F487322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 979 | 400 | 979 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300005549|Ga0070704_100822497|Ga0070704_1008224972 |
| Length | 96 |
| Sequence | MPTAVPSDAFSTFRIAMDKHPSRIDLLELDIDLRLADLWREAADISEWNLEVVAAFMRAAYGKGYCDALTEDSPGSLCLDHGYRVPAPRQQKSLTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 3 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 234 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 252 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 253 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 254 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 255 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 262 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 263 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 264 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 265 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 266 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 267 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 268 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 269 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 270 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 271 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 272 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 273 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 274 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 275 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 276 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 277 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 278 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 279 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 280 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 281 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 282 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 283 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 284 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 285 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 286 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 289 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 290 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 291 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 292 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 293 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 294 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 295 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 340 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 343 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 344 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 345 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 346 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 347 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 348 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 382 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 400 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.74 |
| Nodule | 0 |
| Rhizoplane | 5.11 |
| Rhizosphere | 92.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c002016 | 3300000043 | Bacteria | 2151 |
| 2 | ARSoilOldRDRAFT_c002131 | 3300000044 | Bacteria | 1782 |
| 3 | ARCol0yngRDRAFT_1001263 | 3300000652 | Bacteria | 2114 |
| 4 | JGI24743J22301_10050931 | 3300001991 | Bacteria | 844 |
| 5 | JGI24738J21930_10079082 | 3300002075 | Bacteria | 687 |
| 6 | JGI24033J26618_1015690 | 3300002155 | Bacteria | 937 |
| 7 | JGI24034J26672_10019729 | 3300002239 | Bacteria | 1053 |
| 8 | JGI25406J46586_10048652 | 3300003203 | Unclassified | 1436 |
| 9 | JGI25407J50210_10008218 | 3300003373 | Bacteria | 2630 |
| 10 | JGI25407J50210_10064747 | 3300003373 | Bacteria | 915 |
| 11 | JGI25407J50210_10079816 | 3300003373 | Bacteria | 814 |
| 12 | Ga0070658_10146058 | 3300005327 | Bacteria | 1978 |
| 13 | Ga0070658_10174636 | 3300005327 | Bacteria | 1806 |
| 14 | Ga0070658_10614307 | 3300005327 | Bacteria | 942 |
| 15 | Ga0070658_11744570 | 3300005327 | Bacteria | 539 |
| 16 | Ga0070676_11136035 | 3300005328 | Bacteria | 591 |
| 17 | Ga0070683_100078296 | 3300005329 | Bacteria | 3092 |
| 18 | Ga0070683_100199752 | 3300005329 | Unclassified | 1899 |
| 19 | Ga0070683_100214838 | 3300005329 | Bacteria | 1827 |
| 20 | Ga0070690_100014597 | 3300005330 | Bacteria | 4662 |
| 21 | Ga0070670_100075128 | 3300005331 | Bacteria | 2904 |
| 22 | Ga0070670_101057610 | 3300005331 | Unclassified | 739 |
| 23 | Ga0070670_101431423 | 3300005331 | Unclassified | 634 |
| 24 | Ga0070677_10245514 | 3300005333 | Bacteria | 886 |
| 25 | Ga0068869_101950629 | 3300005334 | Bacteria | 527 |
| 26 | Ga0070680_100233246 | 3300005336 | Bacteria | 1555 |
| 27 | Ga0070680_100386592 | 3300005336 | Bacteria | 1192 |
| 28 | Ga0070680_100731041 | 3300005336 | Unclassified | 852 |
| 29 | Ga0070680_101431146 | 3300005336 | Bacteria | 598 |
| 30 | Ga0070682_101528978 | 3300005337 | Bacteria | 575 |
| 31 | Ga0068868_100111612 | 3300005338 | Bacteria | 2222 |
| 32 | Ga0068868_101339369 | 3300005338 | Unclassified | 666 |
| 33 | Ga0070660_100093399 | 3300005339 | Bacteria | 2376 |
| 34 | Ga0070660_100485581 | 3300005339 | Bacteria | 1027 |
| 35 | Ga0070660_101205756 | 3300005339 | Bacteria | 642 |
| 36 | Ga0070689_100070015 | 3300005340 | Bacteria | 2738 |
| 37 | Ga0070687_100018472 | 3300005343 | Bacteria | 3227 |
| 38 | Ga0070687_100218857 | 3300005343 | Bacteria | 1165 |
| 39 | Ga0070661_100047829 | 3300005344 | Bacteria | 3131 |
| 40 | Ga0070661_100355842 | 3300005344 | Bacteria | 1150 |
| 41 | Ga0070661_100481914 | 3300005344 | Bacteria | 991 |
| 42 | Ga0070692_10213118 | 3300005345 | Bacteria | 1137 |
| 43 | Ga0070692_11170817 | 3300005345 | Unclassified | 546 |
| 44 | Ga0070668_100069398 | 3300005347 | Bacteria | 2741 |
| 45 | Ga0070669_100621181 | 3300005353 | Unclassified | 907 |
| 46 | Ga0070669_101170514 | 3300005353 | Bacteria | 664 |
| 47 | Ga0070675_100258983 | 3300005354 | Unclassified | 1524 |
| 48 | Ga0070675_101279942 | 3300005354 | Bacteria | 675 |
| 49 | Ga0070675_102020010 | 3300005354 | Unclassified | 532 |
| 50 | Ga0070671_100065484 | 3300005355 | Bacteria | 3027 |
| 51 | Ga0070671_100205991 | 3300005355 | Bacteria | 1668 |
| 52 | Ga0070674_100377962 | 3300005356 | Bacteria | 1152 |
| 53 | Ga0070674_101962604 | 3300005356 | Bacteria | 532 |
| 54 | Ga0070673_100067521 | 3300005364 | Bacteria | 2860 |
| 55 | Ga0070688_100014456 | 3300005365 | Bacteria | 4473 |
| 56 | Ga0070688_100802816 | 3300005365 | Bacteria | 736 |
| 57 | Ga0070659_100079337 | 3300005366 | Bacteria | 2620 |
| 58 | Ga0070659_100080179 | 3300005366 | Unclassified | 2606 |
| 59 | Ga0070659_101022946 | 3300005366 | Bacteria | 726 |
| 60 | Ga0070709_10039764 | 3300005434 | Unclassified | 2888 |
| 61 | Ga0070714_100170255 | 3300005435 | Bacteria | 1976 |
| 62 | Ga0070714_100244715 | 3300005435 | Unclassified | 1656 |
| 63 | Ga0070714_102209425 | 3300005435 | Unclassified | 536 |
| 64 | Ga0070713_100074912 | 3300005436 | Bacteria | 2869 |
| 65 | Ga0070710_10469624 | 3300005437 | Unclassified | 856 |
| 66 | Ga0070701_10087878 | 3300005438 | Bacteria | 1697 |
| 67 | Ga0070711_100370234 | 3300005439 | Bacteria | 1156 |
| 68 | Ga0070711_100508233 | 3300005439 | Bacteria | 994 |
| 69 | Ga0070711_101071391 | 3300005439 | Unclassified | 694 |
| 70 | Ga0070705_100022413 | 3300005440 | Bacteria | 3375 |
| 71 | Ga0070705_100451126 | 3300005440 | Bacteria | 965 |
| 72 | Ga0070705_101410453 | 3300005440 | Unclassified | 581 |
| 73 | Ga0070700_100011804 | 3300005441 | Bacteria | 4849 |
| 74 | Ga0070700_100112131 | 3300005441 | Unclassified | 1815 |
| 75 | Ga0070694_100174271 | 3300005444 | Bacteria | 1587 |
| 76 | Ga0070694_100517280 | 3300005444 | Unclassified | 952 |
| 77 | Ga0070708_100400602 | 3300005445 | Bacteria | 1294 |
| 78 | Ga0070708_100498547 | 3300005445 | Bacteria | 1149 |
| 79 | Ga0070708_102069855 | 3300005445 | Unclassified | 527 |
| 80 | Ga0070663_100028830 | 3300005455 | Bacteria | 3785 |
| 81 | Ga0070678_100059862 | 3300005456 | Bacteria | 2800 |
| 82 | Ga0070678_100710896 | 3300005456 | Bacteria | 906 |
| 83 | Ga0070678_100834887 | 3300005456 | Unclassified | 839 |
| 84 | Ga0070662_100457237 | 3300005457 | Bacteria | 1060 |
| 85 | Ga0070662_100785549 | 3300005457 | Unclassified | 809 |
| 86 | Ga0070681_10165540 | 3300005458 | Bacteria | 2134 |
| 87 | Ga0070681_10219919 | 3300005458 | Unclassified | 1814 |
| 88 | Ga0070681_10234836 | 3300005458 | Bacteria | 1748 |
| 89 | Ga0068867_100383897 | 3300005459 | Bacteria | 1181 |
| 90 | Ga0068867_100431371 | 3300005459 | Bacteria | 1119 |
| 91 | Ga0070685_10012794 | 3300005466 | Bacteria | 4413 |
| 92 | Ga0070685_10173038 | 3300005466 | Unclassified | 1385 |
| 93 | Ga0070706_100015559 | 3300005467 | Bacteria | 7027 |
| 94 | Ga0070706_102152813 | 3300005467 | Bacteria | 504 |
| 95 | Ga0070707_100044898 | 3300005468 | Bacteria | 4231 |
| 96 | Ga0070707_100303348 | 3300005468 | Bacteria | 1552 |
| 97 | Ga0070707_101345175 | 3300005468 | Bacteria | 681 |
| 98 | Ga0070698_100018972 | 3300005471 | Bacteria | 7234 |
| 99 | Ga0070698_100408244 | 3300005471 | Bacteria | 1292 |
| 100 | Ga0070699_100310349 | 3300005518 | Bacteria | 1416 |
| 101 | Ga0070679_100101819 | 3300005530 | Bacteria | 2859 |
| 102 | Ga0070679_100169595 | 3300005530 | Bacteria | 2155 |
| 103 | Ga0070679_100563865 | 3300005530 | Bacteria | 1082 |
| 104 | Ga0070679_101167763 | 3300005530 | Unclassified | 715 |
| 105 | Ga0070679_101297729 | 3300005530 | Bacteria | 674 |
| 106 | Ga0070679_101382489 | 3300005530 | Unclassified | 650 |
| 107 | Ga0070679_101933021 | 3300005530 | Bacteria | 539 |
| 108 | Ga0070684_100006350 | 3300005535 | Bacteria | 9136 |
| 109 | Ga0070684_100179321 | 3300005535 | Unclassified | 1925 |
| 110 | Ga0070684_100195681 | 3300005535 | Bacteria | 1841 |
| 111 | Ga0070684_100208099 | 3300005535 | Unclassified | 1783 |
| 112 | Ga0070684_100511568 | 3300005535 | Bacteria | 1112 |
| 113 | Ga0070684_100748583 | 3300005535 | Unclassified | 912 |
| 114 | Ga0070684_102358990 | 3300005535 | Unclassified | 501 |
| 115 | Ga0068853_100076074 | 3300005539 | Bacteria | 2931 |
| 116 | Ga0068853_100173046 | 3300005539 | Bacteria | 1954 |
| 117 | Ga0068853_101002024 | 3300005539 | Unclassified | 804 |
| 118 | Ga0070672_100636892 | 3300005543 | Bacteria | 931 |
| 119 | Ga0070686_100313945 | 3300005544 | Bacteria | 1166 |
| 120 | Ga0070686_101270481 | 3300005544 | Bacteria | 614 |
| 121 | Ga0070695_101490806 | 3300005545 | Bacteria | 563 |
| 122 | Ga0070696_100074531 | 3300005546 | Bacteria | 2393 |
| 123 | Ga0070693_100025208 | 3300005547 | Bacteria | 3198 |
| 124 | Ga0070693_100194775 | 3300005547 | Bacteria | 1313 |
| 125 | Ga0070693_100507183 | 3300005547 | Bacteria | 857 |
| 126 | Ga0070665_100147157 | 3300005548 | Bacteria | 2358 |
| 127 | Ga0070704_100138671 | 3300005549 | Unclassified | 1896 |
| 128 | Ga0070704_100822497 | 3300005549 | Bacteria | 831 |
| 129 | Ga0070704_101617351 | 3300005549 | Bacteria | 597 |
| 130 | Ga0068855_100011027 | 3300005563 | Bacteria | 10909 |
| 131 | Ga0068855_100131866 | 3300005563 | Bacteria | 2853 |
| 132 | Ga0068855_100461503 | 3300005563 | Unclassified | 1385 |
| 133 | Ga0068855_100555042 | 3300005563 | Bacteria | 1243 |
| 134 | Ga0070664_100185643 | 3300005564 | Bacteria | 1850 |
| 135 | Ga0068857_100044711 | 3300005577 | Bacteria | 3929 |
| 136 | Ga0068857_100403746 | 3300005577 | Unclassified | 1272 |
| 137 | Ga0068856_100392351 | 3300005614 | Bacteria | 1408 |
| 138 | Ga0070702_100019489 | 3300005615 | Bacteria | 3540 |
| 139 | Ga0068852_100117640 | 3300005616 | Bacteria | 2427 |
| 140 | Ga0068852_100600800 | 3300005616 | Bacteria | 1104 |
| 141 | Ga0068852_100666153 | 3300005616 | Bacteria | 1049 |
| 142 | Ga0068859_100137330 | 3300005617 | Bacteria | 2518 |
| 143 | Ga0068859_102539849 | 3300005617 | Bacteria | 564 |
| 144 | Ga0068864_100011578 | 3300005618 | Bacteria | 7283 |
| 145 | Ga0068864_100035107 | 3300005618 | Bacteria | 4267 |
| 146 | Ga0068864_102693449 | 3300005618 | Unclassified | 503 |
| 147 | Ga0068866_10085005 | 3300005718 | Unclassified | 1709 |
| 148 | Ga0068866_10238039 | 3300005718 | Unclassified | 1107 |
| 149 | Ga0068866_10421434 | 3300005718 | Unclassified | 866 |
| 150 | Ga0068866_10541917 | 3300005718 | Bacteria | 777 |
| 151 | Ga0068861_100295884 | 3300005719 | Unclassified | 1400 |
| 152 | Ga0068861_101396198 | 3300005719 | Unclassified | 684 |
| 153 | Ga0068870_10105171 | 3300005840 | Bacteria | 1602 |
| 154 | Ga0068870_10750587 | 3300005840 | Bacteria | 678 |
| 155 | Ga0068863_100094804 | 3300005841 | Bacteria | 2832 |
| 156 | Ga0068863_100499073 | 3300005841 | Bacteria | 1198 |
| 157 | Ga0068858_100016953 | 3300005842 | Bacteria | 6839 |
| 158 | Ga0068858_100508214 | 3300005842 | Bacteria | 1165 |
| 159 | Ga0068860_100064788 | 3300005843 | Bacteria | 3470 |
| 160 | Ga0068860_101046294 | 3300005843 | Bacteria | 835 |
| 161 | Ga0068862_100646861 | 3300005844 | Bacteria | 1019 |
| 162 | Ga0081455_10021147 | 3300005937 | Bacteria | 6110 |
| 163 | Ga0081455_10038346 | 3300005937 | Bacteria | 4243 |
| 164 | Ga0081455_10128352 | 3300005937 | Unclassified | 1986 |
| 165 | Ga0081455_10171242 | 3300005937 | Bacteria | 1654 |
| 166 | Ga0081538_10000080 | 3300005981 | Bacteria | 92392 |
| 167 | Ga0081538_10001298 | 3300005981 | Bacteria | 25847 |
| 168 | Ga0081538_10002401 | 3300005981 | Bacteria | 18381 |
| 169 | Ga0081538_10004814 | 3300005981 | Bacteria | 12303 |
| 170 | Ga0081540_1020045 | 3300005983 | Bacteria | 4037 |
| 171 | Ga0081539_10000041 | 3300005985 | Bacteria | 292660 |
| 172 | Ga0070717_11065714 | 3300006028 | Bacteria | 736 |
| 173 | Ga0075365_10090351 | 3300006038 | Bacteria | 2086 |
| 174 | Ga0075365_11068499 | 3300006038 | Bacteria | 568 |
| 175 | Ga0075363_100069183 | 3300006048 | Bacteria | 1915 |
| 176 | Ga0075364_10005351 | 3300006051 | Bacteria | 7453 |
| 177 | Ga0075364_10432745 | 3300006051 | Unclassified | 898 |
| 178 | Ga0075364_10912306 | 3300006051 | Unclassified | 598 |
| 179 | Ga0075432_10003333 | 3300006058 | Bacteria | 5427 |
| 180 | Ga0075432_10005420 | 3300006058 | Bacteria | 4349 |
| 181 | Ga0075432_10157126 | 3300006058 | Unclassified | 877 |
| 182 | Ga0070716_100005593 | 3300006173 | Bacteria | 6101 |
| 183 | Ga0070716_100206701 | 3300006173 | Unclassified | 1309 |
| 184 | Ga0070712_100826481 | 3300006175 | Bacteria | 796 |
| 185 | Ga0075362_10228108 | 3300006177 | Bacteria | 912 |
| 186 | Ga0075367_10250342 | 3300006178 | Unclassified | 1111 |
| 187 | Ga0097621_101200189 | 3300006237 | Bacteria | 715 |
| 188 | Ga0068871_100148046 | 3300006358 | Bacteria | 2001 |
| 189 | Ga0075428_100043048 | 3300006844 | Bacteria | 4965 |
| 190 | Ga0075430_100295480 | 3300006846 | Bacteria | 1340 |
| 191 | Ga0075431_100017960 | 3300006847 | Bacteria | 7193 |
| 192 | Ga0075431_101415373 | 3300006847 | Bacteria | 655 |
| 193 | Ga0075433_10138916 | 3300006852 | Bacteria | 2160 |
| 194 | Ga0075433_10207809 | 3300006852 | Unclassified | 1740 |
| 195 | Ga0075433_10531856 | 3300006852 | Bacteria | 1034 |
| 196 | Ga0075434_100098662 | 3300006871 | Bacteria | 2926 |
| 197 | Ga0075434_100306958 | 3300006871 | Unclassified | 1607 |
| 198 | Ga0075434_101142089 | 3300006871 | Bacteria | 792 |
| 199 | Ga0075429_100021894 | 3300006880 | Bacteria | 5541 |
| 200 | Ga0068865_100008633 | 3300006881 | Bacteria | 6302 |
| 201 | Ga0075436_100017712 | 3300006914 | Bacteria | 4876 |
| 202 | Ga0075436_100189612 | 3300006914 | Bacteria | 1454 |
| 203 | Ga0075436_100268101 | 3300006914 | Unclassified | 1219 |
| 204 | Ga0075436_100395493 | 3300006914 | Bacteria | 1001 |
| 205 | Ga0075436_100495782 | 3300006914 | Bacteria | 893 |
| 206 | Ga0097620_100137334 | 3300006931 | Bacteria | 2518 |
| 207 | Ga0097620_102539617 | 3300006931 | Bacteria | 564 |
| 208 | Ga0075435_100081737 | 3300007076 | Unclassified | 2654 |
| 209 | Ga0105251_10392388 | 3300009011 | Unclassified | 637 |
| 210 | Ga0105250_10476070 | 3300009092 | Unclassified | 564 |
| 211 | Ga0105240_10074063 | 3300009093 | Bacteria | 4204 |
| 212 | Ga0105240_10249863 | 3300009093 | Bacteria | 2052 |
| 213 | Ga0111539_10005505 | 3300009094 | Bacteria | 16387 |
| 214 | Ga0111539_10029168 | 3300009094 | Bacteria | 6726 |
| 215 | Ga0111539_10084728 | 3300009094 | Bacteria | 3725 |
| 216 | Ga0111539_10375086 | 3300009094 | Bacteria | 1656 |
| 217 | Ga0111539_10792934 | 3300009094 | Bacteria | 1102 |
| 218 | Ga0111539_10898168 | 3300009094 | Unclassified | 1030 |
| 219 | Ga0111539_11026281 | 3300009094 | Bacteria | 959 |
| 220 | Ga0105245_10065417 | 3300009098 | Bacteria | 3288 |
| 221 | Ga0105245_10160761 | 3300009098 | Unclassified | 2131 |
| 222 | Ga0105245_11014900 | 3300009098 | Bacteria | 874 |
| 223 | Ga0105245_11846125 | 3300009098 | Unclassified | 657 |
| 224 | Ga0105247_10122066 | 3300009101 | Bacteria | 1689 |
| 225 | Ga0114129_10001826 | 3300009147 | Bacteria | 28991 |
| 226 | Ga0114129_10010685 | 3300009147 | Bacteria | 13094 |
| 227 | Ga0114129_10118719 | 3300009147 | Bacteria | 3643 |
| 228 | Ga0114129_10251295 | 3300009147 | Unclassified | 2373 |
| 229 | Ga0114129_10300825 | 3300009147 | Unclassified | 2138 |
| 230 | Ga0114129_11343826 | 3300009147 | Bacteria | 884 |
| 231 | Ga0114129_11650982 | 3300009147 | Bacteria | 783 |
| 232 | Ga0114129_11857136 | 3300009147 | Unclassified | 731 |
| 233 | Ga0114129_12225822 | 3300009147 | Unclassified | 659 |
| 234 | Ga0105243_10016148 | 3300009148 | Bacteria | 5647 |
| 235 | Ga0105243_10109220 | 3300009148 | Bacteria | 2310 |
| 236 | Ga0105243_10384520 | 3300009148 | Bacteria | 1299 |
| 237 | Ga0105243_11295421 | 3300009148 | Bacteria | 745 |
| 238 | Ga0105242_10040403 | 3300009176 | Bacteria | 3759 |
| 239 | Ga0105242_10256909 | 3300009176 | Unclassified | 1577 |
| 240 | Ga0105248_10004837 | 3300009177 | Bacteria | 14910 |
| 241 | Ga0105248_10144247 | 3300009177 | Bacteria | 2686 |
| 242 | Ga0105237_11344400 | 3300009545 | Unclassified | 721 |
| 243 | Ga0105238_10674642 | 3300009551 | Bacteria | 1045 |
| 244 | Ga0105238_10905788 | 3300009551 | Bacteria | 900 |
| 245 | Ga0105238_11834812 | 3300009551 | Unclassified | 639 |
| 246 | Ga0105249_10182214 | 3300009553 | Bacteria | 2044 |
| 247 | Ga0105249_13026524 | 3300009553 | Unclassified | 540 |
| 248 | Ga0105249_13133459 | 3300009553 | Bacteria | 531 |
| 249 | Ga0105239_10341817 | 3300010375 | Bacteria | 1689 |
| 250 | Ga0105246_10166285 | 3300011119 | Bacteria | 1685 |
| 251 | Ga0105246_11584954 | 3300011119 | Unclassified | 618 |
| 252 | Ga0105246_11609011 | 3300011119 | Unclassified | 614 |
| 253 | Ga0105246_11703352 | 3300011119 | Unclassified | 599 |
| 254 | Ga0157327_1065366 | 3300012512 | Unclassified | 552 |
| 255 | Ga0157373_10168724 | 3300013100 | Bacteria | 1540 |
| 256 | Ga0157373_10555221 | 3300013100 | Bacteria | 833 |
| 257 | Ga0157373_10575672 | 3300013100 | Bacteria | 818 |
| 258 | Ga0157371_10445585 | 3300013102 | Bacteria | 951 |
| 259 | Ga0157371_10719774 | 3300013102 | Bacteria | 748 |
| 260 | Ga0157370_10014041 | 3300013104 | Bacteria | 8220 |
| 261 | Ga0157370_10016815 | 3300013104 | Bacteria | 7394 |
| 262 | Ga0157370_10188791 | 3300013104 | Bacteria | 1913 |
| 263 | Ga0157369_10013355 | 3300013105 | Bacteria | 9290 |
| 264 | Ga0157369_10034851 | 3300013105 | Bacteria | 5521 |
| 265 | Ga0157369_11158706 | 3300013105 | Bacteria | 789 |
| 266 | Ga0157369_12304987 | 3300013105 | Unclassified | 546 |
| 267 | Ga0157374_10853487 | 3300013296 | Bacteria | 927 |
| 268 | Ga0157374_12292149 | 3300013296 | Bacteria | 567 |
| 269 | Ga0163162_10180101 | 3300013306 | Bacteria | 2239 |
| 270 | Ga0163162_11176343 | 3300013306 | Bacteria | 870 |
| 271 | Ga0163162_11526124 | 3300013306 | Bacteria | 761 |
| 272 | Ga0163162_11743670 | 3300013306 | Bacteria | 711 |
| 273 | Ga0163162_12899090 | 3300013306 | Unclassified | 552 |
| 274 | Ga0157372_10346817 | 3300013307 | Bacteria | 1730 |
| 275 | Ga0157375_10085146 | 3300013308 | Unclassified | 3211 |
| 276 | Ga0157375_10430495 | 3300013308 | Bacteria | 1485 |
| 277 | Ga0163163_10696609 | 3300014325 | Bacteria | 1079 |
| 278 | Ga0157380_10049133 | 3300014326 | Bacteria | 3326 |
| 279 | Ga0157380_10061007 | 3300014326 | Bacteria | 3016 |
| 280 | Ga0157380_10138713 | 3300014326 | Bacteria | 2086 |
| 281 | Ga0157380_10362572 | 3300014326 | Bacteria | 1360 |
| 282 | Ga0157380_11450248 | 3300014326 | Unclassified | 738 |
| 283 | Ga0182008_10526974 | 3300014497 | Bacteria | 653 |
| 284 | Ga0157377_10238445 | 3300014745 | Unclassified | 1173 |
| 285 | Ga0157377_10552986 | 3300014745 | Bacteria | 813 |
| 286 | Ga0157379_10092357 | 3300014968 | Bacteria | 2715 |
| 287 | Ga0157376_10123997 | 3300014969 | Bacteria | 2294 |
| 288 | Ga0163161_10013589 | 3300017792 | Bacteria | 5667 |
| 289 | Ga0197907_11288220 | 3300020069 | Unclassified | 621 |
| 290 | Ga0206356_10266925 | 3300020070 | Bacteria | 1277 |
| 291 | Ga0206354_10616934 | 3300020081 | Bacteria | 1712 |
| 292 | Ga0206353_11689559 | 3300020082 | Bacteria | 731 |
| 293 | Ga0206353_11915172 | 3300020082 | Bacteria | 639 |
| 294 | Ga0206353_11936762 | 3300020082 | Bacteria | 861 |
| 295 | Ga0206353_12063416 | 3300020082 | Bacteria | 6734 |
| 296 | Ga0207656_10056810 | 3300025321 | Bacteria | 1707 |
| 297 | Ga0207653_10197404 | 3300025885 | Bacteria | 758 |
| 298 | Ga0207682_10527664 | 3300025893 | Bacteria | 559 |
| 299 | Ga0207642_10060998 | 3300025899 | Bacteria | 1752 |
| 300 | Ga0207642_10082979 | 3300025899 | Bacteria | 1561 |
| 301 | Ga0207710_10040328 | 3300025900 | Bacteria | 2069 |
| 302 | Ga0207688_10029283 | 3300025901 | Bacteria | 3031 |
| 303 | Ga0207647_10065508 | 3300025904 | Bacteria | 2205 |
| 304 | Ga0207647_10285508 | 3300025904 | Bacteria | 941 |
| 305 | Ga0207699_10006671 | 3300025906 | Bacteria | 5600 |
| 306 | Ga0207643_10039177 | 3300025908 | Unclassified | 2666 |
| 307 | Ga0207643_11102749 | 3300025908 | Bacteria | 512 |
| 308 | Ga0207705_10116170 | 3300025909 | Bacteria | 1981 |
| 309 | Ga0207705_10395051 | 3300025909 | Bacteria | 1069 |
| 310 | Ga0207684_10014015 | 3300025910 | Bacteria | 6925 |
| 311 | Ga0207684_10162330 | 3300025910 | Bacteria | 1924 |
| 312 | Ga0207707_10241036 | 3300025912 | Unclassified | 1572 |
| 313 | Ga0207707_10289925 | 3300025912 | Bacteria | 1416 |
| 314 | Ga0207707_10862061 | 3300025912 | Bacteria | 751 |
| 315 | Ga0207707_11461162 | 3300025912 | Bacteria | 543 |
| 316 | Ga0207695_10183352 | 3300025913 | Bacteria | 2013 |
| 317 | Ga0207695_10602607 | 3300025913 | Bacteria | 980 |
| 318 | Ga0207663_10478685 | 3300025916 | Bacteria | 964 |
| 319 | Ga0207660_10149117 | 3300025917 | Bacteria | 1795 |
| 320 | Ga0207660_10157117 | 3300025917 | Bacteria | 1751 |
| 321 | Ga0207660_10400285 | 3300025917 | Bacteria | 1106 |
| 322 | Ga0207660_10464053 | 3300025917 | Bacteria | 1025 |
| 323 | Ga0207662_10035141 | 3300025918 | Bacteria | 2926 |
| 324 | Ga0207657_10007923 | 3300025919 | Bacteria | 10833 |
| 325 | Ga0207657_10388064 | 3300025919 | Bacteria | 1099 |
| 326 | Ga0207657_10604150 | 3300025919 | Bacteria | 856 |
| 327 | Ga0207649_10129969 | 3300025920 | Bacteria | 1709 |
| 328 | Ga0207649_10370242 | 3300025920 | Bacteria | 1065 |
| 329 | Ga0207649_11460596 | 3300025920 | Bacteria | 541 |
| 330 | Ga0207652_10026109 | 3300025921 | Bacteria | 4861 |
| 331 | Ga0207652_10080184 | 3300025921 | Bacteria | 2853 |
| 332 | Ga0207652_10182832 | 3300025921 | Bacteria | 1884 |
| 333 | Ga0207652_10730075 | 3300025921 | Bacteria | 882 |
| 334 | Ga0207652_11729890 | 3300025921 | Unclassified | 530 |
| 335 | Ga0207646_10040494 | 3300025922 | Bacteria | 4189 |
| 336 | Ga0207646_10133107 | 3300025922 | Bacteria | 2238 |
| 337 | Ga0207646_11884875 | 3300025922 | Bacteria | 510 |
| 338 | Ga0207694_10594287 | 3300025924 | Bacteria | 931 |
| 339 | Ga0207650_10141985 | 3300025925 | Bacteria | 1889 |
| 340 | Ga0207659_10032967 | 3300025926 | Bacteria | 3560 |
| 341 | Ga0207659_10395197 | 3300025926 | Bacteria | 1155 |
| 342 | Ga0207659_11499064 | 3300025926 | Bacteria | 577 |
| 343 | Ga0207687_10098615 | 3300025927 | Unclassified | 2145 |
| 344 | Ga0207687_11618396 | 3300025927 | Unclassified | 556 |
| 345 | Ga0207700_10000002 | 3300025928 | Bacteria | 775978 |
| 346 | Ga0207700_10314490 | 3300025928 | Unclassified | 1355 |
| 347 | Ga0207700_10867839 | 3300025928 | Unclassified | 808 |
| 348 | Ga0207664_10011931 | 3300025929 | Bacteria | 6203 |
| 349 | Ga0207664_10066261 | 3300025929 | Bacteria | 2894 |
| 350 | Ga0207644_11204391 | 3300025931 | Bacteria | 637 |
| 351 | Ga0207690_10934242 | 3300025932 | Unclassified | 720 |
| 352 | Ga0207706_10116879 | 3300025933 | Bacteria | 2346 |
| 353 | Ga0207706_10219300 | 3300025933 | Bacteria | 1666 |
| 354 | Ga0207686_10424651 | 3300025934 | Bacteria | 1017 |
| 355 | Ga0207709_10054695 | 3300025935 | Bacteria | 2462 |
| 356 | Ga0207709_10492279 | 3300025935 | Bacteria | 955 |
| 357 | Ga0207709_10626051 | 3300025935 | Bacteria | 854 |
| 358 | Ga0207670_10060344 | 3300025936 | Bacteria | 2583 |
| 359 | Ga0207669_10029778 | 3300025937 | Bacteria | 3024 |
| 360 | Ga0207704_10075276 | 3300025938 | Bacteria | 2158 |
| 361 | Ga0207704_10306290 | 3300025938 | Bacteria | 1219 |
| 362 | Ga0207704_10523383 | 3300025938 | Bacteria | 959 |
| 363 | Ga0207665_10017834 | 3300025939 | Unclassified | 4666 |
| 364 | Ga0207691_10039448 | 3300025940 | Bacteria | 4369 |
| 365 | Ga0207711_10122098 | 3300025941 | Bacteria | 2327 |
| 366 | Ga0207711_10345171 | 3300025941 | Bacteria | 1378 |
| 367 | Ga0207711_11405289 | 3300025941 | Bacteria | 640 |
| 368 | Ga0207689_10049158 | 3300025942 | Unclassified | 3479 |
| 369 | Ga0207661_10033451 | 3300025944 | Bacteria | 3990 |
| 370 | Ga0207661_10073039 | 3300025944 | Bacteria | 2808 |
| 371 | Ga0207661_10324746 | 3300025944 | Unclassified | 1384 |
| 372 | Ga0207661_10531338 | 3300025944 | Unclassified | 1076 |
| 373 | Ga0207661_10617671 | 3300025944 | Bacteria | 995 |
| 374 | Ga0207661_10957077 | 3300025944 | Bacteria | 789 |
| 375 | Ga0207679_10126378 | 3300025945 | Bacteria | 2044 |
| 376 | Ga0207667_10033234 | 3300025949 | Bacteria | 5549 |
| 377 | Ga0207667_10376509 | 3300025949 | Unclassified | 1447 |
| 378 | Ga0207667_10820678 | 3300025949 | Bacteria | 926 |
| 379 | Ga0207651_10027189 | 3300025960 | Bacteria | 3589 |
| 380 | Ga0207651_10451447 | 3300025960 | Bacteria | 1103 |
| 381 | Ga0207712_10442720 | 3300025961 | Bacteria | 1100 |
| 382 | Ga0207712_10939251 | 3300025961 | Unclassified | 766 |
| 383 | Ga0207712_11425582 | 3300025961 | Unclassified | 620 |
| 384 | Ga0207668_10169232 | 3300025972 | Bacteria | 1712 |
| 385 | Ga0207668_10256009 | 3300025972 | Bacteria | 1424 |
| 386 | Ga0207640_11033783 | 3300025981 | Unclassified | 724 |
| 387 | Ga0207677_10185133 | 3300026023 | Bacteria | 1641 |
| 388 | Ga0207677_10381887 | 3300026023 | Unclassified | 1189 |
| 389 | Ga0207677_11572826 | 3300026023 | Bacteria | 608 |
| 390 | Ga0207703_11994223 | 3300026035 | Bacteria | 557 |
| 391 | Ga0207639_10149729 | 3300026041 | Unclassified | 1953 |
| 392 | Ga0207639_10367993 | 3300026041 | Bacteria | 1288 |
| 393 | Ga0207678_10008584 | 3300026067 | Bacteria | 9001 |
| 394 | Ga0207708_10040436 | 3300026075 | Bacteria | 3555 |
| 395 | Ga0207708_10489346 | 3300026075 | Unclassified | 1029 |
| 396 | Ga0207702_11166903 | 3300026078 | Bacteria | 764 |
| 397 | Ga0207641_11315378 | 3300026088 | Bacteria | 723 |
| 398 | Ga0207648_10014284 | 3300026089 | Bacteria | 7340 |
| 399 | Ga0207648_10047579 | 3300026089 | Bacteria | 3759 |
| 400 | Ga0207648_10376151 | 3300026089 | Unclassified | 1284 |
| 401 | Ga0207676_10019373 | 3300026095 | Bacteria | 4963 |
| 402 | Ga0207676_12377267 | 3300026095 | Unclassified | 527 |
| 403 | Ga0207674_10007911 | 3300026116 | Bacteria | 12348 |
| 404 | Ga0207674_10015082 | 3300026116 | Bacteria | 8506 |
| 405 | Ga0207674_10117820 | 3300026116 | Bacteria | 2626 |
| 406 | Ga0207674_10720154 | 3300026116 | Bacteria | 963 |
| 407 | Ga0207675_100113029 | 3300026118 | Bacteria | 2564 |
| 408 | Ga0207675_100518491 | 3300026118 | Unclassified | 1188 |
| 409 | Ga0207683_10013801 | 3300026121 | Bacteria | 6889 |
| 410 | Ga0207698_10671757 | 3300026142 | Bacteria | 1028 |
| 411 | Ga0209969_1029806 | 3300027360 | Bacteria | 832 |
| 412 | Ga0209974_10025491 | 3300027876 | Bacteria | 1956 |
| 413 | Ga0207428_10000774 | 3300027907 | Bacteria | 36366 |
| 414 | Ga0207428_10062171 | 3300027907 | Bacteria | 2954 |
| 415 | Ga0207428_10257999 | 3300027907 | Bacteria | 1299 |
| 416 | Ga0268266_10033299 | 3300028379 | Bacteria | 4381 |
| 417 | Ga0268264_10408170 | 3300028381 | Bacteria | 1307 |
| 418 | Ga0265326_10011746 | 3300028558 | Bacteria | 2579 |
| 419 | Ga0265326_10078009 | 3300028558 | Bacteria | 937 |
| 420 | Ga0265319_1003621 | 3300028563 | Bacteria | 7992 |
| 421 | Ga0265334_10006234 | 3300028573 | Bacteria | 5155 |
| 422 | Ga0265318_10000604 | 3300028577 | Bacteria | 25020 |
| 423 | Ga0265323_10081857 | 3300028653 | Bacteria | 1090 |
| 424 | Ga0265322_10011177 | 3300028654 | Bacteria | 2604 |
| 425 | Ga0265336_10058455 | 3300028666 | Bacteria | 1157 |
| 426 | Ga0265338_10004690 | 3300028800 | Bacteria | 18320 |
| 427 | Ga0265338_10016776 | 3300028800 | Bacteria | 7934 |
| 428 | Ga0265324_10060749 | 3300029957 | Bacteria | 1292 |
| 429 | Ga0265330_10014403 | 3300031235 | Bacteria | 3670 |
| 430 | Ga0265332_10034933 | 3300031238 | Bacteria | 2184 |
| 431 | Ga0265328_10000719 | 3300031239 | Bacteria | 15346 |
| 432 | Ga0265325_10002559 | 3300031241 | Bacteria | 12232 |
| 433 | Ga0265329_10022835 | 3300031242 | Bacteria | 2088 |
| 434 | Ga0265340_10002638 | 3300031247 | Bacteria | 10198 |
| 435 | Ga0265339_10014186 | 3300031249 | Bacteria | 4808 |
| 436 | Ga0265316_10002341 | 3300031344 | Bacteria | 19753 |
| 437 | Ga0307408_100165182 | 3300031548 | Bacteria | 1762 |
| 438 | Ga0307408_101234083 | 3300031548 | Unclassified | 698 |
| 439 | Ga0307408_101462892 | 3300031548 | Bacteria | 645 |
| 440 | Ga0265313_10006053 | 3300031595 | Bacteria | 8722 |
| 441 | Ga0265313_10007335 | 3300031595 | Bacteria | 7562 |
| 442 | Ga0265314_10174016 | 3300031711 | Bacteria | 1296 |
| 443 | Ga0265342_10013160 | 3300031712 | Bacteria | 5565 |
| 444 | Ga0307405_11919907 | 3300031731 | Unclassified | 528 |
| 445 | Ga0307413_10610871 | 3300031824 | Bacteria | 894 |
| 446 | Ga0307413_11720936 | 3300031824 | Bacteria | 559 |
| 447 | Ga0307410_10154190 | 3300031852 | Bacteria | 1713 |
| 448 | Ga0307406_10030702 | 3300031901 | Unclassified | 3265 |
| 449 | Ga0307406_10210646 | 3300031901 | Bacteria | 1437 |
| 450 | Ga0307407_10047735 | 3300031903 | Bacteria | 2432 |
| 451 | Ga0307407_10554554 | 3300031903 | Bacteria | 850 |
| 452 | Ga0307412_10052502 | 3300031911 | Bacteria | 2700 |
| 453 | Ga0307412_10473692 | 3300031911 | Bacteria | 1037 |
| 454 | Ga0307412_10746622 | 3300031911 | Unclassified | 844 |
| 455 | Ga0307409_100051043 | 3300031995 | Bacteria | 3163 |
| 456 | Ga0307409_100074201 | 3300031995 | Unclassified | 2717 |
| 457 | Ga0307409_100379052 | 3300031995 | Bacteria | 1344 |
| 458 | Ga0307409_100561599 | 3300031995 | Unclassified | 1122 |
| 459 | Ga0307416_100005741 | 3300032002 | Bacteria | 7682 |
| 460 | Ga0307416_100096804 | 3300032002 | Bacteria | 2553 |
| 461 | Ga0307416_100831913 | 3300032002 | Unclassified | 1020 |
| 462 | Ga0307416_100969902 | 3300032002 | Bacteria | 952 |
| 463 | Ga0307414_10166723 | 3300032004 | Bacteria | 1756 |
| 464 | Ga0307411_10213576 | 3300032005 | Unclassified | 1491 |
| 465 | Ga0307415_100660519 | 3300032126 | Bacteria | 938 |
| 466 | Ga0307415_101301372 | 3300032126 | Bacteria | 688 |
| 467 | Ga0316583_10006849 | 3300032133 | Bacteria | 4105 |
| 468 | Ga0373959_0025311 | 3300034820 | Bacteria | 1165 |
| 469 | Ga0373938_0005578 | 3300034957 | Bacteria | 2146 |
| 470 | Ga0373928_0048236 | 3300035084 | Bacteria | 999 |
| 471 | Ga0373929_0021704 | 3300035085 | Bacteria | 1305 |
| 472 | Ga0373952_0074291 | 3300035092 | Bacteria | 856 |
| 473 | Ga0373939_0037040 | 3300035114 | Bacteria | 1447 |
| 474 | Ga0373941_0027768 | 3300035115 | Bacteria | 1655 |
| 475 | Ga0373960_0303889 | 3300035121 | Bacteria | 594 |
| 476 | Ga0373942_0142612 | 3300035207 | Bacteria | 764 |
| 477 | Ga0373961_0149795 | 3300035241 | Bacteria | 794 |
| 478 | Ga0373962_0083499 | 3300035242 | Bacteria | 973 |
| 479 | Ga0373931_0331785 | 3300035691 | Bacteria | 947 |
| 480 | Ga0395899_0013759 | 3300037312 | Bacteria | 6185 |
| 481 | Ga0395899_0067109 | 3300037312 | Bacteria | 2633 |
| 482 | Ga0395899_0104560 | 3300037312 | Bacteria | 2041 |
| 483 | Ga0395899_0120065 | 3300037312 | Bacteria | 1884 |
| 484 | Ga0395899_0505236 | 3300037312 | Unclassified | 784 |
| 485 | Ga0395899_0529780 | 3300037312 | Unclassified | 760 |
| 486 | Ga0395899_0608879 | 3300037312 | Unclassified | 695 |
| 487 | Ga0395900_0031901 | 3300037418 | Bacteria | 5416 |
| 488 | Ga0395900_0035226 | 3300037418 | Bacteria | 5156 |
| 489 | Ga0395900_0061491 | 3300037418 | Bacteria | 3861 |
| 490 | Ga0395900_0071011 | 3300037418 | Unclassified | 3579 |
| 491 | Ga0395900_0091257 | 3300037418 | Unclassified | 3130 |
| 492 | Ga0395900_0200019 | 3300037418 | Bacteria | 2022 |
| 493 | Ga0395900_0235831 | 3300037418 | Bacteria | 1838 |
| 494 | Ga0395900_0330563 | 3300037418 | Bacteria | 1502 |
| 495 | Ga0395900_0411098 | 3300037418 | Bacteria | 1315 |
| 496 | Ga0395898_0033463 | 3300037466 | Bacteria | 5129 |
| 497 | Ga0395898_0072520 | 3300037466 | Bacteria | 3327 |
| 498 | Ga0395898_0092734 | 3300037466 | Bacteria | 2904 |
| 499 | Ga0395898_0108666 | 3300037466 | Bacteria | 2659 |
| 500 | Ga0395898_0171181 | 3300037466 | Bacteria | 2076 |
| 501 | Ga0395898_0262237 | 3300037466 | Bacteria | 1648 |
| 502 | Ga0395898_0337222 | 3300037466 | Bacteria | 1438 |
| 503 | Ga0395898_1832231 | 3300037466 | Unclassified | 528 |
| 504 | Ga0395905_0031387 | 3300037471 | Bacteria | 5001 |
| 505 | Ga0395905_0059154 | 3300037471 | Bacteria | 3583 |
| 506 | Ga0395905_0063925 | 3300037471 | Bacteria | 3443 |
| 507 | Ga0395905_0161855 | 3300037471 | Bacteria | 2103 |
| 508 | Ga0395905_0590126 | 3300037471 | Bacteria | 1013 |
| 509 | Ga0395905_0599624 | 3300037471 | Bacteria | 1003 |
| 510 | Ga0395905_1013546 | 3300037471 | Bacteria | 733 |
| 511 | Ga0395901_0000559 | 3300038443 | Bacteria | 43102 |
| 512 | Ga0395901_0013278 | 3300038443 | Bacteria | 8366 |
| 513 | Ga0395901_0155561 | 3300038443 | Bacteria | 2401 |
| 514 | Ga0395901_0187193 | 3300038443 | Bacteria | 2171 |
| 515 | Ga0395901_0356132 | 3300038443 | Bacteria | 1510 |
| 516 | Ga0395901_0433892 | 3300038443 | Bacteria | 1346 |
| 517 | Ga0395901_0845163 | 3300038443 | Bacteria | 901 |
| 518 | Ga0395901_0972719 | 3300038443 | Bacteria | 826 |
| 519 | Ga0395901_1652691 | 3300038443 | Unclassified | 593 |
| 520 | Ga0242420_008529 | 3300038996 | Bacteria | 1665 |
| 521 | Ga0439438_133792 | 3300041405 | Unclassified | 594 |
| 522 | Ga0439439_0106883 | 3300041406 | Bacteria | 773 |
| 523 | Ga0439466_0033013 | 3300041411 | Bacteria | 1761 |
| 524 | Ga0439466_0147002 | 3300041411 | Bacteria | 722 |
| 525 | Ga0439466_0216078 | 3300041411 | Bacteria | 582 |
| 526 | Ga0451789_0709166 | 3300041443 | Bacteria | 1720 |
| 527 | Ga0451797_1555583 | 3300041453 | Bacteria | 726 |
| 528 | Ga0451795_0457816 | 3300041456 | Bacteria | 1255 |
| 529 | Ga0451798_0121441 | 3300041458 | Bacteria | 726 |
| 530 | Ga0451802_0203603 | 3300041460 | Bacteria | 619 |
| 531 | Ga0451804_0722354 | 3300041463 | Unclassified | 574 |
| 532 | Ga0451847_0857348 | 3300041503 | Unclassified | 530 |
| 533 | Ga0451843_0196419 | 3300041509 | Bacteria | 770 |
| 534 | Ga0451853_0232164 | 3300041512 | Bacteria | 512 |
| 535 | Ga0439431_0178422 | 3300041997 | Bacteria | 612 |
| 536 | Ga0439433_0064523 | 3300041999 | Bacteria | 877 |
| 537 | Ga0439437_002505 | 3300042000 | Unclassified | 1967 |
| 538 | Ga0439441_024830 | 3300042001 | Bacteria | 1128 |
| 539 | Ga0439442_132617 | 3300042002 | Unclassified | 549 |
| 540 | Ga0439445_0012487 | 3300042004 | Unclassified | 2043 |
| 541 | Ga0439448_0094457 | 3300042005 | Bacteria | 1012 |
| 542 | Ga0439454_071712 | 3300042011 | Unclassified | 616 |
| 543 | Ga0439462_0149285 | 3300042015 | Bacteria | 657 |
| 544 | Ga0450920_056275 | 3300042122 | Unclassified | 792 |
| 545 | Ga0450905_018778 | 3300042142 | Bacteria | 1009 |
| 546 | Ga0450906_022561 | 3300042145 | Unclassified | 1122 |
| 547 | Ga0450910_107162 | 3300042147 | Bacteria | 505 |
| 548 | Ga0439446_0004129 | 3300042156 | Bacteria | 3660 |
| 549 | Ga0450908_043230 | 3300042184 | Bacteria | 781 |
| 550 | Ga0439434_0021832 | 3300042435 | Unclassified | 1924 |
| 551 | Ga0439434_0063821 | 3300042435 | Bacteria | 1154 |
| 552 | Ga0439434_0084434 | 3300042435 | Unclassified | 1010 |
| 553 | Ga0439444_0154187 | 3300042437 | Unclassified | 557 |
| 554 | Ga0450918_041180 | 3300042531 | Unclassified | 829 |
| 555 | Ga0439440_0150583 | 3300042993 | Bacteria | 666 |
| 556 | Ga0466972_0387279 | 3300044658 | Bacteria | 655 |
| 557 | Ga0466965_0231544 | 3300044683 | Bacteria | 987 |
| 558 | Ga0466966_0002463 | 3300044684 | Bacteria | 12110 |
| 559 | Ga0466966_0025242 | 3300044684 | Bacteria | 3883 |
| 560 | Ga0466966_0156545 | 3300044684 | Bacteria | 1388 |
| 561 | Ga0466961_0004872 | 3300044693 | Bacteria | 8445 |
| 562 | Ga0466961_0252431 | 3300044693 | Bacteria | 1083 |
| 563 | Ga0466963_0030174 | 3300044694 | Bacteria | 3496 |
| 564 | Ga0466963_0705779 | 3300044694 | Bacteria | 712 |
| 565 | Ga0466963_0761393 | 3300044694 | Bacteria | 683 |
| 566 | Ga0466964_0041351 | 3300044706 | Bacteria | 1864 |
| 567 | Ga0466964_0045488 | 3300044706 | Bacteria | 1786 |
| 568 | Ga0466971_0016832 | 3300044719 | Bacteria | 3230 |
| 569 | Ga0466970_0032806 | 3300044765 | Bacteria | 2744 |
| 570 | Ga0466957_0024144 | 3300044842 | Bacteria | 3597 |
| 571 | Ga0466957_0130447 | 3300044842 | Bacteria | 1610 |
| 572 | Ga0466957_0547279 | 3300044842 | Bacteria | 806 |
| 573 | Ga0466957_0900858 | 3300044842 | Bacteria | 632 |
| 574 | Ga0466957_0967688 | 3300044842 | Unclassified | 610 |
| 575 | Ga0466960_0025394 | 3300044901 | Bacteria | 2681 |
| 576 | Ga0466960_0085392 | 3300044901 | Bacteria | 1599 |
| 577 | Ga0466960_0210141 | 3300044901 | Bacteria | 1067 |
| 578 | Ga0466960_0396360 | 3300044901 | Bacteria | 794 |
| 579 | Ga0466960_0719853 | 3300044901 | Unclassified | 600 |
| 580 | Ga0466959_0003456 | 3300045049 | Bacteria | 10339 |
| 581 | Ga0466959_0013757 | 3300045049 | Bacteria | 5874 |
| 582 | Ga0466959_1006106 | 3300045049 | Unclassified | 555 |
| 583 | Ga0451576_0709492 | 3300045051 | Bacteria | 1057 |
| 584 | Ga0466958_0028485 | 3300045836 | Bacteria | 3312 |
| 585 | Ga0466958_0168633 | 3300045836 | Bacteria | 1386 |
| 586 | Ga0466958_0722717 | 3300045836 | Bacteria | 649 |
| 587 | Ga0466958_0758186 | 3300045836 | Unclassified | 632 |
| 588 | Ga0466967_0014102 | 3300045976 | Bacteria | 6209 |
| 589 | Ga0466967_0030892 | 3300045976 | Bacteria | 4501 |
| 590 | Ga0466967_0147364 | 3300045976 | Bacteria | 2196 |
| 591 | Ga0466967_0289140 | 3300045976 | Bacteria | 1574 |
| 592 | Ga0466967_0330518 | 3300045976 | Bacteria | 1472 |
| 593 | Ga0466967_2046165 | 3300045976 | Bacteria | 569 |
| 594 | Ga0495592_0543811 | 3300046454 | Bacteria | 715 |
| 595 | Ga0495590_0304996 | 3300046457 | Unclassified | 599 |
| 596 | Ga0495629_0745166 | 3300046459 | Unclassified | 649 |
| 597 | Ga0495641_0063952 | 3300046461 | Bacteria | 1657 |
| 598 | Ga0495653_0132255 | 3300046463 | Bacteria | 1765 |
| 599 | Ga0495580_1013490 | 3300046472 | Unclassified | 529 |
| 600 | Ga0495582_0353018 | 3300046473 | Bacteria | 847 |
| 601 | Ga0495582_0624079 | 3300046473 | Bacteria | 624 |
| 602 | Ga0495605_0187501 | 3300046474 | Bacteria | 907 |
| 603 | Ga0495585_0182029 | 3300046492 | Bacteria | 1080 |
| 604 | Ga0495608_0305205 | 3300046511 | Bacteria | 985 |
| 605 | Ga0495608_0753654 | 3300046511 | Unclassified | 577 |
| 606 | Ga0495618_0198279 | 3300046514 | Bacteria | 1271 |
| 607 | Ga0495620_0394921 | 3300046515 | Unclassified | 524 |
| 608 | Ga0495643_0326367 | 3300046522 | Unclassified | 693 |
| 609 | Ga0495642_0139863 | 3300046528 | Bacteria | 1045 |
| 610 | Ga0495652_0158819 | 3300046529 | Bacteria | 1758 |
| 611 | Ga0495640_0518006 | 3300046533 | Bacteria | 725 |
| 612 | Ga0495586_0829978 | 3300046535 | Bacteria | 533 |
| 613 | Ga0495667_0410687 | 3300046559 | Bacteria | 852 |
| 614 | Ga0495668_0566984 | 3300046616 | Unclassified | 627 |
| 615 | Ga0495634_0341336 | 3300046642 | Unclassified | 898 |
| 616 | Ga0495634_0803522 | 3300046642 | Bacteria | 536 |
| 617 | Ga0495635_0936705 | 3300046663 | Unclassified | 553 |
| 618 | Ga0495659_0019622 | 3300046664 | Unclassified | 2262 |
| 619 | Ga0495659_0033709 | 3300046664 | Bacteria | 1799 |
| 620 | Ga0495661_0441165 | 3300046665 | Unclassified | 628 |
| 621 | Ga0495657_0313282 | 3300046675 | Bacteria | 934 |
| 622 | Ga0495613_0145718 | 3300046689 | Unclassified | 1690 |
| 623 | Ga0495670_0323841 | 3300046691 | Bacteria | 828 |
| 624 | Ga0495670_0799776 | 3300046691 | Bacteria | 515 |
| 625 | Ga0495589_0574270 | 3300046794 | Unclassified | 514 |
| 626 | Ga0495600_0831823 | 3300046809 | Bacteria | 548 |
| 627 | Ga0495581_0894386 | 3300047315 | Unclassified | 507 |
| 628 | Ga0495604_0184102 | 3300047317 | Bacteria | 1460 |
| 629 | Ga0495674_0072947 | 3300047319 | Bacteria | 2960 |
| 630 | Ga0495674_0904912 | 3300047319 | Bacteria | 681 |
| 631 | Ga0495676_0176869 | 3300047321 | Bacteria | 1498 |
| 632 | Ga0495680_0040238 | 3300047322 | Bacteria | 3725 |
| 633 | Ga0495680_0098661 | 3300047322 | Unclassified | 2180 |
| 634 | Ga0495680_0261907 | 3300047322 | Bacteria | 1223 |
| 635 | Ga0495675_0500230 | 3300047444 | Unclassified | 698 |
| 636 | Ga0495684_0160199 | 3300047471 | Bacteria | 1679 |
| 637 | Ga0495684_0436169 | 3300047471 | Bacteria | 913 |
| 638 | Ga0495593_0266044 | 3300047673 | Bacteria | 858 |
| 639 | Ga0496100_0034176 | 3300048903 | Bacteria | 3188 |
| 640 | Ga0496100_0124417 | 3300048903 | Bacteria | 1808 |
| 641 | Ga0496101_1038495 | 3300048904 | Bacteria | 644 |
| 642 | Ga0496101_1196780 | 3300048904 | Unclassified | 595 |
| 643 | Ga0496102_0411868 | 3300048905 | Unclassified | 1270 |
| 644 | Ga0496102_0449371 | 3300048905 | Bacteria | 1209 |
| 645 | Ga0496104_0023751 | 3300048907 | Bacteria | 5638 |
| 646 | Ga0496104_0100569 | 3300048907 | Bacteria | 2768 |
| 647 | Ga0496104_0322637 | 3300048907 | Unclassified | 1457 |
| 648 | Ga0496104_0472891 | 3300048907 | Bacteria | 1165 |
| 649 | Ga0496104_0765140 | 3300048907 | Unclassified | 872 |
| 650 | Ga0496104_1103663 | 3300048907 | Bacteria | 697 |
| 651 | Ga0496105_0056696 | 3300048908 | Bacteria | 3234 |
| 652 | Ga0496105_0074957 | 3300048908 | Bacteria | 2795 |
| 653 | Ga0496105_0558823 | 3300048908 | Bacteria | 892 |
| 654 | Ga0496105_0940145 | 3300048908 | Unclassified | 650 |
| 655 | Ga0496105_1363289 | 3300048908 | Bacteria | 515 |
| 656 | Ga0496106_0013815 | 3300048909 | Bacteria | 5967 |
| 657 | Ga0496106_0262438 | 3300048909 | Bacteria | 1382 |
| 658 | Ga0496107_0019666 | 3300048910 | Bacteria | 4764 |
| 659 | Ga0496107_0063851 | 3300048910 | Bacteria | 2669 |
| 660 | Ga0496108_0019698 | 3300048911 | Bacteria | 5541 |
| 661 | Ga0496108_0050702 | 3300048911 | Bacteria | 3475 |
| 662 | Ga0496108_1005176 | 3300048911 | Bacteria | 712 |
| 663 | Ga0496109_0019278 | 3300048912 | Bacteria | 6011 |
| 664 | Ga0496109_0239526 | 3300048912 | Bacteria | 1707 |
| 665 | Ga0496109_0457059 | 3300048912 | Bacteria | 1206 |
| 666 | Ga0496109_0604575 | 3300048912 | Unclassified | 1033 |
| 667 | Ga0496110_0010426 | 3300048913 | Bacteria | 7557 |
| 668 | Ga0496110_0010563 | 3300048913 | Bacteria | 7519 |
| 669 | Ga0496110_0757735 | 3300048913 | Bacteria | 874 |
| 670 | Ga0496110_1050558 | 3300048913 | Unclassified | 722 |
| 671 | Ga0496111_0080744 | 3300048914 | Bacteria | 2373 |
| 672 | Ga0496111_0295270 | 3300048914 | Unclassified | 1201 |
| 673 | Ga0496111_0302982 | 3300048914 | Unclassified | 1185 |
| 674 | Ga0496111_0393130 | 3300048914 | Unclassified | 1025 |
| 675 | Ga0496111_0808039 | 3300048914 | Bacteria | 678 |
| 676 | Ga0496112_0475528 | 3300048915 | Bacteria | 1186 |
| 677 | Ga0496112_0896769 | 3300048915 | Bacteria | 809 |
| 678 | Ga0496112_1146554 | 3300048915 | Bacteria | 695 |
| 679 | Ga0496113_0268797 | 3300048916 | Unclassified | 1362 |
| 680 | Ga0496113_0293605 | 3300048916 | Unclassified | 1301 |
| 681 | Ga0496114_0081504 | 3300048917 | Bacteria | 2733 |
| 682 | Ga0496114_0681115 | 3300048917 | Bacteria | 903 |
| 683 | Ga0501291_095998 | 3300049514 | Bacteria | 612 |
| 684 | Ga0501031_0044840 | 3300049568 | Bacteria | 2885 |
| 685 | Ga0501031_0045747 | 3300049568 | Bacteria | 2855 |
| 686 | Ga0501031_0278829 | 3300049568 | Bacteria | 1084 |
| 687 | Ga0501031_0341503 | 3300049568 | Bacteria | 969 |
| 688 | Ga0501031_0410563 | 3300049568 | Bacteria | 876 |
| 689 | Ga0501031_0614072 | 3300049568 | Unclassified | 699 |
| 690 | Ga0501031_0626869 | 3300049568 | Bacteria | 691 |
| 691 | Ga0501031_0999247 | 3300049568 | Bacteria | 535 |
| 692 | Ga0501032_0010634 | 3300049569 | Bacteria | 6626 |
| 693 | Ga0501032_0020977 | 3300049569 | Bacteria | 4545 |
| 694 | Ga0501032_0146246 | 3300049569 | Bacteria | 1556 |
| 695 | Ga0501033_0008174 | 3300049570 | Bacteria | 8105 |
| 696 | Ga0501033_0032812 | 3300049570 | Bacteria | 3899 |
| 697 | Ga0501033_0280187 | 3300049570 | Bacteria | 1177 |
| 698 | Ga0501033_0384285 | 3300049570 | Bacteria | 980 |
| 699 | Ga0501033_0758726 | 3300049570 | Bacteria | 658 |
| 700 | Ga0501033_0776939 | 3300049570 | Unclassified | 648 |
| 701 | Ga0501034_0022438 | 3300049571 | Bacteria | 6432 |
| 702 | Ga0501034_0023812 | 3300049571 | Bacteria | 6235 |
| 703 | Ga0501034_0153643 | 3300049571 | Bacteria | 2277 |
| 704 | Ga0501034_0322222 | 3300049571 | Bacteria | 1478 |
| 705 | Ga0501034_0492207 | 3300049571 | Unclassified | 1141 |
| 706 | Ga0501036_0000085 | 3300049572 | Bacteria | 58421 |
| 707 | Ga0501036_0005203 | 3300049572 | Bacteria | 10515 |
| 708 | Ga0501036_0007002 | 3300049572 | Bacteria | 9178 |
| 709 | Ga0501036_0010372 | 3300049572 | Bacteria | 7690 |
| 710 | Ga0501036_0122684 | 3300049572 | Bacteria | 2194 |
| 711 | Ga0501036_0178356 | 3300049572 | Bacteria | 1789 |
| 712 | Ga0501036_0188353 | 3300049572 | Bacteria | 1736 |
| 713 | Ga0501037_0003886 | 3300049573 | Bacteria | 10839 |
| 714 | Ga0501037_0019377 | 3300049573 | Bacteria | 5019 |
| 715 | Ga0501037_0454278 | 3300049573 | Bacteria | 873 |
| 716 | Ga0501038_0010910 | 3300049574 | Bacteria | 8298 |
| 717 | Ga0501038_0045897 | 3300049574 | Bacteria | 3790 |
| 718 | Ga0501038_0059781 | 3300049574 | Bacteria | 3263 |
| 719 | Ga0501038_0377347 | 3300049574 | Bacteria | 1100 |
| 720 | Ga0501038_0634694 | 3300049574 | Bacteria | 805 |
| 721 | Ga0501039_0001894 | 3300049575 | Bacteria | 15471 |
| 722 | Ga0501039_0004981 | 3300049575 | Bacteria | 10077 |
| 723 | Ga0501039_0043970 | 3300049575 | Bacteria | 3450 |
| 724 | Ga0501039_0044514 | 3300049575 | Bacteria | 3428 |
| 725 | Ga0501039_0155483 | 3300049575 | Bacteria | 1796 |
| 726 | Ga0501039_0302011 | 3300049575 | Bacteria | 1258 |
| 727 | Ga0501039_0386889 | 3300049575 | Bacteria | 1099 |
| 728 | Ga0501039_0589518 | 3300049575 | Bacteria | 871 |
| 729 | Ga0501040_0001505 | 3300049576 | Bacteria | 14790 |
| 730 | Ga0501040_0074578 | 3300049576 | Bacteria | 2344 |
| 731 | Ga0501040_0135515 | 3300049576 | Bacteria | 1733 |
| 732 | Ga0501040_0240027 | 3300049576 | Bacteria | 1291 |
| 733 | Ga0501040_0694088 | 3300049576 | Bacteria | 736 |
| 734 | Ga0501041_0001056 | 3300049577 | Bacteria | 15063 |
| 735 | Ga0501041_0025825 | 3300049577 | Bacteria | 3531 |
| 736 | Ga0501041_0046784 | 3300049577 | Bacteria | 2632 |
| 737 | Ga0501041_0051414 | 3300049577 | Bacteria | 2512 |
| 738 | Ga0501041_0088670 | 3300049577 | Bacteria | 1909 |
| 739 | Ga0501041_0276965 | 3300049577 | Bacteria | 1055 |
| 740 | Ga0501041_0522786 | 3300049577 | Bacteria | 755 |
| 741 | Ga0501042_0000066 | 3300049578 | Bacteria | 37903 |
| 742 | Ga0501042_0005607 | 3300049578 | Bacteria | 8095 |
| 743 | Ga0501042_0053729 | 3300049578 | Bacteria | 2873 |
| 744 | Ga0501042_0068462 | 3300049578 | Bacteria | 2538 |
| 745 | Ga0501042_1188070 | 3300049578 | Bacteria | 556 |
| 746 | Ga0501043_0013502 | 3300049579 | Bacteria | 6390 |
| 747 | Ga0501043_0036393 | 3300049579 | Bacteria | 3871 |
| 748 | Ga0501043_0165031 | 3300049579 | Bacteria | 1729 |
| 749 | Ga0501043_0271745 | 3300049579 | Bacteria | 1301 |
| 750 | Ga0501043_0493718 | 3300049579 | Bacteria | 915 |
| 751 | Ga0501043_0780884 | 3300049579 | Bacteria | 692 |
| 752 | Ga0501046_0000352 | 3300049580 | Bacteria | 46220 |
| 753 | Ga0501046_0022182 | 3300049580 | Bacteria | 5232 |
| 754 | Ga0501046_0051601 | 3300049580 | Bacteria | 3245 |
| 755 | Ga0501046_0069698 | 3300049580 | Bacteria | 2735 |
| 756 | Ga0501046_0084831 | 3300049580 | Unclassified | 2442 |
| 757 | Ga0501046_0197252 | 3300049580 | Bacteria | 1499 |
| 758 | Ga0501046_0362881 | 3300049580 | Bacteria | 1050 |
| 759 | Ga0501046_0782058 | 3300049580 | Bacteria | 669 |
| 760 | Ga0501047_0005241 | 3300049581 | Bacteria | 12174 |
| 761 | Ga0501047_0058177 | 3300049581 | Bacteria | 3734 |
| 762 | Ga0501047_0132026 | 3300049581 | Bacteria | 2377 |
| 763 | Ga0501047_0174943 | 3300049581 | Bacteria | 2014 |
| 764 | Ga0501047_0347918 | 3300049581 | Bacteria | 1319 |
| 765 | Ga0501047_0586855 | 3300049581 | Bacteria | 937 |
| 766 | Ga0501047_0896741 | 3300049581 | Unclassified | 700 |
| 767 | Ga0501048_0000212 | 3300049582 | Bacteria | 38029 |
| 768 | Ga0501048_0006478 | 3300049582 | Bacteria | 8899 |
| 769 | Ga0501048_0046714 | 3300049582 | Bacteria | 3090 |
| 770 | Ga0501048_0270755 | 3300049582 | Bacteria | 1207 |
| 771 | Ga0501048_0588755 | 3300049582 | Unclassified | 798 |
| 772 | Ga0501067_0109212 | 3300049583 | Unclassified | 1538 |
| 773 | Ga0501067_0134175 | 3300049583 | Bacteria | 1378 |
| 774 | Ga0501068_0003889 | 3300049584 | Bacteria | 8114 |
| 775 | Ga0501068_0017760 | 3300049584 | Bacteria | 4117 |
| 776 | Ga0501068_0038729 | 3300049584 | Bacteria | 2856 |
| 777 | Ga0501068_0051610 | 3300049584 | Bacteria | 2488 |
| 778 | Ga0501068_0079853 | 3300049584 | Bacteria | 2006 |
| 779 | Ga0501068_0239392 | 3300049584 | Bacteria | 1155 |
| 780 | Ga0501068_0242734 | 3300049584 | Bacteria | 1147 |
| 781 | Ga0501068_0392303 | 3300049584 | Bacteria | 894 |
| 782 | Ga0501069_0115402 | 3300049585 | Unclassified | 1532 |
| 783 | Ga0501069_0167035 | 3300049585 | Bacteria | 1268 |
| 784 | Ga0501069_0224501 | 3300049585 | Unclassified | 1092 |
| 785 | Ga0501069_0376329 | 3300049585 | Bacteria | 838 |
| 786 | Ga0501070_0001060 | 3300049586 | Bacteria | 24749 |
| 787 | Ga0501070_0012020 | 3300049586 | Bacteria | 7306 |
| 788 | Ga0501070_0040880 | 3300049586 | Bacteria | 3864 |
| 789 | Ga0501070_0054282 | 3300049586 | Bacteria | 3323 |
| 790 | Ga0501070_0247007 | 3300049586 | Unclassified | 1460 |
| 791 | Ga0501070_0280477 | 3300049586 | Bacteria | 1359 |
| 792 | Ga0501070_0352174 | 3300049586 | Bacteria | 1195 |
| 793 | Ga0501070_1085914 | 3300049586 | Unclassified | 618 |
| 794 | Ga0501071_0001186 | 3300049587 | Bacteria | 14677 |
| 795 | Ga0501071_0002446 | 3300049587 | Bacteria | 11270 |
| 796 | Ga0501071_0008081 | 3300049587 | Bacteria | 6939 |
| 797 | Ga0501071_0145985 | 3300049587 | Bacteria | 1763 |
| 798 | Ga0501071_0361809 | 3300049587 | Bacteria | 1105 |
| 799 | Ga0501071_1214506 | 3300049587 | Bacteria | 582 |
| 800 | Ga0501071_1250911 | 3300049587 | Bacteria | 573 |
| 801 | Ga0501072_0000072 | 3300049588 | Bacteria | 72875 |
| 802 | Ga0501072_0004289 | 3300049588 | Bacteria | 10823 |
| 803 | Ga0501072_0005411 | 3300049588 | Bacteria | 9720 |
| 804 | Ga0501072_0056800 | 3300049588 | Bacteria | 3083 |
| 805 | Ga0501072_0103016 | 3300049588 | Bacteria | 2268 |
| 806 | Ga0501072_0129073 | 3300049588 | Bacteria | 2014 |
| 807 | Ga0501072_0189811 | 3300049588 | Bacteria | 1639 |
| 808 | Ga0501072_0227324 | 3300049588 | Bacteria | 1486 |
| 809 | Ga0501072_0967637 | 3300049588 | Bacteria | 664 |
| 810 | Ga0501072_1317547 | 3300049588 | Bacteria | 559 |
| 811 | Ga0501072_1420447 | 3300049588 | Unclassified | 536 |
| 812 | Ga0501073_0009735 | 3300049589 | Bacteria | 7077 |
| 813 | Ga0501073_0015671 | 3300049589 | Bacteria | 5496 |
| 814 | Ga0501073_0019844 | 3300049589 | Bacteria | 4850 |
| 815 | Ga0501073_0055581 | 3300049589 | Bacteria | 2769 |
| 816 | Ga0501073_0069593 | 3300049589 | Bacteria | 2452 |
| 817 | Ga0501073_0151481 | 3300049589 | Bacteria | 1607 |
| 818 | Ga0501073_0176670 | 3300049589 | Unclassified | 1478 |
| 819 | Ga0501073_1225303 | 3300049589 | Bacteria | 515 |
| 820 | Ga0501073_1256677 | 3300049589 | Unclassified | 508 |
| 821 | Ga0501074_0001385 | 3300049590 | Bacteria | 16089 |
| 822 | Ga0501074_0034829 | 3300049590 | Bacteria | 3649 |
| 823 | Ga0501074_0045873 | 3300049590 | Bacteria | 3160 |
| 824 | Ga0501074_0050161 | 3300049590 | Bacteria | 3012 |
| 825 | Ga0501074_0054055 | 3300049590 | Bacteria | 2896 |
| 826 | Ga0501074_0069110 | 3300049590 | Bacteria | 2539 |
| 827 | Ga0501074_0174411 | 3300049590 | Bacteria | 1534 |
| 828 | Ga0501074_0200994 | 3300049590 | Unclassified | 1420 |
| 829 | Ga0501074_0781768 | 3300049590 | Unclassified | 673 |
| 830 | Ga0501075_0001193 | 3300049591 | Bacteria | 16807 |
| 831 | Ga0501075_0005139 | 3300049591 | Bacteria | 8949 |
| 832 | Ga0501075_0043599 | 3300049591 | Bacteria | 3364 |
| 833 | Ga0501075_0043656 | 3300049591 | Bacteria | 3362 |
| 834 | Ga0501075_0051117 | 3300049591 | Bacteria | 3107 |
| 835 | Ga0501075_0126394 | 3300049591 | Bacteria | 1946 |
| 836 | Ga0501075_0185126 | 3300049591 | Bacteria | 1588 |
| 837 | Ga0501075_0303671 | 3300049591 | Bacteria | 1216 |
| 838 | Ga0501075_0404003 | 3300049591 | Bacteria | 1041 |
| 839 | Ga0501076_0000747 | 3300049592 | Bacteria | 21026 |
| 840 | Ga0501076_0003147 | 3300049592 | Bacteria | 11509 |
| 841 | Ga0501076_0009286 | 3300049592 | Bacteria | 7255 |
| 842 | Ga0501076_0049847 | 3300049592 | Bacteria | 3312 |
| 843 | Ga0501076_0084275 | 3300049592 | Bacteria | 2553 |
| 844 | Ga0501076_0328083 | 3300049592 | Bacteria | 1255 |
| 845 | Ga0501076_0407296 | 3300049592 | Bacteria | 1118 |
| 846 | Ga0501076_0418977 | 3300049592 | Unclassified | 1102 |
| 847 | Ga0501076_0465588 | 3300049592 | Bacteria | 1041 |
| 848 | Ga0501076_1318183 | 3300049592 | Unclassified | 594 |
| 849 | Ga0501077_0001220 | 3300049593 | Bacteria | 15544 |
| 850 | Ga0501077_0001950 | 3300049593 | Bacteria | 12491 |
| 851 | Ga0501077_0058417 | 3300049593 | Bacteria | 2449 |
| 852 | Ga0501077_0071309 | 3300049593 | Bacteria | 2202 |
| 853 | Ga0501077_0193626 | 3300049593 | Bacteria | 1291 |
| 854 | Ga0501077_0689163 | 3300049593 | Unclassified | 656 |
| 855 | Ga0501079_0000515 | 3300049741 | Bacteria | 25161 |
| 856 | Ga0501079_0017707 | 3300049741 | Bacteria | 5442 |
| 857 | Ga0501079_0027702 | 3300049741 | Bacteria | 4346 |
| 858 | Ga0501079_0041231 | 3300049741 | Bacteria | 3562 |
| 859 | Ga0501079_0043215 | 3300049741 | Bacteria | 3478 |
| 860 | Ga0501079_0088098 | 3300049741 | Bacteria | 2403 |
| 861 | Ga0501079_0101460 | 3300049741 | Bacteria | 2231 |
| 862 | Ga0501079_0132435 | 3300049741 | Bacteria | 1940 |
| 863 | Ga0501079_0233928 | 3300049741 | Unclassified | 1436 |
| 864 | Ga0501079_0928166 | 3300049741 | Bacteria | 685 |
| 865 | Ga0501080_0000230 | 3300049742 | Bacteria | 42082 |
| 866 | Ga0501080_0002151 | 3300049742 | Bacteria | 17113 |
| 867 | Ga0501080_0008348 | 3300049742 | Bacteria | 9378 |
| 868 | Ga0501080_0016662 | 3300049742 | Bacteria | 6785 |
| 869 | Ga0501080_0066622 | 3300049742 | Bacteria | 3349 |
| 870 | Ga0501080_0082540 | 3300049742 | Bacteria | 2985 |
| 871 | Ga0501080_0306245 | 3300049742 | Bacteria | 1440 |
| 872 | Ga0501080_0531498 | 3300049742 | Bacteria | 1048 |
| 873 | Ga0501080_0720698 | 3300049742 | Bacteria | 879 |
| 874 | Ga0501080_1178714 | 3300049742 | Bacteria | 659 |
| 875 | Ga0501080_1558072 | 3300049742 | Bacteria | 560 |
| 876 | Ga0501081_0001918 | 3300049743 | Bacteria | 12908 |
| 877 | Ga0501081_0023796 | 3300049743 | Bacteria | 4108 |
| 878 | Ga0501081_0037280 | 3300049743 | Bacteria | 3316 |
| 879 | Ga0501081_0154613 | 3300049743 | Bacteria | 1650 |
| 880 | Ga0501081_0272018 | 3300049743 | Bacteria | 1239 |
| 881 | Ga0501081_0300960 | 3300049743 | Bacteria | 1176 |
| 882 | Ga0501081_0674421 | 3300049743 | Bacteria | 775 |
| 883 | Ga0501081_1226111 | 3300049743 | Bacteria | 568 |
| 884 | Ga0501083_0001262 | 3300049744 | Bacteria | 17164 |
| 885 | Ga0501083_0006498 | 3300049744 | Bacteria | 8290 |
| 886 | Ga0501083_0019061 | 3300049744 | Bacteria | 4777 |
| 887 | Ga0501083_0026562 | 3300049744 | Bacteria | 4001 |
| 888 | Ga0501083_0099265 | 3300049744 | Bacteria | 1921 |
| 889 | Ga0501083_0112080 | 3300049744 | Bacteria | 1793 |
| 890 | Ga0501083_0212927 | 3300049744 | Bacteria | 1260 |
| 891 | Ga0501083_0535333 | 3300049744 | Unclassified | 762 |
| 892 | Ga0501035_0001838 | 3300049822 | Bacteria | 21366 |
| 893 | Ga0501035_0014173 | 3300049822 | Bacteria | 7356 |
| 894 | Ga0501035_0074417 | 3300049822 | Bacteria | 3005 |
| 895 | Ga0501035_0087731 | 3300049822 | Bacteria | 2741 |
| 896 | Ga0501035_0200264 | 3300049822 | Unclassified | 1713 |
| 897 | Ga0501035_0825444 | 3300049822 | Bacteria | 739 |
| 898 | Ga0501035_0940604 | 3300049822 | Bacteria | 682 |
| 899 | Ga0501044_0015207 | 3300049823 | Bacteria | 8288 |
| 900 | Ga0501044_0032149 | 3300049823 | Bacteria | 5516 |
| 901 | Ga0501044_0223902 | 3300049823 | Bacteria | 1831 |
| 902 | Ga0501044_0608684 | 3300049823 | Bacteria | 985 |
| 903 | Ga0501044_1257546 | 3300049823 | Bacteria | 607 |
| 904 | Ga0501044_1407733 | 3300049823 | Unclassified | 563 |
| 905 | Ga0501045_0000241 | 3300049824 | Bacteria | 31816 |
| 906 | Ga0501045_0038756 | 3300049824 | Bacteria | 3466 |
| 907 | Ga0501045_0086387 | 3300049824 | Bacteria | 2315 |
| 908 | Ga0501045_0117774 | 3300049824 | Bacteria | 1971 |
| 909 | Ga0501045_0251831 | 3300049824 | Bacteria | 1314 |
| 910 | Ga0501045_0339881 | 3300049824 | Bacteria | 1117 |
| 911 | Ga0501045_0462285 | 3300049824 | Bacteria | 943 |
| 912 | Ga0501045_0573722 | 3300049824 | Bacteria | 836 |
| 913 | Ga0501045_0942880 | 3300049824 | Unclassified | 633 |
| 914 | nmdc:mga03n38_22652_c1 | 3300050490 | Bacteria | 2545 |
| 915 | nmdc:mga00v17_343744_c2 | 3300050491 | Unclassified | 605 |
| 916 | nmdc:mga00v17_3709_c1 | 3300050491 | Bacteria | 7895 |
| 917 | nmdc:mga0yw44_218170_c1 | 3300050492 | Bacteria | 1263 |
| 918 | nmdc:mga0yw44_35630_c1 | 3300050492 | Bacteria | 2926 |
| 919 | nmdc:mga0yw44_413568_c1 | 3300050492 | Unclassified | 913 |
| 920 | nmdc:mga0yw44_774095_c1 | 3300050492 | Unclassified | 652 |
| 921 | nmdc:mga06z11_113928_c1 | 3300050494 | Bacteria | 1500 |
| 922 | nmdc:mga04h51_378496_c1 | 3300050495 | Unclassified | 589 |
| 923 | nmdc:mga05p37_102731_c1 | 3300050507 | Bacteria | 3519 |
| 924 | nmdc:mga05p37_1614_c1 | 3300050507 | Bacteria | 26128 |
| 925 | nmdc:mga05p37_2114966_c1 | 3300050507 | Bacteria | 527 |
| 926 | nmdc:mga05p37_239326_c1 | 3300050507 | Bacteria | 2183 |
| 927 | nmdc:mga05p37_582639_c1 | 3300050507 | Bacteria | 1267 |
| 928 | nmdc:mga09592_1116897_c1 | 3300050508 | Unclassified | 655 |
| 929 | nmdc:mga09592_28817_c1 | 3300050508 | Bacteria | 4616 |
| 930 | nmdc:mga0qj67_219018_c1 | 3300050509 | Bacteria | 1545 |
| 931 | nmdc:mga06r32_1601087_c1 | 3300050510 | Unclassified | 590 |
| 932 | nmdc:mga08y16_1039_c1 | 3300050511 | Bacteria | 27204 |
| 933 | nmdc:mga08y16_169317_c1 | 3300050511 | Bacteria | 2269 |
| 934 | nmdc:mga08y16_521234_c1 | 3300050511 | Bacteria | 1205 |
| 935 | nmdc:mga08y16_53313_c1 | 3300050511 | Bacteria | 4229 |
| 936 | nmdc:mga08y16_663006_c1 | 3300050511 | Unclassified | 1046 |
| 937 | nmdc:mga0n895_151250_c1 | 3300050512 | Bacteria | 2351 |
| 938 | nmdc:mga0n895_362128_c1 | 3300050512 | Unclassified | 1468 |
| 939 | nmdc:mga0rr50_41125_c1 | 3300050513 | Bacteria | 3366 |
| 940 | nmdc:mga08x19_118756_c1 | 3300050514 | Bacteria | 1770 |
| 941 | nmdc:mga08x19_25407_c1 | 3300050514 | Unclassified | 3689 |
| 942 | nmdc:mga0a205_19581_c1 | 3300050515 | Bacteria | 6383 |
| 943 | nmdc:mga0a205_40860_c1 | 3300050515 | Bacteria | 4466 |
| 944 | nmdc:mga0a205_469750_c1 | 3300050515 | Bacteria | 1117 |
| 945 | Ga0495601_0286832 | 3300053077 | Bacteria | 1073 |
| 946 | Ga0495595_0418333 | 3300053084 | Bacteria | 680 |
| 947 | Ga0501084_0002046 | 3300054114 | Bacteria | 16113 |
| 948 | Ga0501084_0008815 | 3300054114 | Bacteria | 8347 |
| 949 | Ga0501084_0026511 | 3300054114 | Bacteria | 4837 |
| 950 | Ga0501084_0034478 | 3300054114 | Bacteria | 4232 |
| 951 | Ga0501084_0125949 | 3300054114 | Bacteria | 2155 |
| 952 | Ga0501084_0128954 | 3300054114 | Bacteria | 2129 |
| 953 | Ga0501084_0423210 | 3300054114 | Unclassified | 1126 |
| 954 | Ga0501084_0659096 | 3300054114 | Bacteria | 883 |
| 955 | Ga0501084_1146381 | 3300054114 | Bacteria | 652 |
| 956 | Ga0501084_1550607 | 3300054114 | Bacteria | 554 |
| 957 | Ga0501084_1575978 | 3300054114 | Unclassified | 549 |
| 958 | Ga0501082_0000655 | 3300060353 | Bacteria | 30539 |
| 959 | Ga0501082_0002993 | 3300060353 | Bacteria | 14760 |
| 960 | Ga0501082_0048532 | 3300060353 | Bacteria | 3659 |
| 961 | Ga0501082_0059769 | 3300060353 | Bacteria | 3284 |
| 962 | Ga0501082_0072939 | 3300060353 | Bacteria | 2956 |
| 963 | Ga0501082_0095281 | 3300060353 | Bacteria | 2572 |
| 964 | Ga0501082_0124794 | 3300060353 | Bacteria | 2233 |
| 965 | Ga0501082_0131934 | 3300060353 | Bacteria | 2167 |
| 966 | Ga0501082_0163053 | 3300060353 | Bacteria | 1937 |
| 967 | Ga0501082_0163151 | 3300060353 | Bacteria | 1936 |
| 968 | Ga0501082_0389852 | 3300060353 | Bacteria | 1215 |
| 969 | Ga0501082_1711305 | 3300060353 | Unclassified | 549 |
| 970 | Ga0466962_0034503 | 3300061719 | Bacteria | 2422 |
| 971 | Ga0530510_0001039 | 3300061734 | Bacteria | 18381 |
| 972 | Ga0530510_0005040 | 3300061734 | Bacteria | 9115 |
| 973 | Ga0530510_0016537 | 3300061734 | Bacteria | 5222 |
| 974 | Ga0530510_0097762 | 3300061734 | Bacteria | 2146 |
| 975 | Ga0530510_0119197 | 3300061734 | Bacteria | 1936 |
| 976 | Ga0530510_0147992 | 3300061734 | Bacteria | 1733 |
| 977 | Ga0530510_0160641 | 3300061734 | Unclassified | 1662 |
| 978 | Ga0530510_0495782 | 3300061734 | Bacteria | 926 |
| 979 | Ga0530510_0755289 | 3300061734 | Bacteria | 741 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005439 | Ga0070711_100508233 | Ga0070711_1005082332 | 74 |
| 2 | 3300005439 | Ga0070711_101071391 | Ga0070711_1010713912 | 74 |
| 3 | 3300006028 | Ga0070717_11065714 | Ga0070717_110657142 | 74 |
| 4 | 3300006173 | Ga0070716_100206701 | Ga0070716_1002067012 | 74 |
| 5 | 3300006175 | Ga0070712_100826481 | Ga0070712_1008264812 | 74 |
| 6 | 3300009094 | Ga0111539_10792934 | Ga0111539_107929342 | 74 |
| 7 | 3300009011 | Ga0105251_10392388 | Ga0105251_103923882 | 75 |
| 8 | 3300011119 | Ga0105246_11584954 | Ga0105246_115849542 | 76 |
| 9 | 3300028558 | Ga0265326_10011746 | Ga0265326_100117463 | 76 |
| 10 | 3300028563 | Ga0265319_1003621 | Ga0265319_10036214 | 76 |
| 11 | 3300028577 | Ga0265318_10000604 | Ga0265318_1000060423 | 76 |
| 12 | 3300028653 | Ga0265323_10081857 | Ga0265323_100818571 | 76 |
| 13 | 3300028654 | Ga0265322_10011177 | Ga0265322_100111772 | 76 |
| 14 | 3300028666 | Ga0265336_10058455 | Ga0265336_100584552 | 76 |
| 15 | 3300028800 | Ga0265338_10016776 | Ga0265338_100167767 | 76 |
| 16 | 3300029957 | Ga0265324_10060749 | Ga0265324_100607492 | 76 |
| 17 | 3300031235 | Ga0265330_10014403 | Ga0265330_100144033 | 76 |
| 18 | 3300031238 | Ga0265332_10034933 | Ga0265332_100349332 | 76 |
| 19 | 3300031239 | Ga0265328_10000719 | Ga0265328_1000071912 | 76 |
| 20 | 3300031241 | Ga0265325_10002559 | Ga0265325_100025595 | 76 |
| 21 | 3300031242 | Ga0265329_10022835 | Ga0265329_100228353 | 76 |
| 22 | 3300031247 | Ga0265340_10002638 | Ga0265340_100026384 | 76 |
| 23 | 3300031249 | Ga0265339_10014186 | Ga0265339_100141862 | 76 |
| 24 | 3300031344 | Ga0265316_10002341 | Ga0265316_100023413 | 76 |
| 25 | 3300031595 | Ga0265313_10006053 | Ga0265313_100060534 | 76 |
| 26 | 3300031711 | Ga0265314_10174016 | Ga0265314_101740162 | 76 |
| 27 | 3300031712 | Ga0265342_10013160 | Ga0265342_100131603 | 76 |
| 28 | 3300045049 | Ga0466959_1006106 | Ga0466959_1006106_186_425 | 76 |
| 29 | 3300049568 | Ga0501031_0044840 | Ga0501031_0044840_2554_2805 | 76 |
| 30 | 3300049569 | Ga0501032_0020977 | Ga0501032_0020977_4044_4289 | 76 |
| 31 | 3300049570 | Ga0501033_0032812 | Ga0501033_0032812_3389_3634 | 76 |
| 32 | 3300049570 | Ga0501033_0384285 | Ga0501033_0384285_600_851 | 76 |
| 33 | 3300049571 | Ga0501034_0022438 | Ga0501034_0022438_6101_6352 | 76 |
| 34 | 3300049571 | Ga0501034_0322222 | Ga0501034_0322222_1028_1273 | 76 |
| 35 | 3300049572 | Ga0501036_0005203 | Ga0501036_0005203_8928_9173 | 76 |
| 36 | 3300049572 | Ga0501036_0010372 | Ga0501036_0010372_285_536 | 76 |
| 37 | 3300049573 | Ga0501037_0003886 | Ga0501037_0003886_1220_1465 | 76 |
| 38 | 3300049573 | Ga0501037_0454278 | Ga0501037_0454278_209_460 | 76 |
| 39 | 3300049574 | Ga0501038_0045897 | Ga0501038_0045897_3279_3524 | 76 |
| 40 | 3300049574 | Ga0501038_0059781 | Ga0501038_0059781_2102_2353 | 76 |
| 41 | 3300049575 | Ga0501039_0044514 | Ga0501039_0044514_911_1162 | 76 |
| 42 | 3300049575 | Ga0501039_0155483 | Ga0501039_0155483_1060_1305 | 76 |
| 43 | 3300049576 | Ga0501040_0135515 | Ga0501040_0135515_1441_1686 | 76 |
| 44 | 3300049576 | Ga0501040_0240027 | Ga0501040_0240027_911_1162 | 76 |
| 45 | 3300049577 | Ga0501041_0276965 | Ga0501041_0276965_728_979 | 76 |
| 46 | 3300049577 | Ga0501041_0522786 | Ga0501041_0522786_244_489 | 76 |
| 47 | 3300049578 | Ga0501042_0053729 | Ga0501042_0053729_1188_1433 | 76 |
| 48 | 3300049579 | Ga0501043_0013502 | Ga0501043_0013502_5946_6191 | 76 |
| 49 | 3300049579 | Ga0501043_0165031 | Ga0501043_0165031_1349_1600 | 76 |
| 50 | 3300049580 | Ga0501046_0022182 | Ga0501046_0022182_3322_3573 | 76 |
| 51 | 3300049580 | Ga0501046_0084831 | Ga0501046_0084831_1458_1703 | 76 |
| 52 | 3300049581 | Ga0501047_0058177 | Ga0501047_0058177_2019_2270 | 76 |
| 53 | 3300049582 | Ga0501048_0006478 | Ga0501048_0006478_492_737 | 76 |
| 54 | 3300049584 | Ga0501068_0038729 | Ga0501068_0038729_1424_1669 | 76 |
| 55 | 3300049584 | Ga0501068_0392303 | Ga0501068_0392303_563_814 | 76 |
| 56 | 3300049585 | Ga0501069_0167035 | Ga0501069_0167035_418_669 | 76 |
| 57 | 3300049585 | Ga0501069_0376329 | Ga0501069_0376329_427_672 | 76 |
| 58 | 3300049586 | Ga0501070_0012020 | Ga0501070_0012020_3826_4071 | 76 |
| 59 | 3300049586 | Ga0501070_0280477 | Ga0501070_0280477_911_1162 | 76 |
| 60 | 3300049587 | Ga0501071_0008081 | Ga0501071_0008081_5340_5591 | 76 |
| 61 | 3300049588 | Ga0501072_0056800 | Ga0501072_0056800_2752_3003 | 76 |
| 62 | 3300049588 | Ga0501072_1420447 | Ga0501072_1420447_48_293 | 76 |
| 63 | 3300049589 | Ga0501073_0015671 | Ga0501073_0015671_334_579 | 76 |
| 64 | 3300049589 | Ga0501073_0151481 | Ga0501073_0151481_1159_1410 | 76 |
| 65 | 3300049590 | Ga0501074_0045873 | Ga0501074_0045873_2310_2561 | 76 |
| 66 | 3300049590 | Ga0501074_0050161 | Ga0501074_0050161_1580_1825 | 76 |
| 67 | 3300049591 | Ga0501075_0005139 | Ga0501075_0005139_7350_7601 | 76 |
| 68 | 3300049591 | Ga0501075_0126394 | Ga0501075_0126394_642_887 | 76 |
| 69 | 3300049592 | Ga0501076_0009286 | Ga0501076_0009286_5823_6068 | 76 |
| 70 | 3300049592 | Ga0501076_0049847 | Ga0501076_0049847_911_1162 | 76 |
| 71 | 3300049593 | Ga0501077_0193626 | Ga0501077_0193626_130_381 | 76 |
| 72 | 3300049593 | Ga0501077_0689163 | Ga0501077_0689163_48_293 | 76 |
| 73 | 3300049741 | Ga0501079_0000515 | Ga0501079_0000515_785_1036 | 76 |
| 74 | 3300049741 | Ga0501079_0041231 | Ga0501079_0041231_3051_3296 | 76 |
| 75 | 3300049742 | Ga0501080_0016662 | Ga0501080_0016662_1567_1812 | 76 |
| 76 | 3300049742 | Ga0501080_0531498 | Ga0501080_0531498_198_449 | 76 |
| 77 | 3300049743 | Ga0501081_0001918 | Ga0501081_0001918_11457_11708 | 76 |
| 78 | 3300049743 | Ga0501081_0674421 | Ga0501081_0674421_136_381 | 76 |
| 79 | 3300049744 | Ga0501083_0001262 | Ga0501083_0001262_7459_7704 | 76 |
| 80 | 3300049822 | Ga0501035_0014173 | Ga0501035_0014173_372_617 | 76 |
| 81 | 3300049822 | Ga0501035_0087731 | Ga0501035_0087731_1891_2142 | 76 |
| 82 | 3300049823 | Ga0501044_0032149 | Ga0501044_0032149_4974_5219 | 76 |
| 83 | 3300049824 | Ga0501045_0038756 | Ga0501045_0038756_1065_1316 | 76 |
| 84 | 3300049824 | Ga0501045_0942880 | Ga0501045_0942880_214_459 | 76 |
| 85 | 3300054114 | Ga0501084_0034478 | Ga0501084_0034478_911_1162 | 76 |
| 86 | 3300054114 | Ga0501084_0659096 | Ga0501084_0659096_395_640 | 76 |
| 87 | 3300060353 | Ga0501082_0002993 | Ga0501082_0002993_6642_6893 | 76 |
| 88 | 3300060353 | Ga0501082_0163151 | Ga0501082_0163151_267_512 | 76 |
| 89 | 3300061734 | Ga0530510_0016537 | Ga0530510_0016537_4187_4438 | 76 |
| 90 | 3300061734 | Ga0530510_0119197 | Ga0530510_0119197_1425_1670 | 76 |
| 91 | 3300003203 | JGI25406J46586_10048652 | JGI25406J46586_100486522 | 77 |
| 92 | 3300003373 | JGI25407J50210_10008218 | JGI25407J50210_100082183 | 77 |
| 93 | 3300003373 | JGI25407J50210_10064747 | JGI25407J50210_100647472 | 77 |
| 94 | 3300003373 | JGI25407J50210_10079816 | JGI25407J50210_100798161 | 77 |
| 95 | 3300005327 | Ga0070658_10146058 | Ga0070658_101460582 | 77 |
| 96 | 3300005327 | Ga0070658_10174636 | Ga0070658_101746363 | 77 |
| 97 | 3300005331 | Ga0070670_101057610 | Ga0070670_1010576102 | 77 |
| 98 | 3300005336 | Ga0070680_100233246 | Ga0070680_1002332463 | 77 |
| 99 | 3300005336 | Ga0070680_100386592 | Ga0070680_1003865922 | 77 |
| 100 | 3300005337 | Ga0070682_101528978 | Ga0070682_1015289781 | 77 |
| 101 | 3300005340 | Ga0070689_100070015 | Ga0070689_1000700157 | 77 |
| 102 | 3300005343 | Ga0070687_100218857 | Ga0070687_1002188573 | 77 |
| 103 | 3300005345 | Ga0070692_11170817 | Ga0070692_111708171 | 77 |
| 104 | 3300005353 | Ga0070669_100621181 | Ga0070669_1006211812 | 77 |
| 105 | 3300005355 | Ga0070671_100205991 | Ga0070671_1002059913 | 77 |
| 106 | 3300005356 | Ga0070674_100377962 | Ga0070674_1003779622 | 77 |
| 107 | 3300005366 | Ga0070659_100080179 | Ga0070659_1000801793 | 77 |
| 108 | 3300005437 | Ga0070710_10469624 | Ga0070710_104696242 | 77 |
| 109 | 3300005438 | Ga0070701_10087878 | Ga0070701_100878782 | 77 |
| 110 | 3300005439 | Ga0070711_100370234 | Ga0070711_1003702341 | 77 |
| 111 | 3300005440 | Ga0070705_101410453 | Ga0070705_1014104531 | 77 |
| 112 | 3300005456 | Ga0070678_100710896 | Ga0070678_1007108962 | 77 |
| 113 | 3300005456 | Ga0070678_100834887 | Ga0070678_1008348872 | 77 |
| 114 | 3300005458 | Ga0070681_10234836 | Ga0070681_102348363 | 77 |
| 115 | 3300005530 | Ga0070679_100169595 | Ga0070679_1001695953 | 77 |
| 116 | 3300005530 | Ga0070679_101167763 | Ga0070679_1011677632 | 77 |
| 117 | 3300005530 | Ga0070679_101382489 | Ga0070679_1013824891 | 77 |
| 118 | 3300005535 | Ga0070684_100006350 | Ga0070684_1000063502 | 77 |
| 119 | 3300005535 | Ga0070684_100195681 | Ga0070684_1001956812 | 77 |
| 120 | 3300005535 | Ga0070684_102358990 | Ga0070684_1023589901 | 77 |
| 121 | 3300005539 | Ga0068853_101002024 | Ga0068853_1010020242 | 77 |
| 122 | 3300005544 | Ga0070686_100313945 | Ga0070686_1003139452 | 77 |
| 123 | 3300005547 | Ga0070693_100194775 | Ga0070693_1001947752 | 77 |
| 124 | 3300005549 | Ga0070704_100138671 | Ga0070704_1001386713 | 77 |
| 125 | 3300005577 | Ga0068857_100044711 | Ga0068857_1000447117 | 77 |
| 126 | 3300005577 | Ga0068857_100403746 | Ga0068857_1004037462 | 77 |
| 127 | 3300005616 | Ga0068852_100600800 | Ga0068852_1006008002 | 77 |
| 128 | 3300005618 | Ga0068864_100035107 | Ga0068864_1000351074 | 77 |
| 129 | 3300005718 | Ga0068866_10238039 | Ga0068866_102380392 | 77 |
| 130 | 3300005719 | Ga0068861_100295884 | Ga0068861_1002958842 | 77 |
| 131 | 3300005719 | Ga0068861_101396198 | Ga0068861_1013961982 | 77 |
| 132 | 3300005840 | Ga0068870_10105171 | Ga0068870_101051713 | 77 |
| 133 | 3300005841 | Ga0068863_100499073 | Ga0068863_1004990732 | 77 |
| 134 | 3300005842 | Ga0068858_100508214 | Ga0068858_1005082142 | 77 |
| 135 | 3300005843 | Ga0068860_101046294 | Ga0068860_1010462943 | 77 |
| 136 | 3300005937 | Ga0081455_10038346 | Ga0081455_100383463 | 77 |
| 137 | 3300005937 | Ga0081455_10128352 | Ga0081455_101283522 | 77 |
| 138 | 3300005981 | Ga0081538_10000080 | Ga0081538_1000008047 | 77 |
| 139 | 3300005981 | Ga0081538_10001298 | Ga0081538_1000129818 | 77 |
| 140 | 3300005981 | Ga0081538_10002401 | Ga0081538_1000240115 | 77 |
| 141 | 3300005981 | Ga0081538_10004814 | Ga0081538_100048144 | 77 |
| 142 | 3300005985 | Ga0081539_10000041 | Ga0081539_10000041288 | 77 |
| 143 | 3300006038 | Ga0075365_11068499 | Ga0075365_110684991 | 77 |
| 144 | 3300006051 | Ga0075364_10432745 | Ga0075364_104327452 | 77 |
| 145 | 3300006058 | Ga0075432_10157126 | Ga0075432_101571262 | 77 |
| 146 | 3300006177 | Ga0075362_10228108 | Ga0075362_102281082 | 77 |
| 147 | 3300006852 | Ga0075433_10531856 | Ga0075433_105318562 | 77 |
| 148 | 3300006871 | Ga0075434_100098662 | Ga0075434_1000986623 | 77 |
| 149 | 3300006914 | Ga0075436_100017712 | Ga0075436_1000177125 | 77 |
| 150 | 3300006914 | Ga0075436_100268101 | Ga0075436_1002681012 | 77 |
| 151 | 3300006914 | Ga0075436_100395493 | Ga0075436_1003954932 | 77 |
| 152 | 3300006914 | Ga0075436_100495782 | Ga0075436_1004957822 | 77 |
| 153 | 3300009092 | Ga0105250_10476070 | Ga0105250_104760702 | 77 |
| 154 | 3300009094 | Ga0111539_10375086 | Ga0111539_103750863 | 77 |
| 155 | 3300009094 | Ga0111539_11026281 | Ga0111539_110262812 | 77 |
| 156 | 3300009098 | Ga0105245_11846125 | Ga0105245_118461252 | 77 |
| 157 | 3300009147 | Ga0114129_10118719 | Ga0114129_101187193 | 77 |
| 158 | 3300009147 | Ga0114129_11857136 | Ga0114129_118571361 | 77 |
| 159 | 3300009147 | Ga0114129_12225822 | Ga0114129_122258222 | 77 |
| 160 | 3300009148 | Ga0105243_10384520 | Ga0105243_103845203 | 77 |
| 161 | 3300009177 | Ga0105248_10144247 | Ga0105248_101442473 | 77 |
| 162 | 3300009545 | Ga0105237_11344400 | Ga0105237_113444002 | 77 |
| 163 | 3300009551 | Ga0105238_11834812 | Ga0105238_118348121 | 77 |
| 164 | 3300009553 | Ga0105249_10182214 | Ga0105249_101822142 | 77 |
| 165 | 3300009553 | Ga0105249_13026524 | Ga0105249_130265241 | 77 |
| 166 | 3300010375 | Ga0105239_10341817 | Ga0105239_103418172 | 77 |
| 167 | 3300012512 | Ga0157327_1065366 | Ga0157327_10653662 | 77 |
| 168 | 3300013102 | Ga0157371_10445585 | Ga0157371_104455852 | 77 |
| 169 | 3300013104 | Ga0157370_10014041 | Ga0157370_100140414 | 77 |
| 170 | 3300013306 | Ga0163162_11176343 | Ga0163162_111763432 | 77 |
| 171 | 3300013308 | Ga0157375_10085146 | Ga0157375_100851467 | 77 |
| 172 | 3300014326 | Ga0157380_10362572 | Ga0157380_103625722 | 77 |
| 173 | 3300020082 | Ga0206353_11915172 | Ga0206353_119151722 | 77 |
| 174 | 3300020082 | Ga0206353_11936762 | Ga0206353_119367622 | 77 |
| 175 | 3300025908 | Ga0207643_10039177 | Ga0207643_100391777 | 77 |
| 176 | 3300025909 | Ga0207705_10116170 | Ga0207705_101161702 | 77 |
| 177 | 3300025912 | Ga0207707_10862061 | Ga0207707_108620611 | 77 |
| 178 | 3300025916 | Ga0207663_10478685 | Ga0207663_104786852 | 77 |
| 179 | 3300025917 | Ga0207660_10149117 | Ga0207660_101491172 | 77 |
| 180 | 3300025917 | Ga0207660_10464053 | Ga0207660_104640533 | 77 |
| 181 | 3300025920 | Ga0207649_10370242 | Ga0207649_103702423 | 77 |
| 182 | 3300025921 | Ga0207652_10080184 | Ga0207652_100801843 | 77 |
| 183 | 3300025921 | Ga0207652_11729890 | Ga0207652_117298901 | 77 |
| 184 | 3300025925 | Ga0207650_10141985 | Ga0207650_101419853 | 77 |
| 185 | 3300025926 | Ga0207659_10395197 | Ga0207659_103951972 | 77 |
| 186 | 3300025927 | Ga0207687_11618396 | Ga0207687_116183962 | 77 |
| 187 | 3300025928 | Ga0207700_10867839 | Ga0207700_108678391 | 77 |
| 188 | 3300025929 | Ga0207664_10011931 | Ga0207664_100119314 | 77 |
| 189 | 3300025932 | Ga0207690_10934242 | Ga0207690_109342422 | 77 |
| 190 | 3300025935 | Ga0207709_10492279 | Ga0207709_104922792 | 77 |
| 191 | 3300025938 | Ga0207704_10523383 | Ga0207704_105233833 | 77 |
| 192 | 3300025941 | Ga0207711_10345171 | Ga0207711_103451712 | 77 |
| 193 | 3300025942 | Ga0207689_10049158 | Ga0207689_100491587 | 77 |
| 194 | 3300025944 | Ga0207661_10033451 | Ga0207661_100334513 | 77 |
| 195 | 3300025944 | Ga0207661_10617671 | Ga0207661_106176711 | 77 |
| 196 | 3300025945 | Ga0207679_10126378 | Ga0207679_101263782 | 77 |
| 197 | 3300025960 | Ga0207651_10451447 | Ga0207651_104514473 | 77 |
| 198 | 3300025961 | Ga0207712_10939251 | Ga0207712_109392512 | 77 |
| 199 | 3300025961 | Ga0207712_11425582 | Ga0207712_114255821 | 77 |
| 200 | 3300025981 | Ga0207640_11033783 | Ga0207640_110337832 | 77 |
| 201 | 3300026023 | Ga0207677_10381887 | Ga0207677_103818872 | 77 |
| 202 | 3300026116 | Ga0207674_10007911 | Ga0207674_100079112 | 77 |
| 203 | 3300026116 | Ga0207674_10015082 | Ga0207674_100150823 | 77 |
| 204 | 3300026118 | Ga0207675_100518491 | Ga0207675_1005184912 | 77 |
| 205 | 3300027876 | Ga0209974_10025491 | Ga0209974_100254915 | 77 |
| 206 | 3300027907 | Ga0207428_10062171 | Ga0207428_100621714 | 77 |
| 207 | 3300031548 | Ga0307408_100165182 | Ga0307408_1001651823 | 77 |
| 208 | 3300031548 | Ga0307408_101234083 | Ga0307408_1012340832 | 77 |
| 209 | 3300031548 | Ga0307408_101462892 | Ga0307408_1014628922 | 77 |
| 210 | 3300031731 | Ga0307405_11919907 | Ga0307405_119199072 | 77 |
| 211 | 3300031824 | Ga0307413_10610871 | Ga0307413_106108713 | 77 |
| 212 | 3300031824 | Ga0307413_11720936 | Ga0307413_117209362 | 77 |
| 213 | 3300031852 | Ga0307410_10154190 | Ga0307410_101541903 | 77 |
| 214 | 3300031901 | Ga0307406_10030702 | Ga0307406_100307026 | 77 |
| 215 | 3300031901 | Ga0307406_10210646 | Ga0307406_102106462 | 77 |
| 216 | 3300031903 | Ga0307407_10047735 | Ga0307407_100477353 | 77 |
| 217 | 3300031911 | Ga0307412_10052502 | Ga0307412_100525023 | 77 |
| 218 | 3300031911 | Ga0307412_10473692 | Ga0307412_104736922 | 77 |
| 219 | 3300031911 | Ga0307412_10746622 | Ga0307412_107466222 | 77 |
| 220 | 3300031995 | Ga0307409_100051043 | Ga0307409_1000510432 | 77 |
| 221 | 3300031995 | Ga0307409_100074201 | Ga0307409_1000742011 | 77 |
| 222 | 3300031995 | Ga0307409_100561599 | Ga0307409_1005615992 | 77 |
| 223 | 3300032002 | Ga0307416_100005741 | Ga0307416_1000057417 | 77 |
| 224 | 3300032002 | Ga0307416_100096804 | Ga0307416_1000968043 | 77 |
| 225 | 3300032002 | Ga0307416_100831913 | Ga0307416_1008319132 | 77 |
| 226 | 3300032002 | Ga0307416_100969902 | Ga0307416_1009699022 | 77 |
| 227 | 3300032004 | Ga0307414_10166723 | Ga0307414_101667232 | 77 |
| 228 | 3300032005 | Ga0307411_10213576 | Ga0307411_102135763 | 77 |
| 229 | 3300032126 | Ga0307415_100660519 | Ga0307415_1006605192 | 77 |
| 230 | 3300032126 | Ga0307415_101301372 | Ga0307415_1013013721 | 77 |
| 231 | 3300037312 | Ga0395899_0013759 | Ga0395899_0013759_1104_1346 | 77 |
| 232 | 3300037312 | Ga0395899_0067109 | Ga0395899_0067109_279_521 | 77 |
| 233 | 3300037312 | Ga0395899_0529780 | Ga0395899_0529780_154_393 | 77 |
| 234 | 3300037418 | Ga0395900_0091257 | Ga0395900_0091257_307_549 | 77 |
| 235 | 3300037418 | Ga0395900_0200019 | Ga0395900_0200019_1709_1951 | 77 |
| 236 | 3300037418 | Ga0395900_0411098 | Ga0395900_0411098_61_300 | 77 |
| 237 | 3300037466 | Ga0395898_0072520 | Ga0395898_0072520_1510_1752 | 77 |
| 238 | 3300037466 | Ga0395898_0092734 | Ga0395898_0092734_2159_2398 | 77 |
| 239 | 3300037466 | Ga0395898_0108666 | Ga0395898_0108666_884_1126 | 77 |
| 240 | 3300037466 | Ga0395898_0337222 | Ga0395898_0337222_1031_1267 | 77 |
| 241 | 3300037471 | Ga0395905_0031387 | Ga0395905_0031387_4522_4764 | 77 |
| 242 | 3300037471 | Ga0395905_0599624 | Ga0395905_0599624_261_503 | 77 |
| 243 | 3300038443 | Ga0395901_0013278 | Ga0395901_0013278_6137_6379 | 77 |
| 244 | 3300041405 | Ga0439438_133792 | Ga0439438_133792_288_530 | 77 |
| 245 | 3300041406 | Ga0439439_0106883 | Ga0439439_0106883_22_264 | 77 |
| 246 | 3300041411 | Ga0439466_0033013 | Ga0439466_0033013_1415_1657 | 77 |
| 247 | 3300041411 | Ga0439466_0147002 | Ga0439466_0147002_435_671 | 77 |
| 248 | 3300041411 | Ga0439466_0216078 | Ga0439466_0216078_280_522 | 77 |
| 249 | 3300041443 | Ga0451789_0709166 | Ga0451789_0709166_1161_1397 | 77 |
| 250 | 3300041453 | Ga0451797_1555583 | Ga0451797_1555583_415_651 | 77 |
| 251 | 3300041456 | Ga0451795_0457816 | Ga0451795_0457816_864_1100 | 77 |
| 252 | 3300041458 | Ga0451798_0121441 | Ga0451798_0121441_158_394 | 77 |
| 253 | 3300041460 | Ga0451802_0203603 | Ga0451802_0203603_55_291 | 77 |
| 254 | 3300041463 | Ga0451804_0722354 | Ga0451804_0722354_264_503 | 77 |
| 255 | 3300041509 | Ga0451843_0196419 | Ga0451843_0196419_246_482 | 77 |
| 256 | 3300041997 | Ga0439431_0178422 | Ga0439431_0178422_96_338 | 77 |
| 257 | 3300041999 | Ga0439433_0064523 | Ga0439433_0064523_330_572 | 77 |
| 258 | 3300042000 | Ga0439437_002505 | Ga0439437_002505_745_987 | 77 |
| 259 | 3300042001 | Ga0439441_024830 | Ga0439441_024830_353_595 | 77 |
| 260 | 3300042002 | Ga0439442_132617 | Ga0439442_132617_90_332 | 77 |
| 261 | 3300042004 | Ga0439445_0012487 | Ga0439445_0012487_1302_1538 | 77 |
| 262 | 3300042005 | Ga0439448_0094457 | Ga0439448_0094457_219_461 | 77 |
| 263 | 3300042011 | Ga0439454_071712 | Ga0439454_071712_326_565 | 77 |
| 264 | 3300042015 | Ga0439462_0149285 | Ga0439462_0149285_117_359 | 77 |
| 265 | 3300042122 | Ga0450920_056275 | Ga0450920_056275_209_451 | 77 |
| 266 | 3300042142 | Ga0450905_018778 | Ga0450905_018778_251_493 | 77 |
| 267 | 3300042156 | Ga0439446_0004129 | Ga0439446_0004129_2284_2520 | 77 |
| 268 | 3300042435 | Ga0439434_0021832 | Ga0439434_0021832_796_1038 | 77 |
| 269 | 3300042435 | Ga0439434_0063821 | Ga0439434_0063821_113_349 | 77 |
| 270 | 3300042435 | Ga0439434_0084434 | Ga0439434_0084434_226_468 | 77 |
| 271 | 3300042437 | Ga0439444_0154187 | Ga0439444_0154187_105_341 | 77 |
| 272 | 3300042993 | Ga0439440_0150583 | Ga0439440_0150583_376_612 | 77 |
| 273 | 3300044658 | Ga0466972_0387279 | Ga0466972_0387279_248_490 | 77 |
| 274 | 3300044683 | Ga0466965_0231544 | Ga0466965_0231544_722_964 | 77 |
| 275 | 3300044684 | Ga0466966_0002463 | Ga0466966_0002463_11618_11854 | 77 |
| 276 | 3300044684 | Ga0466966_0025242 | Ga0466966_0025242_1357_1599 | 77 |
| 277 | 3300044684 | Ga0466966_0156545 | Ga0466966_0156545_539_775 | 77 |
| 278 | 3300044693 | Ga0466961_0004872 | Ga0466961_0004872_4261_4503 | 77 |
| 279 | 3300044693 | Ga0466961_0252431 | Ga0466961_0252431_743_979 | 77 |
| 280 | 3300044694 | Ga0466963_0030174 | Ga0466963_0030174_973_1209 | 77 |
| 281 | 3300044694 | Ga0466963_0705779 | Ga0466963_0705779_224_466 | 77 |
| 282 | 3300044694 | Ga0466963_0761393 | Ga0466963_0761393_317_553 | 77 |
| 283 | 3300044706 | Ga0466964_0045488 | Ga0466964_0045488_220_459 | 77 |
| 284 | 3300044719 | Ga0466971_0016832 | Ga0466971_0016832_1588_1830 | 77 |
| 285 | 3300044765 | Ga0466970_0032806 | Ga0466970_0032806_2364_2606 | 77 |
| 286 | 3300044842 | Ga0466957_0024144 | Ga0466957_0024144_2312_2554 | 77 |
| 287 | 3300044842 | Ga0466957_0130447 | Ga0466957_0130447_200_442 | 77 |
| 288 | 3300044842 | Ga0466957_0547279 | Ga0466957_0547279_234_470 | 77 |
| 289 | 3300044842 | Ga0466957_0900858 | Ga0466957_0900858_98_337 | 77 |
| 290 | 3300044842 | Ga0466957_0967688 | Ga0466957_0967688_164_406 | 77 |
| 291 | 3300044901 | Ga0466960_0085392 | Ga0466960_0085392_345_587 | 77 |
| 292 | 3300044901 | Ga0466960_0719853 | Ga0466960_0719853_236_472 | 77 |
| 293 | 3300045049 | Ga0466959_0003456 | Ga0466959_0003456_387_623 | 77 |
| 294 | 3300045049 | Ga0466959_0013757 | Ga0466959_0013757_4326_4568 | 77 |
| 295 | 3300045836 | Ga0466958_0028485 | Ga0466958_0028485_1637_1879 | 77 |
| 296 | 3300045836 | Ga0466958_0168633 | Ga0466958_0168633_150_386 | 77 |
| 297 | 3300045836 | Ga0466958_0722717 | Ga0466958_0722717_251_487 | 77 |
| 298 | 3300045836 | Ga0466958_0758186 | Ga0466958_0758186_310_552 | 77 |
| 299 | 3300045976 | Ga0466967_0030892 | Ga0466967_0030892_1624_1860 | 77 |
| 300 | 3300045976 | Ga0466967_0147364 | Ga0466967_0147364_1577_1816 | 77 |
| 301 | 3300045976 | Ga0466967_0289140 | Ga0466967_0289140_944_1180 | 77 |
| 302 | 3300045976 | Ga0466967_0330518 | Ga0466967_0330518_67_306 | 77 |
| 303 | 3300046457 | Ga0495590_0304996 | Ga0495590_0304996_129_374 | 77 |
| 304 | 3300046459 | Ga0495629_0745166 | Ga0495629_0745166_76_312 | 77 |
| 305 | 3300046461 | Ga0495641_0063952 | Ga0495641_0063952_713_949 | 77 |
| 306 | 3300046463 | Ga0495653_0132255 | Ga0495653_0132255_494_730 | 77 |
| 307 | 3300046472 | Ga0495580_1013490 | Ga0495580_1013490_209_451 | 77 |
| 308 | 3300046473 | Ga0495582_0353018 | Ga0495582_0353018_178_414 | 77 |
| 309 | 3300046514 | Ga0495618_0198279 | Ga0495618_0198279_257_493 | 77 |
| 310 | 3300046515 | Ga0495620_0394921 | Ga0495620_0394921_99_344 | 77 |
| 311 | 3300046522 | Ga0495643_0326367 | Ga0495643_0326367_211_456 | 77 |
| 312 | 3300046528 | Ga0495642_0139863 | Ga0495642_0139863_706_948 | 77 |
| 313 | 3300046533 | Ga0495640_0518006 | Ga0495640_0518006_13_252 | 77 |
| 314 | 3300046559 | Ga0495667_0410687 | Ga0495667_0410687_347_583 | 77 |
| 315 | 3300046616 | Ga0495668_0566984 | Ga0495668_0566984_202_444 | 77 |
| 316 | 3300046664 | Ga0495659_0019622 | Ga0495659_0019622_842_1087 | 77 |
| 317 | 3300046665 | Ga0495661_0441165 | Ga0495661_0441165_365_610 | 77 |
| 318 | 3300046689 | Ga0495613_0145718 | Ga0495613_0145718_593_829 | 77 |
| 319 | 3300046691 | Ga0495670_0799776 | Ga0495670_0799776_44_286 | 77 |
| 320 | 3300046809 | Ga0495600_0831823 | Ga0495600_0831823_254_490 | 77 |
| 321 | 3300047317 | Ga0495604_0184102 | Ga0495604_0184102_550_786 | 77 |
| 322 | 3300047319 | Ga0495674_0072947 | Ga0495674_0072947_174_410 | 77 |
| 323 | 3300047321 | Ga0495676_0176869 | Ga0495676_0176869_248_484 | 77 |
| 324 | 3300047322 | Ga0495680_0040238 | Ga0495680_0040238_3352_3588 | 77 |
| 325 | 3300047471 | Ga0495684_0160199 | Ga0495684_0160199_918_1154 | 77 |
| 326 | 3300047673 | Ga0495593_0266044 | Ga0495593_0266044_257_493 | 77 |
| 327 | 3300048903 | Ga0496100_0034176 | Ga0496100_0034176_95_337 | 77 |
| 328 | 3300048904 | Ga0496101_1038495 | Ga0496101_1038495_73_315 | 77 |
| 329 | 3300048904 | Ga0496101_1196780 | Ga0496101_1196780_106_342 | 77 |
| 330 | 3300048907 | Ga0496104_0100569 | Ga0496104_0100569_1109_1345 | 77 |
| 331 | 3300048908 | Ga0496105_0558823 | Ga0496105_0558823_392_628 | 77 |
| 332 | 3300048908 | Ga0496105_1363289 | Ga0496105_1363289_226_462 | 77 |
| 333 | 3300048909 | Ga0496106_0262438 | Ga0496106_0262438_679_921 | 77 |
| 334 | 3300048910 | Ga0496107_0019666 | Ga0496107_0019666_2675_2917 | 77 |
| 335 | 3300048911 | Ga0496108_0050702 | Ga0496108_0050702_1802_2038 | 77 |
| 336 | 3300048912 | Ga0496109_0239526 | Ga0496109_0239526_135_371 | 77 |
| 337 | 3300048913 | Ga0496110_0757735 | Ga0496110_0757735_568_807 | 77 |
| 338 | 3300048913 | Ga0496110_1050558 | Ga0496110_1050558_463_699 | 77 |
| 339 | 3300048914 | Ga0496111_0080744 | Ga0496111_0080744_206_442 | 77 |
| 340 | 3300048914 | Ga0496111_0393130 | Ga0496111_0393130_219_458 | 77 |
| 341 | 3300048915 | Ga0496112_0475528 | Ga0496112_0475528_107_349 | 77 |
| 342 | 3300048916 | Ga0496113_0293605 | Ga0496113_0293605_817_1053 | 77 |
| 343 | 3300049514 | Ga0501291_095998 | Ga0501291_095998_68_304 | 77 |
| 344 | 3300049568 | Ga0501031_0045747 | Ga0501031_0045747_1095_1346 | 77 |
| 345 | 3300049568 | Ga0501031_0410563 | Ga0501031_0410563_10_255 | 77 |
| 346 | 3300049568 | Ga0501031_0614072 | Ga0501031_0614072_353_589 | 77 |
| 347 | 3300049568 | Ga0501031_0626869 | Ga0501031_0626869_397_636 | 77 |
| 348 | 3300049568 | Ga0501031_0999247 | Ga0501031_0999247_63_305 | 77 |
| 349 | 3300049569 | Ga0501032_0010634 | Ga0501032_0010634_1546_1797 | 77 |
| 350 | 3300049569 | Ga0501032_0146246 | Ga0501032_0146246_84_323 | 77 |
| 351 | 3300049570 | Ga0501033_0008174 | Ga0501033_0008174_5794_6045 | 77 |
| 352 | 3300049570 | Ga0501033_0280187 | Ga0501033_0280187_912_1151 | 77 |
| 353 | 3300049570 | Ga0501033_0776939 | Ga0501033_0776939_361_612 | 77 |
| 354 | 3300049571 | Ga0501034_0023812 | Ga0501034_0023812_1036_1272 | 77 |
| 355 | 3300049571 | Ga0501034_0153643 | Ga0501034_0153643_1656_1907 | 77 |
| 356 | 3300049571 | Ga0501034_0492207 | Ga0501034_0492207_388_627 | 77 |
| 357 | 3300049572 | Ga0501036_0000085 | Ga0501036_0000085_26209_26460 | 77 |
| 358 | 3300049572 | Ga0501036_0007002 | Ga0501036_0007002_611_850 | 77 |
| 359 | 3300049572 | Ga0501036_0188353 | Ga0501036_0188353_168_419 | 77 |
| 360 | 3300049573 | Ga0501037_0019377 | Ga0501037_0019377_953_1204 | 77 |
| 361 | 3300049574 | Ga0501038_0010910 | Ga0501038_0010910_2061_2312 | 77 |
| 362 | 3300049574 | Ga0501038_0377347 | Ga0501038_0377347_65_304 | 77 |
| 363 | 3300049575 | Ga0501039_0004981 | Ga0501039_0004981_5792_6043 | 77 |
| 364 | 3300049575 | Ga0501039_0043970 | Ga0501039_0043970_270_509 | 77 |
| 365 | 3300049575 | Ga0501039_0302011 | Ga0501039_0302011_686_937 | 77 |
| 366 | 3300049575 | Ga0501039_0589518 | Ga0501039_0589518_240_479 | 77 |
| 367 | 3300049576 | Ga0501040_0001505 | Ga0501040_0001505_12479_12730 | 77 |
| 368 | 3300049576 | Ga0501040_0074578 | Ga0501040_0074578_1223_1474 | 77 |
| 369 | 3300049576 | Ga0501040_0694088 | Ga0501040_0694088_217_459 | 77 |
| 370 | 3300049577 | Ga0501041_0001056 | Ga0501041_0001056_13737_13976 | 77 |
| 371 | 3300049577 | Ga0501041_0025825 | Ga0501041_0025825_1899_2150 | 77 |
| 372 | 3300049577 | Ga0501041_0051414 | Ga0501041_0051414_765_1010 | 77 |
| 373 | 3300049577 | Ga0501041_0088670 | Ga0501041_0088670_289_540 | 77 |
| 374 | 3300049578 | Ga0501042_0000066 | Ga0501042_0000066_2324_2575 | 77 |
| 375 | 3300049578 | Ga0501042_0068462 | Ga0501042_0068462_1282_1533 | 77 |
| 376 | 3300049578 | Ga0501042_1188070 | Ga0501042_1188070_38_277 | 77 |
| 377 | 3300049579 | Ga0501043_0036393 | Ga0501043_0036393_1297_1548 | 77 |
| 378 | 3300049579 | Ga0501043_0493718 | Ga0501043_0493718_422_673 | 77 |
| 379 | 3300049579 | Ga0501043_0780884 | Ga0501043_0780884_67_306 | 77 |
| 380 | 3300049580 | Ga0501046_0000352 | Ga0501046_0000352_43638_43889 | 77 |
| 381 | 3300049580 | Ga0501046_0069698 | Ga0501046_0069698_1338_1589 | 77 |
| 382 | 3300049580 | Ga0501046_0197252 | Ga0501046_0197252_303_542 | 77 |
| 383 | 3300049580 | Ga0501046_0362881 | Ga0501046_0362881_598_837 | 77 |
| 384 | 3300049580 | Ga0501046_0782058 | Ga0501046_0782058_70_306 | 77 |
| 385 | 3300049581 | Ga0501047_0005241 | Ga0501047_0005241_2053_2304 | 77 |
| 386 | 3300049581 | Ga0501047_0132026 | Ga0501047_0132026_1566_1805 | 77 |
| 387 | 3300049581 | Ga0501047_0174943 | Ga0501047_0174943_609_848 | 77 |
| 388 | 3300049581 | Ga0501047_0586855 | Ga0501047_0586855_681_920 | 77 |
| 389 | 3300049581 | Ga0501047_0896741 | Ga0501047_0896741_189_425 | 77 |
| 390 | 3300049582 | Ga0501048_0000212 | Ga0501048_0000212_21163_21414 | 77 |
| 391 | 3300049582 | Ga0501048_0046714 | Ga0501048_0046714_747_986 | 77 |
| 392 | 3300049582 | Ga0501048_0588755 | Ga0501048_0588755_155_406 | 77 |
| 393 | 3300049583 | Ga0501067_0109212 | Ga0501067_0109212_147_383 | 77 |
| 394 | 3300049584 | Ga0501068_0003889 | Ga0501068_0003889_2053_2304 | 77 |
| 395 | 3300049584 | Ga0501068_0051610 | Ga0501068_0051610_710_949 | 77 |
| 396 | 3300049584 | Ga0501068_0079853 | Ga0501068_0079853_1598_1843 | 77 |
| 397 | 3300049585 | Ga0501069_0115402 | Ga0501069_0115402_453_692 | 77 |
| 398 | 3300049585 | Ga0501069_0224501 | Ga0501069_0224501_633_884 | 77 |
| 399 | 3300049586 | Ga0501070_0001060 | Ga0501070_0001060_6016_6267 | 77 |
| 400 | 3300049586 | Ga0501070_0054282 | Ga0501070_0054282_2015_2251 | 77 |
| 401 | 3300049586 | Ga0501070_0352174 | Ga0501070_0352174_894_1133 | 77 |
| 402 | 3300049586 | Ga0501070_1085914 | Ga0501070_1085914_190_429 | 77 |
| 403 | 3300049587 | Ga0501071_0001186 | Ga0501071_0001186_12539_12790 | 77 |
| 404 | 3300049587 | Ga0501071_0145985 | Ga0501071_0145985_1143_1382 | 77 |
| 405 | 3300049587 | Ga0501071_0361809 | Ga0501071_0361809_817_1056 | 77 |
| 406 | 3300049587 | Ga0501071_1214506 | Ga0501071_1214506_264_503 | 77 |
| 407 | 3300049587 | Ga0501071_1250911 | Ga0501071_1250911_295_546 | 77 |
| 408 | 3300049588 | Ga0501072_0000072 | Ga0501072_0000072_19462_19713 | 77 |
| 409 | 3300049588 | Ga0501072_0103016 | Ga0501072_0103016_946_1197 | 77 |
| 410 | 3300049588 | Ga0501072_0129073 | Ga0501072_0129073_1217_1456 | 77 |
| 411 | 3300049588 | Ga0501072_0227324 | Ga0501072_0227324_1217_1456 | 77 |
| 412 | 3300049588 | Ga0501072_0967637 | Ga0501072_0967637_82_327 | 77 |
| 413 | 3300049588 | Ga0501072_1317547 | Ga0501072_1317547_82_321 | 77 |
| 414 | 3300049589 | Ga0501073_0009735 | Ga0501073_0009735_5467_5718 | 77 |
| 415 | 3300049589 | Ga0501073_0019844 | Ga0501073_0019844_4009_4245 | 77 |
| 416 | 3300049589 | Ga0501073_0176670 | Ga0501073_0176670_680_919 | 77 |
| 417 | 3300049589 | Ga0501073_1225303 | Ga0501073_1225303_122_361 | 77 |
| 418 | 3300049589 | Ga0501073_1256677 | Ga0501073_1256677_228_467 | 77 |
| 419 | 3300049590 | Ga0501074_0001385 | Ga0501074_0001385_9888_10139 | 77 |
| 420 | 3300049590 | Ga0501074_0034829 | Ga0501074_0034829_2225_2464 | 77 |
| 421 | 3300049590 | Ga0501074_0054055 | Ga0501074_0054055_1875_2111 | 77 |
| 422 | 3300049590 | Ga0501074_0174411 | Ga0501074_0174411_373_624 | 77 |
| 423 | 3300049590 | Ga0501074_0781768 | Ga0501074_0781768_343_582 | 77 |
| 424 | 3300049591 | Ga0501075_0001193 | Ga0501075_0001193_15972_16223 | 77 |
| 425 | 3300049591 | Ga0501075_0043656 | Ga0501075_0043656_2326_2565 | 77 |
| 426 | 3300049591 | Ga0501075_0051117 | Ga0501075_0051117_2001_2246 | 77 |
| 427 | 3300049591 | Ga0501075_0185126 | Ga0501075_0185126_656_907 | 77 |
| 428 | 3300049591 | Ga0501075_0404003 | Ga0501075_0404003_150_389 | 77 |
| 429 | 3300049592 | Ga0501076_0000747 | Ga0501076_0000747_18715_18966 | 77 |
| 430 | 3300049592 | Ga0501076_0328083 | Ga0501076_0328083_836_1087 | 77 |
| 431 | 3300049592 | Ga0501076_0407296 | Ga0501076_0407296_852_1091 | 77 |
| 432 | 3300049592 | Ga0501076_0418977 | Ga0501076_0418977_731_976 | 77 |
| 433 | 3300049592 | Ga0501076_1318183 | Ga0501076_1318183_317_559 | 77 |
| 434 | 3300049593 | Ga0501077_0001950 | Ga0501077_0001950_6567_6818 | 77 |
| 435 | 3300049593 | Ga0501077_0058417 | Ga0501077_0058417_1308_1553 | 77 |
| 436 | 3300049741 | Ga0501079_0017707 | Ga0501079_0017707_5172_5423 | 77 |
| 437 | 3300049741 | Ga0501079_0088098 | Ga0501079_0088098_261_512 | 77 |
| 438 | 3300049741 | Ga0501079_0101460 | Ga0501079_0101460_1126_1365 | 77 |
| 439 | 3300049741 | Ga0501079_0928166 | Ga0501079_0928166_287_523 | 77 |
| 440 | 3300049742 | Ga0501080_0000230 | Ga0501080_0000230_6092_6343 | 77 |
| 441 | 3300049742 | Ga0501080_0002151 | Ga0501080_0002151_7752_7988 | 77 |
| 442 | 3300049742 | Ga0501080_0066622 | Ga0501080_0066622_624_863 | 77 |
| 443 | 3300049742 | Ga0501080_0720698 | Ga0501080_0720698_116_361 | 77 |
| 444 | 3300049742 | Ga0501080_1178714 | Ga0501080_1178714_237_476 | 77 |
| 445 | 3300049742 | Ga0501080_1558072 | Ga0501080_1558072_139_396 | 77 |
| 446 | 3300049743 | Ga0501081_0037280 | Ga0501081_0037280_1167_1418 | 77 |
| 447 | 3300049743 | Ga0501081_0154613 | Ga0501081_0154613_258_503 | 77 |
| 448 | 3300049743 | Ga0501081_0272018 | Ga0501081_0272018_853_1092 | 77 |
| 449 | 3300049743 | Ga0501081_0300960 | Ga0501081_0300960_811_1062 | 77 |
| 450 | 3300049743 | Ga0501081_1226111 | Ga0501081_1226111_135_374 | 77 |
| 451 | 3300049744 | Ga0501083_0006498 | Ga0501083_0006498_5987_6238 | 77 |
| 452 | 3300049744 | Ga0501083_0099265 | Ga0501083_0099265_96_335 | 77 |
| 453 | 3300049744 | Ga0501083_0112080 | Ga0501083_0112080_185_424 | 77 |
| 454 | 3300049744 | Ga0501083_0212927 | Ga0501083_0212927_10_267 | 77 |
| 455 | 3300049744 | Ga0501083_0535333 | Ga0501083_0535333_404_640 | 77 |
| 456 | 3300049822 | Ga0501035_0001838 | Ga0501035_0001838_5172_5423 | 77 |
| 457 | 3300049822 | Ga0501035_0074417 | Ga0501035_0074417_786_1025 | 77 |
| 458 | 3300049822 | Ga0501035_0825444 | Ga0501035_0825444_438_677 | 77 |
| 459 | 3300049823 | Ga0501044_0015207 | Ga0501044_0015207_5074_5325 | 77 |
| 460 | 3300049823 | Ga0501044_0223902 | Ga0501044_0223902_924_1163 | 77 |
| 461 | 3300049823 | Ga0501044_0608684 | Ga0501044_0608684_683_922 | 77 |
| 462 | 3300049823 | Ga0501044_1257546 | Ga0501044_1257546_219_458 | 77 |
| 463 | 3300049824 | Ga0501045_0000241 | Ga0501045_0000241_29505_29756 | 77 |
| 464 | 3300049824 | Ga0501045_0086387 | Ga0501045_0086387_631_870 | 77 |
| 465 | 3300049824 | Ga0501045_0251831 | Ga0501045_0251831_186_437 | 77 |
| 466 | 3300049824 | Ga0501045_0462285 | Ga0501045_0462285_381_626 | 77 |
| 467 | 3300049824 | Ga0501045_0573722 | Ga0501045_0573722_248_487 | 77 |
| 468 | 3300050507 | nmdc:mga05p37_102731_c1 | nmdc:mga05p37_102731_c1_1492_1731 | 77 |
| 469 | 3300050511 | nmdc:mga08y16_169317_c1 | nmdc:mga08y16_169317_c1_353_592 | 77 |
| 470 | 3300050511 | nmdc:mga08y16_521234_c1 | nmdc:mga08y16_521234_c1_147_383 | 77 |
| 471 | 3300050512 | nmdc:mga0n895_151250_c1 | nmdc:mga0n895_151250_c1_883_1122 | 77 |
| 472 | 3300050514 | nmdc:mga08x19_118756_c1 | nmdc:mga08x19_118756_c1_42_287 | 77 |
| 473 | 3300050514 | nmdc:mga08x19_25407_c1 | nmdc:mga08x19_25407_c1_573_818 | 77 |
| 474 | 3300050515 | nmdc:mga0a205_469750_c1 | nmdc:mga0a205_469750_c1_547_786 | 77 |
| 475 | 3300053084 | Ga0495595_0418333 | Ga0495595_0418333_299_535 | 77 |
| 476 | 3300054114 | Ga0501084_0002046 | Ga0501084_0002046_10080_10331 | 77 |
| 477 | 3300054114 | Ga0501084_0125949 | Ga0501084_0125949_1176_1427 | 77 |
| 478 | 3300054114 | Ga0501084_0128954 | Ga0501084_0128954_1040_1297 | 77 |
| 479 | 3300054114 | Ga0501084_1146381 | Ga0501084_1146381_316_555 | 77 |
| 480 | 3300054114 | Ga0501084_1550607 | Ga0501084_1550607_28_270 | 77 |
| 481 | 3300054114 | Ga0501084_1575978 | Ga0501084_1575978_53_298 | 77 |
| 482 | 3300060353 | Ga0501082_0000655 | Ga0501082_0000655_16583_16834 | 77 |
| 483 | 3300060353 | Ga0501082_0059769 | Ga0501082_0059769_351_590 | 77 |
| 484 | 3300060353 | Ga0501082_0072939 | Ga0501082_0072939_1166_1417 | 77 |
| 485 | 3300060353 | Ga0501082_0095281 | Ga0501082_0095281_788_1027 | 77 |
| 486 | 3300060353 | Ga0501082_0124794 | Ga0501082_0124794_176_421 | 77 |
| 487 | 3300060353 | Ga0501082_0163053 | Ga0501082_0163053_1148_1387 | 77 |
| 488 | 3300060353 | Ga0501082_0389852 | Ga0501082_0389852_845_1096 | 77 |
| 489 | 3300061719 | Ga0466962_0034503 | Ga0466962_0034503_633_875 | 77 |
| 490 | 3300061734 | Ga0530510_0001039 | Ga0530510_0001039_978_1217 | 77 |
| 491 | 3300061734 | Ga0530510_0005040 | Ga0530510_0005040_8845_9096 | 77 |
| 492 | 3300061734 | Ga0530510_0495782 | Ga0530510_0495782_180_425 | 77 |
| 493 | 3300061734 | Ga0530510_0755289 | Ga0530510_0755289_398_649 | 77 |
| 494 | 3300005327 | Ga0070658_10614307 | Ga0070658_106143071 | 78 |
| 495 | 3300005327 | Ga0070658_11744570 | Ga0070658_117445701 | 78 |
| 496 | 3300005339 | Ga0070660_100093399 | Ga0070660_1000933992 | 78 |
| 497 | 3300005344 | Ga0070661_100047829 | Ga0070661_1000478292 | 78 |
| 498 | 3300005354 | Ga0070675_102020010 | Ga0070675_1020200101 | 78 |
| 499 | 3300005365 | Ga0070688_100802816 | Ga0070688_1008028162 | 78 |
| 500 | 3300005434 | Ga0070709_10039764 | Ga0070709_100397642 | 78 |
| 501 | 3300005435 | Ga0070714_100170255 | Ga0070714_1001702552 | 78 |
| 502 | 3300005435 | Ga0070714_100244715 | Ga0070714_1002447152 | 78 |
| 503 | 3300005435 | Ga0070714_102209425 | Ga0070714_1022094252 | 78 |
| 504 | 3300005436 | Ga0070713_100074912 | Ga0070713_1000749123 | 78 |
| 505 | 3300005440 | Ga0070705_100451126 | Ga0070705_1004511262 | 78 |
| 506 | 3300005445 | Ga0070708_100498547 | Ga0070708_1004985472 | 78 |
| 507 | 3300005445 | Ga0070708_102069855 | Ga0070708_1020698552 | 78 |
| 508 | 3300005458 | Ga0070681_10165540 | Ga0070681_101655403 | 78 |
| 509 | 3300005467 | Ga0070706_100015559 | Ga0070706_1000155597 | 78 |
| 510 | 3300005467 | Ga0070706_102152813 | Ga0070706_1021528131 | 78 |
| 511 | 3300005468 | Ga0070707_100044898 | Ga0070707_1000448984 | 78 |
| 512 | 3300005468 | Ga0070707_100303348 | Ga0070707_1003033482 | 78 |
| 513 | 3300005471 | Ga0070698_100018972 | Ga0070698_1000189727 | 78 |
| 514 | 3300005471 | Ga0070698_100408244 | Ga0070698_1004082442 | 78 |
| 515 | 3300005530 | Ga0070679_101933021 | Ga0070679_1019330212 | 78 |
| 516 | 3300005535 | Ga0070684_100748583 | Ga0070684_1007485832 | 78 |
| 517 | 3300005543 | Ga0070672_100636892 | Ga0070672_1006368923 | 78 |
| 518 | 3300005549 | Ga0070704_100822497 | Ga0070704_1008224972 | 78 |
| 519 | 3300005563 | Ga0068855_100011027 | Ga0068855_10001102712 | 78 |
| 520 | 3300005563 | Ga0068855_100555042 | Ga0068855_1005550423 | 78 |
| 521 | 3300005617 | Ga0068859_102539849 | Ga0068859_1025398492 | 78 |
| 522 | 3300005618 | Ga0068864_102693449 | Ga0068864_1026934492 | 78 |
| 523 | 3300005718 | Ga0068866_10085005 | Ga0068866_100850052 | 78 |
| 524 | 3300005718 | Ga0068866_10541917 | Ga0068866_105419172 | 78 |
| 525 | 3300005983 | Ga0081540_1020045 | Ga0081540_10200453 | 78 |
| 526 | 3300006058 | Ga0075432_10003333 | Ga0075432_100033333 | 78 |
| 527 | 3300006173 | Ga0070716_100005593 | Ga0070716_1000055931 | 78 |
| 528 | 3300006846 | Ga0075430_100295480 | Ga0075430_1002954802 | 78 |
| 529 | 3300006847 | Ga0075431_100017960 | Ga0075431_1000179604 | 78 |
| 530 | 3300006852 | Ga0075433_10207809 | Ga0075433_102078092 | 78 |
| 531 | 3300006871 | Ga0075434_100306958 | Ga0075434_1003069582 | 78 |
| 532 | 3300006914 | Ga0075436_100189612 | Ga0075436_1001896123 | 78 |
| 533 | 3300006931 | Ga0097620_102539617 | Ga0097620_1025396172 | 78 |
| 534 | 3300007076 | Ga0075435_100081737 | Ga0075435_1000817373 | 78 |
| 535 | 3300009093 | Ga0105240_10074063 | Ga0105240_100740632 | 78 |
| 536 | 3300009093 | Ga0105240_10249863 | Ga0105240_102498633 | 78 |
| 537 | 3300009094 | Ga0111539_10029168 | Ga0111539_100291682 | 78 |
| 538 | 3300009098 | Ga0105245_11014900 | Ga0105245_110149002 | 78 |
| 539 | 3300009147 | Ga0114129_10010685 | Ga0114129_100106853 | 78 |
| 540 | 3300009147 | Ga0114129_10300825 | Ga0114129_103008252 | 78 |
| 541 | 3300009147 | Ga0114129_11343826 | Ga0114129_113438261 | 78 |
| 542 | 3300009147 | Ga0114129_11650982 | Ga0114129_116509822 | 78 |
| 543 | 3300009148 | Ga0105243_10109220 | Ga0105243_101092202 | 78 |
| 544 | 3300009176 | Ga0105242_10256909 | Ga0105242_102569092 | 78 |
| 545 | 3300009551 | Ga0105238_10905788 | Ga0105238_109057882 | 78 |
| 546 | 3300013100 | Ga0157373_10168724 | Ga0157373_101687242 | 78 |
| 547 | 3300013100 | Ga0157373_10555221 | Ga0157373_105552211 | 78 |
| 548 | 3300013104 | Ga0157370_10016815 | Ga0157370_100168152 | 78 |
| 549 | 3300013104 | Ga0157370_10188791 | Ga0157370_101887913 | 78 |
| 550 | 3300013105 | Ga0157369_10013355 | Ga0157369_100133558 | 78 |
| 551 | 3300013105 | Ga0157369_10034851 | Ga0157369_100348516 | 78 |
| 552 | 3300013105 | Ga0157369_11158706 | Ga0157369_111587061 | 78 |
| 553 | 3300013105 | Ga0157369_12304987 | Ga0157369_123049872 | 78 |
| 554 | 3300013296 | Ga0157374_10853487 | Ga0157374_108534872 | 78 |
| 555 | 3300013306 | Ga0163162_11526124 | Ga0163162_115261242 | 78 |
| 556 | 3300013307 | Ga0157372_10346817 | Ga0157372_103468173 | 78 |
| 557 | 3300014326 | Ga0157380_10138713 | Ga0157380_101387131 | 78 |
| 558 | 3300014326 | Ga0157380_11450248 | Ga0157380_114502482 | 78 |
| 559 | 3300014497 | Ga0182008_10526974 | Ga0182008_105269741 | 78 |
| 560 | 3300020069 | Ga0197907_11288220 | Ga0197907_112882201 | 78 |
| 561 | 3300020070 | Ga0206356_10266925 | Ga0206356_102669251 | 78 |
| 562 | 3300020081 | Ga0206354_10616934 | Ga0206354_106169342 | 78 |
| 563 | 3300020082 | Ga0206353_12063416 | Ga0206353_120634166 | 78 |
| 564 | 3300025899 | Ga0207642_10060998 | Ga0207642_100609983 | 78 |
| 565 | 3300025906 | Ga0207699_10006671 | Ga0207699_100066715 | 78 |
| 566 | 3300025909 | Ga0207705_10395051 | Ga0207705_103950512 | 78 |
| 567 | 3300025910 | Ga0207684_10014015 | Ga0207684_100140154 | 78 |
| 568 | 3300025910 | Ga0207684_10162330 | Ga0207684_101623302 | 78 |
| 569 | 3300025912 | Ga0207707_10241036 | Ga0207707_102410362 | 78 |
| 570 | 3300025913 | Ga0207695_10183352 | Ga0207695_101833523 | 78 |
| 571 | 3300025913 | Ga0207695_10602607 | Ga0207695_106026071 | 78 |
| 572 | 3300025917 | Ga0207660_10400285 | Ga0207660_104002852 | 78 |
| 573 | 3300025919 | Ga0207657_10007923 | Ga0207657_1000792310 | 78 |
| 574 | 3300025919 | Ga0207657_10604150 | Ga0207657_106041502 | 78 |
| 575 | 3300025920 | Ga0207649_10129969 | Ga0207649_101299693 | 78 |
| 576 | 3300025921 | Ga0207652_10730075 | Ga0207652_107300751 | 78 |
| 577 | 3300025922 | Ga0207646_10040494 | Ga0207646_100404944 | 78 |
| 578 | 3300025922 | Ga0207646_10133107 | Ga0207646_101331072 | 78 |
| 579 | 3300025926 | Ga0207659_11499064 | Ga0207659_114990641 | 78 |
| 580 | 3300025928 | Ga0207700_10000002 | Ga0207700_10000002178 | 78 |
| 581 | 3300025928 | Ga0207700_10314490 | Ga0207700_103144902 | 78 |
| 582 | 3300025929 | Ga0207664_10066261 | Ga0207664_100662613 | 78 |
| 583 | 3300025931 | Ga0207644_11204391 | Ga0207644_112043912 | 78 |
| 584 | 3300025937 | Ga0207669_10029778 | Ga0207669_100297783 | 78 |
| 585 | 3300025939 | Ga0207665_10017834 | Ga0207665_100178343 | 78 |
| 586 | 3300025941 | Ga0207711_10122098 | Ga0207711_101220981 | 78 |
| 587 | 3300025944 | Ga0207661_10957077 | Ga0207661_109570772 | 78 |
| 588 | 3300025949 | Ga0207667_10033234 | Ga0207667_100332345 | 78 |
| 589 | 3300025949 | Ga0207667_10820678 | Ga0207667_108206782 | 78 |
| 590 | 3300026075 | Ga0207708_10489346 | Ga0207708_104893462 | 78 |
| 591 | 3300026089 | Ga0207648_10014284 | Ga0207648_100142845 | 78 |
| 592 | 3300026095 | Ga0207676_12377267 | Ga0207676_123772671 | 78 |
| 593 | 3300027360 | Ga0209969_1029806 | Ga0209969_10298062 | 78 |
| 594 | 3300027907 | Ga0207428_10257999 | Ga0207428_102579992 | 78 |
| 595 | 3300028558 | Ga0265326_10078009 | Ga0265326_100780092 | 78 |
| 596 | 3300028573 | Ga0265334_10006234 | Ga0265334_100062342 | 78 |
| 597 | 3300028800 | Ga0265338_10004690 | Ga0265338_1000469010 | 78 |
| 598 | 3300031595 | Ga0265313_10007335 | Ga0265313_100073355 | 78 |
| 599 | 3300031903 | Ga0307407_10554554 | Ga0307407_105545542 | 78 |
| 600 | 3300031995 | Ga0307409_100379052 | Ga0307409_1003790522 | 78 |
| 601 | 3300032133 | Ga0316583_10006849 | Ga0316583_100068494 | 78 |
| 602 | 3300037312 | Ga0395899_0104560 | Ga0395899_0104560_500_739 | 78 |
| 603 | 3300037312 | Ga0395899_0120065 | Ga0395899_0120065_771_1010 | 78 |
| 604 | 3300037312 | Ga0395899_0505236 | Ga0395899_0505236_93_332 | 78 |
| 605 | 3300037312 | Ga0395899_0608879 | Ga0395899_0608879_326_571 | 78 |
| 606 | 3300037418 | Ga0395900_0031901 | Ga0395900_0031901_3145_3390 | 78 |
| 607 | 3300037418 | Ga0395900_0035226 | Ga0395900_0035226_288_530 | 78 |
| 608 | 3300037418 | Ga0395900_0061491 | Ga0395900_0061491_2673_2912 | 78 |
| 609 | 3300037418 | Ga0395900_0071011 | Ga0395900_0071011_1238_1477 | 78 |
| 610 | 3300037418 | Ga0395900_0235831 | Ga0395900_0235831_260_502 | 78 |
| 611 | 3300037418 | Ga0395900_0330563 | Ga0395900_0330563_464_703 | 78 |
| 612 | 3300037466 | Ga0395898_0033463 | Ga0395898_0033463_4512_4754 | 78 |
| 613 | 3300037466 | Ga0395898_0171181 | Ga0395898_0171181_1477_1716 | 78 |
| 614 | 3300037466 | Ga0395898_0262237 | Ga0395898_0262237_1294_1533 | 78 |
| 615 | 3300037466 | Ga0395898_1832231 | Ga0395898_1832231_221_463 | 78 |
| 616 | 3300037471 | Ga0395905_0059154 | Ga0395905_0059154_1948_2187 | 78 |
| 617 | 3300037471 | Ga0395905_0063925 | Ga0395905_0063925_2735_2977 | 78 |
| 618 | 3300037471 | Ga0395905_0161855 | Ga0395905_0161855_45_284 | 78 |
| 619 | 3300037471 | Ga0395905_0590126 | Ga0395905_0590126_209_448 | 78 |
| 620 | 3300037471 | Ga0395905_1013546 | Ga0395905_1013546_168_413 | 78 |
| 621 | 3300038443 | Ga0395901_0000559 | Ga0395901_0000559_14376_14618 | 78 |
| 622 | 3300038443 | Ga0395901_0155561 | Ga0395901_0155561_452_691 | 78 |
| 623 | 3300038443 | Ga0395901_0187193 | Ga0395901_0187193_440_679 | 78 |
| 624 | 3300038443 | Ga0395901_0356132 | Ga0395901_0356132_42_281 | 78 |
| 625 | 3300038443 | Ga0395901_0433892 | Ga0395901_0433892_490_732 | 78 |
| 626 | 3300038443 | Ga0395901_0845163 | Ga0395901_0845163_330_569 | 78 |
| 627 | 3300038443 | Ga0395901_0972719 | Ga0395901_0972719_73_318 | 78 |
| 628 | 3300038443 | Ga0395901_1652691 | Ga0395901_1652691_243_482 | 78 |
| 629 | 3300038996 | Ga0242420_008529 | Ga0242420_008529_715_957 | 78 |
| 630 | 3300041512 | Ga0451853_0232164 | Ga0451853_0232164_139_378 | 78 |
| 631 | 3300042147 | Ga0450910_107162 | Ga0450910_107162_208_444 | 78 |
| 632 | 3300042184 | Ga0450908_043230 | Ga0450908_043230_417_653 | 78 |
| 633 | 3300042531 | Ga0450918_041180 | Ga0450918_041180_346_582 | 78 |
| 634 | 3300044706 | Ga0466964_0041351 | Ga0466964_0041351_1605_1850 | 78 |
| 635 | 3300044901 | Ga0466960_0025394 | Ga0466960_0025394_1283_1525 | 78 |
| 636 | 3300044901 | Ga0466960_0210141 | Ga0466960_0210141_108_383 | 78 |
| 637 | 3300044901 | Ga0466960_0396360 | Ga0466960_0396360_269_511 | 78 |
| 638 | 3300045051 | Ga0451576_0709492 | Ga0451576_0709492_799_1038 | 78 |
| 639 | 3300045976 | Ga0466967_0014102 | Ga0466967_0014102_4493_4738 | 78 |
| 640 | 3300045976 | Ga0466967_2046165 | Ga0466967_2046165_49_288 | 78 |
| 641 | 3300046454 | Ga0495592_0543811 | Ga0495592_0543811_211_471 | 78 |
| 642 | 3300046473 | Ga0495582_0624079 | Ga0495582_0624079_18_257 | 78 |
| 643 | 3300046474 | Ga0495605_0187501 | Ga0495605_0187501_368_607 | 78 |
| 644 | 3300046492 | Ga0495585_0182029 | Ga0495585_0182029_576_815 | 78 |
| 645 | 3300046511 | Ga0495608_0305205 | Ga0495608_0305205_425_685 | 78 |
| 646 | 3300046511 | Ga0495608_0753654 | Ga0495608_0753654_241_501 | 78 |
| 647 | 3300046529 | Ga0495652_0158819 | Ga0495652_0158819_169_429 | 78 |
| 648 | 3300046535 | Ga0495586_0829978 | Ga0495586_0829978_144_422 | 78 |
| 649 | 3300046642 | Ga0495634_0341336 | Ga0495634_0341336_358_603 | 78 |
| 650 | 3300046642 | Ga0495634_0803522 | Ga0495634_0803522_215_475 | 78 |
| 651 | 3300046663 | Ga0495635_0936705 | Ga0495635_0936705_121_381 | 78 |
| 652 | 3300046664 | Ga0495659_0033709 | Ga0495659_0033709_616_855 | 78 |
| 653 | 3300046675 | Ga0495657_0313282 | Ga0495657_0313282_600_845 | 78 |
| 654 | 3300046691 | Ga0495670_0323841 | Ga0495670_0323841_518_757 | 78 |
| 655 | 3300046794 | Ga0495589_0574270 | Ga0495589_0574270_84_323 | 78 |
| 656 | 3300047315 | Ga0495581_0894386 | Ga0495581_0894386_11_256 | 78 |
| 657 | 3300047319 | Ga0495674_0904912 | Ga0495674_0904912_386_646 | 78 |
| 658 | 3300047322 | Ga0495680_0098661 | Ga0495680_0098661_758_1018 | 78 |
| 659 | 3300047322 | Ga0495680_0261907 | Ga0495680_0261907_836_1081 | 78 |
| 660 | 3300047444 | Ga0495675_0500230 | Ga0495675_0500230_405_665 | 78 |
| 661 | 3300047471 | Ga0495684_0436169 | Ga0495684_0436169_549_809 | 78 |
| 662 | 3300048907 | Ga0496104_0322637 | Ga0496104_0322637_457_699 | 78 |
| 663 | 3300048907 | Ga0496104_0472891 | Ga0496104_0472891_264_503 | 78 |
| 664 | 3300048907 | Ga0496104_1103663 | Ga0496104_1103663_228_473 | 78 |
| 665 | 3300048908 | Ga0496105_0056696 | Ga0496105_0056696_1061_1303 | 78 |
| 666 | 3300048908 | Ga0496105_0940145 | Ga0496105_0940145_266_505 | 78 |
| 667 | 3300048912 | Ga0496109_0457059 | Ga0496109_0457059_798_1037 | 78 |
| 668 | 3300048913 | Ga0496110_0010426 | Ga0496110_0010426_945_1187 | 78 |
| 669 | 3300048914 | Ga0496111_0295270 | Ga0496111_0295270_311_553 | 78 |
| 670 | 3300048914 | Ga0496111_0808039 | Ga0496111_0808039_24_263 | 78 |
| 671 | 3300048915 | Ga0496112_0896769 | Ga0496112_0896769_102_341 | 78 |
| 672 | 3300048916 | Ga0496113_0268797 | Ga0496113_0268797_491_733 | 78 |
| 673 | 3300048917 | Ga0496114_0681115 | Ga0496114_0681115_433_678 | 78 |
| 674 | 3300049574 | Ga0501038_0634694 | Ga0501038_0634694_559_795 | 78 |
| 675 | 3300049583 | Ga0501067_0134175 | Ga0501067_0134175_1101_1343 | 78 |
| 676 | 3300049741 | Ga0501079_0233928 | Ga0501079_0233928_223_465 | 78 |
| 677 | 3300050507 | nmdc:mga05p37_2114966_c1 | nmdc:mga05p37_2114966_c1_258_497 | 78 |
| 678 | 3300050507 | nmdc:mga05p37_239326_c1 | nmdc:mga05p37_239326_c1_98_340 | 78 |
| 679 | 3300050507 | nmdc:mga05p37_582639_c1 | nmdc:mga05p37_582639_c1_370_609 | 78 |
| 680 | 3300050508 | nmdc:mga09592_1116897_c1 | nmdc:mga09592_1116897_c1_79_324 | 78 |
| 681 | 3300050509 | nmdc:mga0qj67_219018_c1 | nmdc:mga0qj67_219018_c1_274_519 | 78 |
| 682 | 3300050512 | nmdc:mga0n895_362128_c1 | nmdc:mga0n895_362128_c1_747_986 | 78 |
| 683 | 3300050513 | nmdc:mga0rr50_41125_c1 | nmdc:mga0rr50_41125_c1_2250_2492 | 78 |
| 684 | 3300050515 | nmdc:mga0a205_40860_c1 | nmdc:mga0a205_40860_c1_2248_2490 | 78 |
| 685 | 3300053077 | Ga0495601_0286832 | Ga0495601_0286832_486_746 | 78 |
| 686 | 3300054114 | Ga0501084_0423210 | Ga0501084_0423210_302_544 | 78 |
| 687 | 3300060353 | Ga0501082_1711305 | Ga0501082_1711305_101_337 | 78 |
| 688 | 3300061734 | Ga0530510_0160641 | Ga0530510_0160641_661_903 | 78 |
| 689 | 3300000043 | ARcpr5yngRDRAFT_c002016 | ARcpr5yngRDRAFT_0020163 | 79 |
| 690 | 3300000044 | ARSoilOldRDRAFT_c002131 | ARSoilOldRDRAFT_0021313 | 79 |
| 691 | 3300000652 | ARCol0yngRDRAFT_1001263 | ARCol0yngRDRAFT_10012633 | 79 |
| 692 | 3300001991 | JGI24743J22301_10050931 | JGI24743J22301_100509312 | 79 |
| 693 | 3300002075 | JGI24738J21930_10079082 | JGI24738J21930_100790822 | 79 |
| 694 | 3300002155 | JGI24033J26618_1015690 | JGI24033J26618_10156903 | 79 |
| 695 | 3300002239 | JGI24034J26672_10019729 | JGI24034J26672_100197292 | 79 |
| 696 | 3300005328 | Ga0070676_11136035 | Ga0070676_111360351 | 79 |
| 697 | 3300005329 | Ga0070683_100078296 | Ga0070683_1000782963 | 79 |
| 698 | 3300005329 | Ga0070683_100199752 | Ga0070683_1001997523 | 79 |
| 699 | 3300005329 | Ga0070683_100214838 | Ga0070683_1002148383 | 79 |
| 700 | 3300005330 | Ga0070690_100014597 | Ga0070690_1000145974 | 79 |
| 701 | 3300005331 | Ga0070670_100075128 | Ga0070670_1000751282 | 79 |
| 702 | 3300005331 | Ga0070670_101431423 | Ga0070670_1014314232 | 79 |
| 703 | 3300005333 | Ga0070677_10245514 | Ga0070677_102455141 | 79 |
| 704 | 3300005334 | Ga0068869_101950629 | Ga0068869_1019506291 | 79 |
| 705 | 3300005336 | Ga0070680_100731041 | Ga0070680_1007310412 | 79 |
| 706 | 3300005336 | Ga0070680_101431146 | Ga0070680_1014311461 | 79 |
| 707 | 3300005338 | Ga0068868_100111612 | Ga0068868_1001116122 | 79 |
| 708 | 3300005338 | Ga0068868_101339369 | Ga0068868_1013393691 | 79 |
| 709 | 3300005339 | Ga0070660_100485581 | Ga0070660_1004855812 | 79 |
| 710 | 3300005339 | Ga0070660_101205756 | Ga0070660_1012057561 | 79 |
| 711 | 3300005343 | Ga0070687_100018472 | Ga0070687_1000184722 | 79 |
| 712 | 3300005344 | Ga0070661_100355842 | Ga0070661_1003558422 | 79 |
| 713 | 3300005344 | Ga0070661_100481914 | Ga0070661_1004819142 | 79 |
| 714 | 3300005345 | Ga0070692_10213118 | Ga0070692_102131182 | 79 |
| 715 | 3300005347 | Ga0070668_100069398 | Ga0070668_1000693982 | 79 |
| 716 | 3300005353 | Ga0070669_101170514 | Ga0070669_1011705141 | 79 |
| 717 | 3300005354 | Ga0070675_100258983 | Ga0070675_1002589833 | 79 |
| 718 | 3300005354 | Ga0070675_101279942 | Ga0070675_1012799421 | 79 |
| 719 | 3300005355 | Ga0070671_100065484 | Ga0070671_1000654843 | 79 |
| 720 | 3300005356 | Ga0070674_101962604 | Ga0070674_1019626041 | 79 |
| 721 | 3300005364 | Ga0070673_100067521 | Ga0070673_1000675212 | 79 |
| 722 | 3300005365 | Ga0070688_100014456 | Ga0070688_1000144564 | 79 |
| 723 | 3300005366 | Ga0070659_100079337 | Ga0070659_1000793372 | 79 |
| 724 | 3300005366 | Ga0070659_101022946 | Ga0070659_1010229461 | 79 |
| 725 | 3300005440 | Ga0070705_100022413 | Ga0070705_1000224133 | 79 |
| 726 | 3300005441 | Ga0070700_100011804 | Ga0070700_1000118043 | 79 |
| 727 | 3300005441 | Ga0070700_100112131 | Ga0070700_1001121313 | 79 |
| 728 | 3300005444 | Ga0070694_100174271 | Ga0070694_1001742712 | 79 |
| 729 | 3300005444 | Ga0070694_100517280 | Ga0070694_1005172802 | 79 |
| 730 | 3300005445 | Ga0070708_100400602 | Ga0070708_1004006022 | 79 |
| 731 | 3300005455 | Ga0070663_100028830 | Ga0070663_1000288304 | 79 |
| 732 | 3300005456 | Ga0070678_100059862 | Ga0070678_1000598624 | 79 |
| 733 | 3300005457 | Ga0070662_100457237 | Ga0070662_1004572372 | 79 |
| 734 | 3300005457 | Ga0070662_100785549 | Ga0070662_1007855491 | 79 |
| 735 | 3300005458 | Ga0070681_10219919 | Ga0070681_102199193 | 79 |
| 736 | 3300005459 | Ga0068867_100383897 | Ga0068867_1003838972 | 79 |
| 737 | 3300005459 | Ga0068867_100431371 | Ga0068867_1004313712 | 79 |
| 738 | 3300005466 | Ga0070685_10012794 | Ga0070685_100127942 | 79 |
| 739 | 3300005466 | Ga0070685_10173038 | Ga0070685_101730382 | 79 |
| 740 | 3300005468 | Ga0070707_101345175 | Ga0070707_1013451751 | 79 |
| 741 | 3300005518 | Ga0070699_100310349 | Ga0070699_1003103492 | 79 |
| 742 | 3300005530 | Ga0070679_100101819 | Ga0070679_1001018193 | 79 |
| 743 | 3300005530 | Ga0070679_100563865 | Ga0070679_1005638651 | 79 |
| 744 | 3300005530 | Ga0070679_101297729 | Ga0070679_1012977292 | 79 |
| 745 | 3300005535 | Ga0070684_100179321 | Ga0070684_1001793212 | 79 |
| 746 | 3300005535 | Ga0070684_100208099 | Ga0070684_1002080992 | 79 |
| 747 | 3300005535 | Ga0070684_100511568 | Ga0070684_1005115683 | 79 |
| 748 | 3300005539 | Ga0068853_100076074 | Ga0068853_1000760743 | 79 |
| 749 | 3300005539 | Ga0068853_100173046 | Ga0068853_1001730462 | 79 |
| 750 | 3300005544 | Ga0070686_101270481 | Ga0070686_1012704812 | 79 |
| 751 | 3300005545 | Ga0070695_101490806 | Ga0070695_1014908061 | 79 |
| 752 | 3300005546 | Ga0070696_100074531 | Ga0070696_1000745313 | 79 |
| 753 | 3300005547 | Ga0070693_100025208 | Ga0070693_1000252083 | 79 |
| 754 | 3300005547 | Ga0070693_100507183 | Ga0070693_1005071832 | 79 |
| 755 | 3300005548 | Ga0070665_100147157 | Ga0070665_1001471573 | 79 |
| 756 | 3300005549 | Ga0070704_101617351 | Ga0070704_1016173511 | 79 |
| 757 | 3300005563 | Ga0068855_100131866 | Ga0068855_1001318663 | 79 |
| 758 | 3300005563 | Ga0068855_100461503 | Ga0068855_1004615032 | 79 |
| 759 | 3300005564 | Ga0070664_100185643 | Ga0070664_1001856433 | 79 |
| 760 | 3300005614 | Ga0068856_100392351 | Ga0068856_1003923513 | 79 |
| 761 | 3300005615 | Ga0070702_100019489 | Ga0070702_1000194893 | 79 |
| 762 | 3300005616 | Ga0068852_100117640 | Ga0068852_1001176401 | 79 |
| 763 | 3300005616 | Ga0068852_100666153 | Ga0068852_1006661531 | 79 |
| 764 | 3300005617 | Ga0068859_100137330 | Ga0068859_1001373304 | 79 |
| 765 | 3300005618 | Ga0068864_100011578 | Ga0068864_1000115784 | 79 |
| 766 | 3300005718 | Ga0068866_10421434 | Ga0068866_104214342 | 79 |
| 767 | 3300005840 | Ga0068870_10750587 | Ga0068870_107505871 | 79 |
| 768 | 3300005841 | Ga0068863_100094804 | Ga0068863_1000948043 | 79 |
| 769 | 3300005842 | Ga0068858_100016953 | Ga0068858_1000169532 | 79 |
| 770 | 3300005843 | Ga0068860_100064788 | Ga0068860_1000647883 | 79 |
| 771 | 3300005844 | Ga0068862_100646861 | Ga0068862_1006468612 | 79 |
| 772 | 3300005937 | Ga0081455_10021147 | Ga0081455_100211476 | 79 |
| 773 | 3300005937 | Ga0081455_10171242 | Ga0081455_101712422 | 79 |
| 774 | 3300006038 | Ga0075365_10090351 | Ga0075365_100903512 | 79 |
| 775 | 3300006048 | Ga0075363_100069183 | Ga0075363_1000691832 | 79 |
| 776 | 3300006051 | Ga0075364_10005351 | Ga0075364_100053513 | 79 |
| 777 | 3300006051 | Ga0075364_10912306 | Ga0075364_109123062 | 79 |
| 778 | 3300006058 | Ga0075432_10005420 | Ga0075432_100054203 | 79 |
| 779 | 3300006178 | Ga0075367_10250342 | Ga0075367_102503422 | 79 |
| 780 | 3300006237 | Ga0097621_101200189 | Ga0097621_1012001891 | 79 |
| 781 | 3300006358 | Ga0068871_100148046 | Ga0068871_1001480462 | 79 |
| 782 | 3300006844 | Ga0075428_100043048 | Ga0075428_1000430483 | 79 |
| 783 | 3300006847 | Ga0075431_101415373 | Ga0075431_1014153731 | 79 |
| 784 | 3300006852 | Ga0075433_10138916 | Ga0075433_101389163 | 79 |
| 785 | 3300006871 | Ga0075434_101142089 | Ga0075434_1011420892 | 79 |
| 786 | 3300006880 | Ga0075429_100021894 | Ga0075429_1000218942 | 79 |
| 787 | 3300006881 | Ga0068865_100008633 | Ga0068865_1000086332 | 79 |
| 788 | 3300006931 | Ga0097620_100137334 | Ga0097620_1001373342 | 79 |
| 789 | 3300009094 | Ga0111539_10005505 | Ga0111539_100055054 | 79 |
| 790 | 3300009094 | Ga0111539_10084728 | Ga0111539_100847283 | 79 |
| 791 | 3300009094 | Ga0111539_10898168 | Ga0111539_108981682 | 79 |
| 792 | 3300009098 | Ga0105245_10065417 | Ga0105245_100654173 | 79 |
| 793 | 3300009098 | Ga0105245_10160761 | Ga0105245_101607612 | 79 |
| 794 | 3300009101 | Ga0105247_10122066 | Ga0105247_101220662 | 79 |
| 795 | 3300009147 | Ga0114129_10001826 | Ga0114129_100018267 | 79 |
| 796 | 3300009147 | Ga0114129_10251295 | Ga0114129_102512953 | 79 |
| 797 | 3300009148 | Ga0105243_10016148 | Ga0105243_100161485 | 79 |
| 798 | 3300009148 | Ga0105243_11295421 | Ga0105243_112954212 | 79 |
| 799 | 3300009176 | Ga0105242_10040403 | Ga0105242_100404033 | 79 |
| 800 | 3300009177 | Ga0105248_10004837 | Ga0105248_1000483716 | 79 |
| 801 | 3300009551 | Ga0105238_10674642 | Ga0105238_106746421 | 79 |
| 802 | 3300009553 | Ga0105249_13133459 | Ga0105249_131334591 | 79 |
| 803 | 3300011119 | Ga0105246_10166285 | Ga0105246_101662852 | 79 |
| 804 | 3300011119 | Ga0105246_11609011 | Ga0105246_116090112 | 79 |
| 805 | 3300011119 | Ga0105246_11703352 | Ga0105246_117033522 | 79 |
| 806 | 3300013100 | Ga0157373_10575672 | Ga0157373_105756722 | 79 |
| 807 | 3300013102 | Ga0157371_10719774 | Ga0157371_107197742 | 79 |
| 808 | 3300013296 | Ga0157374_12292149 | Ga0157374_122921491 | 79 |
| 809 | 3300013306 | Ga0163162_10180101 | Ga0163162_101801012 | 79 |
| 810 | 3300013306 | Ga0163162_11743670 | Ga0163162_117436702 | 79 |
| 811 | 3300013306 | Ga0163162_12899090 | Ga0163162_128990901 | 79 |
| 812 | 3300013308 | Ga0157375_10430495 | Ga0157375_104304952 | 79 |
| 813 | 3300014325 | Ga0163163_10696609 | Ga0163163_106966092 | 79 |
| 814 | 3300014326 | Ga0157380_10049133 | Ga0157380_100491333 | 79 |
| 815 | 3300014326 | Ga0157380_10061007 | Ga0157380_100610073 | 79 |
| 816 | 3300014745 | Ga0157377_10238445 | Ga0157377_102384453 | 79 |
| 817 | 3300014745 | Ga0157377_10552986 | Ga0157377_105529861 | 79 |
| 818 | 3300014968 | Ga0157379_10092357 | Ga0157379_100923573 | 79 |
| 819 | 3300014969 | Ga0157376_10123997 | Ga0157376_101239973 | 79 |
| 820 | 3300017792 | Ga0163161_10013589 | Ga0163161_100135893 | 79 |
| 821 | 3300020082 | Ga0206353_11689559 | Ga0206353_116895592 | 79 |
| 822 | 3300025321 | Ga0207656_10056810 | Ga0207656_100568103 | 79 |
| 823 | 3300025885 | Ga0207653_10197404 | Ga0207653_101974041 | 79 |
| 824 | 3300025893 | Ga0207682_10527664 | Ga0207682_105276642 | 79 |
| 825 | 3300025899 | Ga0207642_10082979 | Ga0207642_100829793 | 79 |
| 826 | 3300025900 | Ga0207710_10040328 | Ga0207710_100403282 | 79 |
| 827 | 3300025901 | Ga0207688_10029283 | Ga0207688_100292833 | 79 |
| 828 | 3300025904 | Ga0207647_10065508 | Ga0207647_100655081 | 79 |
| 829 | 3300025904 | Ga0207647_10285508 | Ga0207647_102855082 | 79 |
| 830 | 3300025908 | Ga0207643_11102749 | Ga0207643_111027491 | 79 |
| 831 | 3300025912 | Ga0207707_10289925 | Ga0207707_102899253 | 79 |
| 832 | 3300025912 | Ga0207707_11461162 | Ga0207707_114611621 | 79 |
| 833 | 3300025917 | Ga0207660_10157117 | Ga0207660_101571172 | 79 |
| 834 | 3300025918 | Ga0207662_10035141 | Ga0207662_100351412 | 79 |
| 835 | 3300025919 | Ga0207657_10388064 | Ga0207657_103880642 | 79 |
| 836 | 3300025920 | Ga0207649_11460596 | Ga0207649_114605961 | 79 |
| 837 | 3300025921 | Ga0207652_10026109 | Ga0207652_100261093 | 79 |
| 838 | 3300025921 | Ga0207652_10182832 | Ga0207652_101828323 | 79 |
| 839 | 3300025922 | Ga0207646_11884875 | Ga0207646_118848751 | 79 |
| 840 | 3300025924 | Ga0207694_10594287 | Ga0207694_105942871 | 79 |
| 841 | 3300025926 | Ga0207659_10032967 | Ga0207659_100329671 | 79 |
| 842 | 3300025927 | Ga0207687_10098615 | Ga0207687_100986152 | 79 |
| 843 | 3300025933 | Ga0207706_10116879 | Ga0207706_101168793 | 79 |
| 844 | 3300025933 | Ga0207706_10219300 | Ga0207706_102193001 | 79 |
| 845 | 3300025934 | Ga0207686_10424651 | Ga0207686_104246511 | 79 |
| 846 | 3300025935 | Ga0207709_10054695 | Ga0207709_100546953 | 79 |
| 847 | 3300025935 | Ga0207709_10626051 | Ga0207709_106260512 | 79 |
| 848 | 3300025936 | Ga0207670_10060344 | Ga0207670_100603443 | 79 |
| 849 | 3300025938 | Ga0207704_10075276 | Ga0207704_100752763 | 79 |
| 850 | 3300025938 | Ga0207704_10306290 | Ga0207704_103062901 | 79 |
| 851 | 3300025940 | Ga0207691_10039448 | Ga0207691_100394483 | 79 |
| 852 | 3300025941 | Ga0207711_11405289 | Ga0207711_114052892 | 79 |
| 853 | 3300025944 | Ga0207661_10073039 | Ga0207661_100730393 | 79 |
| 854 | 3300025944 | Ga0207661_10324746 | Ga0207661_103247463 | 79 |
| 855 | 3300025944 | Ga0207661_10531338 | Ga0207661_105313381 | 79 |
| 856 | 3300025949 | Ga0207667_10376509 | Ga0207667_103765092 | 79 |
| 857 | 3300025960 | Ga0207651_10027189 | Ga0207651_100271892 | 79 |
| 858 | 3300025961 | Ga0207712_10442720 | Ga0207712_104427203 | 79 |
| 859 | 3300025972 | Ga0207668_10169232 | Ga0207668_101692323 | 79 |
| 860 | 3300025972 | Ga0207668_10256009 | Ga0207668_102560092 | 79 |
| 861 | 3300026023 | Ga0207677_10185133 | Ga0207677_101851333 | 79 |
| 862 | 3300026023 | Ga0207677_11572826 | Ga0207677_115728262 | 79 |
| 863 | 3300026035 | Ga0207703_11994223 | Ga0207703_119942232 | 79 |
| 864 | 3300026041 | Ga0207639_10149729 | Ga0207639_101497292 | 79 |
| 865 | 3300026041 | Ga0207639_10367993 | Ga0207639_103679933 | 79 |
| 866 | 3300026067 | Ga0207678_10008584 | Ga0207678_100085844 | 79 |
| 867 | 3300026075 | Ga0207708_10040436 | Ga0207708_100404363 | 79 |
| 868 | 3300026078 | Ga0207702_11166903 | Ga0207702_111669032 | 79 |
| 869 | 3300026088 | Ga0207641_11315378 | Ga0207641_113153781 | 79 |
| 870 | 3300026089 | Ga0207648_10047579 | Ga0207648_100475794 | 79 |
| 871 | 3300026089 | Ga0207648_10376151 | Ga0207648_103761512 | 79 |
| 872 | 3300026095 | Ga0207676_10019373 | Ga0207676_100193735 | 79 |
| 873 | 3300026116 | Ga0207674_10117820 | Ga0207674_101178203 | 79 |
| 874 | 3300026116 | Ga0207674_10720154 | Ga0207674_107201542 | 79 |
| 875 | 3300026118 | Ga0207675_100113029 | Ga0207675_1001130293 | 79 |
| 876 | 3300026121 | Ga0207683_10013801 | Ga0207683_100138013 | 79 |
| 877 | 3300026142 | Ga0207698_10671757 | Ga0207698_106717572 | 79 |
| 878 | 3300027907 | Ga0207428_10000774 | Ga0207428_1000077414 | 79 |
| 879 | 3300028379 | Ga0268266_10033299 | Ga0268266_100332994 | 79 |
| 880 | 3300028381 | Ga0268264_10408170 | Ga0268264_104081702 | 79 |
| 881 | 3300034820 | Ga0373959_0025311 | Ga0373959_0025311_744_983 | 79 |
| 882 | 3300034957 | Ga0373938_0005578 | Ga0373938_0005578_1722_1961 | 79 |
| 883 | 3300035084 | Ga0373928_0048236 | Ga0373928_0048236_264_503 | 79 |
| 884 | 3300035085 | Ga0373929_0021704 | Ga0373929_0021704_402_644 | 79 |
| 885 | 3300035092 | Ga0373952_0074291 | Ga0373952_0074291_226_465 | 79 |
| 886 | 3300035114 | Ga0373939_0037040 | Ga0373939_0037040_616_855 | 79 |
| 887 | 3300035115 | Ga0373941_0027768 | Ga0373941_0027768_249_488 | 79 |
| 888 | 3300035121 | Ga0373960_0303889 | Ga0373960_0303889_332_571 | 79 |
| 889 | 3300035207 | Ga0373942_0142612 | Ga0373942_0142612_42_281 | 79 |
| 890 | 3300035241 | Ga0373961_0149795 | Ga0373961_0149795_295_534 | 79 |
| 891 | 3300035242 | Ga0373962_0083499 | Ga0373962_0083499_218_457 | 79 |
| 892 | 3300035691 | Ga0373931_0331785 | Ga0373931_0331785_677_916 | 79 |
| 893 | 3300041503 | Ga0451847_0857348 | Ga0451847_0857348_92_361 | 79 |
| 894 | 3300042145 | Ga0450906_022561 | Ga0450906_022561_695_934 | 79 |
| 895 | 3300048903 | Ga0496100_0124417 | Ga0496100_0124417_1516_1755 | 79 |
| 896 | 3300048905 | Ga0496102_0411868 | Ga0496102_0411868_779_1018 | 79 |
| 897 | 3300048905 | Ga0496102_0449371 | Ga0496102_0449371_514_753 | 79 |
| 898 | 3300048907 | Ga0496104_0023751 | Ga0496104_0023751_1697_1936 | 79 |
| 899 | 3300048907 | Ga0496104_0765140 | Ga0496104_0765140_109_348 | 79 |
| 900 | 3300048908 | Ga0496105_0074957 | Ga0496105_0074957_465_704 | 79 |
| 901 | 3300048909 | Ga0496106_0013815 | Ga0496106_0013815_2927_3166 | 79 |
| 902 | 3300048910 | Ga0496107_0063851 | Ga0496107_0063851_723_962 | 79 |
| 903 | 3300048911 | Ga0496108_0019698 | Ga0496108_0019698_1644_1883 | 79 |
| 904 | 3300048911 | Ga0496108_1005176 | Ga0496108_1005176_349_588 | 79 |
| 905 | 3300048912 | Ga0496109_0019278 | Ga0496109_0019278_1267_1506 | 79 |
| 906 | 3300048912 | Ga0496109_0604575 | Ga0496109_0604575_23_262 | 79 |
| 907 | 3300048913 | Ga0496110_0010563 | Ga0496110_0010563_5331_5570 | 79 |
| 908 | 3300048914 | Ga0496111_0302982 | Ga0496111_0302982_267_506 | 79 |
| 909 | 3300048915 | Ga0496112_1146554 | Ga0496112_1146554_166_405 | 79 |
| 910 | 3300048917 | Ga0496114_0081504 | Ga0496114_0081504_1696_1935 | 79 |
| 911 | 3300049568 | Ga0501031_0278829 | Ga0501031_0278829_742_981 | 79 |
| 912 | 3300049568 | Ga0501031_0341503 | Ga0501031_0341503_228_467 | 79 |
| 913 | 3300049570 | Ga0501033_0758726 | Ga0501033_0758726_132_371 | 79 |
| 914 | 3300049572 | Ga0501036_0122684 | Ga0501036_0122684_1249_1488 | 79 |
| 915 | 3300049572 | Ga0501036_0178356 | Ga0501036_0178356_978_1217 | 79 |
| 916 | 3300049575 | Ga0501039_0001894 | Ga0501039_0001894_5386_5625 | 79 |
| 917 | 3300049575 | Ga0501039_0386889 | Ga0501039_0386889_347_586 | 79 |
| 918 | 3300049577 | Ga0501041_0046784 | Ga0501041_0046784_1266_1505 | 79 |
| 919 | 3300049578 | Ga0501042_0005607 | Ga0501042_0005607_5880_6119 | 79 |
| 920 | 3300049579 | Ga0501043_0271745 | Ga0501043_0271745_192_431 | 79 |
| 921 | 3300049580 | Ga0501046_0051601 | Ga0501046_0051601_1247_1486 | 79 |
| 922 | 3300049581 | Ga0501047_0347918 | Ga0501047_0347918_191_442 | 79 |
| 923 | 3300049582 | Ga0501048_0270755 | Ga0501048_0270755_425_664 | 79 |
| 924 | 3300049584 | Ga0501068_0017760 | Ga0501068_0017760_2631_2870 | 79 |
| 925 | 3300049584 | Ga0501068_0239392 | Ga0501068_0239392_490_741 | 79 |
| 926 | 3300049584 | Ga0501068_0242734 | Ga0501068_0242734_443_682 | 79 |
| 927 | 3300049586 | Ga0501070_0040880 | Ga0501070_0040880_910_1161 | 79 |
| 928 | 3300049586 | Ga0501070_0247007 | Ga0501070_0247007_129_368 | 79 |
| 929 | 3300049587 | Ga0501071_0002446 | Ga0501071_0002446_7400_7639 | 79 |
| 930 | 3300049588 | Ga0501072_0004289 | Ga0501072_0004289_874_1125 | 79 |
| 931 | 3300049588 | Ga0501072_0005411 | Ga0501072_0005411_8182_8421 | 79 |
| 932 | 3300049588 | Ga0501072_0189811 | Ga0501072_0189811_744_983 | 79 |
| 933 | 3300049589 | Ga0501073_0055581 | Ga0501073_0055581_1954_2205 | 79 |
| 934 | 3300049589 | Ga0501073_0069593 | Ga0501073_0069593_1379_1618 | 79 |
| 935 | 3300049590 | Ga0501074_0069110 | Ga0501074_0069110_1013_1264 | 79 |
| 936 | 3300049590 | Ga0501074_0200994 | Ga0501074_0200994_1154_1393 | 79 |
| 937 | 3300049591 | Ga0501075_0043599 | Ga0501075_0043599_2994_3233 | 79 |
| 938 | 3300049591 | Ga0501075_0303671 | Ga0501075_0303671_694_933 | 79 |
| 939 | 3300049592 | Ga0501076_0003147 | Ga0501076_0003147_8294_8533 | 79 |
| 940 | 3300049592 | Ga0501076_0084275 | Ga0501076_0084275_1048_1287 | 79 |
| 941 | 3300049592 | Ga0501076_0465588 | Ga0501076_0465588_77_316 | 79 |
| 942 | 3300049593 | Ga0501077_0001220 | Ga0501077_0001220_3541_3780 | 79 |
| 943 | 3300049593 | Ga0501077_0071309 | Ga0501077_0071309_1890_2129 | 79 |
| 944 | 3300049741 | Ga0501079_0027702 | Ga0501079_0027702_3165_3404 | 79 |
| 945 | 3300049741 | Ga0501079_0043215 | Ga0501079_0043215_765_1016 | 79 |
| 946 | 3300049741 | Ga0501079_0132435 | Ga0501079_0132435_1081_1320 | 79 |
| 947 | 3300049742 | Ga0501080_0008348 | Ga0501080_0008348_3220_3471 | 79 |
| 948 | 3300049742 | Ga0501080_0082540 | Ga0501080_0082540_1269_1508 | 79 |
| 949 | 3300049742 | Ga0501080_0306245 | Ga0501080_0306245_532_771 | 79 |
| 950 | 3300049743 | Ga0501081_0023796 | Ga0501081_0023796_2992_3231 | 79 |
| 951 | 3300049744 | Ga0501083_0019061 | Ga0501083_0019061_2645_2896 | 79 |
| 952 | 3300049744 | Ga0501083_0026562 | Ga0501083_0026562_50_289 | 79 |
| 953 | 3300049822 | Ga0501035_0200264 | Ga0501035_0200264_1206_1445 | 79 |
| 954 | 3300049822 | Ga0501035_0940604 | Ga0501035_0940604_329_568 | 79 |
| 955 | 3300049823 | Ga0501044_1407733 | Ga0501044_1407733_24_275 | 79 |
| 956 | 3300049824 | Ga0501045_0117774 | Ga0501045_0117774_587_826 | 79 |
| 957 | 3300049824 | Ga0501045_0339881 | Ga0501045_0339881_434_673 | 79 |
| 958 | 3300050490 | nmdc:mga03n38_22652_c1 | nmdc:mga03n38_22652_c1_687_926 | 79 |
| 959 | 3300050491 | nmdc:mga00v17_343744_c2 | nmdc:mga00v17_343744_c2_146_385 | 79 |
| 960 | 3300050491 | nmdc:mga00v17_3709_c1 | nmdc:mga00v17_3709_c1_6256_6495 | 79 |
| 961 | 3300050492 | nmdc:mga0yw44_218170_c1 | nmdc:mga0yw44_218170_c1_889_1158 | 79 |
| 962 | 3300050492 | nmdc:mga0yw44_35630_c1 | nmdc:mga0yw44_35630_c1_1133_1372 | 79 |
| 963 | 3300050492 | nmdc:mga0yw44_413568_c1 | nmdc:mga0yw44_413568_c1_496_735 | 79 |
| 964 | 3300050492 | nmdc:mga0yw44_774095_c1 | nmdc:mga0yw44_774095_c1_192_431 | 79 |
| 965 | 3300050494 | nmdc:mga06z11_113928_c1 | nmdc:mga06z11_113928_c1_1106_1345 | 79 |
| 966 | 3300050495 | nmdc:mga04h51_378496_c1 | nmdc:mga04h51_378496_c1_200_439 | 79 |
| 967 | 3300050507 | nmdc:mga05p37_1614_c1 | nmdc:mga05p37_1614_c1_13799_14038 | 79 |
| 968 | 3300050508 | nmdc:mga09592_28817_c1 | nmdc:mga09592_28817_c1_17_256 | 79 |
| 969 | 3300050510 | nmdc:mga06r32_1601087_c1 | nmdc:mga06r32_1601087_c1_12_251 | 79 |
| 970 | 3300050511 | nmdc:mga08y16_1039_c1 | nmdc:mga08y16_1039_c1_16286_16525 | 79 |
| 971 | 3300050511 | nmdc:mga08y16_53313_c1 | nmdc:mga08y16_53313_c1_778_1047 | 79 |
| 972 | 3300050511 | nmdc:mga08y16_663006_c1 | nmdc:mga08y16_663006_c1_619_858 | 79 |
| 973 | 3300050515 | nmdc:mga0a205_19581_c1 | nmdc:mga0a205_19581_c1_1068_1307 | 79 |
| 974 | 3300054114 | Ga0501084_0008815 | Ga0501084_0008815_4976_5215 | 79 |
| 975 | 3300054114 | Ga0501084_0026511 | Ga0501084_0026511_356_595 | 79 |
| 976 | 3300060353 | Ga0501082_0048532 | Ga0501082_0048532_60_311 | 79 |
| 977 | 3300060353 | Ga0501082_0131934 | Ga0501082_0131934_298_537 | 79 |
| 978 | 3300061734 | Ga0530510_0097762 | Ga0530510_0097762_848_1087 | 79 |
| 979 | 3300061734 | Ga0530510_0147992 | Ga0530510_0147992_924_1163 | 79 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7e8k-assembly2.cif.gz_C | crystal structure of proteinaceous rnase p (prorp) from planctomycetes bacterium gwf2_40_8 | 0.5305 | 1 | 63 |
| 4ue5-assembly1.cif.gz_D | structural basis for targeting and elongation arrest of bacillus signal recognition particle | 0.4998 | 12 | 64 |
| 7e8k-assembly1.cif.gz_B | crystal structure of proteinaceous rnase p (prorp) from planctomycetes bacterium gwf2_40_8 | 0.4995 | 1 | 63 |
| 7nc7-assembly1.cif.gz_B | crystal structure of fructose-bisphosphate aldolases fbac from bacillus methanolicus | 0.4734 | 10 | 47 |
| 2gsl-assembly2.cif.gz_C | x-ray crystal structure of protein fn1578 from fusobacterium nucleatum. northeast structural genomics consortium target nr1. | 0.4689 | 2 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94489_406_718_3.60.40.10 | Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain | 0.5952 | 4 | 60 | 3.60.40.10 |
| af_Q8LES5_259_325_1.10.1240.40 | Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain | 0.5811 | 7 | 42 | 1.10.1240.40 |
| af_A0A1D6MHG4_97_208_1.10.1520.10 | Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain | 0.5557 | 4 | 78 | 1.10.1520.10 |
| 2gslB00 | Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain | 0.5301 | 2 | 67 | 1.10.1520.10 |
| af_A0A0B4K7C5_135_220_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.5293 | 2 | 55 | 1.10.238.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538GSE0-F1-model_v4 | Uncharacterized protein | 0.5832 | 2 | 61 |
|
| AF-W4FLW1-F1-model_v4 | DDE Tnp4 domain-containing protein | 0.5615 | 9 | 53 |
|
| AF-A0A538GSE0-F1-model_v4 | Uncharacterized protein | 0.5606 | 2 | 61 |
|
| AF-A0A1Q3FTF4-F1-model_v4 | Putative conserved plasma membrane protein | 0.5347 | 7 | 78 |
GO:0016020
|
| AF-A0A5B9D9K0-F1-model_v4 | Uncharacterized protein | 0.4931 | 10 | 71 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar