria 9720
804 Ga0501072_0056800 3300049588 Bacteria 3083
805 Ga0501072_0103016 3300049588 Bacteria 2268
806 Ga0501072_0129073 3300049588 Bacteria 2014
807 Ga0501072_0189811 3300049588 Bacteria 1639
808 Ga0501072_0227324 3300049588 Bacteria 1486
809 Ga0501072_0967637 3300049588 Bacteria 664
810 Ga0501072_1317547 3300049588 Bacteria 559
811 Ga0501072_1420447 3300049588 Unclassified 536
812 Ga0501073_0009735 3300049589 Bacteria 7077
813 Ga0501073_0015671 3300049589 Bacteria 5496
814 Ga0501073_0019844 3300049589 Bacteria 4850
815 Ga0501073_0055581 3300049589 Bacteria 2769
816 Ga0501073_0069593 3300049589 Bacteria 2452
817 Ga0501073_0151481 3300049589 Bacteria 1607
818 Ga0501073_0176670 3300049589 Unclassified 1478
819 Ga0501073_1225303 3300049589 Bacteria 515
820 Ga0501073_1256677 3300049589 Unclassified 508
821 Ga0501074_0001385 3300049590 Bacteria 16089
822 Ga0501074_0034829 3300049590 Bacteria 3649
823 Ga0501074_0045873 3300049590 Bacteria 3160
824 Ga0501074_0050161 3300049590 Bacteria 3012
825 Ga0501074_0054055 3300049590 Bacteria 2896
826 Ga0501074_0069110 3300049590 Bacteria 2539
827 Ga0501074_0174411 3300049590 Bacteria 1534
828 Ga0501074_0200994 3300049590 Unclassified 1420
829 Ga0501074_0781768 3300049590 Unclassified 673
830 Ga0501075_0001193 3300049591 Bacteria 16807
831 Ga0501075_0005139 3300049591 Bacteria 8949
832 Ga0501075_0043599 3300049591 Bacteria 3364
833 Ga0501075_0043656 3300049591 Bacteria 3362
834 Ga0501075_0051117 3300049591 Bacteria 3107
835 Ga0501075_0126394 3300049591 Bacteria 1946
836 Ga0501075_0185126 3300049591 Bacteria 1588
837 Ga0501075_0303671 3300049591 Bacteria 1216
838 Ga0501075_0404003 3300049591 Bacteria 1041
839 Ga0501076_0000747 3300049592 Bacteria 21026
840 Ga0501076_0003147 3300049592 Bacteria 11509
841 Ga0501076_0009286 3300049592 Bacteria 7255
842 Ga0501076_0049847 3300049592 Bacteria 3312
843 Ga0501076_0084275 3300049592 Bacteria 2553
844 Ga0501076_0328083 3300049592 Bacteria 1255
845 Ga0501076_0407296 3300049592 Bacteria 1118
846 Ga0501076_0418977 3300049592 Unclassified 1102
847 Ga0501076_0465588 3300049592 Bacteria 1041
848 Ga0501076_1318183 3300049592 Unclassified 594
849 Ga0501077_0001220 3300049593 Bacteria 15544
850 Ga0501077_0001950 3300049593 Bacteria 12491
851 Ga0501077_0058417 3300049593 Bacteria 2449
852 Ga0501077_0071309 3300049593 Bacteria 2202
853 Ga0501077_0193626 3300049593 Bacteria 1291
854 Ga0501077_0689163 3300049593 Unclassified 656
855 Ga0501079_0000515 3300049741 Bacteria 25161
856 Ga0501079_0017707 3300049741 Bacteria 5442
857 Ga0501079_0027702 3300049741 Bacteria 4346
858 Ga0501079_0041231 3300049741 Bacteria 3562
859 Ga0501079_0043215 3300049741 Bacteria 3478
860 Ga0501079_0088098 3300049741 Bacteria 2403
861 Ga0501079_0101460 3300049741 Bacteria 2231
862 Ga0501079_0132435 3300049741 Bacteria 1940
863 Ga0501079_0233928 3300049741 Unclassified 1436
864 Ga0501079_0928166 3300049741 Bacteria 685
865 Ga0501080_0000230 3300049742 Bacteria 42082
866 Ga0501080_0002151 3300049742 Bacteria 17113
867 Ga0501080_0008348 3300049742 Bacteria 9378
868 Ga0501080_0016662 3300049742 Bacteria 6785
869 Ga0501080_0066622 3300049742 Bacteria 3349
870 Ga0501080_0082540 3300049742 Bacteria 2985
871 Ga0501080_0306245 3300049742 Bacteria 1440
872 Ga0501080_0531498 3300049742 Bacteria 1048
873 Ga0501080_0720698 3300049742 Bacteria 879
874 Ga0501080_1178714 3300049742 Bacteria 659
875 Ga0501080_1558072 3300049742 Bacteria 560
876 Ga0501081_0001918 3300049743 Bacteria 12908
877 Ga0501081_0023796 3300049743 Bacteria 4108
878 Ga0501081_0037280 3300049743 Bacteria 3316
879 Ga0501081_0154613 3300049743 Bacteria 1650
880 Ga0501081_0272018 3300049743 Bacteria 1239
881 Ga0501081_0300960 3300049743 Bacteria 1176
882 Ga0501081_0674421 3300049743 Bacteria 775
883 Ga0501081_1226111 3300049743 Bacteria 568
884 Ga0501083_0001262 3300049744 Bacteria 17164
885 Ga0501083_0006498 3300049744 Bacteria 8290
886 Ga0501083_0019061 3300049744 Bacteria 4777
887 Ga0501083_0026562 3300049744 Bacteria 4001
888 Ga0501083_0099265 3300049744 Bacteria 1921
889 Ga0501083_0112080 3300049744 Bacteria 1793
890 Ga0501083_0212927 3300049744 Bacteria 1260
891 Ga0501083_0535333 3300049744 Unclassified 762
892 Ga0501035_0001838 3300049822 Bacteria 21366
893 Ga0501035_0014173 3300049822 Bacteria 7356
894 Ga0501035_0074417 3300049822 Bacteria 3005
895 Ga0501035_0087731 3300049822 Bacteria 2741
896 Ga0501035_0200264 3300049822 Unclassified 1713
897 Ga0501035_0825444 3300049822 Bacteria 739
898 Ga0501035_0940604 3300049822 Bacteria 682
899 Ga0501044_0015207 3300049823 Bacteria 8288
900 Ga0501044_0032149 3300049823 Bacteria 5516
901 Ga0501044_0223902 3300049823 Bacteria 1831
902 Ga0501044_0608684 3300049823 Bacteria 985
903 Ga0501044_1257546 3300049823 Bacteria 607
904 Ga0501044_1407733 3300049823 Unclassified 563
905 Ga0501045_0000241 3300049824 Bacteria 31816
906 Ga0501045_0038756 3300049824 Bacteria 3466
907 Ga0501045_0086387 3300049824 Bacteria 2315
908 Ga0501045_0117774 3300049824 Bacteria 1971
909 Ga0501045_0251831 3300049824 Bacteria 1314
910 Ga0501045_0339881 3300049824 Bacteria 1117
911 Ga0501045_0462285 3300049824 Bacteria 943
912 Ga0501045_0573722 3300049824 Bacteria 836
913 Ga0501045_0942880 3300049824 Unclassified 633
914 nmdc:mga03n38_22652_c1 3300050490 Bacteria 2545
915 nmdc:mga00v17_343744_c2 3300050491 Unclassified 605
916 nmdc:mga00v17_3709_c1 3300050491 Bacteria 7895
917 nmdc:mga0yw44_218170_c1 3300050492 Bacteria 1263
918 nmdc:mga0yw44_35630_c1 3300050492 Bacteria 2926
919 nmdc:mga0yw44_413568_c1 3300050492 Unclassified 913
920 nmdc:mga0yw44_774095_c1 3300050492 Unclassified 652
921 nmdc:mga06z11_113928_c1 3300050494 Bacteria 1500
922 nmdc:mga04h51_378496_c1 3300050495 Unclassified 589
923 nmdc:mga05p37_102731_c1 3300050507 Bacteria 3519
924 nmdc:mga05p37_1614_c1 3300050507 Bacteria 26128
925 nmdc:mga05p37_2114966_c1 3300050507 Bacteria 527
926 nmdc:mga05p37_239326_c1 3300050507 Bacteria 2183
927 nmdc:mga05p37_582639_c1 3300050507 Bacteria 1267
928 nmdc:mga09592_1116897_c1 3300050508 Unclassified 655
929 nmdc:mga09592_28817_c1 3300050508 Bacteria 4616
930 nmdc:mga0qj67_219018_c1 3300050509 Bacteria 1545
931 nmdc:mga06r32_1601087_c1 3300050510 Unclassified 590
932 nmdc:mga08y16_1039_c1 3300050511 Bacteria 27204
933 nmdc:mga08y16_169317_c1 3300050511 Bacteria 2269
934 nmdc:mga08y16_521234_c1 3300050511 Bacteria 1205
935 nmdc:mga08y16_53313_c1 3300050511 Bacteria 4229
936 nmdc:mga08y16_663006_c1 3300050511 Unclassified 1046
937 nmdc:mga0n895_151250_c1 3300050512 Bacteria 2351
938 nmdc:mga0n895_362128_c1 3300050512 Unclassified 1468
939 nmdc:mga0rr50_41125_c1 3300050513 Bacteria 3366
940 nmdc:mga08x19_118756_c1 3300050514 Bacteria 1770
941 nmdc:mga08x19_25407_c1 3300050514 Unclassified 3689
942 nmdc:mga0a205_19581_c1 3300050515 Bacteria 6383
943 nmdc:mga0a205_40860_c1 3300050515 Bacteria 4466
944 nmdc:mga0a205_469750_c1 3300050515 Bacteria 1117
945 Ga0495601_0286832 3300053077 Bacteria 1073
946 Ga0495595_0418333 3300053084 Bacteria 680
947 Ga0501084_0002046 3300054114 Bacteria 16113
948 Ga0501084_0008815 3300054114 Bacteria 8347
949 Ga0501084_0026511 3300054114 Bacteria 4837
950 Ga0501084_0034478 3300054114 Bacteria 4232
951 Ga0501084_0125949 3300054114 Bacteria 2155
952 Ga0501084_0128954 3300054114 Bacteria 2129
953 Ga0501084_0423210 3300054114 Unclassified 1126
954 Ga0501084_0659096 3300054114 Bacteria 883
955 Ga0501084_1146381 3300054114 Bacteria 652
956 Ga0501084_1550607 3300054114 Bacteria 554
957 Ga0501084_1575978 3300054114 Unclassified 549
958 Ga0501082_0000655 3300060353 Bacteria 30539
959 Ga0501082_0002993 3300060353 Bacteria 14760
960 Ga0501082_0048532 3300060353 Bacteria 3659
961 Ga0501082_0059769 3300060353 Bacteria 3284
962 Ga0501082_0072939 3300060353 Bacteria 2956
963 Ga0501082_0095281 3300060353 Bacteria 2572
964 Ga0501082_0124794 3300060353 Bacteria 2233
965 Ga0501082_0131934 3300060353 Bacteria 2167
966 Ga0501082_0163053 3300060353 Bacteria 1937
967 Ga0501082_0163151 3300060353 Bacteria 1936
968 Ga0501082_0389852 3300060353 Bacteria 1215
969 Ga0501082_1711305 3300060353 Unclassified 549
970 Ga0466962_0034503 3300061719 Bacteria 2422
971 Ga0530510_0001039 3300061734 Bacteria 18381
972 Ga0530510_0005040 3300061734 Bacteria 9115
973 Ga0530510_0016537 3300061734 Bacteria 5222
974 Ga0530510_0097762 3300061734 Bacteria 2146
975 Ga0530510_0119197 3300061734 Bacteria 1936
976 Ga0530510_0147992 3300061734 Bacteria 1733
977 Ga0530510_0160641 3300061734 Unclassified 1662
978 Ga0530510_0495782 3300061734 Bacteria 926
979 Ga0530510_0755289 3300061734 Bacteria 741

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100508233 Ga0070711_1005082332 74
2 3300005439 Ga0070711_101071391 Ga0070711_1010713912 74
3 3300006028 Ga0070717_11065714 Ga0070717_110657142 74
4 3300006173 Ga0070716_100206701 Ga0070716_1002067012 74
5 3300006175 Ga0070712_100826481 Ga0070712_1008264812 74
6 3300009094 Ga0111539_10792934 Ga0111539_107929342 74
7 3300009011 Ga0105251_10392388 Ga0105251_103923882 75
8 3300011119 Ga0105246_11584954 Ga0105246_115849542 76
9 3300028558 Ga0265326_10011746 Ga0265326_100117463 76
10 3300028563 Ga0265319_1003621 Ga0265319_10036214 76
11 3300028577 Ga0265318_10000604 Ga0265318_1000060423 76
12 3300028653 Ga0265323_10081857 Ga0265323_100818571 76
13 3300028654 Ga0265322_10011177 Ga0265322_100111772 76
14 3300028666 Ga0265336_10058455 Ga0265336_100584552 76
15 3300028800 Ga0265338_10016776 Ga0265338_100167767 76
16 3300029957 Ga0265324_10060749 Ga0265324_100607492 76
17 3300031235 Ga0265330_10014403 Ga0265330_100144033 76
18 3300031238 Ga0265332_10034933 Ga0265332_100349332 76
19 3300031239 Ga0265328_10000719 Ga0265328_1000071912 76
20 3300031241 Ga0265325_10002559 Ga0265325_100025595 76
21 3300031242 Ga0265329_10022835 Ga0265329_100228353 76
22 3300031247 Ga0265340_10002638 Ga0265340_100026384 76
23 3300031249 Ga0265339_10014186 Ga0265339_100141862 76
24 3300031344 Ga0265316_10002341 Ga0265316_100023413 76
25 3300031595 Ga0265313_10006053 Ga0265313_100060534 76
26 3300031711 Ga0265314_10174016 Ga0265314_101740162 76
27 3300031712 Ga0265342_10013160 Ga0265342_100131603 76
28 3300045049 Ga0466959_1006106 Ga0466959_1006106_186_425 76
29 3300049568 Ga0501031_0044840 Ga0501031_0044840_2554_2805 76
30 3300049569 Ga0501032_0020977 Ga0501032_0020977_4044_4289 76
31 3300049570 Ga0501033_0032812 Ga0501033_0032812_3389_3634 76
32 3300049570 Ga0501033_0384285 Ga0501033_0384285_600_851 76
33 3300049571 Ga0501034_0022438 Ga0501034_0022438_6101_6352 76
34 3300049571 Ga0501034_0322222 Ga0501034_0322222_1028_1273 76
35 3300049572 Ga0501036_0005203 Ga0501036_0005203_8928_9173 76
36 3300049572 Ga0501036_0010372 Ga0501036_0010372_285_536 76
37 3300049573 Ga0501037_0003886 Ga0501037_0003886_1220_1465 76
38 3300049573 Ga0501037_0454278 Ga0501037_0454278_209_460 76
39 3300049574 Ga0501038_0045897 Ga0501038_0045897_3279_3524 76
40 3300049574 Ga0501038_0059781 Ga0501038_0059781_2102_2353 76
41 3300049575 Ga0501039_0044514 Ga0501039_0044514_911_1162 76
42 3300049575 Ga0501039_0155483 Ga0501039_0155483_1060_1305 76
43 3300049576 Ga0501040_0135515 Ga0501040_0135515_1441_1686 76
44 3300049576 Ga0501040_0240027 Ga0501040_0240027_911_1162 76
45 3300049577 Ga0501041_0276965 Ga0501041_0276965_728_979 76
46 3300049577 Ga0501041_0522786 Ga0501041_0522786_244_489 76
47 3300049578 Ga0501042_0053729 Ga0501042_0053729_1188_1433 76
48 3300049579 Ga0501043_0013502 Ga0501043_0013502_5946_6191 76
49 3300049579 Ga0501043_0165031 Ga0501043_0165031_1349_1600 76
50 3300049580 Ga0501046_0022182 Ga0501046_0022182_3322_3573 76
51 3300049580 Ga0501046_0084831 Ga0501046_0084831_1458_1703 76
52 3300049581 Ga0501047_0058177 Ga0501047_0058177_2019_2270 76
53 3300049582 Ga0501048_0006478 Ga0501048_0006478_492_737 76
54 3300049584 Ga0501068_0038729 Ga0501068_0038729_1424_1669 76
55 3300049584 Ga0501068_0392303 Ga0501068_0392303_563_814 76
56 3300049585 Ga0501069_0167035 Ga0501069_0167035_418_669 76
57 3300049585 Ga0501069_0376329 Ga0501069_0376329_427_672 76
58 3300049586 Ga0501070_0012020 Ga0501070_0012020_3826_4071 76
59 3300049586 Ga0501070_0280477 Ga0501070_0280477_911_1162 76
60 3300049587 Ga0501071_0008081 Ga0501071_0008081_5340_5591 76
61 3300049588 Ga0501072_0056800 Ga0501072_0056800_2752_3003 76
62 3300049588 Ga0501072_1420447 Ga0501072_1420447_48_293 76
63 3300049589 Ga0501073_0015671 Ga0501073_0015671_334_579 76
64 3300049589 Ga0501073_0151481 Ga0501073_0151481_1159_1410 76
65 3300049590 Ga0501074_0045873 Ga0501074_0045873_2310_2561 76
66 3300049590 Ga0501074_0050161 Ga0501074_0050161_1580_1825 76
67 3300049591 Ga0501075_0005139 Ga0501075_0005139_7350_7601 76
68 3300049591 Ga0501075_0126394 Ga0501075_0126394_642_887 76
69 3300049592 Ga0501076_0009286 Ga0501076_0009286_5823_6068 76
70 3300049592 Ga0501076_0049847 Ga0501076_0049847_911_1162 76
71 3300049593 Ga0501077_0193626 Ga0501077_0193626_130_381 76
72 3300049593 Ga0501077_0689163 Ga0501077_0689163_48_293 76
73 3300049741 Ga0501079_0000515 Ga0501079_0000515_785_1036 76
74 3300049741 Ga0501079_0041231 Ga0501079_0041231_3051_3296 76
75 3300049742 Ga0501080_0016662 Ga0501080_0016662_1567_1812 76
76 3300049742 Ga0501080_0531498 Ga0501080_0531498_198_449 76
77 3300049743 Ga0501081_0001918 Ga0501081_0001918_11457_11708 76
78 3300049743 Ga0501081_0674421 Ga0501081_0674421_136_381 76
79 3300049744 Ga0501083_0001262 Ga0501083_0001262_7459_7704 76
80 3300049822 Ga0501035_0014173 Ga0501035_0014173_372_617 76
81 3300049822 Ga0501035_0087731 Ga0501035_0087731_1891_2142 76
82 3300049823 Ga0501044_0032149 Ga0501044_0032149_4974_5219 76
83 3300049824 Ga0501045_0038756 Ga0501045_0038756_1065_1316 76
84 3300049824 Ga0501045_0942880 Ga0501045_0942880_214_459 76
85 3300054114 Ga0501084_0034478 Ga0501084_0034478_911_1162 76
86 3300054114 Ga0501084_0659096 Ga0501084_0659096_395_640 76
87 3300060353 Ga0501082_0002993 Ga0501082_0002993_6642_6893 76
88 3300060353 Ga0501082_0163151 Ga0501082_0163151_267_512 76
89 3300061734 Ga0530510_0016537 Ga0530510_0016537_4187_4438 76
90 3300061734 Ga0530510_0119197 Ga0530510_0119197_1425_1670 76
91 3300003203 JGI25406J46586_10048652 JGI25406J46586_100486522 77
92 3300003373 JGI25407J50210_10008218 JGI25407J50210_100082183 77
93 3300003373 JGI25407J50210_10064747 JGI25407J50210_100647472 77
94 3300003373 JGI25407J50210_10079816 JGI25407J50210_100798161 77
95 3300005327 Ga0070658_10146058 Ga0070658_101460582 77
96 3300005327 Ga0070658_10174636 Ga0070658_101746363 77
97 3300005331 Ga0070670_101057610 Ga0070670_1010576102 77
98 3300005336 Ga0070680_100233246 Ga0070680_1002332463 77
99 3300005336 Ga0070680_100386592 Ga0070680_1003865922 77
100 3300005337 Ga0070682_101528978 Ga0070682_1015289781 77
101 3300005340 Ga0070689_100070015 Ga0070689_1000700157 77
102 3300005343 Ga0070687_100218857 Ga0070687_1002188573 77
103 3300005345 Ga0070692_11170817 Ga0070692_111708171 77
104 3300005353 Ga0070669_100621181 Ga0070669_1006211812 77
105 3300005355 Ga0070671_100205991 Ga0070671_1002059913 77
106 3300005356 Ga0070674_100377962 Ga0070674_1003779622 77
107 3300005366 Ga0070659_100080179 Ga0070659_1000801793 77
108 3300005437 Ga0070710_10469624 Ga0070710_104696242 77
109 3300005438 Ga0070701_10087878 Ga0070701_100878782 77
110 3300005439 Ga0070711_100370234 Ga0070711_1003702341 77
111 3300005440 Ga0070705_101410453 Ga0070705_1014104531 77
112 3300005456 Ga0070678_100710896 Ga0070678_1007108962 77
113 3300005456 Ga0070678_100834887 Ga0070678_1008348872 77
114 3300005458 Ga0070681_10234836 Ga0070681_102348363 77
115 3300005530 Ga0070679_100169595 Ga0070679_1001695953 77
116 3300005530 Ga0070679_101167763 Ga0070679_1011677632 77
117 3300005530 Ga0070679_101382489 Ga0070679_1013824891 77
118 3300005535 Ga0070684_100006350 Ga0070684_1000063502 77
119 3300005535 Ga0070684_100195681 Ga0070684_1001956812 77
120 3300005535 Ga0070684_102358990 Ga0070684_1023589901 77
121 3300005539 Ga0068853_101002024 Ga0068853_1010020242 77
122 3300005544 Ga0070686_100313945 Ga0070686_1003139452 77
123 3300005547 Ga0070693_100194775 Ga0070693_1001947752 77
124 3300005549 Ga0070704_100138671 Ga0070704_1001386713 77
125 3300005577 Ga0068857_100044711 Ga0068857_1000447117 77
126 3300005577 Ga0068857_100403746 Ga0068857_1004037462 77
127 3300005616 Ga0068852_100600800 Ga0068852_1006008002 77
128 3300005618 Ga0068864_100035107 Ga0068864_1000351074 77
129 3300005718 Ga0068866_10238039 Ga0068866_102380392 77
130 3300005719 Ga0068861_100295884 Ga0068861_1002958842 77
131 3300005719 Ga0068861_101396198 Ga0068861_1013961982 77
132 3300005840 Ga0068870_10105171 Ga0068870_101051713 77
133 3300005841 Ga0068863_100499073 Ga0068863_1004990732 77
134 3300005842 Ga0068858_100508214 Ga0068858_1005082142 77
135 3300005843 Ga0068860_101046294 Ga0068860_1010462943 77
136 3300005937 Ga0081455_10038346 Ga0081455_100383463 77
137 3300005937 Ga0081455_10128352 Ga0081455_101283522 77
138 3300005981 Ga0081538_10000080 Ga0081538_1000008047 77
139 3300005981 Ga0081538_10001298 Ga0081538_1000129818 77
140 3300005981 Ga0081538_10002401 Ga0081538_1000240115 77
141 3300005981 Ga0081538_10004814 Ga0081538_100048144 77
142 3300005985 Ga0081539_10000041 Ga0081539_10000041288 77
143 3300006038 Ga0075365_11068499 Ga0075365_110684991 77
144 3300006051 Ga0075364_10432745 Ga0075364_104327452 77
145 3300006058 Ga0075432_10157126 Ga0075432_101571262 77
146 3300006177 Ga0075362_10228108 Ga0075362_102281082 77
147 3300006852 Ga0075433_10531856 Ga0075433_105318562 77
148 3300006871 Ga0075434_100098662 Ga0075434_1000986623 77
149 3300006914 Ga0075436_100017712 Ga0075436_1000177125 77
150 3300006914 Ga0075436_100268101 Ga0075436_1002681012 77
151 3300006914 Ga0075436_100395493 Ga0075436_1003954932 77
152 3300006914 Ga0075436_100495782 Ga0075436_1004957822 77
153 3300009092 Ga0105250_10476070 Ga0105250_104760702 77
154 3300009094 Ga0111539_10375086 Ga0111539_103750863 77
155 3300009094 Ga0111539_11026281 Ga0111539_110262812 77
156 3300009098 Ga0105245_11846125 Ga0105245_118461252 77
157 3300009147 Ga0114129_10118719 Ga0114129_101187193 77
158 3300009147 Ga0114129_11857136 Ga0114129_118571361 77
159 3300009147 Ga0114129_12225822 Ga0114129_122258222 77
160 3300009148 Ga0105243_10384520 Ga0105243_103845203 77
161 3300009177 Ga0105248_10144247 Ga0105248_101442473 77
162 3300009545 Ga0105237_11344400 Ga0105237_113444002 77
163 3300009551 Ga0105238_11834812 Ga0105238_118348121 77
164 3300009553 Ga0105249_10182214 Ga0105249_101822142 77
165 3300009553 Ga0105249_13026524 Ga0105249_130265241 77
166 3300010375 Ga0105239_10341817 Ga0105239_103418172 77
167 3300012512 Ga0157327_1065366 Ga0157327_10653662 77
168 3300013102 Ga0157371_10445585 Ga0157371_104455852 77
169 3300013104 Ga0157370_10014041 Ga0157370_100140414 77
170 3300013306 Ga0163162_11176343 Ga0163162_111763432 77
171 3300013308 Ga0157375_10085146 Ga0157375_100851467 77
172 3300014326 Ga0157380_10362572 Ga0157380_103625722 77
173 3300020082 Ga0206353_11915172 Ga0206353_119151722 77
174 3300020082 Ga0206353_11936762 Ga0206353_119367622 77
175 3300025908 Ga0207643_10039177 Ga0207643_100391777 77
176 3300025909 Ga0207705_10116170 Ga0207705_101161702 77
177 3300025912 Ga0207707_10862061 Ga0207707_108620611 77
178 3300025916 Ga0207663_10478685 Ga0207663_104786852 77
179 3300025917 Ga0207660_10149117 Ga0207660_101491172 77
180 3300025917 Ga0207660_10464053 Ga0207660_104640533 77
181 3300025920 Ga0207649_10370242 Ga0207649_103702423 77
182 3300025921 Ga0207652_10080184 Ga0207652_100801843 77
183 3300025921 Ga0207652_11729890 Ga0207652_117298901 77
184 3300025925 Ga0207650_10141985 Ga0207650_101419853 77
185 3300025926 Ga0207659_10395197 Ga0207659_103951972 77
186 3300025927 Ga0207687_11618396 Ga0207687_116183962 77
187 3300025928 Ga0207700_10867839 Ga0207700_108678391 77
188 3300025929 Ga0207664_10011931 Ga0207664_100119314 77
189 3300025932 Ga0207690_10934242 Ga0207690_109342422 77
190 3300025935 Ga0207709_10492279 Ga0207709_104922792 77
191 3300025938 Ga0207704_10523383 Ga0207704_105233833 77
192 3300025941 Ga0207711_10345171 Ga0207711_103451712 77
193 3300025942 Ga0207689_10049158 Ga0207689_100491587 77
194 3300025944 Ga0207661_10033451 Ga0207661_100334513 77
195 3300025944 Ga0207661_10617671 Ga0207661_106176711 77
196 3300025945 Ga0207679_10126378 Ga0207679_101263782 77
197 3300025960 Ga0207651_10451447 Ga0207651_104514473 77
198 3300025961 Ga0207712_10939251 Ga0207712_109392512 77
199 3300025961 Ga0207712_11425582 Ga0207712_114255821 77
200 3300025981 Ga0207640_11033783 Ga0207640_110337832 77
201 3300026023 Ga0207677_10381887 Ga0207677_103818872 77
202 3300026116 Ga0207674_10007911 Ga0207674_100079112 77
203 3300026116 Ga0207674_10015082 Ga0207674_100150823 77
204 3300026118 Ga0207675_100518491 Ga0207675_1005184912 77
205 3300027876 Ga0209974_10025491 Ga0209974_100254915 77
206 3300027907 Ga0207428_10062171 Ga0207428_100621714 77
207 3300031548 Ga0307408_100165182 Ga0307408_1001651823 77
208 3300031548 Ga0307408_101234083 Ga0307408_1012340832 77
209 3300031548 Ga0307408_101462892 Ga0307408_1014628922 77
210 3300031731 Ga0307405_11919907 Ga0307405_119199072 77
211 3300031824 Ga0307413_10610871 Ga0307413_106108713 77
212 3300031824 Ga0307413_11720936 Ga0307413_117209362 77
213 3300031852 Ga0307410_10154190 Ga0307410_101541903 77
214 3300031901 Ga0307406_10030702 Ga0307406_100307026 77
215 3300031901 Ga0307406_10210646 Ga0307406_102106462 77
216 3300031903 Ga0307407_10047735 Ga0307407_100477353 77
217 3300031911 Ga0307412_10052502 Ga0307412_100525023 77
218 3300031911 Ga0307412_10473692 Ga0307412_104736922 77
219 3300031911 Ga0307412_10746622 Ga0307412_107466222 77
220 3300031995 Ga0307409_100051043 Ga0307409_1000510432 77
221 3300031995 Ga0307409_100074201 Ga0307409_1000742011 77
222 3300031995 Ga0307409_100561599 Ga0307409_1005615992 77
223 3300032002 Ga0307416_100005741 Ga0307416_1000057417 77
224 3300032002 Ga0307416_100096804 Ga0307416_1000968043 77
225 3300032002 Ga0307416_100831913 Ga0307416_1008319132 77
226 3300032002 Ga0307416_100969902 Ga0307416_1009699022 77
227 3300032004 Ga0307414_10166723 Ga0307414_101667232 77
228 3300032005 Ga0307411_10213576 Ga0307411_102135763 77
229 3300032126 Ga0307415_100660519 Ga0307415_1006605192 77
230 3300032126 Ga0307415_101301372 Ga0307415_1013013721 77
231 3300037312 Ga0395899_0013759 Ga0395899_0013759_1104_1346 77
232 3300037312 Ga0395899_0067109 Ga0395899_0067109_279_521 77
233 3300037312 Ga0395899_0529780 Ga0395899_0529780_154_393 77
234 3300037418 Ga0395900_0091257 Ga0395900_0091257_307_549 77
235 3300037418 Ga0395900_0200019 Ga0395900_0200019_1709_1951 77
236 3300037418 Ga0395900_0411098 Ga0395900_0411098_61_300 77
237 3300037466 Ga0395898_0072520 Ga0395898_0072520_1510_1752 77
238 3300037466 Ga0395898_0092734 Ga0395898_0092734_2159_2398 77
239 3300037466 Ga0395898_0108666 Ga0395898_0108666_884_1126 77
240 3300037466 Ga0395898_0337222 Ga0395898_0337222_1031_1267 77
241 3300037471 Ga0395905_0031387 Ga0395905_0031387_4522_4764 77
242 3300037471 Ga0395905_0599624 Ga0395905_0599624_261_503 77
243 3300038443 Ga0395901_0013278 Ga0395901_0013278_6137_6379 77
244 3300041405 Ga0439438_133792 Ga0439438_133792_288_530 77
245 3300041406 Ga0439439_0106883 Ga0439439_0106883_22_264 77
246 3300041411 Ga0439466_0033013 Ga0439466_0033013_1415_1657 77
247 3300041411 Ga0439466_0147002 Ga0439466_0147002_435_671 77
248 3300041411 Ga0439466_0216078 Ga0439466_0216078_280_522 77
249 3300041443 Ga0451789_0709166 Ga0451789_0709166_1161_1397 77
250 3300041453 Ga0451797_1555583 Ga0451797_1555583_415_651 77
251 3300041456 Ga0451795_0457816 Ga0451795_0457816_864_1100 77
252 3300041458 Ga0451798_0121441 Ga0451798_0121441_158_394 77
253 3300041460 Ga0451802_0203603 Ga0451802_0203603_55_291 77
254 3300041463 Ga0451804_0722354 Ga0451804_0722354_264_503 77
255 3300041509 Ga0451843_0196419 Ga0451843_0196419_246_482 77
256 3300041997 Ga0439431_0178422 Ga0439431_0178422_96_338 77
257 3300041999 Ga0439433_0064523 Ga0439433_0064523_330_572 77
258 3300042000 Ga0439437_002505 Ga0439437_002505_745_987 77
259 3300042001 Ga0439441_024830 Ga0439441_024830_353_595 77
260 3300042002 Ga0439442_132617 Ga0439442_132617_90_332 77
261 3300042004 Ga0439445_0012487 Ga0439445_0012487_1302_1538 77
262 3300042005 Ga0439448_0094457 Ga0439448_0094457_219_461 77
263 3300042011 Ga0439454_071712 Ga0439454_071712_326_565 77
264 3300042015 Ga0439462_0149285 Ga0439462_0149285_117_359 77
265 3300042122 Ga0450920_056275 Ga0450920_056275_209_451 77
266 3300042142 Ga0450905_018778 Ga0450905_018778_251_493 77
267 3300042156 Ga0439446_0004129 Ga0439446_0004129_2284_2520 77
268 3300042435 Ga0439434_0021832 Ga0439434_0021832_796_1038 77
269 3300042435 Ga0439434_0063821 Ga0439434_0063821_113_349 77
270 3300042435 Ga0439434_0084434 Ga0439434_0084434_226_468 77
271 3300042437 Ga0439444_0154187 Ga0439444_0154187_105_341 77
272 3300042993 Ga0439440_0150583 Ga0439440_0150583_376_612 77
273 3300044658 Ga0466972_0387279 Ga0466972_0387279_248_490 77
274 3300044683 Ga0466965_0231544 Ga0466965_0231544_722_964 77
275 3300044684 Ga0466966_0002463 Ga0466966_0002463_11618_11854 77
276 3300044684 Ga0466966_0025242 Ga0466966_0025242_1357_1599 77
277 3300044684 Ga0466966_0156545 Ga0466966_0156545_539_775 77
278 3300044693 Ga0466961_0004872 Ga0466961_0004872_4261_4503 77
279 3300044693 Ga0466961_0252431 Ga0466961_0252431_743_979 77
280 3300044694 Ga0466963_0030174 Ga0466963_0030174_973_1209 77
281 3300044694 Ga0466963_0705779 Ga0466963_0705779_224_466 77
282 3300044694 Ga0466963_0761393 Ga0466963_0761393_317_553 77
283 3300044706 Ga0466964_0045488 Ga0466964_0045488_220_459 77
284 3300044719 Ga0466971_0016832 Ga0466971_0016832_1588_1830 77
285 3300044765 Ga0466970_0032806 Ga0466970_0032806_2364_2606 77
286 3300044842 Ga0466957_0024144 Ga0466957_0024144_2312_2554 77
287 3300044842 Ga0466957_0130447 Ga0466957_0130447_200_442 77
288 3300044842 Ga0466957_0547279 Ga0466957_0547279_234_470 77
289 3300044842 Ga0466957_0900858 Ga0466957_0900858_98_337 77
290 3300044842 Ga0466957_0967688 Ga0466957_0967688_164_406 77
291 3300044901 Ga0466960_0085392 Ga0466960_0085392_345_587 77
292 3300044901 Ga0466960_0719853 Ga0466960_0719853_236_472 77
293 3300045049 Ga0466959_0003456 Ga0466959_0003456_387_623 77
294 3300045049 Ga0466959_0013757 Ga0466959_0013757_4326_4568 77
295 3300045836 Ga0466958_0028485 Ga0466958_0028485_1637_1879 77
296 3300045836 Ga0466958_0168633 Ga0466958_0168633_150_386 77
297 3300045836 Ga0466958_0722717 Ga0466958_0722717_251_487 77
298 3300045836 Ga0466958_0758186 Ga0466958_0758186_310_552 77
299 3300045976 Ga0466967_0030892 Ga0466967_0030892_1624_1860 77
300 3300045976 Ga0466967_0147364 Ga0466967_0147364_1577_1816 77
301 3300045976 Ga0466967_0289140 Ga0466967_0289140_944_1180 77
302 3300045976 Ga0466967_0330518 Ga0466967_0330518_67_306 77
303 3300046457 Ga0495590_0304996 Ga0495590_0304996_129_374 77
304 3300046459 Ga0495629_0745166 Ga0495629_0745166_76_312 77
305 3300046461 Ga0495641_0063952 Ga0495641_0063952_713_949 77
306 3300046463 Ga0495653_0132255 Ga0495653_0132255_494_730 77
307 3300046472 Ga0495580_1013490 Ga0495580_1013490_209_451 77
308 3300046473 Ga0495582_0353018 Ga0495582_0353018_178_414 77
309 3300046514 Ga0495618_0198279 Ga0495618_0198279_257_493 77
310 3300046515 Ga0495620_0394921 Ga0495620_0394921_99_344 77
311 3300046522 Ga0495643_0326367 Ga0495643_0326367_211_456 77
312 3300046528 Ga0495642_0139863 Ga0495642_0139863_706_948 77
313 3300046533 Ga0495640_0518006 Ga0495640_0518006_13_252 77
314 3300046559 Ga0495667_0410687 Ga0495667_0410687_347_583 77
315 3300046616 Ga0495668_0566984 Ga0495668_0566984_202_444 77
316 3300046664 Ga0495659_0019622 Ga0495659_0019622_842_1087 77
317 3300046665 Ga0495661_0441165 Ga0495661_0441165_365_610 77
318 3300046689 Ga0495613_0145718 Ga0495613_0145718_593_829 77
319 3300046691 Ga0495670_0799776 Ga0495670_0799776_44_286 77
320 3300046809 Ga0495600_0831823 Ga0495600_0831823_254_490 77
321 3300047317 Ga0495604_0184102 Ga0495604_0184102_550_786 77
322 3300047319 Ga0495674_0072947 Ga0495674_0072947_174_410 77
323 3300047321 Ga0495676_0176869 Ga0495676_0176869_248_484 77
324 3300047322 Ga0495680_0040238 Ga0495680_0040238_3352_3588 77
325 3300047471 Ga0495684_0160199 Ga0495684_0160199_918_1154 77
326 3300047673 Ga0495593_0266044 Ga0495593_0266044_257_493 77
327 3300048903 Ga0496100_0034176 Ga0496100_0034176_95_337 77
328 3300048904 Ga0496101_1038495 Ga0496101_1038495_73_315 77
329 3300048904 Ga0496101_1196780 Ga0496101_1196780_106_342 77
330 3300048907 Ga0496104_0100569 Ga0496104_0100569_1109_1345 77
331 3300048908 Ga0496105_0558823 Ga0496105_0558823_392_628 77
332 3300048908 Ga0496105_1363289 Ga0496105_1363289_226_462 77
333 3300048909 Ga0496106_0262438 Ga0496106_0262438_679_921 77
334 3300048910 Ga0496107_0019666 Ga0496107_0019666_2675_2917 77
335 3300048911 Ga0496108_0050702 Ga0496108_0050702_1802_2038 77
336 3300048912 Ga0496109_0239526 Ga0496109_0239526_135_371 77
337 3300048913 Ga0496110_0757735 Ga0496110_0757735_568_807 77
338 3300048913 Ga0496110_1050558 Ga0496110_1050558_463_699 77
339 3300048914 Ga0496111_0080744 Ga0496111_0080744_206_442 77
340 3300048914 Ga0496111_0393130 Ga0496111_0393130_219_458 77
341 3300048915 Ga0496112_0475528 Ga0496112_0475528_107_349 77
342 3300048916 Ga0496113_0293605 Ga0496113_0293605_817_1053 77
343 3300049514 Ga0501291_095998 Ga0501291_095998_68_304 77
344 3300049568 Ga0501031_0045747 Ga0501031_0045747_1095_1346 77
345 3300049568 Ga0501031_0410563 Ga0501031_0410563_10_255 77
346 3300049568 Ga0501031_0614072 Ga0501031_0614072_353_589 77
347 3300049568 Ga0501031_0626869 Ga0501031_0626869_397_636 77
348 3300049568 Ga0501031_0999247 Ga0501031_0999247_63_305 77
349 3300049569 Ga0501032_0010634 Ga0501032_0010634_1546_1797 77
350 3300049569 Ga0501032_0146246 Ga0501032_0146246_84_323 77
351 3300049570 Ga0501033_0008174 Ga0501033_0008174_5794_6045 77
352 3300049570 Ga0501033_0280187 Ga0501033_0280187_912_1151 77
353 3300049570 Ga0501033_0776939 Ga0501033_0776939_361_612 77
354 3300049571 Ga0501034_0023812 Ga0501034_0023812_1036_1272 77
355 3300049571 Ga0501034_0153643 Ga0501034_0153643_1656_1907 77
356 3300049571 Ga0501034_0492207 Ga0501034_0492207_388_627 77
357 3300049572 Ga0501036_0000085 Ga0501036_0000085_26209_26460 77
358 3300049572 Ga0501036_0007002 Ga0501036_0007002_611_850 77
359 3300049572 Ga0501036_0188353 Ga0501036_0188353_168_419 77
360 3300049573 Ga0501037_0019377 Ga0501037_0019377_953_1204 77
361 3300049574 Ga0501038_0010910 Ga0501038_0010910_2061_2312 77
362 3300049574 Ga0501038_0377347 Ga0501038_0377347_65_304 77
363 3300049575 Ga0501039_0004981 Ga0501039_0004981_5792_6043 77
364 3300049575 Ga0501039_0043970 Ga0501039_0043970_270_509 77
365 3300049575 Ga0501039_0302011 Ga0501039_0302011_686_937 77
366 3300049575 Ga0501039_0589518 Ga0501039_0589518_240_479 77
367 3300049576 Ga0501040_0001505 Ga0501040_0001505_12479_12730 77
368 3300049576 Ga0501040_0074578 Ga0501040_0074578_1223_1474 77
369 3300049576 Ga0501040_0694088 Ga0501040_0694088_217_459 77
370 3300049577 Ga0501041_0001056 Ga0501041_0001056_13737_13976 77
371 3300049577 Ga0501041_0025825 Ga0501041_0025825_1899_2150 77
372 3300049577 Ga0501041_0051414 Ga0501041_0051414_765_1010 77
373 3300049577 Ga0501041_0088670 Ga0501041_0088670_289_540 77
374 3300049578 Ga0501042_0000066 Ga0501042_0000066_2324_2575 77
375 3300049578 Ga0501042_0068462 Ga0501042_0068462_1282_1533 77
376 3300049578 Ga0501042_1188070 Ga0501042_1188070_38_277 77
377 3300049579 Ga0501043_0036393 Ga0501043_0036393_1297_1548 77
378 3300049579 Ga0501043_0493718 Ga0501043_0493718_422_673 77
379 3300049579 Ga0501043_0780884 Ga0501043_0780884_67_306 77
380 3300049580 Ga0501046_0000352 Ga0501046_0000352_43638_43889 77
381 3300049580 Ga0501046_0069698 Ga0501046_0069698_1338_1589 77
382 3300049580 Ga0501046_0197252 Ga0501046_0197252_303_542 77
383 3300049580 Ga0501046_0362881 Ga0501046_0362881_598_837 77
384 3300049580 Ga0501046_0782058 Ga0501046_0782058_70_306 77
385 3300049581 Ga0501047_0005241 Ga0501047_0005241_2053_2304 77
386 3300049581 Ga0501047_0132026 Ga0501047_0132026_1566_1805 77
387 3300049581 Ga0501047_0174943 Ga0501047_0174943_609_848 77
388 3300049581 Ga0501047_0586855 Ga0501047_0586855_681_920 77
389 3300049581 Ga0501047_0896741 Ga0501047_0896741_189_425 77
390 3300049582 Ga0501048_0000212 Ga0501048_0000212_21163_21414 77
391 3300049582 Ga0501048_0046714 Ga0501048_0046714_747_986 77
392 3300049582 Ga0501048_0588755 Ga0501048_0588755_155_406 77
393 3300049583 Ga0501067_0109212 Ga0501067_0109212_147_383 77
394 3300049584 Ga0501068_0003889 Ga0501068_0003889_2053_2304 77
395 3300049584 Ga0501068_0051610 Ga0501068_0051610_710_949 77
396 3300049584 Ga0501068_0079853 Ga0501068_0079853_1598_1843 77
397 3300049585 Ga0501069_0115402 Ga0501069_0115402_453_692 77
398 3300049585 Ga0501069_0224501 Ga0501069_0224501_633_884 77
399 3300049586 Ga0501070_0001060 Ga0501070_0001060_6016_6267 77
400 3300049586 Ga0501070_0054282 Ga0501070_0054282_2015_2251 77
401 3300049586 Ga0501070_0352174 Ga0501070_0352174_894_1133 77
402 3300049586 Ga0501070_1085914 Ga0501070_1085914_190_429 77
403 3300049587 Ga0501071_0001186 Ga0501071_0001186_12539_12790 77
404 3300049587 Ga0501071_0145985 Ga0501071_0145985_1143_1382 77
405 3300049587 Ga0501071_0361809 Ga0501071_0361809_817_1056 77
406 3300049587 Ga0501071_1214506 Ga0501071_1214506_264_503 77
407 3300049587 Ga0501071_1250911 Ga0501071_1250911_295_546 77
408 3300049588 Ga0501072_0000072 Ga0501072_0000072_19462_19713 77
409 3300049588 Ga0501072_0103016 Ga0501072_0103016_946_1197 77
410 3300049588 Ga0501072_0129073 Ga0501072_0129073_1217_1456 77
411 3300049588 Ga0501072_0227324 Ga0501072_0227324_1217_1456 77
412 3300049588 Ga0501072_0967637 Ga0501072_0967637_82_327 77
413 3300049588 Ga0501072_1317547 Ga0501072_1317547_82_321 77
414 3300049589 Ga0501073_0009735 Ga0501073_0009735_5467_5718 77
415 3300049589 Ga0501073_0019844 Ga0501073_0019844_4009_4245 77
416 3300049589 Ga0501073_0176670 Ga0501073_0176670_680_919 77
417 3300049589 Ga0501073_1225303 Ga0501073_1225303_122_361 77
418 3300049589 Ga0501073_1256677 Ga0501073_1256677_228_467 77
419 3300049590 Ga0501074_0001385 Ga0501074_0001385_9888_10139 77
420 3300049590 Ga0501074_0034829 Ga0501074_0034829_2225_2464 77
421 3300049590 Ga0501074_0054055 Ga0501074_0054055_1875_2111 77
422 3300049590 Ga0501074_0174411 Ga0501074_0174411_373_624 77
423 3300049590 Ga0501074_0781768 Ga0501074_0781768_343_582 77
424 3300049591 Ga0501075_0001193 Ga0501075_0001193_15972_16223 77
425 3300049591 Ga0501075_0043656 Ga0501075_0043656_2326_2565 77
426 3300049591 Ga0501075_0051117 Ga0501075_0051117_2001_2246 77
427 3300049591 Ga0501075_0185126 Ga0501075_0185126_656_907 77
428 3300049591 Ga0501075_0404003 Ga0501075_0404003_150_389 77
429 3300049592 Ga0501076_0000747 Ga0501076_0000747_18715_18966 77
430 3300049592 Ga0501076_0328083 Ga0501076_0328083_836_1087 77
431 3300049592 Ga0501076_0407296 Ga0501076_0407296_852_1091 77
432 3300049592 Ga0501076_0418977 Ga0501076_0418977_731_976 77
433 3300049592 Ga0501076_1318183 Ga0501076_1318183_317_559 77
434 3300049593 Ga0501077_0001950 Ga0501077_0001950_6567_6818 77
435 3300049593 Ga0501077_0058417 Ga0501077_0058417_1308_1553 77
436 3300049741 Ga0501079_0017707 Ga0501079_0017707_5172_5423 77
437 3300049741 Ga0501079_0088098 Ga0501079_0088098_261_512 77
438 3300049741 Ga0501079_0101460 Ga0501079_0101460_1126_1365 77
439 3300049741 Ga0501079_0928166 Ga0501079_0928166_287_523 77
440 3300049742 Ga0501080_0000230 Ga0501080_0000230_6092_6343 77
441 3300049742 Ga0501080_0002151 Ga0501080_0002151_7752_7988 77
442 3300049742 Ga0501080_0066622 Ga0501080_0066622_624_863 77
443 3300049742 Ga0501080_0720698 Ga0501080_0720698_116_361 77
444 3300049742 Ga0501080_1178714 Ga0501080_1178714_237_476 77
445 3300049742 Ga0501080_1558072 Ga0501080_1558072_139_396 77
446 3300049743 Ga0501081_0037280 Ga0501081_0037280_1167_1418 77
447 3300049743 Ga0501081_0154613 Ga0501081_0154613_258_503 77
448 3300049743 Ga0501081_0272018 Ga0501081_0272018_853_1092 77
449 3300049743 Ga0501081_0300960 Ga0501081_0300960_811_1062 77
450 3300049743 Ga0501081_1226111 Ga0501081_1226111_135_374 77
451 3300049744 Ga0501083_0006498 Ga0501083_0006498_5987_6238 77
452 3300049744 Ga0501083_0099265 Ga0501083_0099265_96_335 77
453 3300049744 Ga0501083_0112080 Ga0501083_0112080_185_424 77
454 3300049744 Ga0501083_0212927 Ga0501083_0212927_10_267 77
455 3300049744 Ga0501083_0535333 Ga0501083_0535333_404_640 77
456 3300049822 Ga0501035_0001838 Ga0501035_0001838_5172_5423 77
457 3300049822 Ga0501035_0074417 Ga0501035_0074417_786_1025 77
458 3300049822 Ga0501035_0825444 Ga0501035_0825444_438_677 77
459 3300049823 Ga0501044_0015207 Ga0501044_0015207_5074_5325 77
460 3300049823 Ga0501044_0223902 Ga0501044_0223902_924_1163 77
461 3300049823 Ga0501044_0608684 Ga0501044_0608684_683_922 77
462 3300049823 Ga0501044_1257546 Ga0501044_1257546_219_458 77
463 3300049824 Ga0501045_0000241 Ga0501045_0000241_29505_29756 77
464 3300049824 Ga0501045_0086387 Ga0501045_0086387_631_870 77
465 3300049824 Ga0501045_0251831 Ga0501045_0251831_186_437 77
466 3300049824 Ga0501045_0462285 Ga0501045_0462285_381_626 77
467 3300049824 Ga0501045_0573722 Ga0501045_0573722_248_487 77
468 3300050507 nmdc:mga05p37_102731_c1 nmdc:mga05p37_102731_c1_1492_1731 77
469 3300050511 nmdc:mga08y16_169317_c1 nmdc:mga08y16_169317_c1_353_592 77
470 3300050511 nmdc:mga08y16_521234_c1 nmdc:mga08y16_521234_c1_147_383 77
471 3300050512 nmdc:mga0n895_151250_c1 nmdc:mga0n895_151250_c1_883_1122 77
472 3300050514 nmdc:mga08x19_118756_c1 nmdc:mga08x19_118756_c1_42_287 77
473 3300050514 nmdc:mga08x19_25407_c1 nmdc:mga08x19_25407_c1_573_818 77
474 3300050515 nmdc:mga0a205_469750_c1 nmdc:mga0a205_469750_c1_547_786 77
475 3300053084 Ga0495595_0418333 Ga0495595_0418333_299_535 77
476 3300054114 Ga0501084_0002046 Ga0501084_0002046_10080_10331 77
477 3300054114 Ga0501084_0125949 Ga0501084_0125949_1176_1427 77
478 3300054114 Ga0501084_0128954 Ga0501084_0128954_1040_1297 77
479 3300054114 Ga0501084_1146381 Ga0501084_1146381_316_555 77
480 3300054114 Ga0501084_1550607 Ga0501084_1550607_28_270 77
481 3300054114 Ga0501084_1575978 Ga0501084_1575978_53_298 77
482 3300060353 Ga0501082_0000655 Ga0501082_0000655_16583_16834 77
483 3300060353 Ga0501082_0059769 Ga0501082_0059769_351_590 77
484 3300060353 Ga0501082_0072939 Ga0501082_0072939_1166_1417 77
485 3300060353 Ga0501082_0095281 Ga0501082_0095281_788_1027 77
486 3300060353 Ga0501082_0124794 Ga0501082_0124794_176_421 77
487 3300060353 Ga0501082_0163053 Ga0501082_0163053_1148_1387 77
488 3300060353 Ga0501082_0389852 Ga0501082_0389852_845_1096 77
489 3300061719 Ga0466962_0034503 Ga0466962_0034503_633_875 77
490 3300061734 Ga0530510_0001039 Ga0530510_0001039_978_1217 77
491 3300061734 Ga0530510_0005040 Ga0530510_0005040_8845_9096 77
492 3300061734 Ga0530510_0495782 Ga0530510_0495782_180_425 77
493 3300061734 Ga0530510_0755289 Ga0530510_0755289_398_649 77
494 3300005327 Ga0070658_10614307 Ga0070658_106143071 78
495 3300005327 Ga0070658_11744570 Ga0070658_117445701 78
496 3300005339 Ga0070660_100093399 Ga0070660_1000933992 78
497 3300005344 Ga0070661_100047829 Ga0070661_1000478292 78
498 3300005354 Ga0070675_102020010 Ga0070675_1020200101 78
499 3300005365 Ga0070688_100802816 Ga0070688_1008028162 78
500 3300005434 Ga0070709_10039764 Ga0070709_100397642 78
501 3300005435 Ga0070714_100170255 Ga0070714_1001702552 78
502 3300005435 Ga0070714_100244715 Ga0070714_1002447152 78
503 3300005435 Ga0070714_102209425 Ga0070714_1022094252 78
504 3300005436 Ga0070713_100074912 Ga0070713_1000749123 78
505 3300005440 Ga0070705_100451126 Ga0070705_1004511262 78
506 3300005445 Ga0070708_100498547 Ga0070708_1004985472 78
507 3300005445 Ga0070708_102069855 Ga0070708_1020698552 78
508 3300005458 Ga0070681_10165540 Ga0070681_101655403 78
509 3300005467 Ga0070706_100015559 Ga0070706_1000155597 78
510 3300005467 Ga0070706_102152813 Ga0070706_1021528131 78
511 3300005468 Ga0070707_100044898 Ga0070707_1000448984 78
512 3300005468 Ga0070707_100303348 Ga0070707_1003033482 78
513 3300005471 Ga0070698_100018972 Ga0070698_1000189727 78
514 3300005471 Ga0070698_100408244 Ga0070698_1004082442 78
515 3300005530 Ga0070679_101933021 Ga0070679_1019330212 78
516 3300005535 Ga0070684_100748583 Ga0070684_1007485832 78
517 3300005543 Ga0070672_100636892 Ga0070672_1006368923 78
518 3300005549 Ga0070704_100822497 Ga0070704_1008224972 78
519 3300005563 Ga0068855_100011027 Ga0068855_10001102712 78
520 3300005563 Ga0068855_100555042 Ga0068855_1005550423 78
521 3300005617 Ga0068859_102539849 Ga0068859_1025398492 78
522 3300005618 Ga0068864_102693449 Ga0068864_1026934492 78
523 3300005718 Ga0068866_10085005 Ga0068866_100850052 78
524 3300005718 Ga0068866_10541917 Ga0068866_105419172 78
525 3300005983 Ga0081540_1020045 Ga0081540_10200453 78
526 3300006058 Ga0075432_10003333 Ga0075432_100033333 78
527 3300006173 Ga0070716_100005593 Ga0070716_1000055931 78
528 3300006846 Ga0075430_100295480 Ga0075430_1002954802 78
529 3300006847 Ga0075431_100017960 Ga0075431_1000179604 78
530 3300006852 Ga0075433_10207809 Ga0075433_102078092 78
531 3300006871 Ga0075434_100306958 Ga0075434_1003069582 78
532 3300006914 Ga0075436_100189612 Ga0075436_1001896123 78
533 3300006931 Ga0097620_102539617 Ga0097620_1025396172 78
534 3300007076 Ga0075435_100081737 Ga0075435_1000817373 78
535 3300009093 Ga0105240_10074063 Ga0105240_100740632 78
536 3300009093 Ga0105240_10249863 Ga0105240_102498633 78
537 3300009094 Ga0111539_10029168 Ga0111539_100291682 78
538 3300009098 Ga0105245_11014900 Ga0105245_110149002 78
539 3300009147 Ga0114129_10010685 Ga0114129_100106853 78
540 3300009147 Ga0114129_10300825 Ga0114129_103008252 78
541 3300009147 Ga0114129_11343826 Ga0114129_113438261 78
542 3300009147 Ga0114129_11650982 Ga0114129_116509822 78
543 3300009148 Ga0105243_10109220 Ga0105243_101092202 78
544 3300009176 Ga0105242_10256909 Ga0105242_102569092 78
545 3300009551 Ga0105238_10905788 Ga0105238_109057882 78
546 3300013100 Ga0157373_10168724 Ga0157373_101687242 78
547 3300013100 Ga0157373_10555221 Ga0157373_105552211 78
548 3300013104 Ga0157370_10016815 Ga0157370_100168152 78
549 3300013104 Ga0157370_10188791 Ga0157370_101887913 78
550 3300013105 Ga0157369_10013355 Ga0157369_100133558 78
551 3300013105 Ga0157369_10034851 Ga0157369_100348516 78
552 3300013105 Ga0157369_11158706 Ga0157369_111587061 78
553 3300013105 Ga0157369_12304987 Ga0157369_123049872 78
554 3300013296 Ga0157374_10853487 Ga0157374_108534872 78
555 3300013306 Ga0163162_11526124 Ga0163162_115261242 78
556 3300013307 Ga0157372_10346817 Ga0157372_103468173 78
557 3300014326 Ga0157380_10138713 Ga0157380_101387131 78
558 3300014326 Ga0157380_11450248 Ga0157380_114502482 78
559 3300014497 Ga0182008_10526974 Ga0182008_105269741 78
560 3300020069 Ga0197907_11288220 Ga0197907_112882201 78
561 3300020070 Ga0206356_10266925 Ga0206356_102669251 78
562 3300020081 Ga0206354_10616934 Ga0206354_106169342 78
563 3300020082 Ga0206353_12063416 Ga0206353_120634166 78
564 3300025899 Ga0207642_10060998 Ga0207642_100609983 78
565 3300025906 Ga0207699_10006671 Ga0207699_100066715 78
566 3300025909 Ga0207705_10395051 Ga0207705_103950512 78
567 3300025910 Ga0207684_10014015 Ga0207684_100140154 78
568 3300025910 Ga0207684_10162330 Ga0207684_101623302 78
569 3300025912 Ga0207707_10241036 Ga0207707_102410362 78
570 3300025913 Ga0207695_10183352 Ga0207695_101833523 78
571 3300025913 Ga0207695_10602607 Ga0207695_106026071 78
572 3300025917 Ga0207660_10400285 Ga0207660_104002852 78
573 3300025919 Ga0207657_10007923 Ga0207657_1000792310 78
574 3300025919 Ga0207657_10604150 Ga0207657_106041502 78
575 3300025920 Ga0207649_10129969 Ga0207649_101299693 78
576 3300025921 Ga0207652_10730075 Ga0207652_107300751 78
577 3300025922 Ga0207646_10040494 Ga0207646_100404944 78
578 3300025922 Ga0207646_10133107 Ga0207646_101331072 78
579 3300025926 Ga0207659_11499064 Ga0207659_114990641 78
580 3300025928 Ga0207700_10000002 Ga0207700_10000002178 78
581 3300025928 Ga0207700_10314490 Ga0207700_103144902 78
582 3300025929 Ga0207664_10066261 Ga0207664_100662613 78
583 3300025931 Ga0207644_11204391 Ga0207644_112043912 78
584 3300025937 Ga0207669_10029778 Ga0207669_100297783 78
585 3300025939 Ga0207665_10017834 Ga0207665_100178343 78
586 3300025941 Ga0207711_10122098 Ga0207711_101220981 78
587 3300025944 Ga0207661_10957077 Ga0207661_109570772 78
588 3300025949 Ga0207667_10033234 Ga0207667_100332345 78
589 3300025949 Ga0207667_10820678 Ga0207667_108206782 78
590 3300026075 Ga0207708_10489346 Ga0207708_104893462 78
591 3300026089 Ga0207648_10014284 Ga0207648_100142845 78
592 3300026095 Ga0207676_12377267 Ga0207676_123772671 78
593 3300027360 Ga0209969_1029806 Ga0209969_10298062 78
594 3300027907 Ga0207428_10257999 Ga0207428_102579992 78
595 3300028558 Ga0265326_10078009 Ga0265326_100780092 78
596 3300028573 Ga0265334_10006234 Ga0265334_100062342 78
597 3300028800 Ga0265338_10004690 Ga0265338_1000469010 78
598 3300031595 Ga0265313_10007335 Ga0265313_100073355 78
599 3300031903 Ga0307407_10554554 Ga0307407_105545542 78
600 3300031995 Ga0307409_100379052 Ga0307409_1003790522 78
601 3300032133 Ga0316583_10006849 Ga0316583_100068494 78
602 3300037312 Ga0395899_0104560 Ga0395899_0104560_500_739 78
603 3300037312 Ga0395899_0120065 Ga0395899_0120065_771_1010 78
604 3300037312 Ga0395899_0505236 Ga0395899_0505236_93_332 78
605 3300037312 Ga0395899_0608879 Ga0395899_0608879_326_571 78
606 3300037418 Ga0395900_0031901 Ga0395900_0031901_3145_3390 78
607 3300037418 Ga0395900_0035226 Ga0395900_0035226_288_530 78
608 3300037418 Ga0395900_0061491 Ga0395900_0061491_2673_2912 78
609 3300037418 Ga0395900_0071011 Ga0395900_0071011_1238_1477 78
610 3300037418 Ga0395900_0235831 Ga0395900_0235831_260_502 78
611 3300037418 Ga0395900_0330563 Ga0395900_0330563_464_703 78
612 3300037466 Ga0395898_0033463 Ga0395898_0033463_4512_4754 78
613 3300037466 Ga0395898_0171181 Ga0395898_0171181_1477_1716 78
614 3300037466 Ga0395898_0262237 Ga0395898_0262237_1294_1533 78
615 3300037466 Ga0395898_1832231 Ga0395898_1832231_221_463 78
616 3300037471 Ga0395905_0059154 Ga0395905_0059154_1948_2187 78
617 3300037471 Ga0395905_0063925 Ga0395905_0063925_2735_2977 78
618 3300037471 Ga0395905_0161855 Ga0395905_0161855_45_284 78
619 3300037471 Ga0395905_0590126 Ga0395905_0590126_209_448 78
620 3300037471 Ga0395905_1013546 Ga0395905_1013546_168_413 78
621 3300038443 Ga0395901_0000559 Ga0395901_0000559_14376_14618 78
622 3300038443 Ga0395901_0155561 Ga0395901_0155561_452_691 78
623 3300038443 Ga0395901_0187193 Ga0395901_0187193_440_679 78
624 3300038443 Ga0395901_0356132 Ga0395901_0356132_42_281 78
625 3300038443 Ga0395901_0433892 Ga0395901_0433892_490_732 78
626 3300038443 Ga0395901_0845163 Ga0395901_0845163_330_569 78
627 3300038443 Ga0395901_0972719 Ga0395901_0972719_73_318 78
628 3300038443 Ga0395901_1652691 Ga0395901_1652691_243_482 78
629 3300038996 Ga0242420_008529 Ga0242420_008529_715_957 78
630 3300041512 Ga0451853_0232164 Ga0451853_0232164_139_378 78
631 3300042147 Ga0450910_107162 Ga0450910_107162_208_444 78
632 3300042184 Ga0450908_043230 Ga0450908_043230_417_653 78
633 3300042531 Ga0450918_041180 Ga0450918_041180_346_582 78
634 3300044706 Ga0466964_0041351 Ga0466964_0041351_1605_1850 78
635 3300044901 Ga0466960_0025394 Ga0466960_0025394_1283_1525 78
636 3300044901 Ga0466960_0210141 Ga0466960_0210141_108_383 78
637 3300044901 Ga0466960_0396360 Ga0466960_0396360_269_511 78
638 3300045051 Ga0451576_0709492 Ga0451576_0709492_799_1038 78
639 3300045976 Ga0466967_0014102 Ga0466967_0014102_4493_4738 78
640 3300045976 Ga0466967_2046165 Ga0466967_2046165_49_288 78
641 3300046454 Ga0495592_0543811 Ga0495592_0543811_211_471 78
642 3300046473 Ga0495582_0624079 Ga0495582_0624079_18_257 78
643 3300046474 Ga0495605_0187501 Ga0495605_0187501_368_607 78
644 3300046492 Ga0495585_0182029 Ga0495585_0182029_576_815 78
645 3300046511 Ga0495608_0305205 Ga0495608_0305205_425_685 78
646 3300046511 Ga0495608_0753654 Ga0495608_0753654_241_501 78
647 3300046529 Ga0495652_0158819 Ga0495652_0158819_169_429 78
648 3300046535 Ga0495586_0829978 Ga0495586_0829978_144_422 78
649 3300046642 Ga0495634_0341336 Ga0495634_0341336_358_603 78
650 3300046642 Ga0495634_0803522 Ga0495634_0803522_215_475 78
651 3300046663 Ga0495635_0936705 Ga0495635_0936705_121_381 78
652 3300046664 Ga0495659_0033709 Ga0495659_0033709_616_855 78
653 3300046675 Ga0495657_0313282 Ga0495657_0313282_600_845 78
654 3300046691 Ga0495670_0323841 Ga0495670_0323841_518_757 78
655 3300046794 Ga0495589_0574270 Ga0495589_0574270_84_323 78
656 3300047315 Ga0495581_0894386 Ga0495581_0894386_11_256 78
657 3300047319 Ga0495674_0904912 Ga0495674_0904912_386_646 78
658 3300047322 Ga0495680_0098661 Ga0495680_0098661_758_1018 78
659 3300047322 Ga0495680_0261907 Ga0495680_0261907_836_1081 78
660 3300047444 Ga0495675_0500230 Ga0495675_0500230_405_665 78
661 3300047471 Ga0495684_0436169 Ga0495684_0436169_549_809 78
662 3300048907 Ga0496104_0322637 Ga0496104_0322637_457_699 78
663 3300048907 Ga0496104_0472891 Ga0496104_0472891_264_503 78
664 3300048907 Ga0496104_1103663 Ga0496104_1103663_228_473 78
665 3300048908 Ga0496105_0056696 Ga0496105_0056696_1061_1303 78
666 3300048908 Ga0496105_0940145 Ga0496105_0940145_266_505 78
667 3300048912 Ga0496109_0457059 Ga0496109_0457059_798_1037 78
668 3300048913 Ga0496110_0010426 Ga0496110_0010426_945_1187 78
669 3300048914 Ga0496111_0295270 Ga0496111_0295270_311_553 78
670 3300048914 Ga0496111_0808039 Ga0496111_0808039_24_263 78
671 3300048915 Ga0496112_0896769 Ga0496112_0896769_102_341 78
672 3300048916 Ga0496113_0268797 Ga0496113_0268797_491_733 78
673 3300048917 Ga0496114_0681115 Ga0496114_0681115_433_678 78
674 3300049574 Ga0501038_0634694 Ga0501038_0634694_559_795 78
675 3300049583 Ga0501067_0134175 Ga0501067_0134175_1101_1343 78
676 3300049741 Ga0501079_0233928 Ga0501079_0233928_223_465 78
677 3300050507 nmdc:mga05p37_2114966_c1 nmdc:mga05p37_2114966_c1_258_497 78
678 3300050507 nmdc:mga05p37_239326_c1 nmdc:mga05p37_239326_c1_98_340 78
679 3300050507 nmdc:mga05p37_582639_c1 nmdc:mga05p37_582639_c1_370_609 78
680 3300050508 nmdc:mga09592_1116897_c1 nmdc:mga09592_1116897_c1_79_324 78
681 3300050509 nmdc:mga0qj67_219018_c1 nmdc:mga0qj67_219018_c1_274_519 78
682 3300050512 nmdc:mga0n895_362128_c1 nmdc:mga0n895_362128_c1_747_986 78
683 3300050513 nmdc:mga0rr50_41125_c1 nmdc:mga0rr50_41125_c1_2250_2492 78
684 3300050515 nmdc:mga0a205_40860_c1 nmdc:mga0a205_40860_c1_2248_2490 78
685 3300053077 Ga0495601_0286832 Ga0495601_0286832_486_746 78
686 3300054114 Ga0501084_0423210 Ga0501084_0423210_302_544 78
687 3300060353 Ga0501082_1711305 Ga0501082_1711305_101_337 78
688 3300061734 Ga0530510_0160641 Ga0530510_0160641_661_903 78
689 3300000043 ARcpr5yngRDRAFT_c002016 ARcpr5yngRDRAFT_0020163 79
690 3300000044 ARSoilOldRDRAFT_c002131 ARSoilOldRDRAFT_0021313 79
691 3300000652 ARCol0yngRDRAFT_1001263 ARCol0yngRDRAFT_10012633 79
692 3300001991 JGI24743J22301_10050931 JGI24743J22301_100509312 79
693 3300002075 JGI24738J21930_10079082 JGI24738J21930_100790822 79
694 3300002155 JGI24033J26618_1015690 JGI24033J26618_10156903 79
695 3300002239 JGI24034J26672_10019729 JGI24034J26672_100197292 79
696 3300005328 Ga0070676_11136035 Ga0070676_111360351 79
697 3300005329 Ga0070683_100078296 Ga0070683_1000782963 79
698 3300005329 Ga0070683_100199752 Ga0070683_1001997523 79
699 3300005329 Ga0070683_100214838 Ga0070683_1002148383 79
700 3300005330 Ga0070690_100014597 Ga0070690_1000145974 79
701 3300005331 Ga0070670_100075128 Ga0070670_1000751282 79
702 3300005331 Ga0070670_101431423 Ga0070670_1014314232 79
703 3300005333 Ga0070677_10245514 Ga0070677_102455141 79
704 3300005334 Ga0068869_101950629 Ga0068869_1019506291 79
705 3300005336 Ga0070680_100731041 Ga0070680_1007310412 79
706 3300005336 Ga0070680_101431146 Ga0070680_1014311461 79
707 3300005338 Ga0068868_100111612 Ga0068868_1001116122 79
708 3300005338 Ga0068868_101339369 Ga0068868_1013393691 79
709 3300005339 Ga0070660_100485581 Ga0070660_1004855812 79
710 3300005339 Ga0070660_101205756 Ga0070660_1012057561 79
711 3300005343 Ga0070687_100018472 Ga0070687_1000184722 79
712 3300005344 Ga0070661_100355842 Ga0070661_1003558422 79
713 3300005344 Ga0070661_100481914 Ga0070661_1004819142 79
714 3300005345 Ga0070692_10213118 Ga0070692_102131182 79
715 3300005347 Ga0070668_100069398 Ga0070668_1000693982 79
716 3300005353 Ga0070669_101170514 Ga0070669_1011705141 79
717 3300005354 Ga0070675_100258983 Ga0070675_1002589833 79
718 3300005354 Ga0070675_101279942 Ga0070675_1012799421 79
719 3300005355 Ga0070671_100065484 Ga0070671_1000654843 79
720 3300005356 Ga0070674_101962604 Ga0070674_1019626041 79
721 3300005364 Ga0070673_100067521 Ga0070673_1000675212 79
722 3300005365 Ga0070688_100014456 Ga0070688_1000144564 79
723 3300005366 Ga0070659_100079337 Ga0070659_1000793372 79
724 3300005366 Ga0070659_101022946 Ga0070659_1010229461 79
725 3300005440 Ga0070705_100022413 Ga0070705_1000224133 79
726 3300005441 Ga0070700_100011804 Ga0070700_1000118043 79
727 3300005441 Ga0070700_100112131 Ga0070700_1001121313 79
728 3300005444 Ga0070694_100174271 Ga0070694_1001742712 79
729 3300005444 Ga0070694_100517280 Ga0070694_1005172802 79
730 3300005445 Ga0070708_100400602 Ga0070708_1004006022 79
731 3300005455 Ga0070663_100028830 Ga0070663_1000288304 79
732 3300005456 Ga0070678_100059862 Ga0070678_1000598624 79
733 3300005457 Ga0070662_100457237 Ga0070662_1004572372 79
734 3300005457 Ga0070662_100785549 Ga0070662_1007855491 79
735 3300005458 Ga0070681_10219919 Ga0070681_102199193 79
736 3300005459 Ga0068867_100383897 Ga0068867_1003838972 79
737 3300005459 Ga0068867_100431371 Ga0068867_1004313712 79
738 3300005466 Ga0070685_10012794 Ga0070685_100127942 79
739 3300005466 Ga0070685_10173038 Ga0070685_101730382 79
740 3300005468 Ga0070707_101345175 Ga0070707_1013451751 79
741 3300005518 Ga0070699_100310349 Ga0070699_1003103492 79
742 3300005530 Ga0070679_100101819 Ga0070679_1001018193 79
743 3300005530 Ga0070679_100563865 Ga0070679_1005638651 79
744 3300005530 Ga0070679_101297729 Ga0070679_1012977292 79
745 3300005535 Ga0070684_100179321 Ga0070684_1001793212 79
746 3300005535 Ga0070684_100208099 Ga0070684_1002080992 79
747 3300005535 Ga0070684_100511568 Ga0070684_1005115683 79
748 3300005539 Ga0068853_100076074 Ga0068853_1000760743 79
749 3300005539 Ga0068853_100173046 Ga0068853_1001730462 79
750 3300005544 Ga0070686_101270481 Ga0070686_1012704812 79
751 3300005545 Ga0070695_101490806 Ga0070695_1014908061 79
752 3300005546 Ga0070696_100074531 Ga0070696_1000745313 79
753 3300005547 Ga0070693_100025208 Ga0070693_1000252083 79
754 3300005547 Ga0070693_100507183 Ga0070693_1005071832 79
755 3300005548 Ga0070665_100147157 Ga0070665_1001471573 79
756 3300005549 Ga0070704_101617351 Ga0070704_1016173511 79
757 3300005563 Ga0068855_100131866 Ga0068855_1001318663 79
758 3300005563 Ga0068855_100461503 Ga0068855_1004615032 79
759 3300005564 Ga0070664_100185643 Ga0070664_1001856433 79
760 3300005614 Ga0068856_100392351 Ga0068856_1003923513 79
761 3300005615 Ga0070702_100019489 Ga0070702_1000194893 79
762 3300005616 Ga0068852_100117640 Ga0068852_1001176401 79
763 3300005616 Ga0068852_100666153 Ga0068852_1006661531 79
764 3300005617 Ga0068859_100137330 Ga0068859_1001373304 79
765 3300005618 Ga0068864_100011578 Ga0068864_1000115784 79
766 3300005718 Ga0068866_10421434 Ga0068866_104214342 79
767 3300005840 Ga0068870_10750587 Ga0068870_107505871 79
768 3300005841 Ga0068863_100094804 Ga0068863_1000948043 79
769 3300005842 Ga0068858_100016953 Ga0068858_1000169532 79
770 3300005843 Ga0068860_100064788 Ga0068860_1000647883 79
771 3300005844 Ga0068862_100646861 Ga0068862_1006468612 79
772 3300005937 Ga0081455_10021147 Ga0081455_100211476 79
773 3300005937 Ga0081455_10171242 Ga0081455_101712422 79
774 3300006038 Ga0075365_10090351 Ga0075365_100903512 79
775 3300006048 Ga0075363_100069183 Ga0075363_1000691832 79
776 3300006051 Ga0075364_10005351 Ga0075364_100053513 79
777 3300006051 Ga0075364_10912306 Ga0075364_109123062 79
778 3300006058 Ga0075432_10005420 Ga0075432_100054203 79
779 3300006178 Ga0075367_10250342 Ga0075367_102503422 79
780 3300006237 Ga0097621_101200189 Ga0097621_1012001891 79
781 3300006358 Ga0068871_100148046 Ga0068871_1001480462 79
782 3300006844 Ga0075428_100043048 Ga0075428_1000430483 79
783 3300006847 Ga0075431_101415373 Ga0075431_1014153731 79
784 3300006852 Ga0075433_10138916 Ga0075433_101389163 79
785 3300006871 Ga0075434_101142089 Ga0075434_1011420892 79
786 3300006880 Ga0075429_100021894 Ga0075429_1000218942 79
787 3300006881 Ga0068865_100008633 Ga0068865_1000086332 79
788 3300006931 Ga0097620_100137334 Ga0097620_1001373342 79
789 3300009094 Ga0111539_10005505 Ga0111539_100055054 79
790 3300009094 Ga0111539_10084728 Ga0111539_100847283 79
791 3300009094 Ga0111539_10898168 Ga0111539_108981682 79
792 3300009098 Ga0105245_10065417 Ga0105245_100654173 79
793 3300009098 Ga0105245_10160761 Ga0105245_101607612 79
794 3300009101 Ga0105247_10122066 Ga0105247_101220662 79
795 3300009147 Ga0114129_10001826 Ga0114129_100018267 79
796 3300009147 Ga0114129_10251295 Ga0114129_102512953 79
797 3300009148 Ga0105243_10016148 Ga0105243_100161485 79
798 3300009148 Ga0105243_11295421 Ga0105243_112954212 79
799 3300009176 Ga0105242_10040403 Ga0105242_100404033 79
800 3300009177 Ga0105248_10004837 Ga0105248_1000483716 79
801 3300009551 Ga0105238_10674642 Ga0105238_106746421 79
802 3300009553 Ga0105249_13133459 Ga0105249_131334591 79
803 3300011119 Ga0105246_10166285 Ga0105246_101662852 79
804 3300011119 Ga0105246_11609011 Ga0105246_116090112 79
805 3300011119 Ga0105246_11703352 Ga0105246_117033522 79
806 3300013100 Ga0157373_10575672 Ga0157373_105756722 79
807 3300013102 Ga0157371_10719774 Ga0157371_107197742 79
808 3300013296 Ga0157374_12292149 Ga0157374_122921491 79
809 3300013306 Ga0163162_10180101 Ga0163162_101801012 79
810 3300013306 Ga0163162_11743670 Ga0163162_117436702 79
811 3300013306 Ga0163162_12899090 Ga0163162_128990901 79
812 3300013308 Ga0157375_10430495 Ga0157375_104304952 79
813 3300014325 Ga0163163_10696609 Ga0163163_106966092 79
814 3300014326 Ga0157380_10049133 Ga0157380_100491333 79
815 3300014326 Ga0157380_10061007 Ga0157380_100610073 79
816 3300014745 Ga0157377_10238445 Ga0157377_102384453 79
817 3300014745 Ga0157377_10552986 Ga0157377_105529861 79
818 3300014968 Ga0157379_10092357 Ga0157379_100923573 79
819 3300014969 Ga0157376_10123997 Ga0157376_101239973 79
820 3300017792 Ga0163161_10013589 Ga0163161_100135893 79
821 3300020082 Ga0206353_11689559 Ga0206353_116895592 79
822 3300025321 Ga0207656_10056810 Ga0207656_100568103 79
823 3300025885 Ga0207653_10197404 Ga0207653_101974041 79
824 3300025893 Ga0207682_10527664 Ga0207682_105276642 79
825 3300025899 Ga0207642_10082979 Ga0207642_100829793 79
826 3300025900 Ga0207710_10040328 Ga0207710_100403282 79
827 3300025901 Ga0207688_10029283 Ga0207688_100292833 79
828 3300025904 Ga0207647_10065508 Ga0207647_100655081 79
829 3300025904 Ga0207647_10285508 Ga0207647_102855082 79
830 3300025908 Ga0207643_11102749 Ga0207643_111027491 79
831 3300025912 Ga0207707_10289925 Ga0207707_102899253 79
832 3300025912 Ga0207707_11461162 Ga0207707_114611621 79
833 3300025917 Ga0207660_10157117 Ga0207660_101571172 79
834 3300025918 Ga0207662_10035141 Ga0207662_100351412 79
835 3300025919 Ga0207657_10388064 Ga0207657_103880642 79
836 3300025920 Ga0207649_11460596 Ga0207649_114605961 79
837 3300025921 Ga0207652_10026109 Ga0207652_100261093 79
838 3300025921 Ga0207652_10182832 Ga0207652_101828323 79
839 3300025922 Ga0207646_11884875 Ga0207646_118848751 79
840 3300025924 Ga0207694_10594287 Ga0207694_105942871 79
841 3300025926 Ga0207659_10032967 Ga0207659_100329671 79
842 3300025927 Ga0207687_10098615 Ga0207687_100986152 79
843 3300025933 Ga0207706_10116879 Ga0207706_101168793 79
844 3300025933 Ga0207706_10219300 Ga0207706_102193001 79
845 3300025934 Ga0207686_10424651 Ga0207686_104246511 79
846 3300025935 Ga0207709_10054695 Ga0207709_100546953 79
847 3300025935 Ga0207709_10626051 Ga0207709_106260512 79
848 3300025936 Ga0207670_10060344 Ga0207670_100603443 79
849 3300025938 Ga0207704_10075276 Ga0207704_100752763 79
850 3300025938 Ga0207704_10306290 Ga0207704_103062901 79
851 3300025940 Ga0207691_10039448 Ga0207691_100394483 79
852 3300025941 Ga0207711_11405289 Ga0207711_114052892 79
853 3300025944 Ga0207661_10073039 Ga0207661_100730393 79
854 3300025944 Ga0207661_10324746 Ga0207661_103247463 79
855 3300025944 Ga0207661_10531338 Ga0207661_105313381 79
856 3300025949 Ga0207667_10376509 Ga0207667_103765092 79
857 3300025960 Ga0207651_10027189 Ga0207651_100271892 79
858 3300025961 Ga0207712_10442720 Ga0207712_104427203 79
859 3300025972 Ga0207668_10169232 Ga0207668_101692323 79
860 3300025972 Ga0207668_10256009 Ga0207668_102560092 79
861 3300026023 Ga0207677_10185133 Ga0207677_101851333 79
862 3300026023 Ga0207677_11572826 Ga0207677_115728262 79
863 3300026035 Ga0207703_11994223 Ga0207703_119942232 79
864 3300026041 Ga0207639_10149729 Ga0207639_101497292 79
865 3300026041 Ga0207639_10367993 Ga0207639_103679933 79
866 3300026067 Ga0207678_10008584 Ga0207678_100085844 79
867 3300026075 Ga0207708_10040436 Ga0207708_100404363 79
868 3300026078 Ga0207702_11166903 Ga0207702_111669032 79
869 3300026088 Ga0207641_11315378 Ga0207641_113153781 79
870 3300026089 Ga0207648_10047579 Ga0207648_100475794 79
871 3300026089 Ga0207648_10376151 Ga0207648_103761512 79
872 3300026095 Ga0207676_10019373 Ga0207676_100193735 79
873 3300026116 Ga0207674_10117820 Ga0207674_101178203 79
874 3300026116 Ga0207674_10720154 Ga0207674_107201542 79
875 3300026118 Ga0207675_100113029 Ga0207675_1001130293 79
876 3300026121 Ga0207683_10013801 Ga0207683_100138013 79
877 3300026142 Ga0207698_10671757 Ga0207698_106717572 79
878 3300027907 Ga0207428_10000774 Ga0207428_1000077414 79
879 3300028379 Ga0268266_10033299 Ga0268266_100332994 79
880 3300028381 Ga0268264_10408170 Ga0268264_104081702 79
881 3300034820 Ga0373959_0025311 Ga0373959_0025311_744_983 79
882 3300034957 Ga0373938_0005578 Ga0373938_0005578_1722_1961 79
883 3300035084 Ga0373928_0048236 Ga0373928_0048236_264_503 79
884 3300035085 Ga0373929_0021704 Ga0373929_0021704_402_644 79
885 3300035092 Ga0373952_0074291 Ga0373952_0074291_226_465 79
886 3300035114 Ga0373939_0037040 Ga0373939_0037040_616_855 79
887 3300035115 Ga0373941_0027768 Ga0373941_0027768_249_488 79
888 3300035121 Ga0373960_0303889 Ga0373960_0303889_332_571 79
889 3300035207 Ga0373942_0142612 Ga0373942_0142612_42_281 79
890 3300035241 Ga0373961_0149795 Ga0373961_0149795_295_534 79
891 3300035242 Ga0373962_0083499 Ga0373962_0083499_218_457 79
892 3300035691 Ga0373931_0331785 Ga0373931_0331785_677_916 79
893 3300041503 Ga0451847_0857348 Ga0451847_0857348_92_361 79
894 3300042145 Ga0450906_022561 Ga0450906_022561_695_934 79
895 3300048903 Ga0496100_0124417 Ga0496100_0124417_1516_1755 79
896 3300048905 Ga0496102_0411868 Ga0496102_0411868_779_1018 79
897 3300048905 Ga0496102_0449371 Ga0496102_0449371_514_753 79
898 3300048907 Ga0496104_0023751 Ga0496104_0023751_1697_1936 79
899 3300048907 Ga0496104_0765140 Ga0496104_0765140_109_348 79
900 3300048908 Ga0496105_0074957 Ga0496105_0074957_465_704 79
901 3300048909 Ga0496106_0013815 Ga0496106_0013815_2927_3166 79
902 3300048910 Ga0496107_0063851 Ga0496107_0063851_723_962 79
903 3300048911 Ga0496108_0019698 Ga0496108_0019698_1644_1883 79
904 3300048911 Ga0496108_1005176 Ga0496108_1005176_349_588 79
905 3300048912 Ga0496109_0019278 Ga0496109_0019278_1267_1506 79
906 3300048912 Ga0496109_0604575 Ga0496109_0604575_23_262 79
907 3300048913 Ga0496110_0010563 Ga0496110_0010563_5331_5570 79
908 3300048914 Ga0496111_0302982 Ga0496111_0302982_267_506 79
909 3300048915 Ga0496112_1146554 Ga0496112_1146554_166_405 79
910 3300048917 Ga0496114_0081504 Ga0496114_0081504_1696_1935 79
911 3300049568 Ga0501031_0278829 Ga0501031_0278829_742_981 79
912 3300049568 Ga0501031_0341503 Ga0501031_0341503_228_467 79
913 3300049570 Ga0501033_0758726 Ga0501033_0758726_132_371 79
914 3300049572 Ga0501036_0122684 Ga0501036_0122684_1249_1488 79
915 3300049572 Ga0501036_0178356 Ga0501036_0178356_978_1217 79
916 3300049575 Ga0501039_0001894 Ga0501039_0001894_5386_5625 79
917 3300049575 Ga0501039_0386889 Ga0501039_0386889_347_586 79
918 3300049577 Ga0501041_0046784 Ga0501041_0046784_1266_1505 79
919 3300049578 Ga0501042_0005607 Ga0501042_0005607_5880_6119 79
920 3300049579 Ga0501043_0271745 Ga0501043_0271745_192_431 79
921 3300049580 Ga0501046_0051601 Ga0501046_0051601_1247_1486 79
922 3300049581 Ga0501047_0347918 Ga0501047_0347918_191_442 79
923 3300049582 Ga0501048_0270755 Ga0501048_0270755_425_664 79
924 3300049584 Ga0501068_0017760 Ga0501068_0017760_2631_2870 79
925 3300049584 Ga0501068_0239392 Ga0501068_0239392_490_741 79
926 3300049584 Ga0501068_0242734 Ga0501068_0242734_443_682 79
927 3300049586 Ga0501070_0040880 Ga0501070_0040880_910_1161 79
928 3300049586 Ga0501070_0247007 Ga0501070_0247007_129_368 79
929 3300049587 Ga0501071_0002446 Ga0501071_0002446_7400_7639 79
930 3300049588 Ga0501072_0004289 Ga0501072_0004289_874_1125 79
931 3300049588 Ga0501072_0005411 Ga0501072_0005411_8182_8421 79
932 3300049588 Ga0501072_0189811 Ga0501072_0189811_744_983 79
933 3300049589 Ga0501073_0055581 Ga0501073_0055581_1954_2205 79
934 3300049589 Ga0501073_0069593 Ga0501073_0069593_1379_1618 79
935 3300049590 Ga0501074_0069110 Ga0501074_0069110_1013_1264 79
936 3300049590 Ga0501074_0200994 Ga0501074_0200994_1154_1393 79
937 3300049591 Ga0501075_0043599 Ga0501075_0043599_2994_3233 79
938 3300049591 Ga0501075_0303671 Ga0501075_0303671_694_933 79
939 3300049592 Ga0501076_0003147 Ga0501076_0003147_8294_8533 79
940 3300049592 Ga0501076_0084275 Ga0501076_0084275_1048_1287 79
941 3300049592 Ga0501076_0465588 Ga0501076_0465588_77_316 79
942 3300049593 Ga0501077_0001220 Ga0501077_0001220_3541_3780 79
943 3300049593 Ga0501077_0071309 Ga0501077_0071309_1890_2129 79
944 3300049741 Ga0501079_0027702 Ga0501079_0027702_3165_3404 79
945 3300049741 Ga0501079_0043215 Ga0501079_0043215_765_1016 79
946 3300049741 Ga0501079_0132435 Ga0501079_0132435_1081_1320 79
947 3300049742 Ga0501080_0008348 Ga0501080_0008348_3220_3471 79
948 3300049742 Ga0501080_0082540 Ga0501080_0082540_1269_1508 79
949 3300049742 Ga0501080_0306245 Ga0501080_0306245_532_771 79
950 3300049743 Ga0501081_0023796 Ga0501081_0023796_2992_3231 79
951 3300049744 Ga0501083_0019061 Ga0501083_0019061_2645_2896 79
952 3300049744 Ga0501083_0026562 Ga0501083_0026562_50_289 79
953 3300049822 Ga0501035_0200264 Ga0501035_0200264_1206_1445 79
954 3300049822 Ga0501035_0940604 Ga0501035_0940604_329_568 79
955 3300049823 Ga0501044_1407733 Ga0501044_1407733_24_275 79
956 3300049824 Ga0501045_0117774 Ga0501045_0117774_587_826 79
957 3300049824 Ga0501045_0339881 Ga0501045_0339881_434_673 79
958 3300050490 nmdc:mga03n38_22652_c1 nmdc:mga03n38_22652_c1_687_926 79
959 3300050491 nmdc:mga00v17_343744_c2 nmdc:mga00v17_343744_c2_146_385 79
960 3300050491 nmdc:mga00v17_3709_c1 nmdc:mga00v17_3709_c1_6256_6495 79
961 3300050492 nmdc:mga0yw44_218170_c1 nmdc:mga0yw44_218170_c1_889_1158 79
962 3300050492 nmdc:mga0yw44_35630_c1 nmdc:mga0yw44_35630_c1_1133_1372 79
963 3300050492 nmdc:mga0yw44_413568_c1 nmdc:mga0yw44_413568_c1_496_735 79
964 3300050492 nmdc:mga0yw44_774095_c1 nmdc:mga0yw44_774095_c1_192_431 79
965 3300050494 nmdc:mga06z11_113928_c1 nmdc:mga06z11_113928_c1_1106_1345 79
966 3300050495 nmdc:mga04h51_378496_c1 nmdc:mga04h51_378496_c1_200_439 79
967 3300050507 nmdc:mga05p37_1614_c1 nmdc:mga05p37_1614_c1_13799_14038 79
968 3300050508 nmdc:mga09592_28817_c1 nmdc:mga09592_28817_c1_17_256 79
969 3300050510 nmdc:mga06r32_1601087_c1 nmdc:mga06r32_1601087_c1_12_251 79
970 3300050511 nmdc:mga08y16_1039_c1 nmdc:mga08y16_1039_c1_16286_16525 79
971 3300050511 nmdc:mga08y16_53313_c1 nmdc:mga08y16_53313_c1_778_1047 79
972 3300050511 nmdc:mga08y16_663006_c1 nmdc:mga08y16_663006_c1_619_858 79
973 3300050515 nmdc:mga0a205_19581_c1 nmdc:mga0a205_19581_c1_1068_1307 79
974 3300054114 Ga0501084_0008815 Ga0501084_0008815_4976_5215 79
975 3300054114 Ga0501084_0026511 Ga0501084_0026511_356_595 79
976 3300060353 Ga0501082_0048532 Ga0501082_0048532_60_311 79
977 3300060353 Ga0501082_0131934 Ga0501082_0131934_298_537 79
978 3300061734 Ga0530510_0097762 Ga0530510_0097762_848_1087 79
979 3300061734 Ga0530510_0147992 Ga0530510_0147992_924_1163 79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e8k-assembly2.cif.gz_C crystal structure of proteinaceous rnase p (prorp) from planctomycetes bacterium gwf2_40_8 0.5305 1 63
4ue5-assembly1.cif.gz_D structural basis for targeting and elongation arrest of bacillus signal recognition particle 0.4998 12 64
7e8k-assembly1.cif.gz_B crystal structure of proteinaceous rnase p (prorp) from planctomycetes bacterium gwf2_40_8 0.4995 1 63
7nc7-assembly1.cif.gz_B crystal structure of fructose-bisphosphate aldolases fbac from bacillus methanolicus 0.4734 10 47
2gsl-assembly2.cif.gz_C x-ray crystal structure of protein fn1578 from fusobacterium nucleatum. northeast structural genomics consortium target nr1. 0.4689 2 72
ID Description Score Start End Superfamily
af_Q94489_406_718_3.60.40.10 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.5952 4 60 3.60.40.10
af_Q8LES5_259_325_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.5811 7 42 1.10.1240.40
af_A0A1D6MHG4_97_208_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.5557 4 78 1.10.1520.10
2gslB00 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.5301 2 67 1.10.1520.10
af_A0A0B4K7C5_135_220_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5293 2 55 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A538GSE0-F1-model_v4 Uncharacterized protein 0.5832 2 61
AF-W4FLW1-F1-model_v4 DDE Tnp4 domain-containing protein 0.5615 9 53
AF-A0A538GSE0-F1-model_v4 Uncharacterized protein 0.5606 2 61
AF-A0A1Q3FTF4-F1-model_v4 Putative conserved plasma membrane protein 0.5347 7 78 GO:0016020
AF-A0A5B9D9K0-F1-model_v4 Uncharacterized protein 0.4931 10 71

Feature Viewer

pLDDT pTM Quality
77.16 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map