F487114
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 971 | 434 | 940 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_101537332|Ga0070659_1015373321 |
| Length | 120 |
| Sequence | MENSKAESKVKVKKKVTLPYSLEVRARAVRMVFEPQHQYKSHWAAIKSIAPKIGCTAETLRIGVRRAETDRGLRAGQTTQEQERIKALEREVRELRQVNEILRKASAYFAQAALDRRVKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 3 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 4 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 5 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 6 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 7 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 8 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 9 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 10 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 11 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 12 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 13 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 14 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 15 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 16 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 17 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 18 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 22 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 23 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 24 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 102 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 103 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 180 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 181 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 182 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 183 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 194 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 195 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 196 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 220 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 237 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 238 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 239 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 240 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 241 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 242 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 243 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 244 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 245 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 246 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 247 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 361 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 362 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 363 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 364 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 365 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 366 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 367 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 368 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 369 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 370 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 371 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 372 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 373 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 374 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 375 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 376 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 377 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 380 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 424 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 427 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 428 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 429 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 430 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 433 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 434 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.6 |
| Metatranscriptomes | 0.21 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.34 |
| Nodule | 0.93 |
| Rhizoplane | 7.72 |
| Rhizosphere | 84.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10018797 | 3300001979 | Bacteria | 2444 |
| 2 | JGI24739J22299_10014786 | 3300001989 | Bacteria | 2838 |
| 3 | JGI24739J22299_10014941 | 3300001989 | Bacteria | 2823 |
| 4 | JGI24739J22299_10014954 | 3300001989 | Bacteria | 2822 |
| 5 | JGI24739J22299_10014969 | 3300001989 | Bacteria | 2821 |
| 6 | JGI24737J22298_10011905 | 3300001990 | Bacteria | 2841 |
| 7 | JGI24735J21928_10002116 | 3300002067 | Bacteria | 6994 |
| 8 | JGI24738J21930_10006207 | 3300002075 | Bacteria | 2822 |
| 9 | JGI24742J22300_10030343 | 3300002244 | Bacteria | 943 |
| 10 | JGI25406J46586_10037561 | 3300003203 | Bacteria | 1744 |
| 11 | JGI25406J46586_10040120 | 3300003203 | Bacteria | 1663 |
| 12 | rootH2_10112718 | 3300003320 | Bacteria | 4376 |
| 13 | JGI25160J50197_1014753 | 3300003354 | Bacteria | 2598 |
| 14 | JGI25160J50197_1054618 | 3300003354 | Bacteria | 827 |
| 15 | Ga0065712_10294991 | 3300005290 | Bacteria | 870 |
| 16 | Ga0065715_10328151 | 3300005293 | Bacteria | 986 |
| 17 | Ga0065707_11079123 | 3300005295 | Bacteria | 520 |
| 18 | Ga0070658_10067828 | 3300005327 | Bacteria | 2915 |
| 19 | Ga0070658_10312761 | 3300005327 | Bacteria | 1340 |
| 20 | Ga0070676_10255499 | 3300005328 | Bacteria | 1171 |
| 21 | Ga0070670_100151636 | 3300005331 | Bacteria | 2006 |
| 22 | Ga0070670_100622975 | 3300005331 | Bacteria | 966 |
| 23 | Ga0070670_101244196 | 3300005331 | Bacteria | 681 |
| 24 | Ga0070670_101459568 | 3300005331 | Bacteria | 628 |
| 25 | Ga0068869_100218925 | 3300005334 | Bacteria | 1508 |
| 26 | Ga0068869_100301097 | 3300005334 | Bacteria | 1295 |
| 27 | Ga0070666_10001193 | 3300005335 | Bacteria | 15729 |
| 28 | Ga0070666_10050419 | 3300005335 | Bacteria | 2799 |
| 29 | Ga0070682_100064785 | 3300005337 | Bacteria | 2321 |
| 30 | Ga0070682_100065216 | 3300005337 | Bacteria | 2314 |
| 31 | Ga0068868_100212352 | 3300005338 | Bacteria | 1618 |
| 32 | Ga0070660_100151611 | 3300005339 | Bacteria | 1864 |
| 33 | Ga0070668_100001401 | 3300005347 | Bacteria | 17339 |
| 34 | Ga0070675_100111634 | 3300005354 | Bacteria | 2314 |
| 35 | Ga0070675_100346522 | 3300005354 | Bacteria | 1317 |
| 36 | Ga0070671_100052699 | 3300005355 | Bacteria | 3383 |
| 37 | Ga0070671_100513810 | 3300005355 | Bacteria | 1031 |
| 38 | Ga0070673_100093963 | 3300005364 | Bacteria | 2457 |
| 39 | Ga0070673_100673720 | 3300005364 | Bacteria | 948 |
| 40 | Ga0070673_101113402 | 3300005364 | Bacteria | 738 |
| 41 | Ga0070688_100327416 | 3300005365 | Bacteria | 1115 |
| 42 | Ga0070688_100904759 | 3300005365 | Bacteria | 696 |
| 43 | Ga0070659_101537332 | 3300005366 | Bacteria | 593 |
| 44 | Ga0070659_101699200 | 3300005366 | Bacteria | 564 |
| 45 | Ga0070667_100001946 | 3300005367 | Bacteria | 18322 |
| 46 | Ga0070667_100301323 | 3300005367 | Bacteria | 1443 |
| 47 | Ga0070667_100312911 | 3300005367 | Bacteria | 1416 |
| 48 | Ga0070667_100320820 | 3300005367 | Bacteria | 1398 |
| 49 | Ga0070667_101008652 | 3300005367 | Bacteria | 777 |
| 50 | Ga0070714_100793881 | 3300005435 | Bacteria | 917 |
| 51 | Ga0070710_10153304 | 3300005437 | Bacteria | 1423 |
| 52 | Ga0070711_100151979 | 3300005439 | Bacteria | 1747 |
| 53 | Ga0070663_101107468 | 3300005455 | Bacteria | 692 |
| 54 | Ga0070663_101438891 | 3300005455 | Bacteria | 611 |
| 55 | Ga0070678_100291393 | 3300005456 | Bacteria | 1384 |
| 56 | Ga0070678_100332198 | 3300005456 | Bacteria | 1301 |
| 57 | Ga0070678_100339789 | 3300005456 | Bacteria | 1288 |
| 58 | Ga0070678_100773868 | 3300005456 | Bacteria | 870 |
| 59 | Ga0070685_10106003 | 3300005466 | Bacteria | 1724 |
| 60 | Ga0070685_10145997 | 3300005466 | Bacteria | 1494 |
| 61 | Ga0070707_100970467 | 3300005468 | Bacteria | 815 |
| 62 | Ga0070698_100304462 | 3300005471 | Bacteria | 1524 |
| 63 | Ga0070679_101601707 | 3300005530 | Bacteria | 599 |
| 64 | Ga0070684_101418244 | 3300005535 | Bacteria | 654 |
| 65 | Ga0068853_102065077 | 3300005539 | Bacteria | 553 |
| 66 | Ga0070672_100169555 | 3300005543 | Bacteria | 1815 |
| 67 | Ga0070672_101621371 | 3300005543 | Bacteria | 581 |
| 68 | Ga0070665_100099392 | 3300005548 | Bacteria | 2914 |
| 69 | Ga0070665_100232511 | 3300005548 | Bacteria | 1843 |
| 70 | Ga0070665_100314592 | 3300005548 | Bacteria | 1570 |
| 71 | Ga0070665_100547289 | 3300005548 | Bacteria | 1169 |
| 72 | Ga0070704_100770565 | 3300005549 | Bacteria | 858 |
| 73 | Ga0068855_100349567 | 3300005563 | Bacteria | 1629 |
| 74 | Ga0070664_101005843 | 3300005564 | Bacteria | 784 |
| 75 | Ga0068856_100305166 | 3300005614 | Bacteria | 1610 |
| 76 | Ga0068856_101126525 | 3300005614 | Bacteria | 802 |
| 77 | Ga0068852_100006949 | 3300005616 | Bacteria | 8236 |
| 78 | Ga0068852_100198172 | 3300005616 | Bacteria | 1899 |
| 79 | Ga0068852_101059126 | 3300005616 | Bacteria | 830 |
| 80 | Ga0068859_101278173 | 3300005617 | Bacteria | 809 |
| 81 | Ga0068859_102388689 | 3300005617 | Bacteria | 583 |
| 82 | Ga0068864_100374626 | 3300005618 | Bacteria | 1348 |
| 83 | Ga0068866_10275061 | 3300005718 | Bacteria | 1041 |
| 84 | Ga0068861_102582594 | 3300005719 | Bacteria | 512 |
| 85 | Ga0068851_10313365 | 3300005834 | Bacteria | 905 |
| 86 | Ga0068863_100002488 | 3300005841 | Bacteria | 18322 |
| 87 | Ga0068863_100017312 | 3300005841 | Bacteria | 6911 |
| 88 | Ga0068863_100327227 | 3300005841 | Bacteria | 1489 |
| 89 | Ga0068863_100386720 | 3300005841 | Bacteria | 1367 |
| 90 | Ga0068863_100890361 | 3300005841 | Bacteria | 890 |
| 91 | Ga0068860_100014783 | 3300005843 | Bacteria | 7634 |
| 92 | Ga0081455_10055690 | 3300005937 | Bacteria | 3363 |
| 93 | Ga0081538_10068670 | 3300005981 | Bacteria | 1969 |
| 94 | Ga0081539_10011863 | 3300005985 | Bacteria | 6811 |
| 95 | Ga0081539_10012508 | 3300005985 | Bacteria | 6531 |
| 96 | Ga0081539_10054045 | 3300005985 | Bacteria | 2245 |
| 97 | Ga0075365_11278816 | 3300006038 | Bacteria | 516 |
| 98 | Ga0075432_10407140 | 3300006058 | Bacteria | 588 |
| 99 | Ga0070716_100619356 | 3300006173 | Bacteria | 817 |
| 100 | Ga0070712_100312298 | 3300006175 | Bacteria | 1276 |
| 101 | Ga0070712_100490447 | 3300006175 | Bacteria | 1028 |
| 102 | Ga0070712_101474143 | 3300006175 | Bacteria | 594 |
| 103 | Ga0097621_100132935 | 3300006237 | Bacteria | 2119 |
| 104 | Ga0097621_100177034 | 3300006237 | Bacteria | 1841 |
| 105 | Ga0097621_101177049 | 3300006237 | Bacteria | 721 |
| 106 | Ga0068871_100132447 | 3300006358 | Bacteria | 2115 |
| 107 | Ga0068871_100221464 | 3300006358 | Bacteria | 1639 |
| 108 | Ga0075428_100429855 | 3300006844 | Bacteria | 1415 |
| 109 | Ga0075428_102243809 | 3300006844 | Bacteria | 563 |
| 110 | Ga0075430_100287654 | 3300006846 | Bacteria | 1360 |
| 111 | Ga0075430_101783466 | 3300006846 | Bacteria | 505 |
| 112 | Ga0075431_100378052 | 3300006847 | Bacteria | 1421 |
| 113 | Ga0075429_100378781 | 3300006880 | Bacteria | 1239 |
| 114 | Ga0068865_100198362 | 3300006881 | Bacteria | 1557 |
| 115 | Ga0075436_100143339 | 3300006914 | Bacteria | 1680 |
| 116 | Ga0097620_101278283 | 3300006931 | Bacteria | 809 |
| 117 | Ga0099794_10533633 | 3300007265 | Bacteria | 619 |
| 118 | Ga0105251_10080688 | 3300009011 | Bacteria | 1504 |
| 119 | Ga0105250_10042193 | 3300009092 | Bacteria | 1828 |
| 120 | Ga0105250_10302218 | 3300009092 | Bacteria | 692 |
| 121 | Ga0105240_10245188 | 3300009093 | Bacteria | 2075 |
| 122 | Ga0105240_11187964 | 3300009093 | Bacteria | 808 |
| 123 | Ga0111539_10061134 | 3300009094 | Bacteria | 4463 |
| 124 | Ga0111539_10513727 | 3300009094 | Bacteria | 1395 |
| 125 | Ga0111539_11643268 | 3300009094 | Bacteria | 745 |
| 126 | Ga0105245_10079895 | 3300009098 | Bacteria | 2987 |
| 127 | Ga0105245_11794379 | 3300009098 | Bacteria | 666 |
| 128 | Ga0105247_10035340 | 3300009101 | Bacteria | 3046 |
| 129 | Ga0105247_10216304 | 3300009101 | Bacteria | 1295 |
| 130 | Ga0114129_10548674 | 3300009147 | Bacteria | 1503 |
| 131 | Ga0105241_10031643 | 3300009174 | Bacteria | 3961 |
| 132 | Ga0105248_10232458 | 3300009177 | Bacteria | 2075 |
| 133 | Ga0105248_10545735 | 3300009177 | Bacteria | 1308 |
| 134 | Ga0105248_13044833 | 3300009177 | Bacteria | 534 |
| 135 | Ga0105237_10946118 | 3300009545 | Bacteria | 868 |
| 136 | Ga0105237_11697765 | 3300009545 | Bacteria | 639 |
| 137 | Ga0105238_10021194 | 3300009551 | Bacteria | 6624 |
| 138 | Ga0105239_10079390 | 3300010375 | Bacteria | 3611 |
| 139 | Ga0105246_10135957 | 3300011119 | Bacteria | 1842 |
| 140 | Ga0157344_1006271 | 3300012476 | Bacteria | 763 |
| 141 | Ga0157321_1013110 | 3300012487 | Bacteria | 671 |
| 142 | Ga0157315_1019421 | 3300012508 | Bacteria | 704 |
| 143 | Ga0157370_11295893 | 3300013104 | Bacteria | 656 |
| 144 | Ga0157369_10140370 | 3300013105 | Bacteria | 2557 |
| 145 | Ga0157369_11138615 | 3300013105 | Bacteria | 797 |
| 146 | Ga0157369_11222514 | 3300013105 | Bacteria | 767 |
| 147 | Ga0157374_10077502 | 3300013296 | Bacteria | 3146 |
| 148 | Ga0157378_10063043 | 3300013297 | Bacteria | 3311 |
| 149 | Ga0163162_10154128 | 3300013306 | Bacteria | 2417 |
| 150 | Ga0163162_10449836 | 3300013306 | Bacteria | 1420 |
| 151 | Ga0157375_10233048 | 3300013308 | Bacteria | 2000 |
| 152 | Ga0157375_11602565 | 3300013308 | Bacteria | 770 |
| 153 | Ga0163163_10291901 | 3300014325 | Bacteria | 1683 |
| 154 | Ga0163163_11112003 | 3300014325 | Bacteria | 853 |
| 155 | Ga0157380_13393924 | 3300014326 | Bacteria | 510 |
| 156 | Ga0182008_10023906 | 3300014497 | Bacteria | 3115 |
| 157 | Ga0182008_10094502 | 3300014497 | Bacteria | 1475 |
| 158 | Ga0182008_10204037 | 3300014497 | Bacteria | 1007 |
| 159 | Ga0157379_10068242 | 3300014968 | Bacteria | 3179 |
| 160 | Ga0157379_10151646 | 3300014968 | Bacteria | 2090 |
| 161 | Ga0157376_10332684 | 3300014969 | Bacteria | 1448 |
| 162 | Ga0157376_10348050 | 3300014969 | Bacteria | 1417 |
| 163 | Ga0157376_13099856 | 3300014969 | Bacteria | 503 |
| 164 | Ga0182005_1052547 | 3300015265 | Bacteria | 1110 |
| 165 | Ga0183365_10008 | 3300015684 | Bacteria | 74681 |
| 166 | Ga0163161_10241960 | 3300017792 | Bacteria | 1404 |
| 167 | Ga0163161_10788740 | 3300017792 | Bacteria | 797 |
| 168 | Ga0209050_1039729 | 3300025298 | Bacteria | 1321 |
| 169 | Ga0207426_1001804 | 3300025302 | Bacteria | 15918 |
| 170 | Ga0207697_10163086 | 3300025315 | Bacteria | 973 |
| 171 | Ga0207656_10229232 | 3300025321 | Bacteria | 905 |
| 172 | Ga0207696_1014539 | 3300025711 | Bacteria | 2695 |
| 173 | Ga0207655_1025765 | 3300025728 | Bacteria | 2845 |
| 174 | Ga0207713_1024005 | 3300025735 | Bacteria | 2854 |
| 175 | Ga0207692_10784257 | 3300025898 | Bacteria | 622 |
| 176 | Ga0207642_10407032 | 3300025899 | Bacteria | 815 |
| 177 | Ga0207710_10007973 | 3300025900 | Bacteria | 4478 |
| 178 | Ga0207710_10019310 | 3300025900 | Bacteria | 2908 |
| 179 | Ga0207710_10209388 | 3300025900 | Bacteria | 965 |
| 180 | Ga0207688_10224182 | 3300025901 | Bacteria | 1133 |
| 181 | Ga0207688_10776768 | 3300025901 | Bacteria | 607 |
| 182 | Ga0207680_10001242 | 3300025903 | Bacteria | 12054 |
| 183 | Ga0207680_10066894 | 3300025903 | Bacteria | 2212 |
| 184 | Ga0207680_10078681 | 3300025903 | Bacteria | 2065 |
| 185 | Ga0207680_10265213 | 3300025903 | Bacteria | 1190 |
| 186 | Ga0207647_10019140 | 3300025904 | Bacteria | 4609 |
| 187 | Ga0207645_10390005 | 3300025907 | Bacteria | 936 |
| 188 | Ga0207705_10092025 | 3300025909 | Bacteria | 2221 |
| 189 | Ga0207705_10218017 | 3300025909 | Bacteria | 1448 |
| 190 | Ga0207654_10150176 | 3300025911 | Bacteria | 1495 |
| 191 | Ga0207707_10228670 | 3300025912 | Bacteria | 1618 |
| 192 | Ga0207695_10356273 | 3300025913 | Bacteria | 1350 |
| 193 | Ga0207671_10245106 | 3300025914 | Bacteria | 1408 |
| 194 | Ga0207671_10266968 | 3300025914 | Bacteria | 1348 |
| 195 | Ga0207671_10321905 | 3300025914 | Bacteria | 1224 |
| 196 | Ga0207693_10490732 | 3300025915 | Bacteria | 959 |
| 197 | Ga0207693_10769017 | 3300025915 | Bacteria | 743 |
| 198 | Ga0207663_10345369 | 3300025916 | Bacteria | 1125 |
| 199 | Ga0207657_10137591 | 3300025919 | Bacteria | 1997 |
| 200 | Ga0207657_10312808 | 3300025919 | Bacteria | 1243 |
| 201 | Ga0207652_10355340 | 3300025921 | Bacteria | 1322 |
| 202 | Ga0207681_10049251 | 3300025923 | Bacteria | 2847 |
| 203 | Ga0207694_10241255 | 3300025924 | Bacteria | 1477 |
| 204 | Ga0207650_10076112 | 3300025925 | Bacteria | 2535 |
| 205 | Ga0207650_10125120 | 3300025925 | Bacteria | 2006 |
| 206 | Ga0207650_10890363 | 3300025925 | Bacteria | 756 |
| 207 | Ga0207659_10083362 | 3300025926 | Bacteria | 2370 |
| 208 | Ga0207687_10210617 | 3300025927 | Bacteria | 1525 |
| 209 | Ga0207700_10778108 | 3300025928 | Bacteria | 856 |
| 210 | Ga0207664_10308064 | 3300025929 | Bacteria | 1395 |
| 211 | Ga0207644_10052600 | 3300025931 | Bacteria | 2927 |
| 212 | Ga0207644_10683518 | 3300025931 | Bacteria | 855 |
| 213 | Ga0207690_11661209 | 3300025932 | Bacteria | 534 |
| 214 | Ga0207686_10235736 | 3300025934 | Bacteria | 1329 |
| 215 | Ga0207709_11282694 | 3300025935 | Bacteria | 605 |
| 216 | Ga0207670_11112775 | 3300025936 | Bacteria | 667 |
| 217 | Ga0207669_10477997 | 3300025937 | Bacteria | 993 |
| 218 | Ga0207704_10169615 | 3300025938 | Bacteria | 1563 |
| 219 | Ga0207691_10106659 | 3300025940 | Bacteria | 2495 |
| 220 | Ga0207691_10284678 | 3300025940 | Bacteria | 1422 |
| 221 | Ga0207711_10166274 | 3300025941 | Bacteria | 1999 |
| 222 | Ga0207711_10332560 | 3300025941 | Bacteria | 1405 |
| 223 | Ga0207689_10157847 | 3300025942 | Bacteria | 1870 |
| 224 | Ga0207667_10290741 | 3300025949 | Bacteria | 1670 |
| 225 | Ga0207651_10554934 | 3300025960 | Bacteria | 999 |
| 226 | Ga0207651_11724907 | 3300025960 | Bacteria | 564 |
| 227 | Ga0207668_10000897 | 3300025972 | Bacteria | 17991 |
| 228 | Ga0207658_10000855 | 3300025986 | Bacteria | 25454 |
| 229 | Ga0207658_10439077 | 3300025986 | Bacteria | 1154 |
| 230 | Ga0207658_10585200 | 3300025986 | Bacteria | 1001 |
| 231 | Ga0207658_11169373 | 3300025986 | Bacteria | 703 |
| 232 | Ga0207678_10035555 | 3300026067 | Bacteria | 4337 |
| 233 | Ga0207678_10118679 | 3300026067 | Bacteria | 2257 |
| 234 | Ga0207678_10123486 | 3300026067 | Bacteria | 2209 |
| 235 | Ga0207702_10266954 | 3300026078 | Bacteria | 1613 |
| 236 | Ga0207702_10406238 | 3300026078 | Bacteria | 1314 |
| 237 | Ga0207702_10514142 | 3300026078 | Bacteria | 1168 |
| 238 | Ga0207641_10001239 | 3300026088 | Bacteria | 25454 |
| 239 | Ga0207641_10008857 | 3300026088 | Bacteria | 8309 |
| 240 | Ga0207641_10337801 | 3300026088 | Bacteria | 1432 |
| 241 | Ga0207641_10383447 | 3300026088 | Bacteria | 1346 |
| 242 | Ga0207641_11218551 | 3300026088 | Bacteria | 752 |
| 243 | Ga0207648_10052234 | 3300026089 | Bacteria | 3573 |
| 244 | Ga0207676_11419938 | 3300026095 | Bacteria | 690 |
| 245 | Ga0207683_10177407 | 3300026121 | Bacteria | 1931 |
| 246 | Ga0207683_10260227 | 3300026121 | Bacteria | 1584 |
| 247 | Ga0207683_10376503 | 3300026121 | Bacteria | 1305 |
| 248 | Ga0207698_10012755 | 3300026142 | Bacteria | 5515 |
| 249 | Ga0207698_10175873 | 3300026142 | Bacteria | 1890 |
| 250 | Ga0207698_11106828 | 3300026142 | Bacteria | 805 |
| 251 | Ga0209371_1037806 | 3300027312 | Bacteria | 1000 |
| 252 | Ga0209999_1027953 | 3300027543 | Bacteria | 1045 |
| 253 | Ga0209998_10194753 | 3300027717 | Bacteria | 529 |
| 254 | Ga0209974_10270365 | 3300027876 | Bacteria | 644 |
| 255 | Ga0207428_10049284 | 3300027907 | Bacteria | 3375 |
| 256 | Ga0268266_10137789 | 3300028379 | Bacteria | 2187 |
| 257 | Ga0268266_10272892 | 3300028379 | Bacteria | 1570 |
| 258 | Ga0268266_10306696 | 3300028379 | Bacteria | 1482 |
| 259 | Ga0268265_11038006 | 3300028380 | Bacteria | 811 |
| 260 | Ga0268264_10011283 | 3300028381 | Bacteria | 7381 |
| 261 | Ga0268264_10481848 | 3300028381 | Bacteria | 1207 |
| 262 | Ga0268256_1042966 | 3300030500 | Bacteria | 1000 |
| 263 | Ga0307513_10215539 | 3300031456 | Bacteria | 1746 |
| 264 | Ga0316575_10171221 | 3300031665 | Bacteria | 900 |
| 265 | Ga0316579_10435185 | 3300031691 | Bacteria | 634 |
| 266 | Ga0316576_10001399 | 3300031727 | Bacteria | 12906 |
| 267 | Ga0316576_10237034 | 3300031727 | Bacteria | 1371 |
| 268 | Ga0316576_10674542 | 3300031727 | Bacteria | 750 |
| 269 | Ga0316578_10074903 | 3300031728 | Bacteria | 2007 |
| 270 | Ga0316578_10377055 | 3300031728 | Bacteria | 842 |
| 271 | Ga0316578_10607522 | 3300031728 | Bacteria | 640 |
| 272 | Ga0316577_10001739 | 3300031733 | Bacteria | 10470 |
| 273 | Ga0307413_11321227 | 3300031824 | Bacteria | 631 |
| 274 | Ga0307413_12106688 | 3300031824 | Bacteria | 510 |
| 275 | Ga0307410_10159946 | 3300031852 | Bacteria | 1686 |
| 276 | Ga0307406_10073981 | 3300031901 | Bacteria | 2242 |
| 277 | Ga0307406_10485378 | 3300031901 | Bacteria | 999 |
| 278 | Ga0307407_10622896 | 3300031903 | Bacteria | 805 |
| 279 | Ga0307407_11546073 | 3300031903 | Bacteria | 525 |
| 280 | Ga0307412_11920344 | 3300031911 | Bacteria | 547 |
| 281 | Ga0307409_100238227 | 3300031995 | Bacteria | 1654 |
| 282 | Ga0307409_100333353 | 3300031995 | Bacteria | 1425 |
| 283 | Ga0307409_100462351 | 3300031995 | Bacteria | 1227 |
| 284 | Ga0307409_101136980 | 3300031995 | Bacteria | 803 |
| 285 | Ga0307416_100413121 | 3300032002 | Bacteria | 1391 |
| 286 | Ga0307414_10053637 | 3300032004 | Bacteria | 2813 |
| 287 | Ga0307414_10098116 | 3300032004 | Bacteria | 2197 |
| 288 | Ga0307414_11449263 | 3300032004 | Bacteria | 638 |
| 289 | Ga0307411_11411405 | 3300032005 | Bacteria | 637 |
| 290 | Ga0316583_10062843 | 3300032133 | Bacteria | 1300 |
| 291 | Ga0316583_10076543 | 3300032133 | Bacteria | 1170 |
| 292 | Ga0316583_10291867 | 3300032133 | Bacteria | 564 |
| 293 | Ga0316585_10038761 | 3300032137 | Bacteria | 1514 |
| 294 | Ga0316580_10000387 | 3300032139 | Bacteria | 9921 |
| 295 | Ga0316580_10252808 | 3300032139 | Bacteria | 545 |
| 296 | Ga0316592_1081511 | 3300033524 | Bacteria | 736 |
| 297 | Ga0316596_1230181 | 3300033541 | Bacteria | 520 |
| 298 | Ga0373926_0049132 | 3300035083 | Bacteria | 1518 |
| 299 | Ga0373926_0056492 | 3300035083 | Bacteria | 1424 |
| 300 | Ga0373934_0060884 | 3300035086 | Bacteria | 1503 |
| 301 | Ga0373934_0066572 | 3300035086 | Bacteria | 1438 |
| 302 | Ga0373944_0030361 | 3300035089 | Bacteria | 1621 |
| 303 | Ga0373944_0035120 | 3300035089 | Bacteria | 1526 |
| 304 | Ga0373923_0082802 | 3300035111 | Bacteria | 1393 |
| 305 | Ga0373923_0596879 | 3300035111 | Bacteria | 543 |
| 306 | Ga0373936_0069598 | 3300035113 | Bacteria | 1448 |
| 307 | Ga0373936_0075741 | 3300035113 | Bacteria | 1393 |
| 308 | Ga0373945_0030164 | 3300035116 | Bacteria | 1910 |
| 309 | Ga0373945_0059526 | 3300035116 | Bacteria | 1422 |
| 310 | Ga0373945_0068247 | 3300035116 | Bacteria | 1340 |
| 311 | Ga0373945_0100380 | 3300035116 | Bacteria | 1132 |
| 312 | Ga0373953_0059855 | 3300035117 | Bacteria | 1555 |
| 313 | Ga0373953_0061514 | 3300035117 | Bacteria | 1535 |
| 314 | Ga0373954_0082685 | 3300035118 | Bacteria | 1535 |
| 315 | Ga0373954_0088099 | 3300035118 | Bacteria | 1488 |
| 316 | Ga0373956_0066586 | 3300035119 | Bacteria | 1638 |
| 317 | Ga0373956_0087905 | 3300035119 | Bacteria | 1431 |
| 318 | Ga0373957_0059439 | 3300035120 | Bacteria | 1478 |
| 319 | Ga0373957_0125015 | 3300035120 | Bacteria | 1043 |
| 320 | Ga0373943_0075857 | 3300035170 | Bacteria | 1713 |
| 321 | Ga0373943_0131275 | 3300035170 | Bacteria | 1340 |
| 322 | Ga0373943_0187868 | 3300035170 | Bacteria | 1138 |
| 323 | Ga0373943_0464303 | 3300035170 | Bacteria | 737 |
| 324 | Ga0373946_0084264 | 3300035171 | Bacteria | 1397 |
| 325 | Ga0373946_0086731 | 3300035171 | Bacteria | 1380 |
| 326 | Ga0373946_0087135 | 3300035171 | Bacteria | 1377 |
| 327 | Ga0373946_0130085 | 3300035171 | Bacteria | 1157 |
| 328 | Ga0373946_0153889 | 3300035171 | Bacteria | 1075 |
| 329 | Ga0373955_0117576 | 3300035172 | Bacteria | 1542 |
| 330 | Ga0373955_0384878 | 3300035172 | Bacteria | 851 |
| 331 | Ga0373942_0153805 | 3300035207 | Bacteria | 740 |
| 332 | Ga0316574_0107753 | 3300035398 | Bacteria | 1785 |
| 333 | Ga0373924_0046896 | 3300035410 | Bacteria | 1781 |
| 334 | Ga0373924_0123204 | 3300035410 | Bacteria | 1125 |
| 335 | Ga0373924_0477042 | 3300035410 | Bacteria | 560 |
| 336 | Ga0373935_0151938 | 3300035692 | Bacteria | 1571 |
| 337 | Ga0373935_0212344 | 3300035692 | Bacteria | 1341 |
| 338 | Ga0373935_0415658 | 3300035692 | Bacteria | 967 |
| 339 | Ga0373935_1046655 | 3300035692 | Bacteria | 607 |
| 340 | Ga0373927_0157903 | 3300035695 | Bacteria | 1485 |
| 341 | Ga0373927_0261363 | 3300035695 | Bacteria | 1138 |
| 342 | Ga0373927_0422769 | 3300035695 | Bacteria | 879 |
| 343 | Ga0373927_0487698 | 3300035695 | Bacteria | 814 |
| 344 | Ga0373933_0172272 | 3300035724 | Bacteria | 1377 |
| 345 | Ga0373933_0178808 | 3300035724 | Bacteria | 1352 |
| 346 | Ga0373933_0369420 | 3300035724 | Bacteria | 933 |
| 347 | Ga0373947_0098565 | 3300035725 | Bacteria | 1833 |
| 348 | Ga0373947_0105969 | 3300035725 | Bacteria | 1771 |
| 349 | Ga0373947_0256725 | 3300035725 | Bacteria | 1157 |
| 350 | Ga0373947_0720142 | 3300035725 | Bacteria | 681 |
| 351 | Ga0373937_0110578 | 3300036401 | Bacteria | 2555 |
| 352 | Ga0373937_0317224 | 3300036401 | Bacteria | 1474 |
| 353 | Ga0373937_0328162 | 3300036401 | Bacteria | 1448 |
| 354 | Ga0373937_0370130 | 3300036401 | Bacteria | 1358 |
| 355 | Ga0373937_1205156 | 3300036401 | Bacteria | 705 |
| 356 | Ga0316582_0001824 | 3300036647 | Bacteria | 9637 |
| 357 | Ga0316582_1270999 | 3300036647 | Bacteria | 500 |
| 358 | Ga0316584_0014865 | 3300036712 | Bacteria | 5560 |
| 359 | Ga0316584_0669560 | 3300036712 | Bacteria | 714 |
| 360 | Ga0373925_0058690 | 3300037068 | Bacteria | 2885 |
| 361 | Ga0373925_0096744 | 3300037068 | Bacteria | 2263 |
| 362 | Ga0373925_0449151 | 3300037068 | Bacteria | 1055 |
| 363 | Ga0373925_1436016 | 3300037068 | Bacteria | 565 |
| 364 | Ga0316581_0111762 | 3300037588 | Bacteria | 842 |
| 365 | Ga0436364_0105997 | 3300037853 | Bacteria | 2959 |
| 366 | Ga0436364_0309800 | 3300037853 | Bacteria | 505 |
| 367 | Ga0436364_0573740 | 3300037853 | Bacteria | 1326 |
| 368 | Ga0436364_1125838 | 3300037853 | Bacteria | 2470 |
| 369 | Ga0395901_1522460 | 3300038443 | Bacteria | 624 |
| 370 | Ga0395901_1970073 | 3300038443 | Bacteria | 531 |
| 371 | Ga0395901_2113597 | 3300038443 | Bacteria | 508 |
| 372 | Ga0400491_09399 | 3300038727 | Bacteria | 1465 |
| 373 | Ga0400483_279772 | 3300039062 | Bacteria | 1429 |
| 374 | Ga0436361_0044481 | 3300039447 | Bacteria | 1081 |
| 375 | Ga0439453_0074328 | 3300041408 | Bacteria | 724 |
| 376 | Ga0439466_0178272 | 3300041411 | Bacteria | 648 |
| 377 | Ga0451789_0042650 | 3300041443 | Bacteria | 1040 |
| 378 | Ga0451791_0011144 | 3300041451 | Bacteria | 1721 |
| 379 | Ga0451797_0728442 | 3300041453 | Bacteria | 938 |
| 380 | Ga0451806_650239 | 3300041462 | Bacteria | 838 |
| 381 | Ga0451804_0748938 | 3300041463 | Bacteria | 1308 |
| 382 | Ga0451807_2057432 | 3300041486 | Bacteria | 1291 |
| 383 | Ga0451835_1087131 | 3300041492 | Bacteria | 1137 |
| 384 | Ga0439449_0091366 | 3300042007 | Bacteria | 1124 |
| 385 | Ga0439450_229923 | 3300042008 | Bacteria | 501 |
| 386 | Ga0439452_089516 | 3300042010 | Bacteria | 666 |
| 387 | Ga0439452_126427 | 3300042010 | Bacteria | 543 |
| 388 | Ga0439456_070758 | 3300042013 | Bacteria | 773 |
| 389 | Ga0450923_070741 | 3300042125 | Bacteria | 773 |
| 390 | Ga0450896_014900 | 3300042133 | Bacteria | 1111 |
| 391 | Ga0450898_051491 | 3300042134 | Bacteria | 796 |
| 392 | Ga0450906_059266 | 3300042145 | Bacteria | 680 |
| 393 | Ga0439446_0026564 | 3300042156 | Bacteria | 1659 |
| 394 | Ga0450908_069517 | 3300042184 | Bacteria | 624 |
| 395 | Ga0439434_0076549 | 3300042435 | Bacteria | 1058 |
| 396 | Ga0451577_0258403 | 3300042876 | Bacteria | 1577 |
| 397 | Ga0466969_0402056 | 3300044656 | Bacteria | 622 |
| 398 | Ga0466961_0472845 | 3300044693 | Bacteria | 758 |
| 399 | Ga0466963_0522263 | 3300044694 | Bacteria | 838 |
| 400 | Ga0466970_0260059 | 3300044765 | Bacteria | 974 |
| 401 | Ga0466958_0898205 | 3300045836 | Bacteria | 578 |
| 402 | Ga0466967_0139996 | 3300045976 | Bacteria | 2253 |
| 403 | Ga0466967_1848260 | 3300045976 | Bacteria | 601 |
| 404 | Ga0495617_099588 | 3300046452 | Bacteria | 945 |
| 405 | Ga0495627_212368 | 3300046453 | Bacteria | 532 |
| 406 | Ga0495592_0145694 | 3300046454 | Bacteria | 1642 |
| 407 | Ga0495592_0161473 | 3300046454 | Bacteria | 1541 |
| 408 | Ga0495592_0186558 | 3300046454 | Bacteria | 1408 |
| 409 | Ga0495592_0649089 | 3300046454 | Bacteria | 639 |
| 410 | Ga0495603_0063339 | 3300046455 | Bacteria | 2181 |
| 411 | Ga0495603_0142417 | 3300046455 | Bacteria | 1394 |
| 412 | Ga0495603_0156083 | 3300046455 | Bacteria | 1324 |
| 413 | Ga0495590_0002933 | 3300046457 | Bacteria | 7021 |
| 414 | Ga0495590_0036120 | 3300046457 | Bacteria | 1723 |
| 415 | Ga0495591_035547 | 3300046458 | Bacteria | 1457 |
| 416 | Ga0495629_0013766 | 3300046459 | Bacteria | 5836 |
| 417 | Ga0495629_0112654 | 3300046459 | Bacteria | 1896 |
| 418 | Ga0495629_0200840 | 3300046459 | Bacteria | 1378 |
| 419 | Ga0495629_0403854 | 3300046459 | Bacteria | 928 |
| 420 | Ga0495638_0131412 | 3300046460 | Bacteria | 1470 |
| 421 | Ga0495641_0107752 | 3300046461 | Bacteria | 1243 |
| 422 | Ga0495641_0278327 | 3300046461 | Bacteria | 753 |
| 423 | Ga0495641_0468117 | 3300046461 | Bacteria | 574 |
| 424 | Ga0495641_0607399 | 3300046461 | Bacteria | 500 |
| 425 | Ga0495651_0195108 | 3300046462 | Bacteria | 1421 |
| 426 | Ga0495651_0195109 | 3300046462 | Bacteria | 1421 |
| 427 | Ga0495651_0196676 | 3300046462 | Bacteria | 1414 |
| 428 | Ga0495653_0070521 | 3300046463 | Bacteria | 2615 |
| 429 | Ga0495653_0104864 | 3300046463 | Bacteria | 2042 |
| 430 | Ga0495653_0144197 | 3300046463 | Bacteria | 1671 |
| 431 | Ga0495653_0192875 | 3300046463 | Bacteria | 1388 |
| 432 | Ga0495653_0298876 | 3300046463 | Bacteria | 1051 |
| 433 | Ga0495650_0014917 | 3300046471 | Bacteria | 4010 |
| 434 | Ga0495650_0058020 | 3300046471 | Bacteria | 1564 |
| 435 | Ga0495580_0006397 | 3300046472 | Bacteria | 9599 |
| 436 | Ga0495580_0140155 | 3300046472 | Bacteria | 1676 |
| 437 | Ga0495580_0193451 | 3300046472 | Bacteria | 1402 |
| 438 | Ga0495580_0207802 | 3300046472 | Bacteria | 1347 |
| 439 | Ga0495580_0295518 | 3300046472 | Bacteria | 1103 |
| 440 | Ga0495582_0124759 | 3300046473 | Bacteria | 1452 |
| 441 | Ga0495582_0758195 | 3300046473 | Bacteria | 561 |
| 442 | Ga0495605_0026412 | 3300046474 | Bacteria | 3019 |
| 443 | Ga0495605_0095825 | 3300046474 | Bacteria | 1369 |
| 444 | Ga0495605_0141610 | 3300046474 | Bacteria | 1078 |
| 445 | Ga0495639_0101548 | 3300046475 | Bacteria | 1358 |
| 446 | Ga0495639_0130120 | 3300046475 | Bacteria | 1204 |
| 447 | Ga0495662_0061906 | 3300046476 | Bacteria | 1808 |
| 448 | Ga0495662_0094547 | 3300046476 | Bacteria | 1459 |
| 449 | Ga0495662_0107893 | 3300046476 | Bacteria | 1363 |
| 450 | Ga0495662_0452297 | 3300046476 | Bacteria | 630 |
| 451 | Ga0495662_0582388 | 3300046476 | Bacteria | 547 |
| 452 | Ga0495664_0025368 | 3300046477 | Bacteria | 3450 |
| 453 | Ga0495664_0101274 | 3300046477 | Bacteria | 1735 |
| 454 | Ga0495664_0147601 | 3300046477 | Bacteria | 1426 |
| 455 | Ga0495664_0335953 | 3300046477 | Bacteria | 910 |
| 456 | Ga0495584_0022112 | 3300046491 | Bacteria | 3227 |
| 457 | Ga0495585_0103948 | 3300046492 | Bacteria | 1516 |
| 458 | Ga0495594_0133609 | 3300046499 | Bacteria | 1405 |
| 459 | Ga0495594_0141762 | 3300046499 | Bacteria | 1363 |
| 460 | Ga0495594_0226743 | 3300046499 | Bacteria | 1065 |
| 461 | Ga0495596_0016715 | 3300046500 | Bacteria | 3044 |
| 462 | Ga0495607_0112360 | 3300046501 | Bacteria | 1442 |
| 463 | Ga0495607_0113580 | 3300046501 | Bacteria | 1432 |
| 464 | Ga0495607_0262598 | 3300046501 | Bacteria | 826 |
| 465 | Ga0495583_0000607 | 3300046506 | Bacteria | 48463 |
| 466 | Ga0495583_0007045 | 3300046506 | Bacteria | 7187 |
| 467 | Ga0495583_0070194 | 3300046506 | Bacteria | 1541 |
| 468 | Ga0495583_0078012 | 3300046506 | Bacteria | 1443 |
| 469 | Ga0495606_0024939 | 3300046507 | Bacteria | 4294 |
| 470 | Ga0495606_0080001 | 3300046507 | Bacteria | 2034 |
| 471 | Ga0495606_0128554 | 3300046507 | Bacteria | 1508 |
| 472 | Ga0495606_0279544 | 3300046507 | Bacteria | 913 |
| 473 | Ga0495608_0126676 | 3300046511 | Bacteria | 1635 |
| 474 | Ga0495608_0139248 | 3300046511 | Bacteria | 1549 |
| 475 | Ga0495608_0153497 | 3300046511 | Bacteria | 1466 |
| 476 | Ga0495608_0210495 | 3300046511 | Bacteria | 1222 |
| 477 | Ga0495610_0321045 | 3300046512 | Bacteria | 591 |
| 478 | Ga0495616_0033661 | 3300046513 | Bacteria | 2667 |
| 479 | Ga0495616_0082750 | 3300046513 | Bacteria | 1532 |
| 480 | Ga0495618_0135333 | 3300046514 | Bacteria | 1576 |
| 481 | Ga0495618_0160000 | 3300046514 | Bacteria | 1436 |
| 482 | Ga0495618_0162437 | 3300046514 | Bacteria | 1423 |
| 483 | Ga0495618_0170847 | 3300046514 | Bacteria | 1383 |
| 484 | Ga0495618_0394950 | 3300046514 | Bacteria | 847 |
| 485 | Ga0495618_0733549 | 3300046514 | Bacteria | 579 |
| 486 | Ga0495620_0028642 | 3300046515 | Bacteria | 2587 |
| 487 | Ga0495620_0075585 | 3300046515 | Bacteria | 1370 |
| 488 | Ga0495628_0163854 | 3300046516 | Bacteria | 1688 |
| 489 | Ga0495628_0181574 | 3300046516 | Bacteria | 1591 |
| 490 | Ga0495628_0241651 | 3300046516 | Bacteria | 1350 |
| 491 | Ga0495630_0102363 | 3300046517 | Bacteria | 2166 |
| 492 | Ga0495630_0142679 | 3300046517 | Bacteria | 1821 |
| 493 | Ga0495630_0274292 | 3300046517 | Bacteria | 1288 |
| 494 | Ga0495631_0069097 | 3300046518 | Bacteria | 1527 |
| 495 | Ga0495632_0028797 | 3300046519 | Bacteria | 2897 |
| 496 | Ga0495632_0039124 | 3300046519 | Bacteria | 2396 |
| 497 | Ga0495632_0172232 | 3300046519 | Bacteria | 994 |
| 498 | Ga0495637_0067973 | 3300046520 | Bacteria | 1445 |
| 499 | Ga0495637_0103823 | 3300046520 | Bacteria | 1108 |
| 500 | Ga0495643_0054843 | 3300046522 | Bacteria | 2132 |
| 501 | Ga0495644_0062806 | 3300046523 | Bacteria | 1395 |
| 502 | Ga0495644_0344074 | 3300046523 | Bacteria | 587 |
| 503 | Ga0495648_0003532 | 3300046524 | Bacteria | 13691 |
| 504 | Ga0495648_0013427 | 3300046524 | Bacteria | 6056 |
| 505 | Ga0495648_0063859 | 3300046524 | Bacteria | 2171 |
| 506 | Ga0495648_0081312 | 3300046524 | Bacteria | 1843 |
| 507 | Ga0495648_0096107 | 3300046524 | Bacteria | 1647 |
| 508 | Ga0495666_0082360 | 3300046526 | Bacteria | 1521 |
| 509 | Ga0495666_0088511 | 3300046526 | Bacteria | 1462 |
| 510 | Ga0495666_0247707 | 3300046526 | Bacteria | 812 |
| 511 | Ga0495642_0009484 | 3300046528 | Bacteria | 3724 |
| 512 | Ga0495642_0030353 | 3300046528 | Bacteria | 2162 |
| 513 | Ga0495642_0080414 | 3300046528 | Bacteria | 1371 |
| 514 | Ga0495652_0169789 | 3300046529 | Bacteria | 1685 |
| 515 | Ga0495652_0228735 | 3300046529 | Bacteria | 1392 |
| 516 | Ga0495654_0021791 | 3300046530 | Bacteria | 3332 |
| 517 | Ga0495654_0053012 | 3300046530 | Bacteria | 1973 |
| 518 | Ga0495665_0096293 | 3300046531 | Bacteria | 1554 |
| 519 | Ga0495665_0100445 | 3300046531 | Bacteria | 1518 |
| 520 | Ga0495665_0206683 | 3300046531 | Bacteria | 1017 |
| 521 | Ga0495665_0342277 | 3300046531 | Bacteria | 762 |
| 522 | Ga0495665_0680385 | 3300046531 | Bacteria | 511 |
| 523 | Ga0495640_0119906 | 3300046533 | Bacteria | 1711 |
| 524 | Ga0495640_0153688 | 3300046533 | Bacteria | 1477 |
| 525 | Ga0495640_0167431 | 3300046533 | Bacteria | 1405 |
| 526 | Ga0495640_0444411 | 3300046533 | Bacteria | 793 |
| 527 | Ga0495586_0116765 | 3300046535 | Bacteria | 1488 |
| 528 | Ga0495586_0131655 | 3300046535 | Bacteria | 1400 |
| 529 | Ga0495586_0261099 | 3300046535 | Bacteria | 989 |
| 530 | Ga0495587_0091901 | 3300046536 | Bacteria | 1752 |
| 531 | Ga0495587_0106884 | 3300046536 | Bacteria | 1609 |
| 532 | Ga0495587_0138197 | 3300046536 | Bacteria | 1391 |
| 533 | Ga0495621_0052811 | 3300046539 | Bacteria | 1457 |
| 534 | Ga0495597_0026676 | 3300046542 | Bacteria | 2653 |
| 535 | Ga0495597_0069606 | 3300046542 | Bacteria | 1518 |
| 536 | Ga0495645_0154713 | 3300046543 | Bacteria | 1589 |
| 537 | Ga0495645_0178351 | 3300046543 | Bacteria | 1457 |
| 538 | Ga0495645_0185162 | 3300046543 | Bacteria | 1423 |
| 539 | Ga0495645_0200409 | 3300046543 | Bacteria | 1354 |
| 540 | Ga0495622_0084598 | 3300046557 | Bacteria | 1459 |
| 541 | Ga0495633_0036382 | 3300046558 | Bacteria | 2359 |
| 542 | Ga0495633_0326197 | 3300046558 | Bacteria | 696 |
| 543 | Ga0495667_0136454 | 3300046559 | Bacteria | 1581 |
| 544 | Ga0495667_0138507 | 3300046559 | Bacteria | 1568 |
| 545 | Ga0495667_0156455 | 3300046559 | Bacteria | 1466 |
| 546 | Ga0495667_0258043 | 3300046559 | Bacteria | 1109 |
| 547 | Ga0495667_0442919 | 3300046559 | Bacteria | 816 |
| 548 | Ga0495656_0077409 | 3300046615 | Bacteria | 1492 |
| 549 | Ga0495668_0022302 | 3300046616 | Bacteria | 3620 |
| 550 | Ga0495634_0062285 | 3300046642 | Bacteria | 2477 |
| 551 | Ga0495634_0152876 | 3300046642 | Bacteria | 1458 |
| 552 | Ga0495634_0161678 | 3300046642 | Bacteria | 1411 |
| 553 | Ga0495634_0237357 | 3300046642 | Bacteria | 1119 |
| 554 | Ga0495611_0077193 | 3300046648 | Bacteria | 1527 |
| 555 | Ga0495625_0006453 | 3300046660 | Bacteria | 10438 |
| 556 | Ga0495625_0167084 | 3300046660 | Bacteria | 1470 |
| 557 | Ga0495625_0728047 | 3300046660 | Bacteria | 583 |
| 558 | Ga0495635_0146827 | 3300046663 | Bacteria | 1605 |
| 559 | Ga0495635_0166114 | 3300046663 | Bacteria | 1501 |
| 560 | Ga0495635_0168769 | 3300046663 | Bacteria | 1488 |
| 561 | Ga0495661_0131410 | 3300046665 | Bacteria | 1371 |
| 562 | Ga0495661_0146315 | 3300046665 | Bacteria | 1280 |
| 563 | Ga0495661_0619808 | 3300046665 | Bacteria | 507 |
| 564 | Ga0495588_0122191 | 3300046674 | Bacteria | 1372 |
| 565 | Ga0495588_0292901 | 3300046674 | Bacteria | 857 |
| 566 | Ga0495657_0043261 | 3300046675 | Bacteria | 3072 |
| 567 | Ga0495657_0133466 | 3300046675 | Bacteria | 1553 |
| 568 | Ga0495657_0136248 | 3300046675 | Bacteria | 1533 |
| 569 | Ga0495657_0169660 | 3300046675 | Bacteria | 1344 |
| 570 | Ga0495657_0213624 | 3300046675 | Bacteria | 1172 |
| 571 | Ga0495599_0156749 | 3300046678 | Bacteria | 1408 |
| 572 | Ga0495599_0164734 | 3300046678 | Bacteria | 1369 |
| 573 | Ga0495623_0106379 | 3300046679 | Bacteria | 1704 |
| 574 | Ga0495623_0151466 | 3300046679 | Bacteria | 1370 |
| 575 | Ga0495623_0152717 | 3300046679 | Bacteria | 1363 |
| 576 | Ga0495623_0660887 | 3300046679 | Bacteria | 538 |
| 577 | Ga0495646_0077365 | 3300046680 | Bacteria | 1946 |
| 578 | Ga0495646_0110662 | 3300046680 | Bacteria | 1564 |
| 579 | Ga0495646_0123302 | 3300046680 | Bacteria | 1464 |
| 580 | Ga0495646_0130577 | 3300046680 | Bacteria | 1414 |
| 581 | Ga0495647_0059436 | 3300046681 | Bacteria | 1505 |
| 582 | Ga0495647_0068717 | 3300046681 | Bacteria | 1413 |
| 583 | Ga0495647_0162467 | 3300046681 | Bacteria | 963 |
| 584 | Ga0495658_0201494 | 3300046683 | Bacteria | 1240 |
| 585 | Ga0495658_0247506 | 3300046683 | Bacteria | 1120 |
| 586 | Ga0495658_0291352 | 3300046683 | Bacteria | 1031 |
| 587 | Ga0495669_0007236 | 3300046684 | Bacteria | 4649 |
| 588 | Ga0495669_0015473 | 3300046684 | Bacteria | 3267 |
| 589 | Ga0495669_0082671 | 3300046684 | Bacteria | 1475 |
| 590 | Ga0495613_0116356 | 3300046689 | Bacteria | 1923 |
| 591 | Ga0495613_0119897 | 3300046689 | Bacteria | 1889 |
| 592 | Ga0495613_0173830 | 3300046689 | Bacteria | 1527 |
| 593 | Ga0495613_0186953 | 3300046689 | Bacteria | 1465 |
| 594 | Ga0495624_0091514 | 3300046690 | Bacteria | 1876 |
| 595 | Ga0495624_0133971 | 3300046690 | Bacteria | 1518 |
| 596 | Ga0495624_0157156 | 3300046690 | Bacteria | 1389 |
| 597 | Ga0495624_0429243 | 3300046690 | Bacteria | 792 |
| 598 | Ga0495670_0100618 | 3300046691 | Bacteria | 1488 |
| 599 | Ga0495670_0111560 | 3300046691 | Bacteria | 1415 |
| 600 | Ga0495670_0498140 | 3300046691 | Bacteria | 661 |
| 601 | Ga0495671_0095388 | 3300046692 | Bacteria | 1455 |
| 602 | Ga0495671_0103797 | 3300046692 | Bacteria | 1388 |
| 603 | Ga0495671_0111397 | 3300046692 | Bacteria | 1336 |
| 604 | Ga0495671_0576274 | 3300046692 | Bacteria | 535 |
| 605 | Ga0495649_0033028 | 3300046694 | Bacteria | 2848 |
| 606 | Ga0495649_0104453 | 3300046694 | Bacteria | 1504 |
| 607 | Ga0495649_0129760 | 3300046694 | Bacteria | 1330 |
| 608 | Ga0495649_0133819 | 3300046694 | Bacteria | 1307 |
| 609 | Ga0495589_0022625 | 3300046794 | Bacteria | 3206 |
| 610 | Ga0495589_0058955 | 3300046794 | Bacteria | 1887 |
| 611 | Ga0495589_0092126 | 3300046794 | Bacteria | 1471 |
| 612 | Ga0495600_0045735 | 3300046809 | Bacteria | 2856 |
| 613 | Ga0495600_0151284 | 3300046809 | Bacteria | 1502 |
| 614 | Ga0495600_0152695 | 3300046809 | Bacteria | 1495 |
| 615 | Ga0495600_0158720 | 3300046809 | Bacteria | 1462 |
| 616 | Ga0495660_0035507 | 3300046810 | Bacteria | 2784 |
| 617 | Ga0495660_0113459 | 3300046810 | Bacteria | 1380 |
| 618 | Ga0495660_0114475 | 3300046810 | Bacteria | 1372 |
| 619 | Ga0495581_0081423 | 3300047315 | Bacteria | 1874 |
| 620 | Ga0495581_0123529 | 3300047315 | Bacteria | 1507 |
| 621 | Ga0495581_0127458 | 3300047315 | Bacteria | 1482 |
| 622 | Ga0495581_0137411 | 3300047315 | Bacteria | 1425 |
| 623 | Ga0495604_0207468 | 3300047317 | Bacteria | 1355 |
| 624 | Ga0495604_0278342 | 3300047317 | Bacteria | 1131 |
| 625 | Ga0495604_0328128 | 3300047317 | Bacteria | 1021 |
| 626 | Ga0495604_1028889 | 3300047317 | Bacteria | 508 |
| 627 | Ga0495674_0044862 | 3300047319 | Bacteria | 3928 |
| 628 | Ga0495674_0227103 | 3300047319 | Bacteria | 1542 |
| 629 | Ga0495674_0240872 | 3300047319 | Bacteria | 1491 |
| 630 | Ga0495674_0307220 | 3300047319 | Bacteria | 1294 |
| 631 | Ga0495674_0331699 | 3300047319 | Bacteria | 1238 |
| 632 | Ga0495674_0707261 | 3300047319 | Bacteria | 790 |
| 633 | Ga0495674_0825713 | 3300047319 | Bacteria | 719 |
| 634 | Ga0495672_0012514 | 3300047320 | Bacteria | 5917 |
| 635 | Ga0495672_0039428 | 3300047320 | Bacteria | 2871 |
| 636 | Ga0495676_0079240 | 3300047321 | Bacteria | 2498 |
| 637 | Ga0495676_0186181 | 3300047321 | Bacteria | 1451 |
| 638 | Ga0495676_0187563 | 3300047321 | Bacteria | 1444 |
| 639 | Ga0495676_0245230 | 3300047321 | Bacteria | 1225 |
| 640 | Ga0495676_0313791 | 3300047321 | Bacteria | 1054 |
| 641 | Ga0495680_0066951 | 3300047322 | Bacteria | 2747 |
| 642 | Ga0495680_0196828 | 3300047322 | Bacteria | 1447 |
| 643 | Ga0495680_0217714 | 3300047322 | Bacteria | 1364 |
| 644 | Ga0495680_0219835 | 3300047322 | Bacteria | 1356 |
| 645 | Ga0495680_0615644 | 3300047322 | Bacteria | 725 |
| 646 | Ga0495683_0004881 | 3300047323 | Bacteria | 7513 |
| 647 | Ga0495683_0044650 | 3300047323 | Bacteria | 2228 |
| 648 | Ga0495683_0069302 | 3300047323 | Bacteria | 1733 |
| 649 | Ga0495683_0084127 | 3300047323 | Bacteria | 1548 |
| 650 | Ga0495687_018699 | 3300047443 | Bacteria | 3417 |
| 651 | Ga0495687_020732 | 3300047443 | Bacteria | 3199 |
| 652 | Ga0495675_0151002 | 3300047444 | Bacteria | 1435 |
| 653 | Ga0495675_0159693 | 3300047444 | Bacteria | 1388 |
| 654 | Ga0495675_0163806 | 3300047444 | Bacteria | 1368 |
| 655 | Ga0495675_0164624 | 3300047444 | Bacteria | 1364 |
| 656 | Ga0495675_0435926 | 3300047444 | Bacteria | 760 |
| 657 | Ga0495677_0062008 | 3300047445 | Bacteria | 1387 |
| 658 | Ga0495679_000074 | 3300047446 | Bacteria | 95881 |
| 659 | Ga0495679_028694 | 3300047446 | Bacteria | 1823 |
| 660 | Ga0495679_104231 | 3300047446 | Bacteria | 785 |
| 661 | Ga0495685_044742 | 3300047447 | Bacteria | 1509 |
| 662 | Ga0495673_0005854 | 3300047469 | Bacteria | 7351 |
| 663 | Ga0495673_0010616 | 3300047469 | Bacteria | 4997 |
| 664 | Ga0495673_0020105 | 3300047469 | Bacteria | 3330 |
| 665 | Ga0495681_0077406 | 3300047470 | Bacteria | 1492 |
| 666 | Ga0495684_0188994 | 3300047471 | Bacteria | 1523 |
| 667 | Ga0495684_0195463 | 3300047471 | Bacteria | 1493 |
| 668 | Ga0495684_0806975 | 3300047471 | Bacteria | 612 |
| 669 | Ga0495686_0001044 | 3300047472 | Bacteria | 33258 |
| 670 | Ga0495686_0129795 | 3300047472 | Bacteria | 1495 |
| 671 | Ga0495686_0460773 | 3300047472 | Bacteria | 674 |
| 672 | Ga0495593_0100950 | 3300047673 | Bacteria | 1479 |
| 673 | Ga0495593_0103624 | 3300047673 | Bacteria | 1457 |
| 674 | Ga0495593_0114613 | 3300047673 | Bacteria | 1374 |
| 675 | Ga0495593_0145725 | 3300047673 | Bacteria | 1198 |
| 676 | Ga0495593_0174866 | 3300047673 | Bacteria | 1082 |
| 677 | Ga0495602_0193858 | 3300048088 | Bacteria | 1555 |
| 678 | Ga0495602_0200463 | 3300048088 | Bacteria | 1523 |
| 679 | Ga0495602_0206060 | 3300048088 | Bacteria | 1496 |
| 680 | Ga0495602_0604770 | 3300048088 | Bacteria | 754 |
| 681 | Ga0495602_0655298 | 3300048088 | Bacteria | 716 |
| 682 | Ga0495614_0078827 | 3300048089 | Bacteria | 1425 |
| 683 | Ga0495614_0118121 | 3300048089 | Bacteria | 1168 |
| 684 | Ga0495614_0171859 | 3300048089 | Bacteria | 972 |
| 685 | Ga0495614_0441818 | 3300048089 | Bacteria | 615 |
| 686 | Ga0495626_0073016 | 3300048091 | Bacteria | 1537 |
| 687 | Ga0495626_0097608 | 3300048091 | Bacteria | 1284 |
| 688 | Ga0495626_0150504 | 3300048091 | Bacteria | 981 |
| 689 | Ga0496100_0027437 | 3300048903 | Bacteria | 3501 |
| 690 | Ga0496100_0119526 | 3300048903 | Bacteria | 1841 |
| 691 | Ga0496100_0126890 | 3300048903 | Bacteria | 1791 |
| 692 | Ga0496100_0173287 | 3300048903 | Bacteria | 1555 |
| 693 | Ga0496100_0243775 | 3300048903 | Bacteria | 1327 |
| 694 | Ga0496100_0800290 | 3300048903 | Bacteria | 738 |
| 695 | Ga0496101_0027851 | 3300048904 | Bacteria | 3940 |
| 696 | Ga0496101_0101946 | 3300048904 | Bacteria | 2149 |
| 697 | Ga0496101_0162083 | 3300048904 | Bacteria | 1715 |
| 698 | Ga0496101_0229806 | 3300048904 | Bacteria | 1441 |
| 699 | Ga0496101_0243642 | 3300048904 | Bacteria | 1399 |
| 700 | Ga0496101_0247637 | 3300048904 | Bacteria | 1388 |
| 701 | Ga0496101_0315989 | 3300048904 | Bacteria | 1225 |
| 702 | Ga0496102_0060368 | 3300048905 | Bacteria | 3467 |
| 703 | Ga0496102_0263907 | 3300048905 | Bacteria | 1623 |
| 704 | Ga0496102_0503003 | 3300048905 | Bacteria | 1134 |
| 705 | Ga0496103_0040556 | 3300048906 | Bacteria | 2860 |
| 706 | Ga0496103_0143965 | 3300048906 | Bacteria | 1525 |
| 707 | Ga0496104_0035316 | 3300048907 | Bacteria | 4667 |
| 708 | Ga0496104_0039757 | 3300048907 | Bacteria | 4404 |
| 709 | Ga0496104_0333967 | 3300048907 | Bacteria | 1428 |
| 710 | Ga0496104_0426508 | 3300048907 | Bacteria | 1238 |
| 711 | Ga0496104_0480068 | 3300048907 | Bacteria | 1154 |
| 712 | Ga0496104_0507265 | 3300048907 | Bacteria | 1117 |
| 713 | Ga0496104_0690450 | 3300048907 | Bacteria | 929 |
| 714 | Ga0496104_0691144 | 3300048907 | Bacteria | 928 |
| 715 | Ga0496104_1878235 | 3300048907 | Bacteria | 501 |
| 716 | Ga0496105_0009047 | 3300048908 | Bacteria | 7772 |
| 717 | Ga0496105_0083287 | 3300048908 | Bacteria | 2641 |
| 718 | Ga0496105_0126136 | 3300048908 | Bacteria | 2110 |
| 719 | Ga0496105_0219080 | 3300048908 | Bacteria | 1549 |
| 720 | Ga0496105_0220187 | 3300048908 | Bacteria | 1545 |
| 721 | Ga0496105_0475751 | 3300048908 | Bacteria | 983 |
| 722 | Ga0496105_0896926 | 3300048908 | Bacteria | 668 |
| 723 | Ga0496106_0061709 | 3300048909 | Bacteria | 2844 |
| 724 | Ga0496106_0252121 | 3300048909 | Bacteria | 1411 |
| 725 | Ga0496106_0266342 | 3300048909 | Bacteria | 1371 |
| 726 | Ga0496106_1408451 | 3300048909 | Bacteria | 538 |
| 727 | Ga0496107_0030529 | 3300048910 | Bacteria | 3841 |
| 728 | Ga0496107_0176705 | 3300048910 | Bacteria | 1585 |
| 729 | Ga0496107_0213913 | 3300048910 | Bacteria | 1433 |
| 730 | Ga0496107_0234880 | 3300048910 | Bacteria | 1364 |
| 731 | Ga0496107_0953206 | 3300048910 | Bacteria | 624 |
| 732 | Ga0496108_0067635 | 3300048911 | Bacteria | 3013 |
| 733 | Ga0496108_0260709 | 3300048911 | Bacteria | 1508 |
| 734 | Ga0496108_0413226 | 3300048911 | Bacteria | 1178 |
| 735 | Ga0496109_0064488 | 3300048912 | Bacteria | 3352 |
| 736 | Ga0496109_0203360 | 3300048912 | Bacteria | 1862 |
| 737 | Ga0496109_0273600 | 3300048912 | Bacteria | 1591 |
| 738 | Ga0496109_0682147 | 3300048912 | Bacteria | 965 |
| 739 | Ga0496109_0698070 | 3300048912 | Bacteria | 952 |
| 740 | Ga0496110_0050639 | 3300048913 | Bacteria | 3647 |
| 741 | Ga0496110_0242669 | 3300048913 | Bacteria | 1639 |
| 742 | Ga0496110_0346352 | 3300048913 | Bacteria | 1353 |
| 743 | Ga0496111_0009138 | 3300048914 | Bacteria | 6596 |
| 744 | Ga0496111_0097031 | 3300048914 | Bacteria | 2163 |
| 745 | Ga0496112_0014694 | 3300048915 | Bacteria | 7277 |
| 746 | Ga0496112_0387898 | 3300048915 | Bacteria | 1337 |
| 747 | Ga0496113_0023826 | 3300048916 | Bacteria | 4344 |
| 748 | Ga0496113_0928634 | 3300048916 | Bacteria | 687 |
| 749 | Ga0496114_0161751 | 3300048917 | Bacteria | 1947 |
| 750 | Ga0496114_0279570 | 3300048917 | Bacteria | 1471 |
| 751 | Ga0496114_0396220 | 3300048917 | Bacteria | 1223 |
| 752 | Ga0496114_0764264 | 3300048917 | Bacteria | 844 |
| 753 | Ga0496114_0905341 | 3300048917 | Bacteria | 763 |
| 754 | Ga0496115_0026500 | 3300048918 | Bacteria | 4524 |
| 755 | Ga0496115_0037264 | 3300048918 | Bacteria | 3853 |
| 756 | Ga0496115_0037513 | 3300048918 | Bacteria | 3840 |
| 757 | Ga0496115_0939872 | 3300048918 | Bacteria | 664 |
| 758 | Ga0496116_0068885 | 3300048919 | Bacteria | 2252 |
| 759 | Ga0496116_0147826 | 3300048919 | Bacteria | 1310 |
| 760 | Ga0496117_0045834 | 3300048920 | Bacteria | 3152 |
| 761 | Ga0496117_0051367 | 3300048920 | Bacteria | 2914 |
| 762 | Ga0496117_0092362 | 3300048920 | Bacteria | 1944 |
| 763 | Ga0496118_0010561 | 3300048921 | Bacteria | 9126 |
| 764 | Ga0496118_0050708 | 3300048921 | Bacteria | 3181 |
| 765 | Ga0496118_0107215 | 3300048921 | Bacteria | 1866 |
| 766 | Ga0496119_0054130 | 3300048922 | Bacteria | 2445 |
| 767 | Ga0496119_0122388 | 3300048922 | Bacteria | 1428 |
| 768 | Ga0496120_0038699 | 3300048923 | Bacteria | 2819 |
| 769 | Ga0496120_0103875 | 3300048923 | Bacteria | 1496 |
| 770 | Ga0496121_0000061 | 3300048924 | Bacteria | 275757 |
| 771 | Ga0496121_0025083 | 3300048924 | Bacteria | 5674 |
| 772 | Ga0496121_0076188 | 3300048924 | Bacteria | 2675 |
| 773 | Ga0496121_0080032 | 3300048924 | Bacteria | 2592 |
| 774 | Ga0496121_0183574 | 3300048924 | Bacteria | 1507 |
| 775 | Ga0496122_0003452 | 3300048925 | Bacteria | 20787 |
| 776 | Ga0496122_0053435 | 3300048925 | Bacteria | 3045 |
| 777 | Ga0496122_0185087 | 3300048925 | Bacteria | 1236 |
| 778 | Ga0496123_0000992 | 3300048926 | Bacteria | 43625 |
| 779 | Ga0496123_0048281 | 3300048926 | Bacteria | 2864 |
| 780 | Ga0496123_0153831 | 3300048926 | Bacteria | 1236 |
| 781 | Ga0496124_0068327 | 3300048927 | Bacteria | 2953 |
| 782 | Ga0496124_0647837 | 3300048927 | Bacteria | 678 |
| 783 | Ga0496125_0021360 | 3300048928 | Bacteria | 6040 |
| 784 | Ga0496125_0062775 | 3300048928 | Bacteria | 2967 |
| 785 | Ga0496126_0085820 | 3300048929 | Bacteria | 2775 |
| 786 | Ga0496126_0261655 | 3300048929 | Bacteria | 1438 |
| 787 | Ga0496126_0308439 | 3300048929 | Bacteria | 1303 |
| 788 | Ga0495678_015939 | 3300049459 | Bacteria | 3448 |
| 789 | Ga0495678_037735 | 3300049459 | Bacteria | 1960 |
| 790 | Ga0495678_167237 | 3300049459 | Bacteria | 698 |
| 791 | Ga0495682_0004477 | 3300049460 | Bacteria | 5970 |
| 792 | Ga0495682_0013582 | 3300049460 | Bacteria | 3097 |
| 793 | Ga0495682_0014380 | 3300049460 | Bacteria | 3002 |
| 794 | Ga0501299_103219 | 3300049522 | Bacteria | 665 |
| 795 | Ga0501031_0057845 | 3300049568 | Bacteria | 2526 |
| 796 | Ga0501031_0110428 | 3300049568 | Bacteria | 1795 |
| 797 | Ga0501031_0112732 | 3300049568 | Bacteria | 1776 |
| 798 | Ga0501031_0255607 | 3300049568 | Bacteria | 1138 |
| 799 | Ga0501032_0007349 | 3300049569 | Bacteria | 8050 |
| 800 | Ga0501032_0009618 | 3300049569 | Bacteria | 7005 |
| 801 | Ga0501032_0501770 | 3300049569 | Bacteria | 775 |
| 802 | Ga0501032_0716859 | 3300049569 | Bacteria | 633 |
| 803 | Ga0501033_0004875 | 3300049570 | Bacteria | 10685 |
| 804 | Ga0501033_0120621 | 3300049570 | Bacteria | 1903 |
| 805 | Ga0501033_0206579 | 3300049570 | Bacteria | 1401 |
| 806 | Ga0501034_0369498 | 3300049571 | Bacteria | 1360 |
| 807 | Ga0501034_0394411 | 3300049571 | Bacteria | 1307 |
| 808 | Ga0501036_0100978 | 3300049572 | Bacteria | 2440 |
| 809 | Ga0501036_0196816 | 3300049572 | Bacteria | 1695 |
| 810 | Ga0501036_0197048 | 3300049572 | Bacteria | 1694 |
| 811 | Ga0501036_0264243 | 3300049572 | Bacteria | 1441 |
| 812 | Ga0501036_0436816 | 3300049572 | Bacteria | 1091 |
| 813 | Ga0501036_0824001 | 3300049572 | Bacteria | 763 |
| 814 | Ga0501037_0000216 | 3300049573 | Bacteria | 50948 |
| 815 | Ga0501037_0078431 | 3300049573 | Bacteria | 2396 |
| 816 | Ga0501037_0167355 | 3300049573 | Bacteria | 1564 |
| 817 | Ga0501038_0007407 | 3300049574 | Bacteria | 10122 |
| 818 | Ga0501038_0193931 | 3300049574 | Bacteria | 1633 |
| 819 | Ga0501038_0447733 | 3300049574 | Bacteria | 993 |
| 820 | Ga0501038_0727707 | 3300049574 | Bacteria | 741 |
| 821 | Ga0501039_0035352 | 3300049575 | Bacteria | 3855 |
| 822 | Ga0501039_0040938 | 3300049575 | Bacteria | 3577 |
| 823 | Ga0501039_0267541 | 3300049575 | Bacteria | 1343 |
| 824 | Ga0501039_1054942 | 3300049575 | Bacteria | 630 |
| 825 | Ga0501039_1097078 | 3300049575 | Bacteria | 617 |
| 826 | Ga0501040_0052235 | 3300049576 | Bacteria | 2797 |
| 827 | Ga0501040_1001477 | 3300049576 | Bacteria | 606 |
| 828 | Ga0501040_1379904 | 3300049576 | Bacteria | 511 |
| 829 | Ga0501041_0007807 | 3300049577 | Bacteria | 6286 |
| 830 | Ga0501041_0167662 | 3300049577 | Bacteria | 1373 |
| 831 | Ga0501041_0259976 | 3300049577 | Bacteria | 1091 |
| 832 | Ga0501042_0119433 | 3300049578 | Bacteria | 1898 |
| 833 | Ga0501042_0173927 | 3300049578 | Bacteria | 1553 |
| 834 | Ga0501042_0228098 | 3300049578 | Bacteria | 1343 |
| 835 | Ga0501043_0000132 | 3300049579 | Bacteria | 69702 |
| 836 | Ga0501043_0043939 | 3300049579 | Bacteria | 3512 |
| 837 | Ga0501043_0094351 | 3300049579 | Bacteria | 2352 |
| 838 | Ga0501043_0239224 | 3300049579 | Bacteria | 1400 |
| 839 | Ga0501043_0256985 | 3300049579 | Bacteria | 1344 |
| 840 | Ga0501046_0035473 | 3300049580 | Bacteria | 4019 |
| 841 | Ga0501046_0152727 | 3300049580 | Bacteria | 1741 |
| 842 | Ga0501046_0210012 | 3300049580 | Bacteria | 1445 |
| 843 | Ga0501047_0066064 | 3300049581 | Bacteria | 3486 |
| 844 | Ga0501047_0151585 | 3300049581 | Bacteria | 2194 |
| 845 | Ga0501047_0262995 | 3300049581 | Bacteria | 1572 |
| 846 | Ga0501047_0352672 | 3300049581 | Bacteria | 1308 |
| 847 | Ga0501047_1114437 | 3300049581 | Bacteria | 603 |
| 848 | Ga0501048_0146246 | 3300049582 | Bacteria | 1671 |
| 849 | Ga0501048_0210608 | 3300049582 | Bacteria | 1378 |
| 850 | Ga0501067_0810313 | 3300049583 | Bacteria | 527 |
| 851 | Ga0501068_0029163 | 3300049584 | Bacteria | 3266 |
| 852 | Ga0501068_0080907 | 3300049584 | Bacteria | 1993 |
| 853 | Ga0501068_0171479 | 3300049584 | Bacteria | 1369 |
| 854 | Ga0501069_0000051 | 3300049585 | Bacteria | 70783 |
| 855 | Ga0501069_0139327 | 3300049585 | Bacteria | 1391 |
| 856 | Ga0501069_0659237 | 3300049585 | Bacteria | 630 |
| 857 | Ga0501069_0832802 | 3300049585 | Bacteria | 560 |
| 858 | Ga0501070_0001832 | 3300049586 | Bacteria | 18737 |
| 859 | Ga0501070_0072902 | 3300049586 | Bacteria | 2842 |
| 860 | Ga0501070_0507927 | 3300049586 | Bacteria | 968 |
| 861 | Ga0501070_0601739 | 3300049586 | Bacteria | 876 |
| 862 | Ga0501071_0014770 | 3300049587 | Bacteria | 5346 |
| 863 | Ga0501071_0155621 | 3300049587 | Bacteria | 1706 |
| 864 | Ga0501072_0032112 | 3300049588 | Bacteria | 4111 |
| 865 | Ga0501072_0080175 | 3300049588 | Bacteria | 2585 |
| 866 | Ga0501073_0004947 | 3300049589 | Bacteria | 10000 |
| 867 | Ga0501073_0059743 | 3300049589 | Bacteria | 2662 |
| 868 | Ga0501073_0178121 | 3300049589 | Bacteria | 1471 |
| 869 | Ga0501074_0000043 | 3300049590 | Bacteria | 59245 |
| 870 | Ga0501074_0085629 | 3300049590 | Bacteria | 2258 |
| 871 | Ga0501075_0071265 | 3300049591 | Bacteria | 2626 |
| 872 | Ga0501075_0174326 | 3300049591 | Bacteria | 1641 |
| 873 | Ga0501075_0182724 | 3300049591 | Bacteria | 1600 |
| 874 | Ga0501075_0561076 | 3300049591 | Bacteria | 871 |
| 875 | Ga0501075_0876960 | 3300049591 | Bacteria | 682 |
| 876 | Ga0501076_0058838 | 3300049592 | Bacteria | 3055 |
| 877 | Ga0501076_0237529 | 3300049592 | Bacteria | 1490 |
| 878 | Ga0501076_0460267 | 3300049592 | Bacteria | 1047 |
| 879 | Ga0501076_1372667 | 3300049592 | Bacteria | 581 |
| 880 | Ga0501077_0115112 | 3300049593 | Bacteria | 1704 |
| 881 | Ga0501077_0389035 | 3300049593 | Bacteria | 891 |
| 882 | Ga0501079_0086296 | 3300049741 | Bacteria | 2429 |
| 883 | Ga0501079_0220261 | 3300049741 | Bacteria | 1482 |
| 884 | Ga0501079_0852499 | 3300049741 | Bacteria | 717 |
| 885 | Ga0501080_0001519 | 3300049742 | Bacteria | 19586 |
| 886 | Ga0501080_0001537 | 3300049742 | Bacteria | 19481 |
| 887 | Ga0501080_0259844 | 3300049742 | Bacteria | 1582 |
| 888 | Ga0501080_0322553 | 3300049742 | Bacteria | 1398 |
| 889 | Ga0501081_0155384 | 3300049743 | Bacteria | 1645 |
| 890 | Ga0501081_0201582 | 3300049743 | Bacteria | 1443 |
| 891 | Ga0501083_0000247 | 3300049744 | Bacteria | 34317 |
| 892 | Ga0501083_0173693 | 3300049744 | Bacteria | 1408 |
| 893 | Ga0501083_0599967 | 3300049744 | Bacteria | 716 |
| 894 | Ga0501035_0000280 | 3300049822 | Bacteria | 60510 |
| 895 | Ga0501035_0079197 | 3300049822 | Bacteria | 2902 |
| 896 | Ga0501035_0186790 | 3300049822 | Bacteria | 1783 |
| 897 | Ga0501035_0270789 | 3300049822 | Bacteria | 1437 |
| 898 | Ga0501044_0001427 | 3300049823 | Bacteria | 28051 |
| 899 | Ga0501044_0015615 | 3300049823 | Bacteria | 8178 |
| 900 | Ga0501044_0091608 | 3300049823 | Bacteria | 3066 |
| 901 | Ga0501045_0172807 | 3300049824 | Bacteria | 1609 |
| 902 | Ga0501045_0190959 | 3300049824 | Bacteria | 1526 |
| 903 | nmdc:mga05p37_482271_c1 | 3300050507 | Bacteria | 1428 |
| 904 | nmdc:mga09592_349490_c1 | 3300050508 | Bacteria | 1280 |
| 905 | nmdc:mga0qj67_1250747_c1 | 3300050509 | Bacteria | 576 |
| 906 | nmdc:mga0qj67_242075_c1 | 3300050509 | Bacteria | 1464 |
| 907 | nmdc:mga0qj67_692248_c1 | 3300050509 | Bacteria | 811 |
| 908 | nmdc:mga06r32_1312036_c1 | 3300050510 | Bacteria | 667 |
| 909 | nmdc:mga06r32_325375_c1 | 3300050510 | Bacteria | 1523 |
| 910 | nmdc:mga08y16_136466_c1 | 3300050511 | Bacteria | 2550 |
| 911 | nmdc:mga08x19_125380_c1 | 3300050514 | Bacteria | 1724 |
| 912 | Ga0495601_0133313 | 3300053077 | Bacteria | 1619 |
| 913 | Ga0495601_0141741 | 3300053077 | Bacteria | 1568 |
| 914 | Ga0495601_0165163 | 3300053077 | Bacteria | 1447 |
| 915 | Ga0495601_0490153 | 3300053077 | Bacteria | 793 |
| 916 | Ga0495601_0705542 | 3300053077 | Bacteria | 643 |
| 917 | Ga0495612_0054777 | 3300053078 | Bacteria | 1643 |
| 918 | Ga0495612_0073179 | 3300053078 | Bacteria | 1431 |
| 919 | Ga0495612_0076323 | 3300053078 | Bacteria | 1403 |
| 920 | Ga0495612_0341893 | 3300053078 | Bacteria | 675 |
| 921 | Ga0495595_0091017 | 3300053084 | Bacteria | 1463 |
| 922 | Ga0495595_0108467 | 3300053084 | Bacteria | 1344 |
| 923 | Ga0495595_0428617 | 3300053084 | Bacteria | 671 |
| 924 | Ga0495619_0092116 | 3300053085 | Bacteria | 2053 |
| 925 | Ga0495619_0101847 | 3300053085 | Bacteria | 1955 |
| 926 | Ga0495619_0188490 | 3300053085 | Bacteria | 1427 |
| 927 | Ga0500583_0090653 | 3300053092 | Bacteria | 1487 |
| 928 | Ga0500595_144112 | 3300053119 | Bacteria | 667 |
| 929 | Ga0500618_021111 | 3300053125 | Bacteria | 1591 |
| 930 | Ga0500559_0012819 | 3300053136 | Bacteria | 3557 |
| 931 | Ga0500574_221144 | 3300053141 | Bacteria | 524 |
| 932 | Ga0500616_0061557 | 3300053153 | Bacteria | 1942 |
| 933 | Ga0500645_000352 | 3300053730 | Bacteria | 32678 |
| 934 | Ga0500645_001130 | 3300053730 | Bacteria | 14508 |
| 935 | Ga0501084_0129108 | 3300054114 | Bacteria | 2127 |
| 936 | Ga0501084_0213461 | 3300054114 | Bacteria | 1628 |
| 937 | Ga0501082_0020122 | 3300060353 | Bacteria | 5751 |
| 938 | Ga0501082_0255816 | 3300060353 | Bacteria | 1523 |
| 939 | Ga0501082_0289447 | 3300060353 | Bacteria | 1426 |
| 940 | Ga0530510_0029607 | 3300061734 | Bacteria | 3931 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005468 | Ga0070707_100970467 | Ga0070707_1009704672 | 96 |
| 2 | 3300013105 | Ga0157369_11138615 | Ga0157369_111386152 | 97 |
| 3 | 3300015684 | Ga0183365_10008 | Ga0183365_1000861 | 97 |
| 4 | 3300042876 | Ga0451577_0258403 | Ga0451577_0258403_1271_1564 | 97 |
| 5 | 3300048912 | Ga0496109_0698070 | Ga0496109_0698070_340_633 | 97 |
| 6 | 3300048917 | Ga0496114_0161751 | Ga0496114_0161751_26_319 | 97 |
| 7 | 3300009094 | Ga0111539_11643268 | Ga0111539_116432681 | 99 |
| 8 | iso_pu_bacteria | 2595698237 | 2596376567 | 104 |
| 9 | iso_pu_bacteria | 2643221636 | 2644205032 | 104 |
| 10 | iso_pu_bacteria | 2773857925 | 2774872209 | 104 |
| 11 | iso_pu_bacteria | 2818991438 | 2819552101 | 104 |
| 12 | iso_pu_bacteria | 2889306138 | 2889306563 | 104 |
| 13 | iso_pu_bacteria | 2889306138 | 2889309589 | 104 |
| 14 | iso_pu_bacteria | 8003955200 | 8003963172 | 104 |
| 15 | iso_pu_bacteria | 2511231221 | 2512032772 | 105 |
| 16 | iso_pu_bacteria | 2511231221 | 2512033890 | 105 |
| 17 | iso_pu_bacteria | 2511231221 | 2512035602 | 105 |
| 18 | iso_pu_bacteria | 2511231221 | 2512036032 | 105 |
| 19 | iso_pu_bacteria | 2511231221 | 2512036037 | 105 |
| 20 | iso_pu_bacteria | 2511231221 | 2512036793 | 105 |
| 21 | iso_pu_bacteria | 2511231221 | 2512036878 | 105 |
| 22 | iso_pu_bacteria | 2513237351 | 2514588097 | 105 |
| 23 | iso_pu_bacteria | 2756170246 | 2756678164 | 105 |
| 24 | iso_pu_bacteria | 2842333319 | 2842341700 | 105 |
| 25 | iso_pu_bacteria | 2885350715 | 2885352895 | 105 |
| 26 | iso_pu_bacteria | 2897803580 | 2897807801 | 105 |
| 27 | iso_pu_bacteria | 2899275550 | 2899279439 | 105 |
| 28 | iso_pu_bacteria | 2917699015 | 2917705411 | 105 |
| 29 | iso_pu_bacteria | 8054002106 | 8054002966 | 105 |
| 30 | 3300003203 | JGI25406J46586_10037561 | JGI25406J46586_100375612 | 106 |
| 31 | 3300003203 | JGI25406J46586_10040120 | JGI25406J46586_100401202 | 106 |
| 32 | 3300005290 | Ga0065712_10294991 | Ga0065712_102949912 | 106 |
| 33 | 3300005293 | Ga0065715_10328151 | Ga0065715_103281511 | 106 |
| 34 | 3300005295 | Ga0065707_11079123 | Ga0065707_110791231 | 106 |
| 35 | 3300005331 | Ga0070670_100622975 | Ga0070670_1006229752 | 106 |
| 36 | 3300005334 | Ga0068869_100218925 | Ga0068869_1002189252 | 106 |
| 37 | 3300005337 | Ga0070682_100064785 | Ga0070682_1000647852 | 106 |
| 38 | 3300005354 | Ga0070675_100111634 | Ga0070675_1001116341 | 106 |
| 39 | 3300005365 | Ga0070688_100327416 | Ga0070688_1003274161 | 106 |
| 40 | 3300005365 | Ga0070688_100904759 | Ga0070688_1009047592 | 106 |
| 41 | 3300005367 | Ga0070667_101008652 | Ga0070667_1010086522 | 106 |
| 42 | 3300005455 | Ga0070663_101438891 | Ga0070663_1014388911 | 106 |
| 43 | 3300005466 | Ga0070685_10145997 | Ga0070685_101459972 | 106 |
| 44 | 3300005471 | Ga0070698_100304462 | Ga0070698_1003044622 | 106 |
| 45 | 3300005548 | Ga0070665_100547289 | Ga0070665_1005472892 | 106 |
| 46 | 3300005549 | Ga0070704_100770565 | Ga0070704_1007705652 | 106 |
| 47 | 3300005616 | Ga0068852_100006949 | Ga0068852_1000069492 | 106 |
| 48 | 3300005617 | Ga0068859_102388689 | Ga0068859_1023886892 | 106 |
| 49 | 3300005719 | Ga0068861_102582594 | Ga0068861_1025825942 | 106 |
| 50 | 3300005841 | Ga0068863_100386720 | Ga0068863_1003867202 | 106 |
| 51 | 3300005841 | Ga0068863_100890361 | Ga0068863_1008903612 | 106 |
| 52 | 3300005985 | Ga0081539_10012508 | Ga0081539_100125083 | 106 |
| 53 | 3300005985 | Ga0081539_10054045 | Ga0081539_100540452 | 106 |
| 54 | 3300006237 | Ga0097621_100177034 | Ga0097621_1001770342 | 106 |
| 55 | 3300006358 | Ga0068871_100221464 | Ga0068871_1002214643 | 106 |
| 56 | 3300006844 | Ga0075428_100429855 | Ga0075428_1004298551 | 106 |
| 57 | 3300006844 | Ga0075428_102243809 | Ga0075428_1022438091 | 106 |
| 58 | 3300006846 | Ga0075430_100287654 | Ga0075430_1002876542 | 106 |
| 59 | 3300006846 | Ga0075430_101783466 | Ga0075430_1017834661 | 106 |
| 60 | 3300006914 | Ga0075436_100143339 | Ga0075436_1001433392 | 106 |
| 61 | 3300009092 | Ga0105250_10302218 | Ga0105250_103022182 | 106 |
| 62 | 3300009094 | Ga0111539_10061134 | Ga0111539_100611342 | 106 |
| 63 | 3300009101 | Ga0105247_10216304 | Ga0105247_102163041 | 106 |
| 64 | 3300014325 | Ga0163163_10291901 | Ga0163163_102919012 | 106 |
| 65 | 3300014325 | Ga0163163_11112003 | Ga0163163_111120032 | 106 |
| 66 | 3300014968 | Ga0157379_10151646 | Ga0157379_101516463 | 106 |
| 67 | 3300014969 | Ga0157376_10348050 | Ga0157376_103480501 | 106 |
| 68 | 3300014969 | Ga0157376_13099856 | Ga0157376_130998561 | 106 |
| 69 | 3300017792 | Ga0163161_10241960 | Ga0163161_102419601 | 106 |
| 70 | 3300017792 | Ga0163161_10788740 | Ga0163161_107887402 | 106 |
| 71 | 3300025900 | Ga0207710_10007973 | Ga0207710_100079733 | 106 |
| 72 | 3300025912 | Ga0207707_10228670 | Ga0207707_102286701 | 106 |
| 73 | 3300025921 | Ga0207652_10355340 | Ga0207652_103553401 | 106 |
| 74 | 3300025926 | Ga0207659_10083362 | Ga0207659_100833623 | 106 |
| 75 | 3300025938 | Ga0207704_10169615 | Ga0207704_101696152 | 106 |
| 76 | 3300025940 | Ga0207691_10106659 | Ga0207691_101066594 | 106 |
| 77 | 3300025960 | Ga0207651_11724907 | Ga0207651_117249072 | 106 |
| 78 | 3300025986 | Ga0207658_10439077 | Ga0207658_104390772 | 106 |
| 79 | 3300026088 | Ga0207641_10337801 | Ga0207641_103378011 | 106 |
| 80 | 3300026088 | Ga0207641_11218551 | Ga0207641_112185512 | 106 |
| 81 | 3300026089 | Ga0207648_10052234 | Ga0207648_100522344 | 106 |
| 82 | 3300026142 | Ga0207698_10012755 | Ga0207698_100127555 | 106 |
| 83 | 3300027907 | Ga0207428_10049284 | Ga0207428_100492844 | 106 |
| 84 | 3300028381 | Ga0268264_10481848 | Ga0268264_104818481 | 106 |
| 85 | 3300032002 | Ga0307416_100413121 | Ga0307416_1004131212 | 106 |
| 86 | 3300032133 | Ga0316583_10076543 | Ga0316583_100765431 | 106 |
| 87 | 3300036401 | Ga0373937_0328162 | Ga0373937_0328162_341_661 | 106 |
| 88 | 3300041451 | Ga0451791_0011144 | Ga0451791_0011144_1010_1339 | 106 |
| 89 | 3300041463 | Ga0451804_0748938 | Ga0451804_0748938_349_678 | 106 |
| 90 | 3300041486 | Ga0451807_2057432 | Ga0451807_2057432_668_997 | 106 |
| 91 | 3300041492 | Ga0451835_1087131 | Ga0451835_1087131_124_453 | 106 |
| 92 | 3300042007 | Ga0439449_0091366 | Ga0439449_0091366_150_479 | 106 |
| 93 | 3300042156 | Ga0439446_0026564 | Ga0439446_0026564_30_359 | 106 |
| 94 | 3300044694 | Ga0466963_0522263 | Ga0466963_0522263_413_733 | 106 |
| 95 | 3300045976 | Ga0466967_0139996 | Ga0466967_0139996_214_534 | 106 |
| 96 | 3300045976 | Ga0466967_1848260 | Ga0466967_1848260_155_475 | 106 |
| 97 | 3300046472 | Ga0495580_0140155 | Ga0495580_0140155_318_638 | 106 |
| 98 | 3300046559 | Ga0495667_0258043 | Ga0495667_0258043_725_1045 | 106 |
| 99 | 3300046675 | Ga0495657_0213624 | Ga0495657_0213624_800_1120 | 106 |
| 100 | 3300047315 | Ga0495581_0123529 | Ga0495581_0123529_345_665 | 106 |
| 101 | 3300047322 | Ga0495680_0615644 | Ga0495680_0615644_98_418 | 106 |
| 102 | 3300047444 | Ga0495675_0435926 | Ga0495675_0435926_121_441 | 106 |
| 103 | 3300048907 | Ga0496104_0507265 | Ga0496104_0507265_45_365 | 106 |
| 104 | 3300048907 | Ga0496104_1878235 | Ga0496104_1878235_92_412 | 106 |
| 105 | 3300048912 | Ga0496109_0682147 | Ga0496109_0682147_275_595 | 106 |
| 106 | 3300049568 | Ga0501031_0057845 | Ga0501031_0057845_2015_2335 | 106 |
| 107 | 3300049568 | Ga0501031_0255607 | Ga0501031_0255607_127_456 | 106 |
| 108 | 3300049569 | Ga0501032_0009618 | Ga0501032_0009618_2843_3163 | 106 |
| 109 | 3300049569 | Ga0501032_0501770 | Ga0501032_0501770_364_684 | 106 |
| 110 | 3300049570 | Ga0501033_0120621 | Ga0501033_0120621_1519_1839 | 106 |
| 111 | 3300049571 | Ga0501034_0394411 | Ga0501034_0394411_936_1256 | 106 |
| 112 | 3300049572 | Ga0501036_0100978 | Ga0501036_0100978_809_1129 | 106 |
| 113 | 3300049572 | Ga0501036_0196816 | Ga0501036_0196816_999_1319 | 106 |
| 114 | 3300049572 | Ga0501036_0264243 | Ga0501036_0264243_1025_1354 | 106 |
| 115 | 3300049572 | Ga0501036_0436816 | Ga0501036_0436816_215_535 | 106 |
| 116 | 3300049573 | Ga0501037_0167355 | Ga0501037_0167355_1104_1424 | 106 |
| 117 | 3300049574 | Ga0501038_0007407 | Ga0501038_0007407_16_336 | 106 |
| 118 | 3300049574 | Ga0501038_0193931 | Ga0501038_0193931_953_1273 | 106 |
| 119 | 3300049575 | Ga0501039_0035352 | Ga0501039_0035352_3449_3769 | 106 |
| 120 | 3300049575 | Ga0501039_0040938 | Ga0501039_0040938_245_565 | 106 |
| 121 | 3300049575 | Ga0501039_0267541 | Ga0501039_0267541_104_433 | 106 |
| 122 | 3300049576 | Ga0501040_0052235 | Ga0501040_0052235_454_774 | 106 |
| 123 | 3300049576 | Ga0501040_1001477 | Ga0501040_1001477_35_355 | 106 |
| 124 | 3300049576 | Ga0501040_1379904 | Ga0501040_1379904_134_463 | 106 |
| 125 | 3300049577 | Ga0501041_0007807 | Ga0501041_0007807_3432_3761 | 106 |
| 126 | 3300049577 | Ga0501041_0167662 | Ga0501041_0167662_103_423 | 106 |
| 127 | 3300049577 | Ga0501041_0259976 | Ga0501041_0259976_22_351 | 106 |
| 128 | 3300049578 | Ga0501042_0173927 | Ga0501042_0173927_231_551 | 106 |
| 129 | 3300049578 | Ga0501042_0228098 | Ga0501042_0228098_981_1310 | 106 |
| 130 | 3300049579 | Ga0501043_0043939 | Ga0501043_0043939_3041_3370 | 106 |
| 131 | 3300049579 | Ga0501043_0094351 | Ga0501043_0094351_447_767 | 106 |
| 132 | 3300049579 | Ga0501043_0256985 | Ga0501043_0256985_60_380 | 106 |
| 133 | 3300049580 | Ga0501046_0035473 | Ga0501046_0035473_1760_2080 | 106 |
| 134 | 3300049580 | Ga0501046_0152727 | Ga0501046_0152727_54_374 | 106 |
| 135 | 3300049581 | Ga0501047_0066064 | Ga0501047_0066064_2988_3308 | 106 |
| 136 | 3300049582 | Ga0501048_0146246 | Ga0501048_0146246_1026_1346 | 106 |
| 137 | 3300049583 | Ga0501067_0810313 | Ga0501067_0810313_137_457 | 106 |
| 138 | 3300049584 | Ga0501068_0080907 | Ga0501068_0080907_1514_1834 | 106 |
| 139 | 3300049584 | Ga0501068_0171479 | Ga0501068_0171479_89_409 | 106 |
| 140 | 3300049585 | Ga0501069_0139327 | Ga0501069_0139327_85_405 | 106 |
| 141 | 3300049586 | Ga0501070_0601739 | Ga0501070_0601739_448_768 | 106 |
| 142 | 3300049587 | Ga0501071_0155621 | Ga0501071_0155621_1318_1638 | 106 |
| 143 | 3300049588 | Ga0501072_0032112 | Ga0501072_0032112_3673_3993 | 106 |
| 144 | 3300049588 | Ga0501072_0080175 | Ga0501072_0080175_1820_2140 | 106 |
| 145 | 3300049589 | Ga0501073_0004947 | Ga0501073_0004947_5838_6158 | 106 |
| 146 | 3300049589 | Ga0501073_0178121 | Ga0501073_0178121_1085_1405 | 106 |
| 147 | 3300049590 | Ga0501074_0085629 | Ga0501074_0085629_1691_2011 | 106 |
| 148 | 3300049591 | Ga0501075_0071265 | Ga0501075_0071265_2233_2553 | 106 |
| 149 | 3300049591 | Ga0501075_0174326 | Ga0501075_0174326_162_491 | 106 |
| 150 | 3300049591 | Ga0501075_0561076 | Ga0501075_0561076_38_367 | 106 |
| 151 | 3300049591 | Ga0501075_0876960 | Ga0501075_0876960_74_403 | 106 |
| 152 | 3300049592 | Ga0501076_0058838 | Ga0501076_0058838_1528_1848 | 106 |
| 153 | 3300049592 | Ga0501076_0237529 | Ga0501076_0237529_1077_1406 | 106 |
| 154 | 3300049593 | Ga0501077_0115112 | Ga0501077_0115112_1277_1597 | 106 |
| 155 | 3300049593 | Ga0501077_0389035 | Ga0501077_0389035_396_716 | 106 |
| 156 | 3300049741 | Ga0501079_0086296 | Ga0501079_0086296_71_391 | 106 |
| 157 | 3300049741 | Ga0501079_0220261 | Ga0501079_0220261_974_1294 | 106 |
| 158 | 3300049741 | Ga0501079_0852499 | Ga0501079_0852499_318_647 | 106 |
| 159 | 3300049742 | Ga0501080_0001537 | Ga0501080_0001537_7622_7942 | 106 |
| 160 | 3300049742 | Ga0501080_0259844 | Ga0501080_0259844_1175_1495 | 106 |
| 161 | 3300049743 | Ga0501081_0155384 | Ga0501081_0155384_1235_1555 | 106 |
| 162 | 3300049743 | Ga0501081_0201582 | Ga0501081_0201582_202_531 | 106 |
| 163 | 3300049744 | Ga0501083_0173693 | Ga0501083_0173693_967_1287 | 106 |
| 164 | 3300049822 | Ga0501035_0079197 | Ga0501035_0079197_1624_1944 | 106 |
| 165 | 3300049822 | Ga0501035_0270789 | Ga0501035_0270789_1050_1370 | 106 |
| 166 | 3300049823 | Ga0501044_0015615 | Ga0501044_0015615_3781_4101 | 106 |
| 167 | 3300049824 | Ga0501045_0190959 | Ga0501045_0190959_1133_1453 | 106 |
| 168 | 3300050509 | nmdc:mga0qj67_692248_c1 | nmdc:mga0qj67_692248_c1_130_450 | 106 |
| 169 | 3300050511 | nmdc:mga08y16_136466_c1 | nmdc:mga08y16_136466_c1_2048_2368 | 106 |
| 170 | 3300050514 | nmdc:mga08x19_125380_c1 | nmdc:mga08x19_125380_c1_43_363 | 106 |
| 171 | 3300053084 | Ga0495595_0428617 | Ga0495595_0428617_304_624 | 106 |
| 172 | 3300053092 | Ga0500583_0090653 | Ga0500583_0090653_28_348 | 106 |
| 173 | 3300053730 | Ga0500645_000352 | Ga0500645_000352_22659_22979 | 106 |
| 174 | 3300053730 | Ga0500645_001130 | Ga0500645_001130_7197_7517 | 106 |
| 175 | 3300054114 | Ga0501084_0129108 | Ga0501084_0129108_1719_2039 | 106 |
| 176 | 3300054114 | Ga0501084_0213461 | Ga0501084_0213461_46_375 | 106 |
| 177 | 3300060353 | Ga0501082_0020122 | Ga0501082_0020122_4306_4626 | 106 |
| 178 | 3300060353 | Ga0501082_0255816 | Ga0501082_0255816_1163_1483 | 106 |
| 179 | 3300061734 | Ga0530510_0029607 | Ga0530510_0029607_2364_2684 | 106 |
| 180 | iso_pu_bacteria | 2513237082 | 2513558661 | 106 |
| 181 | iso_pu_bacteria | 2513237082 | 2513558874 | 106 |
| 182 | iso_pu_bacteria | 2902682994 | 2902684440 | 106 |
| 183 | iso_pu_bacteria | 2902682994 | 2902685555 | 106 |
| 184 | iso_pu_bacteria | 8003955200 | 8003963254 | 106 |
| 185 | 3300002244 | JGI24742J22300_10030343 | JGI24742J22300_100303431 | 107 |
| 186 | 3300005327 | Ga0070658_10312761 | Ga0070658_103127611 | 107 |
| 187 | 3300005331 | Ga0070670_101244196 | Ga0070670_1012441961 | 107 |
| 188 | 3300005331 | Ga0070670_101459568 | Ga0070670_1014595682 | 107 |
| 189 | 3300005334 | Ga0068869_100301097 | Ga0068869_1003010971 | 107 |
| 190 | 3300005338 | Ga0068868_100212352 | Ga0068868_1002123522 | 107 |
| 191 | 3300005354 | Ga0070675_100346522 | Ga0070675_1003465221 | 107 |
| 192 | 3300005364 | Ga0070673_101113402 | Ga0070673_1011134022 | 107 |
| 193 | 3300005367 | Ga0070667_100320820 | Ga0070667_1003208201 | 107 |
| 194 | 3300005456 | Ga0070678_100291393 | Ga0070678_1002913932 | 107 |
| 195 | 3300005466 | Ga0070685_10106003 | Ga0070685_101060032 | 107 |
| 196 | 3300005539 | Ga0068853_102065077 | Ga0068853_1020650772 | 107 |
| 197 | 3300005543 | Ga0070672_100169555 | Ga0070672_1001695552 | 107 |
| 198 | 3300005548 | Ga0070665_100314592 | Ga0070665_1003145924 | 107 |
| 199 | 3300005563 | Ga0068855_100349567 | Ga0068855_1003495671 | 107 |
| 200 | 3300005564 | Ga0070664_101005843 | Ga0070664_1010058431 | 107 |
| 201 | 3300005614 | Ga0068856_100305166 | Ga0068856_1003051663 | 107 |
| 202 | 3300005617 | Ga0068859_101278173 | Ga0068859_1012781732 | 107 |
| 203 | 3300005618 | Ga0068864_100374626 | Ga0068864_1003746261 | 107 |
| 204 | 3300005718 | Ga0068866_10275061 | Ga0068866_102750611 | 107 |
| 205 | 3300005841 | Ga0068863_100327227 | Ga0068863_1003272272 | 107 |
| 206 | 3300006237 | Ga0097621_100132935 | Ga0097621_1001329353 | 107 |
| 207 | 3300006358 | Ga0068871_100132447 | Ga0068871_1001324472 | 107 |
| 208 | 3300006881 | Ga0068865_100198362 | Ga0068865_1001983621 | 107 |
| 209 | 3300006931 | Ga0097620_101278283 | Ga0097620_1012782832 | 107 |
| 210 | 3300009545 | Ga0105237_11697765 | Ga0105237_116977652 | 107 |
| 211 | 3300013306 | Ga0163162_10449836 | Ga0163162_104498361 | 107 |
| 212 | 3300025899 | Ga0207642_10407032 | Ga0207642_104070322 | 107 |
| 213 | 3300025901 | Ga0207688_10224182 | Ga0207688_102241821 | 107 |
| 214 | 3300025903 | Ga0207680_10265213 | Ga0207680_102652131 | 107 |
| 215 | 3300025909 | Ga0207705_10218017 | Ga0207705_102180171 | 107 |
| 216 | 3300025914 | Ga0207671_10321905 | Ga0207671_103219051 | 107 |
| 217 | 3300025934 | Ga0207686_10235736 | Ga0207686_102357361 | 107 |
| 218 | 3300025935 | Ga0207709_11282694 | Ga0207709_112826942 | 107 |
| 219 | 3300025936 | Ga0207670_11112775 | Ga0207670_111127751 | 107 |
| 220 | 3300025940 | Ga0207691_10284678 | Ga0207691_102846782 | 107 |
| 221 | 3300025941 | Ga0207711_10166274 | Ga0207711_101662741 | 107 |
| 222 | 3300025942 | Ga0207689_10157847 | Ga0207689_101578472 | 107 |
| 223 | 3300025949 | Ga0207667_10290741 | Ga0207667_102907411 | 107 |
| 224 | 3300025986 | Ga0207658_10585200 | Ga0207658_105852002 | 107 |
| 225 | 3300026078 | Ga0207702_10266954 | Ga0207702_102669541 | 107 |
| 226 | 3300026088 | Ga0207641_10383447 | Ga0207641_103834472 | 107 |
| 227 | 3300026095 | Ga0207676_11419938 | Ga0207676_114199381 | 107 |
| 228 | 3300026121 | Ga0207683_10260227 | Ga0207683_102602272 | 107 |
| 229 | 3300028379 | Ga0268266_10272892 | Ga0268266_102728923 | 107 |
| 230 | 3300031727 | Ga0316576_10001399 | Ga0316576_1000139911 | 107 |
| 231 | 3300031727 | Ga0316576_10237034 | Ga0316576_102370342 | 107 |
| 232 | 3300031728 | Ga0316578_10074903 | Ga0316578_100749032 | 107 |
| 233 | 3300031728 | Ga0316578_10377055 | Ga0316578_103770552 | 107 |
| 234 | 3300031733 | Ga0316577_10001739 | Ga0316577_100017393 | 107 |
| 235 | 3300032133 | Ga0316583_10291867 | Ga0316583_102918672 | 107 |
| 236 | 3300032137 | Ga0316585_10038761 | Ga0316585_100387612 | 107 |
| 237 | 3300032139 | Ga0316580_10000387 | Ga0316580_1000038711 | 107 |
| 238 | 3300033524 | Ga0316592_1081511 | Ga0316592_10815112 | 107 |
| 239 | 3300033541 | Ga0316596_1230181 | Ga0316596_12301812 | 107 |
| 240 | 3300035398 | Ga0316574_0107753 | Ga0316574_0107753_297_620 | 107 |
| 241 | 3300036647 | Ga0316582_0001824 | Ga0316582_0001824_1812_2135 | 107 |
| 242 | 3300036712 | Ga0316584_0014865 | Ga0316584_0014865_3806_4129 | 107 |
| 243 | 3300037588 | Ga0316581_0111762 | Ga0316581_0111762_157_480 | 107 |
| 244 | 3300038443 | Ga0395901_1970073 | Ga0395901_1970073_35_358 | 107 |
| 245 | 3300038443 | Ga0395901_2113597 | Ga0395901_2113597_47_370 | 107 |
| 246 | 3300041443 | Ga0451789_0042650 | Ga0451789_0042650_222_545 | 107 |
| 247 | 3300041453 | Ga0451797_0728442 | Ga0451797_0728442_313_636 | 107 |
| 248 | 3300041462 | Ga0451806_650239 | Ga0451806_650239_38_361 | 107 |
| 249 | 3300042133 | Ga0450896_014900 | Ga0450896_014900_210_533 | 107 |
| 250 | 3300042145 | Ga0450906_059266 | Ga0450906_059266_299_622 | 107 |
| 251 | 3300048903 | Ga0496100_0126890 | Ga0496100_0126890_1405_1728 | 107 |
| 252 | 3300048904 | Ga0496101_0101946 | Ga0496101_0101946_442_765 | 107 |
| 253 | 3300048908 | Ga0496105_0475751 | Ga0496105_0475751_110_433 | 107 |
| 254 | 3300048909 | Ga0496106_0252121 | Ga0496106_0252121_133_456 | 107 |
| 255 | 3300049585 | Ga0501069_0659237 | Ga0501069_0659237_151_474 | 107 |
| 256 | 3300049586 | Ga0501070_0507927 | Ga0501070_0507927_217_540 | 107 |
| 257 | 3300049592 | Ga0501076_1372667 | Ga0501076_1372667_247_570 | 107 |
| 258 | 3300049744 | Ga0501083_0599967 | Ga0501083_0599967_243_566 | 107 |
| 259 | iso_pu_bacteria | 8003955200 | 8003963242 | 107 |
| 260 | 3300003320 | rootH2_10112718 | rootH2_101127181 | 108 |
| 261 | 3300005331 | Ga0070670_100151636 | Ga0070670_1001516362 | 108 |
| 262 | 3300005335 | Ga0070666_10001193 | Ga0070666_1000119310 | 108 |
| 263 | 3300005347 | Ga0070668_100001401 | Ga0070668_10000140112 | 108 |
| 264 | 3300005366 | Ga0070659_101699200 | Ga0070659_1016992001 | 108 |
| 265 | 3300005367 | Ga0070667_100001946 | Ga0070667_1000019465 | 108 |
| 266 | 3300005455 | Ga0070663_101107468 | Ga0070663_1011074681 | 108 |
| 267 | 3300005530 | Ga0070679_101601707 | Ga0070679_1016017071 | 108 |
| 268 | 3300005841 | Ga0068863_100002488 | Ga0068863_1000024885 | 108 |
| 269 | 3300005841 | Ga0068863_100017312 | Ga0068863_10001731211 | 108 |
| 270 | 3300005843 | Ga0068860_100014783 | Ga0068860_1000147835 | 108 |
| 271 | 3300005985 | Ga0081539_10011863 | Ga0081539_100118634 | 108 |
| 272 | 3300006038 | Ga0075365_11278816 | Ga0075365_112788162 | 108 |
| 273 | 3300009098 | Ga0105245_11794379 | Ga0105245_117943791 | 108 |
| 274 | 3300009177 | Ga0105248_13044833 | Ga0105248_130448331 | 108 |
| 275 | 3300014968 | Ga0157379_10068242 | Ga0157379_100682424 | 108 |
| 276 | 3300025298 | Ga0209050_1039729 | Ga0209050_10397292 | 108 |
| 277 | 3300025315 | Ga0207697_10163086 | Ga0207697_101630861 | 108 |
| 278 | 3300025903 | Ga0207680_10001242 | Ga0207680_100012424 | 108 |
| 279 | 3300025915 | Ga0207693_10490732 | Ga0207693_104907321 | 108 |
| 280 | 3300025923 | Ga0207681_10049251 | Ga0207681_100492514 | 108 |
| 281 | 3300025925 | Ga0207650_10125120 | Ga0207650_101251202 | 108 |
| 282 | 3300025925 | Ga0207650_10890363 | Ga0207650_108903632 | 108 |
| 283 | 3300025972 | Ga0207668_10000897 | Ga0207668_1000089712 | 108 |
| 284 | 3300025986 | Ga0207658_10000855 | Ga0207658_1000085510 | 108 |
| 285 | 3300026088 | Ga0207641_10001239 | Ga0207641_1000123910 | 108 |
| 286 | 3300026088 | Ga0207641_10008857 | Ga0207641_1000885710 | 108 |
| 287 | 3300027312 | Ga0209371_1037806 | Ga0209371_10378062 | 108 |
| 288 | 3300028380 | Ga0268265_11038006 | Ga0268265_110380062 | 108 |
| 289 | 3300028381 | Ga0268264_10011283 | Ga0268264_100112835 | 108 |
| 290 | 3300030500 | Ga0268256_1042966 | Ga0268256_10429661 | 108 |
| 291 | 3300031665 | Ga0316575_10171221 | Ga0316575_101712212 | 108 |
| 292 | 3300031691 | Ga0316579_10435185 | Ga0316579_104351851 | 108 |
| 293 | 3300031727 | Ga0316576_10674542 | Ga0316576_106745422 | 108 |
| 294 | 3300031728 | Ga0316578_10607522 | Ga0316578_106075221 | 108 |
| 295 | 3300031824 | Ga0307413_11321227 | Ga0307413_113212272 | 108 |
| 296 | 3300031852 | Ga0307410_10159946 | Ga0307410_101599462 | 108 |
| 297 | 3300031901 | Ga0307406_10485378 | Ga0307406_104853782 | 108 |
| 298 | 3300031903 | Ga0307407_10622896 | Ga0307407_106228962 | 108 |
| 299 | 3300031911 | Ga0307412_11920344 | Ga0307412_119203442 | 108 |
| 300 | 3300031995 | Ga0307409_100238227 | Ga0307409_1002382273 | 108 |
| 301 | 3300031995 | Ga0307409_100333353 | Ga0307409_1003333532 | 108 |
| 302 | 3300032004 | Ga0307414_10053637 | Ga0307414_100536372 | 108 |
| 303 | 3300032133 | Ga0316583_10062843 | Ga0316583_100628432 | 108 |
| 304 | 3300032139 | Ga0316580_10252808 | Ga0316580_102528082 | 108 |
| 305 | 3300038727 | Ga0400491_09399 | Ga0400491_09399_155_481 | 108 |
| 306 | 3300044656 | Ga0466969_0402056 | Ga0466969_0402056_202_528 | 108 |
| 307 | 3300044693 | Ga0466961_0472845 | Ga0466961_0472845_117_443 | 108 |
| 308 | 3300044765 | Ga0466970_0260059 | Ga0466970_0260059_290_616 | 108 |
| 309 | 3300045836 | Ga0466958_0898205 | Ga0466958_0898205_241_567 | 108 |
| 310 | 3300046453 | Ga0495627_212368 | Ga0495627_212368_25_351 | 108 |
| 311 | 3300046501 | Ga0495607_0112360 | Ga0495607_0112360_129_455 | 108 |
| 312 | 3300046512 | Ga0495610_0321045 | Ga0495610_0321045_53_379 | 108 |
| 313 | 3300046519 | Ga0495632_0039124 | Ga0495632_0039124_330_656 | 108 |
| 314 | 3300046520 | Ga0495637_0067973 | Ga0495637_0067973_958_1284 | 108 |
| 315 | 3300046524 | Ga0495648_0013427 | Ga0495648_0013427_338_664 | 108 |
| 316 | 3300046530 | Ga0495654_0053012 | Ga0495654_0053012_887_1213 | 108 |
| 317 | 3300046558 | Ga0495633_0326197 | Ga0495633_0326197_243_569 | 108 |
| 318 | 3300046660 | Ga0495625_0006453 | Ga0495625_0006453_1659_1985 | 108 |
| 319 | 3300046660 | Ga0495625_0728047 | Ga0495625_0728047_99_425 | 108 |
| 320 | 3300046665 | Ga0495661_0619808 | Ga0495661_0619808_106_432 | 108 |
| 321 | 3300046691 | Ga0495670_0100618 | Ga0495670_0100618_1063_1389 | 108 |
| 322 | 3300047472 | Ga0495686_0001044 | Ga0495686_0001044_28894_29220 | 108 |
| 323 | 3300047472 | Ga0495686_0129795 | Ga0495686_0129795_279_605 | 108 |
| 324 | 3300048903 | Ga0496100_0119526 | Ga0496100_0119526_107_433 | 108 |
| 325 | 3300048904 | Ga0496101_0162083 | Ga0496101_0162083_1238_1564 | 108 |
| 326 | 3300048905 | Ga0496102_0503003 | Ga0496102_0503003_792_1118 | 108 |
| 327 | 3300048915 | Ga0496112_0387898 | Ga0496112_0387898_823_1149 | 108 |
| 328 | 3300048919 | Ga0496116_0147826 | Ga0496116_0147826_45_371 | 108 |
| 329 | 3300048920 | Ga0496117_0092362 | Ga0496117_0092362_1363_1689 | 108 |
| 330 | 3300048921 | Ga0496118_0107215 | Ga0496118_0107215_1363_1689 | 108 |
| 331 | 3300048924 | Ga0496121_0000061 | Ga0496121_0000061_4086_4412 | 108 |
| 332 | 3300048924 | Ga0496121_0025083 | Ga0496121_0025083_2606_2932 | 108 |
| 333 | 3300048925 | Ga0496122_0185087 | Ga0496122_0185087_45_371 | 108 |
| 334 | 3300048926 | Ga0496123_0153831 | Ga0496123_0153831_45_371 | 108 |
| 335 | 3300048927 | Ga0496124_0068327 | Ga0496124_0068327_954_1280 | 108 |
| 336 | 3300048928 | Ga0496125_0021360 | Ga0496125_0021360_2067_2393 | 108 |
| 337 | 3300048929 | Ga0496126_0085820 | Ga0496126_0085820_1786_2112 | 108 |
| 338 | 3300048929 | Ga0496126_0308439 | Ga0496126_0308439_45_371 | 108 |
| 339 | 3300049581 | Ga0501047_0352672 | Ga0501047_0352672_343_669 | 108 |
| 340 | 3300049581 | Ga0501047_1114437 | Ga0501047_1114437_92_418 | 108 |
| 341 | 3300053125 | Ga0500618_021111 | Ga0500618_021111_93_419 | 108 |
| 342 | 3300053141 | Ga0500574_221144 | Ga0500574_221144_61_387 | 108 |
| 343 | 3300005339 | Ga0070660_100151611 | Ga0070660_1001516113 | 109 |
| 344 | 3300005435 | Ga0070714_100793881 | Ga0070714_1007938812 | 109 |
| 345 | 3300005437 | Ga0070710_10153304 | Ga0070710_101533042 | 109 |
| 346 | 3300005439 | Ga0070711_100151979 | Ga0070711_1001519792 | 109 |
| 347 | 3300005456 | Ga0070678_100773868 | Ga0070678_1007738682 | 109 |
| 348 | 3300005543 | Ga0070672_101621371 | Ga0070672_1016213712 | 109 |
| 349 | 3300005548 | Ga0070665_100232511 | Ga0070665_1002325112 | 109 |
| 350 | 3300005614 | Ga0068856_101126525 | Ga0068856_1011265252 | 109 |
| 351 | 3300005616 | Ga0068852_101059126 | Ga0068852_1010591262 | 109 |
| 352 | 3300005937 | Ga0081455_10055690 | Ga0081455_100556902 | 109 |
| 353 | 3300006058 | Ga0075432_10407140 | Ga0075432_104071402 | 109 |
| 354 | 3300006173 | Ga0070716_100619356 | Ga0070716_1006193561 | 109 |
| 355 | 3300006175 | Ga0070712_100312298 | Ga0070712_1003122982 | 109 |
| 356 | 3300006175 | Ga0070712_100490447 | Ga0070712_1004904473 | 109 |
| 357 | 3300006847 | Ga0075431_100378052 | Ga0075431_1003780522 | 109 |
| 358 | 3300006880 | Ga0075429_100378781 | Ga0075429_1003787812 | 109 |
| 359 | 3300007265 | Ga0099794_10533633 | Ga0099794_105336331 | 109 |
| 360 | 3300009093 | Ga0105240_11187964 | Ga0105240_111879642 | 109 |
| 361 | 3300009094 | Ga0111539_10513727 | Ga0111539_105137272 | 109 |
| 362 | 3300009147 | Ga0114129_10548674 | Ga0114129_105486741 | 109 |
| 363 | 3300012476 | Ga0157344_1006271 | Ga0157344_10062712 | 109 |
| 364 | 3300012487 | Ga0157321_1013110 | Ga0157321_10131102 | 109 |
| 365 | 3300012508 | Ga0157315_1019421 | Ga0157315_10194212 | 109 |
| 366 | 3300013104 | Ga0157370_11295893 | Ga0157370_112958932 | 109 |
| 367 | 3300013105 | Ga0157369_11222514 | Ga0157369_112225142 | 109 |
| 368 | 3300013308 | Ga0157375_11602565 | Ga0157375_116025652 | 109 |
| 369 | 3300014326 | Ga0157380_13393924 | Ga0157380_133939241 | 109 |
| 370 | 3300014497 | Ga0182008_10204037 | Ga0182008_102040372 | 109 |
| 371 | 3300015265 | Ga0182005_1052547 | Ga0182005_10525471 | 109 |
| 372 | 3300025898 | Ga0207692_10784257 | Ga0207692_107842572 | 109 |
| 373 | 3300025913 | Ga0207695_10356273 | Ga0207695_103562731 | 109 |
| 374 | 3300025914 | Ga0207671_10266968 | Ga0207671_102669681 | 109 |
| 375 | 3300025916 | Ga0207663_10345369 | Ga0207663_103453691 | 109 |
| 376 | 3300025919 | Ga0207657_10137591 | Ga0207657_101375913 | 109 |
| 377 | 3300025919 | Ga0207657_10312808 | Ga0207657_103128083 | 109 |
| 378 | 3300025928 | Ga0207700_10778108 | Ga0207700_107781081 | 109 |
| 379 | 3300025929 | Ga0207664_10308064 | Ga0207664_103080642 | 109 |
| 380 | 3300025937 | Ga0207669_10477997 | Ga0207669_104779972 | 109 |
| 381 | 3300026067 | Ga0207678_10118679 | Ga0207678_101186795 | 109 |
| 382 | 3300026078 | Ga0207702_10406238 | Ga0207702_104062382 | 109 |
| 383 | 3300026078 | Ga0207702_10514142 | Ga0207702_105141422 | 109 |
| 384 | 3300026142 | Ga0207698_11106828 | Ga0207698_111068282 | 109 |
| 385 | 3300027543 | Ga0209999_1027953 | Ga0209999_10279531 | 109 |
| 386 | 3300027717 | Ga0209998_10194753 | Ga0209998_101947532 | 109 |
| 387 | 3300027876 | Ga0209974_10270365 | Ga0209974_102703651 | 109 |
| 388 | 3300028379 | Ga0268266_10306696 | Ga0268266_103066962 | 109 |
| 389 | 3300031456 | Ga0307513_10215539 | Ga0307513_102155392 | 109 |
| 390 | 3300031824 | Ga0307413_12106688 | Ga0307413_121066882 | 109 |
| 391 | 3300031901 | Ga0307406_10073981 | Ga0307406_100739812 | 109 |
| 392 | 3300031903 | Ga0307407_11546073 | Ga0307407_115460731 | 109 |
| 393 | 3300031995 | Ga0307409_100462351 | Ga0307409_1004623512 | 109 |
| 394 | 3300031995 | Ga0307409_101136980 | Ga0307409_1011369802 | 109 |
| 395 | 3300032004 | Ga0307414_10098116 | Ga0307414_100981163 | 109 |
| 396 | 3300032004 | Ga0307414_11449263 | Ga0307414_114492631 | 109 |
| 397 | 3300032005 | Ga0307411_11411405 | Ga0307411_114114052 | 109 |
| 398 | 3300035083 | Ga0373926_0049132 | Ga0373926_0049132_145_474 | 109 |
| 399 | 3300035083 | Ga0373926_0056492 | Ga0373926_0056492_986_1315 | 109 |
| 400 | 3300035086 | Ga0373934_0060884 | Ga0373934_0060884_77_406 | 109 |
| 401 | 3300035086 | Ga0373934_0066572 | Ga0373934_0066572_159_488 | 109 |
| 402 | 3300035089 | Ga0373944_0030361 | Ga0373944_0030361_907_1236 | 109 |
| 403 | 3300035089 | Ga0373944_0035120 | Ga0373944_0035120_965_1294 | 109 |
| 404 | 3300035111 | Ga0373923_0082802 | Ga0373923_0082802_57_386 | 109 |
| 405 | 3300035111 | Ga0373923_0596879 | Ga0373923_0596879_74_403 | 109 |
| 406 | 3300035113 | Ga0373936_0069598 | Ga0373936_0069598_90_419 | 109 |
| 407 | 3300035113 | Ga0373936_0075741 | Ga0373936_0075741_964_1293 | 109 |
| 408 | 3300035116 | Ga0373945_0059526 | Ga0373945_0059526_958_1287 | 109 |
| 409 | 3300035116 | Ga0373945_0068247 | Ga0373945_0068247_56_385 | 109 |
| 410 | 3300035116 | Ga0373945_0100380 | Ga0373945_0100380_106_435 | 109 |
| 411 | 3300035117 | Ga0373953_0059855 | Ga0373953_0059855_266_595 | 109 |
| 412 | 3300035117 | Ga0373953_0061514 | Ga0373953_0061514_126_455 | 109 |
| 413 | 3300035118 | Ga0373954_0082685 | Ga0373954_0082685_1065_1394 | 109 |
| 414 | 3300035118 | Ga0373954_0088099 | Ga0373954_0088099_150_479 | 109 |
| 415 | 3300035119 | Ga0373956_0066586 | Ga0373956_0066586_240_569 | 109 |
| 416 | 3300035119 | Ga0373956_0087905 | Ga0373956_0087905_949_1278 | 109 |
| 417 | 3300035120 | Ga0373957_0059439 | Ga0373957_0059439_952_1281 | 109 |
| 418 | 3300035120 | Ga0373957_0125015 | Ga0373957_0125015_91_420 | 109 |
| 419 | 3300035170 | Ga0373943_0075857 | Ga0373943_0075857_1116_1445 | 109 |
| 420 | 3300035170 | Ga0373943_0131275 | Ga0373943_0131275_61_390 | 109 |
| 421 | 3300035170 | Ga0373943_0464303 | Ga0373943_0464303_371_700 | 109 |
| 422 | 3300035171 | Ga0373946_0084264 | Ga0373946_0084264_105_434 | 109 |
| 423 | 3300035171 | Ga0373946_0087135 | Ga0373946_0087135_959_1288 | 109 |
| 424 | 3300035171 | Ga0373946_0153889 | Ga0373946_0153889_572_901 | 109 |
| 425 | 3300035172 | Ga0373955_0117576 | Ga0373955_0117576_260_589 | 109 |
| 426 | 3300035172 | Ga0373955_0384878 | Ga0373955_0384878_25_354 | 109 |
| 427 | 3300035410 | Ga0373924_0046896 | Ga0373924_0046896_412_741 | 109 |
| 428 | 3300035410 | Ga0373924_0123204 | Ga0373924_0123204_117_446 | 109 |
| 429 | 3300035692 | Ga0373935_0151938 | Ga0373935_0151938_86_415 | 109 |
| 430 | 3300035692 | Ga0373935_0212344 | Ga0373935_0212344_958_1287 | 109 |
| 431 | 3300035692 | Ga0373935_1046655 | Ga0373935_1046655_214_543 | 109 |
| 432 | 3300035695 | Ga0373927_0157903 | Ga0373927_0157903_1055_1384 | 109 |
| 433 | 3300035695 | Ga0373927_0422769 | Ga0373927_0422769_79_408 | 109 |
| 434 | 3300035695 | Ga0373927_0487698 | Ga0373927_0487698_40_369 | 109 |
| 435 | 3300035724 | Ga0373933_0172272 | Ga0373933_0172272_963_1292 | 109 |
| 436 | 3300035724 | Ga0373933_0178808 | Ga0373933_0178808_70_399 | 109 |
| 437 | 3300035724 | Ga0373933_0369420 | Ga0373933_0369420_195_524 | 109 |
| 438 | 3300035725 | Ga0373947_0098565 | Ga0373947_0098565_560_889 | 109 |
| 439 | 3300035725 | Ga0373947_0105969 | Ga0373947_0105969_244_573 | 109 |
| 440 | 3300036401 | Ga0373937_0110578 | Ga0373937_0110578_946_1275 | 109 |
| 441 | 3300036401 | Ga0373937_0317224 | Ga0373937_0317224_190_519 | 109 |
| 442 | 3300036401 | Ga0373937_0370130 | Ga0373937_0370130_992_1321 | 109 |
| 443 | 3300036401 | Ga0373937_1205156 | Ga0373937_1205156_60_389 | 109 |
| 444 | 3300036647 | Ga0316582_1270999 | Ga0316582_1270999_21_356 | 109 |
| 445 | 3300036712 | Ga0316584_0669560 | Ga0316584_0669560_39_374 | 109 |
| 446 | 3300037068 | Ga0373925_0058690 | Ga0373925_0058690_2495_2824 | 109 |
| 447 | 3300037068 | Ga0373925_0096744 | Ga0373925_0096744_72_401 | 109 |
| 448 | 3300037853 | Ga0436364_0105997 | Ga0436364_0105997_2165_2494 | 109 |
| 449 | 3300037853 | Ga0436364_0309800 | Ga0436364_0309800_119_448 | 109 |
| 450 | 3300037853 | Ga0436364_0573740 | Ga0436364_0573740_56_385 | 109 |
| 451 | 3300037853 | Ga0436364_1125838 | Ga0436364_1125838_976_1305 | 109 |
| 452 | 3300038443 | Ga0395901_1522460 | Ga0395901_1522460_95_424 | 109 |
| 453 | 3300039447 | Ga0436361_0044481 | Ga0436361_0044481_620_949 | 109 |
| 454 | 3300041408 | Ga0439453_0074328 | Ga0439453_0074328_218_547 | 109 |
| 455 | 3300041411 | Ga0439466_0178272 | Ga0439466_0178272_70_399 | 109 |
| 456 | 3300042008 | Ga0439450_229923 | Ga0439450_229923_46_375 | 109 |
| 457 | 3300042010 | Ga0439452_089516 | Ga0439452_089516_98_427 | 109 |
| 458 | 3300042010 | Ga0439452_126427 | Ga0439452_126427_204_533 | 109 |
| 459 | 3300042013 | Ga0439456_070758 | Ga0439456_070758_72_401 | 109 |
| 460 | 3300042125 | Ga0450923_070741 | Ga0450923_070741_43_372 | 109 |
| 461 | 3300042134 | Ga0450898_051491 | Ga0450898_051491_109_438 | 109 |
| 462 | 3300042184 | Ga0450908_069517 | Ga0450908_069517_100_429 | 109 |
| 463 | 3300042435 | Ga0439434_0076549 | Ga0439434_0076549_125_454 | 109 |
| 464 | 3300046454 | Ga0495592_0145694 | Ga0495592_0145694_268_597 | 109 |
| 465 | 3300046454 | Ga0495592_0186558 | Ga0495592_0186558_91_420 | 109 |
| 466 | 3300046455 | Ga0495603_0142417 | Ga0495603_0142417_95_424 | 109 |
| 467 | 3300046459 | Ga0495629_0112654 | Ga0495629_0112654_1366_1695 | 109 |
| 468 | 3300046459 | Ga0495629_0200840 | Ga0495629_0200840_72_401 | 109 |
| 469 | 3300046461 | Ga0495641_0107752 | Ga0495641_0107752_859_1188 | 109 |
| 470 | 3300046461 | Ga0495641_0607399 | Ga0495641_0607399_81_410 | 109 |
| 471 | 3300046462 | Ga0495651_0195109 | Ga0495651_0195109_132_461 | 109 |
| 472 | 3300046462 | Ga0495651_0196676 | Ga0495651_0196676_1030_1359 | 109 |
| 473 | 3300046463 | Ga0495653_0144197 | Ga0495653_0144197_151_480 | 109 |
| 474 | 3300046463 | Ga0495653_0298876 | Ga0495653_0298876_324_653 | 109 |
| 475 | 3300046472 | Ga0495580_0207802 | Ga0495580_0207802_70_399 | 109 |
| 476 | 3300046472 | Ga0495580_0295518 | Ga0495580_0295518_25_354 | 109 |
| 477 | 3300046473 | Ga0495582_0124759 | Ga0495582_0124759_1047_1376 | 109 |
| 478 | 3300046475 | Ga0495639_0101548 | Ga0495639_0101548_973_1302 | 109 |
| 479 | 3300046475 | Ga0495639_0130120 | Ga0495639_0130120_767_1096 | 109 |
| 480 | 3300046476 | Ga0495662_0107893 | Ga0495662_0107893_72_401 | 109 |
| 481 | 3300046476 | Ga0495662_0452297 | Ga0495662_0452297_278_607 | 109 |
| 482 | 3300046476 | Ga0495662_0582388 | Ga0495662_0582388_104_433 | 109 |
| 483 | 3300046477 | Ga0495664_0147601 | Ga0495664_0147601_1015_1344 | 109 |
| 484 | 3300046477 | Ga0495664_0335953 | Ga0495664_0335953_472_801 | 109 |
| 485 | 3300046499 | Ga0495594_0141762 | Ga0495594_0141762_82_411 | 109 |
| 486 | 3300046511 | Ga0495608_0126676 | Ga0495608_0126676_77_406 | 109 |
| 487 | 3300046511 | Ga0495608_0139248 | Ga0495608_0139248_114_443 | 109 |
| 488 | 3300046514 | Ga0495618_0135333 | Ga0495618_0135333_1027_1356 | 109 |
| 489 | 3300046514 | Ga0495618_0160000 | Ga0495618_0160000_110_439 | 109 |
| 490 | 3300046514 | Ga0495618_0162437 | Ga0495618_0162437_118_447 | 109 |
| 491 | 3300046514 | Ga0495618_0394950 | Ga0495618_0394950_48_377 | 109 |
| 492 | 3300046515 | Ga0495620_0075585 | Ga0495620_0075585_976_1305 | 109 |
| 493 | 3300046516 | Ga0495628_0163854 | Ga0495628_0163854_1254_1583 | 109 |
| 494 | 3300046516 | Ga0495628_0241651 | Ga0495628_0241651_73_402 | 109 |
| 495 | 3300046517 | Ga0495630_0142679 | Ga0495630_0142679_247_576 | 109 |
| 496 | 3300046517 | Ga0495630_0274292 | Ga0495630_0274292_49_378 | 109 |
| 497 | 3300046523 | Ga0495644_0344074 | Ga0495644_0344074_44_373 | 109 |
| 498 | 3300046526 | Ga0495666_0088511 | Ga0495666_0088511_108_437 | 109 |
| 499 | 3300046529 | Ga0495652_0228735 | Ga0495652_0228735_1010_1339 | 109 |
| 500 | 3300046531 | Ga0495665_0096293 | Ga0495665_0096293_253_582 | 109 |
| 501 | 3300046531 | Ga0495665_0100445 | Ga0495665_0100445_922_1251 | 109 |
| 502 | 3300046531 | Ga0495665_0680385 | Ga0495665_0680385_111_440 | 109 |
| 503 | 3300046533 | Ga0495640_0119906 | Ga0495640_0119906_1266_1595 | 109 |
| 504 | 3300046533 | Ga0495640_0153688 | Ga0495640_0153688_987_1316 | 109 |
| 505 | 3300046533 | Ga0495640_0167431 | Ga0495640_0167431_955_1284 | 109 |
| 506 | 3300046533 | Ga0495640_0444411 | Ga0495640_0444411_126_455 | 109 |
| 507 | 3300046535 | Ga0495586_0131655 | Ga0495586_0131655_88_417 | 109 |
| 508 | 3300046536 | Ga0495587_0106884 | Ga0495587_0106884_114_443 | 109 |
| 509 | 3300046536 | Ga0495587_0138197 | Ga0495587_0138197_1021_1350 | 109 |
| 510 | 3300046542 | Ga0495597_0069606 | Ga0495597_0069606_261_590 | 109 |
| 511 | 3300046543 | Ga0495645_0178351 | Ga0495645_0178351_135_464 | 109 |
| 512 | 3300046543 | Ga0495645_0200409 | Ga0495645_0200409_950_1279 | 109 |
| 513 | 3300046559 | Ga0495667_0136454 | Ga0495667_0136454_1132_1461 | 109 |
| 514 | 3300046559 | Ga0495667_0138507 | Ga0495667_0138507_1151_1480 | 109 |
| 515 | 3300046642 | Ga0495634_0062285 | Ga0495634_0062285_2064_2393 | 109 |
| 516 | 3300046642 | Ga0495634_0161678 | Ga0495634_0161678_70_399 | 109 |
| 517 | 3300046663 | Ga0495635_0146827 | Ga0495635_0146827_1231_1560 | 109 |
| 518 | 3300046663 | Ga0495635_0166114 | Ga0495635_0166114_78_407 | 109 |
| 519 | 3300046674 | Ga0495588_0292901 | Ga0495588_0292901_508_837 | 109 |
| 520 | 3300046675 | Ga0495657_0133466 | Ga0495657_0133466_116_445 | 109 |
| 521 | 3300046675 | Ga0495657_0169660 | Ga0495657_0169660_946_1275 | 109 |
| 522 | 3300046678 | Ga0495599_0156749 | Ga0495599_0156749_964_1293 | 109 |
| 523 | 3300046678 | Ga0495599_0164734 | Ga0495599_0164734_988_1317 | 109 |
| 524 | 3300046679 | Ga0495623_0106379 | Ga0495623_0106379_384_713 | 109 |
| 525 | 3300046679 | Ga0495623_0151466 | Ga0495623_0151466_957_1286 | 109 |
| 526 | 3300046680 | Ga0495646_0110662 | Ga0495646_0110662_1173_1502 | 109 |
| 527 | 3300046680 | Ga0495646_0130577 | Ga0495646_0130577_1034_1363 | 109 |
| 528 | 3300046681 | Ga0495647_0059436 | Ga0495647_0059436_202_531 | 109 |
| 529 | 3300046681 | Ga0495647_0068717 | Ga0495647_0068717_103_432 | 109 |
| 530 | 3300046681 | Ga0495647_0162467 | Ga0495647_0162467_105_434 | 109 |
| 531 | 3300046683 | Ga0495658_0201494 | Ga0495658_0201494_191_520 | 109 |
| 532 | 3300046689 | Ga0495613_0173830 | Ga0495613_0173830_989_1318 | 109 |
| 533 | 3300046689 | Ga0495613_0186953 | Ga0495613_0186953_96_425 | 109 |
| 534 | 3300046690 | Ga0495624_0133971 | Ga0495624_0133971_1045_1374 | 109 |
| 535 | 3300046690 | Ga0495624_0157156 | Ga0495624_0157156_115_444 | 109 |
| 536 | 3300046809 | Ga0495600_0045735 | Ga0495600_0045735_136_465 | 109 |
| 537 | 3300046809 | Ga0495600_0151284 | Ga0495600_0151284_961_1290 | 109 |
| 538 | 3300047315 | Ga0495581_0127458 | Ga0495581_0127458_1039_1368 | 109 |
| 539 | 3300047317 | Ga0495604_0207468 | Ga0495604_0207468_944_1273 | 109 |
| 540 | 3300047317 | Ga0495604_1028889 | Ga0495604_1028889_65_394 | 109 |
| 541 | 3300047319 | Ga0495674_0307220 | Ga0495674_0307220_102_431 | 109 |
| 542 | 3300047319 | Ga0495674_0707261 | Ga0495674_0707261_84_413 | 109 |
| 543 | 3300047319 | Ga0495674_0825713 | Ga0495674_0825713_290_619 | 109 |
| 544 | 3300047321 | Ga0495676_0186181 | Ga0495676_0186181_1067_1396 | 109 |
| 545 | 3300047321 | Ga0495676_0313791 | Ga0495676_0313791_645_974 | 109 |
| 546 | 3300047322 | Ga0495680_0196828 | Ga0495680_0196828_130_459 | 109 |
| 547 | 3300047322 | Ga0495680_0219835 | Ga0495680_0219835_57_386 | 109 |
| 548 | 3300047444 | Ga0495675_0151002 | Ga0495675_0151002_109_438 | 109 |
| 549 | 3300047444 | Ga0495675_0164624 | Ga0495675_0164624_988_1317 | 109 |
| 550 | 3300047471 | Ga0495684_0188994 | Ga0495684_0188994_222_551 | 109 |
| 551 | 3300047471 | Ga0495684_0806975 | Ga0495684_0806975_143_472 | 109 |
| 552 | 3300047673 | Ga0495593_0100950 | Ga0495593_0100950_1029_1358 | 109 |
| 553 | 3300047673 | Ga0495593_0103624 | Ga0495593_0103624_159_488 | 109 |
| 554 | 3300048088 | Ga0495602_0206060 | Ga0495602_0206060_979_1308 | 109 |
| 555 | 3300048088 | Ga0495602_0655298 | Ga0495602_0655298_273_602 | 109 |
| 556 | 3300048089 | Ga0495614_0171859 | Ga0495614_0171859_88_417 | 109 |
| 557 | 3300048089 | Ga0495614_0441818 | Ga0495614_0441818_228_557 | 109 |
| 558 | 3300048903 | Ga0496100_0243775 | Ga0496100_0243775_169_498 | 109 |
| 559 | 3300048904 | Ga0496101_0243642 | Ga0496101_0243642_1005_1334 | 109 |
| 560 | 3300048904 | Ga0496101_0315989 | Ga0496101_0315989_47_376 | 109 |
| 561 | 3300048907 | Ga0496104_0426508 | Ga0496104_0426508_122_451 | 109 |
| 562 | 3300048907 | Ga0496104_0690450 | Ga0496104_0690450_511_840 | 109 |
| 563 | 3300048907 | Ga0496104_0691144 | Ga0496104_0691144_62_391 | 109 |
| 564 | 3300048908 | Ga0496105_0220187 | Ga0496105_0220187_1162_1491 | 109 |
| 565 | 3300048910 | Ga0496107_0176705 | Ga0496107_0176705_860_1189 | 109 |
| 566 | 3300048910 | Ga0496107_0234880 | Ga0496107_0234880_937_1266 | 109 |
| 567 | 3300048910 | Ga0496107_0953206 | Ga0496107_0953206_103_432 | 109 |
| 568 | 3300048911 | Ga0496108_0413226 | Ga0496108_0413226_790_1119 | 109 |
| 569 | 3300048912 | Ga0496109_0203360 | Ga0496109_0203360_492_821 | 109 |
| 570 | 3300048913 | Ga0496110_0346352 | Ga0496110_0346352_967_1296 | 109 |
| 571 | 3300048917 | Ga0496114_0396220 | Ga0496114_0396220_130_459 | 109 |
| 572 | 3300048917 | Ga0496114_0905341 | Ga0496114_0905341_98_427 | 109 |
| 573 | 3300048918 | Ga0496115_0026500 | Ga0496115_0026500_4060_4389 | 109 |
| 574 | 3300048918 | Ga0496115_0939872 | Ga0496115_0939872_105_434 | 109 |
| 575 | 3300048925 | Ga0496122_0003452 | Ga0496122_0003452_16743_17072 | 109 |
| 576 | 3300048926 | Ga0496123_0000992 | Ga0496123_0000992_35480_35809 | 109 |
| 577 | 3300049459 | Ga0495678_037735 | Ga0495678_037735_598_927 | 109 |
| 578 | 3300049522 | Ga0501299_103219 | Ga0501299_103219_121_450 | 109 |
| 579 | 3300049568 | Ga0501031_0110428 | Ga0501031_0110428_1397_1726 | 109 |
| 580 | 3300049568 | Ga0501031_0112732 | Ga0501031_0112732_1266_1595 | 109 |
| 581 | 3300049569 | Ga0501032_0007349 | Ga0501032_0007349_1444_1773 | 109 |
| 582 | 3300049569 | Ga0501032_0716859 | Ga0501032_0716859_233_562 | 109 |
| 583 | 3300049570 | Ga0501033_0004875 | Ga0501033_0004875_3155_3484 | 109 |
| 584 | 3300049570 | Ga0501033_0206579 | Ga0501033_0206579_946_1275 | 109 |
| 585 | 3300049571 | Ga0501034_0369498 | Ga0501034_0369498_60_389 | 109 |
| 586 | 3300049572 | Ga0501036_0197048 | Ga0501036_0197048_1266_1595 | 109 |
| 587 | 3300049572 | Ga0501036_0824001 | Ga0501036_0824001_361_690 | 109 |
| 588 | 3300049573 | Ga0501037_0000216 | Ga0501037_0000216_24433_24762 | 109 |
| 589 | 3300049573 | Ga0501037_0078431 | Ga0501037_0078431_1631_1960 | 109 |
| 590 | 3300049574 | Ga0501038_0447733 | Ga0501038_0447733_609_938 | 109 |
| 591 | 3300049574 | Ga0501038_0727707 | Ga0501038_0727707_361_690 | 109 |
| 592 | 3300049575 | Ga0501039_1054942 | Ga0501039_1054942_233_562 | 109 |
| 593 | 3300049575 | Ga0501039_1097078 | Ga0501039_1097078_65_394 | 109 |
| 594 | 3300049578 | Ga0501042_0119433 | Ga0501042_0119433_660_989 | 109 |
| 595 | 3300049579 | Ga0501043_0000132 | Ga0501043_0000132_18189_18518 | 109 |
| 596 | 3300049579 | Ga0501043_0239224 | Ga0501043_0239224_116_445 | 109 |
| 597 | 3300049580 | Ga0501046_0210012 | Ga0501046_0210012_1030_1359 | 109 |
| 598 | 3300049581 | Ga0501047_0151585 | Ga0501047_0151585_1308_1637 | 109 |
| 599 | 3300049581 | Ga0501047_0262995 | Ga0501047_0262995_272_601 | 109 |
| 600 | 3300049582 | Ga0501048_0210608 | Ga0501048_0210608_989_1318 | 109 |
| 601 | 3300049584 | Ga0501068_0029163 | Ga0501068_0029163_1246_1575 | 109 |
| 602 | 3300049585 | Ga0501069_0000051 | Ga0501069_0000051_26187_26516 | 109 |
| 603 | 3300049585 | Ga0501069_0832802 | Ga0501069_0832802_147_476 | 109 |
| 604 | 3300049586 | Ga0501070_0001832 | Ga0501070_0001832_18327_18656 | 109 |
| 605 | 3300049586 | Ga0501070_0072902 | Ga0501070_0072902_647_976 | 109 |
| 606 | 3300049587 | Ga0501071_0014770 | Ga0501071_0014770_1604_1933 | 109 |
| 607 | 3300049589 | Ga0501073_0059743 | Ga0501073_0059743_1432_1761 | 109 |
| 608 | 3300049590 | Ga0501074_0000043 | Ga0501074_0000043_51160_51489 | 109 |
| 609 | 3300049592 | Ga0501076_0460267 | Ga0501076_0460267_344_673 | 109 |
| 610 | 3300049742 | Ga0501080_0001519 | Ga0501080_0001519_1527_1856 | 109 |
| 611 | 3300049742 | Ga0501080_0322553 | Ga0501080_0322553_931_1260 | 109 |
| 612 | 3300049744 | Ga0501083_0000247 | Ga0501083_0000247_17950_18279 | 109 |
| 613 | 3300049822 | Ga0501035_0000280 | Ga0501035_0000280_13749_14078 | 109 |
| 614 | 3300049822 | Ga0501035_0186790 | Ga0501035_0186790_361_690 | 109 |
| 615 | 3300049823 | Ga0501044_0001427 | Ga0501044_0001427_9534_9863 | 109 |
| 616 | 3300049823 | Ga0501044_0091608 | Ga0501044_0091608_1623_1952 | 109 |
| 617 | 3300049824 | Ga0501045_0172807 | Ga0501045_0172807_1200_1529 | 109 |
| 618 | 3300050507 | nmdc:mga05p37_482271_c1 | nmdc:mga05p37_482271_c1_1042_1371 | 109 |
| 619 | 3300050508 | nmdc:mga09592_349490_c1 | nmdc:mga09592_349490_c1_78_407 | 109 |
| 620 | 3300050509 | nmdc:mga0qj67_242075_c1 | nmdc:mga0qj67_242075_c1_992_1321 | 109 |
| 621 | 3300050510 | nmdc:mga06r32_1312036_c1 | nmdc:mga06r32_1312036_c1_285_614 | 109 |
| 622 | 3300050510 | nmdc:mga06r32_325375_c1 | nmdc:mga06r32_325375_c1_234_563 | 109 |
| 623 | 3300053077 | Ga0495601_0133313 | Ga0495601_0133313_1065_1394 | 109 |
| 624 | 3300053077 | Ga0495601_0141741 | Ga0495601_0141741_113_442 | 109 |
| 625 | 3300053077 | Ga0495601_0490153 | Ga0495601_0490153_290_619 | 109 |
| 626 | 3300053077 | Ga0495601_0705542 | Ga0495601_0705542_243_572 | 109 |
| 627 | 3300053078 | Ga0495612_0054777 | Ga0495612_0054777_1163_1492 | 109 |
| 628 | 3300053078 | Ga0495612_0073179 | Ga0495612_0073179_1012_1341 | 109 |
| 629 | 3300053078 | Ga0495612_0076323 | Ga0495612_0076323_959_1288 | 109 |
| 630 | 3300053084 | Ga0495595_0091017 | Ga0495595_0091017_1067_1396 | 109 |
| 631 | 3300053084 | Ga0495595_0108467 | Ga0495595_0108467_945_1274 | 109 |
| 632 | 3300053085 | Ga0495619_0101847 | Ga0495619_0101847_1536_1865 | 109 |
| 633 | 3300053085 | Ga0495619_0188490 | Ga0495619_0188490_556_885 | 109 |
| 634 | 3300053119 | Ga0500595_144112 | Ga0500595_144112_179_508 | 109 |
| 635 | 3300053136 | Ga0500559_0012819 | Ga0500559_0012819_1814_2143 | 109 |
| 636 | 3300053153 | Ga0500616_0061557 | Ga0500616_0061557_115_444 | 109 |
| 637 | 3300060353 | Ga0501082_0289447 | Ga0501082_0289447_981_1310 | 109 |
| 638 | 3300005981 | Ga0081538_10068670 | Ga0081538_100686702 | 110 |
| 639 | 3300026067 | Ga0207678_10123486 | Ga0207678_101234862 | 110 |
| 640 | 3300035116 | Ga0373945_0030164 | Ga0373945_0030164_450_782 | 110 |
| 641 | 3300035170 | Ga0373943_0187868 | Ga0373943_0187868_127_459 | 110 |
| 642 | 3300035171 | Ga0373946_0086731 | Ga0373946_0086731_988_1320 | 110 |
| 643 | 3300035171 | Ga0373946_0130085 | Ga0373946_0130085_112_444 | 110 |
| 644 | 3300035207 | Ga0373942_0153805 | Ga0373942_0153805_348_680 | 110 |
| 645 | 3300035410 | Ga0373924_0477042 | Ga0373924_0477042_114_446 | 110 |
| 646 | 3300035692 | Ga0373935_0415658 | Ga0373935_0415658_561_893 | 110 |
| 647 | 3300035695 | Ga0373927_0261363 | Ga0373927_0261363_359_691 | 110 |
| 648 | 3300035725 | Ga0373947_0256725 | Ga0373947_0256725_98_430 | 110 |
| 649 | 3300035725 | Ga0373947_0720142 | Ga0373947_0720142_17_349 | 110 |
| 650 | 3300037068 | Ga0373925_0449151 | Ga0373925_0449151_88_420 | 110 |
| 651 | 3300037068 | Ga0373925_1436016 | Ga0373925_1436016_162_494 | 110 |
| 652 | 3300039062 | Ga0400483_279772 | Ga0400483_279772_1049_1381 | 110 |
| 653 | 3300046454 | Ga0495592_0649089 | Ga0495592_0649089_160_492 | 110 |
| 654 | 3300046455 | Ga0495603_0156083 | Ga0495603_0156083_888_1220 | 110 |
| 655 | 3300046459 | Ga0495629_0403854 | Ga0495629_0403854_436_768 | 110 |
| 656 | 3300046460 | Ga0495638_0131412 | Ga0495638_0131412_908_1240 | 110 |
| 657 | 3300046461 | Ga0495641_0278327 | Ga0495641_0278327_377_709 | 110 |
| 658 | 3300046461 | Ga0495641_0468117 | Ga0495641_0468117_46_378 | 110 |
| 659 | 3300046463 | Ga0495653_0104864 | Ga0495653_0104864_680_1012 | 110 |
| 660 | 3300046472 | Ga0495580_0006397 | Ga0495580_0006397_208_540 | 110 |
| 661 | 3300046474 | Ga0495605_0141610 | Ga0495605_0141610_323_655 | 110 |
| 662 | 3300046476 | Ga0495662_0061906 | Ga0495662_0061906_1277_1609 | 110 |
| 663 | 3300046477 | Ga0495664_0025368 | Ga0495664_0025368_2390_2722 | 110 |
| 664 | 3300046499 | Ga0495594_0226743 | Ga0495594_0226743_103_435 | 110 |
| 665 | 3300046501 | Ga0495607_0262598 | Ga0495607_0262598_326_658 | 110 |
| 666 | 3300046506 | Ga0495583_0007045 | Ga0495583_0007045_104_436 | 110 |
| 667 | 3300046507 | Ga0495606_0279544 | Ga0495606_0279544_176_508 | 110 |
| 668 | 3300046511 | Ga0495608_0210495 | Ga0495608_0210495_816_1148 | 110 |
| 669 | 3300046513 | Ga0495616_0033661 | Ga0495616_0033661_2001_2333 | 110 |
| 670 | 3300046514 | Ga0495618_0170847 | Ga0495618_0170847_984_1316 | 110 |
| 671 | 3300046519 | Ga0495632_0172232 | Ga0495632_0172232_189_521 | 110 |
| 672 | 3300046524 | Ga0495648_0003532 | Ga0495648_0003532_768_1100 | 110 |
| 673 | 3300046524 | Ga0495648_0081312 | Ga0495648_0081312_1044_1376 | 110 |
| 674 | 3300046526 | Ga0495666_0247707 | Ga0495666_0247707_255_587 | 110 |
| 675 | 3300046528 | Ga0495642_0030353 | Ga0495642_0030353_1291_1623 | 110 |
| 676 | 3300046529 | Ga0495652_0169789 | Ga0495652_0169789_21_353 | 110 |
| 677 | 3300046531 | Ga0495665_0206683 | Ga0495665_0206683_122_454 | 110 |
| 678 | 3300046531 | Ga0495665_0342277 | Ga0495665_0342277_57_389 | 110 |
| 679 | 3300046535 | Ga0495586_0261099 | Ga0495586_0261099_500_832 | 110 |
| 680 | 3300046543 | Ga0495645_0185162 | Ga0495645_0185162_986_1318 | 110 |
| 681 | 3300046559 | Ga0495667_0442919 | Ga0495667_0442919_324_656 | 110 |
| 682 | 3300046642 | Ga0495634_0237357 | Ga0495634_0237357_58_390 | 110 |
| 683 | 3300046675 | Ga0495657_0043261 | Ga0495657_0043261_521_853 | 110 |
| 684 | 3300046679 | Ga0495623_0660887 | Ga0495623_0660887_131_463 | 110 |
| 685 | 3300046680 | Ga0495646_0077365 | Ga0495646_0077365_430_762 | 110 |
| 686 | 3300046683 | Ga0495658_0247506 | Ga0495658_0247506_36_368 | 110 |
| 687 | 3300046684 | Ga0495669_0007236 | Ga0495669_0007236_4186_4518 | 110 |
| 688 | 3300046689 | Ga0495613_0116356 | Ga0495613_0116356_776_1108 | 110 |
| 689 | 3300046690 | Ga0495624_0429243 | Ga0495624_0429243_439_771 | 110 |
| 690 | 3300046692 | Ga0495671_0103797 | Ga0495671_0103797_1000_1332 | 110 |
| 691 | 3300046694 | Ga0495649_0129760 | Ga0495649_0129760_869_1201 | 110 |
| 692 | 3300046794 | Ga0495589_0058955 | Ga0495589_0058955_462_794 | 110 |
| 693 | 3300046809 | Ga0495600_0158720 | Ga0495600_0158720_1064_1396 | 110 |
| 694 | 3300046810 | Ga0495660_0113459 | Ga0495660_0113459_167_499 | 110 |
| 695 | 3300047315 | Ga0495581_0137411 | Ga0495581_0137411_1026_1358 | 110 |
| 696 | 3300047317 | Ga0495604_0278342 | Ga0495604_0278342_68_400 | 110 |
| 697 | 3300047319 | Ga0495674_0227103 | Ga0495674_0227103_1045_1377 | 110 |
| 698 | 3300047319 | Ga0495674_0240872 | Ga0495674_0240872_951_1283 | 110 |
| 699 | 3300047320 | Ga0495672_0012514 | Ga0495672_0012514_1044_1376 | 110 |
| 700 | 3300047321 | Ga0495676_0079240 | Ga0495676_0079240_1873_2205 | 110 |
| 701 | 3300047321 | Ga0495676_0245230 | Ga0495676_0245230_70_402 | 110 |
| 702 | 3300047322 | Ga0495680_0066951 | Ga0495680_0066951_995_1327 | 110 |
| 703 | 3300047323 | Ga0495683_0004881 | Ga0495683_0004881_6758_7090 | 110 |
| 704 | 3300047443 | Ga0495687_018699 | Ga0495687_018699_2662_2994 | 110 |
| 705 | 3300047444 | Ga0495675_0163806 | Ga0495675_0163806_81_413 | 110 |
| 706 | 3300047445 | Ga0495677_0062008 | Ga0495677_0062008_130_462 | 110 |
| 707 | 3300047446 | Ga0495679_104231 | Ga0495679_104231_138_470 | 110 |
| 708 | 3300047469 | Ga0495673_0010616 | Ga0495673_0010616_655_987 | 110 |
| 709 | 3300047673 | Ga0495593_0145725 | Ga0495593_0145725_592_924 | 110 |
| 710 | 3300048088 | Ga0495602_0193858 | Ga0495602_0193858_87_419 | 110 |
| 711 | 3300048089 | Ga0495614_0118121 | Ga0495614_0118121_690_1022 | 110 |
| 712 | 3300048091 | Ga0495626_0150504 | Ga0495626_0150504_552_884 | 110 |
| 713 | 3300048903 | Ga0496100_0800290 | Ga0496100_0800290_165_497 | 110 |
| 714 | 3300048904 | Ga0496101_0247637 | Ga0496101_0247637_185_517 | 110 |
| 715 | 3300048907 | Ga0496104_0480068 | Ga0496104_0480068_601_933 | 110 |
| 716 | 3300048908 | Ga0496105_0126136 | Ga0496105_0126136_484_816 | 110 |
| 717 | 3300048908 | Ga0496105_0896926 | Ga0496105_0896926_226_558 | 110 |
| 718 | 3300048909 | Ga0496106_1408451 | Ga0496106_1408451_75_407 | 110 |
| 719 | 3300048916 | Ga0496113_0928634 | Ga0496113_0928634_108_440 | 110 |
| 720 | 3300049460 | Ga0495682_0014380 | Ga0495682_0014380_1715_2047 | 110 |
| 721 | 3300049591 | Ga0501075_0182724 | Ga0501075_0182724_1048_1380 | 110 |
| 722 | 3300050509 | nmdc:mga0qj67_1250747_c1 | nmdc:mga0qj67_1250747_c1_108_440 | 110 |
| 723 | 3300053077 | Ga0495601_0165163 | Ga0495601_0165163_1027_1359 | 110 |
| 724 | 3300053078 | Ga0495612_0341893 | Ga0495612_0341893_17_349 | 110 |
| 725 | 3300053085 | Ga0495619_0092116 | Ga0495619_0092116_662_994 | 110 |
| 726 | 3300014497 | Ga0182008_10094502 | Ga0182008_100945022 | 111 |
| 727 | iso_pu_bacteria | 2501025501 | 2501070492 | 111 |
| 728 | iso_pu_bacteria | 2510917015 | 2511108876 | 111 |
| 729 | iso_pu_bacteria | 2856287931 | 2856287946 | 111 |
| 730 | 3300001979 | JGI24740J21852_10018797 | JGI24740J21852_100187972 | 115 |
| 731 | 3300001989 | JGI24739J22299_10014786 | JGI24739J22299_100147862 | 115 |
| 732 | 3300001989 | JGI24739J22299_10014941 | JGI24739J22299_100149412 | 115 |
| 733 | 3300001989 | JGI24739J22299_10014954 | JGI24739J22299_100149542 | 115 |
| 734 | 3300001989 | JGI24739J22299_10014969 | JGI24739J22299_100149692 | 115 |
| 735 | 3300001990 | JGI24737J22298_10011905 | JGI24737J22298_100119052 | 115 |
| 736 | 3300002067 | JGI24735J21928_10002116 | JGI24735J21928_100021164 | 115 |
| 737 | 3300002075 | JGI24738J21930_10006207 | JGI24738J21930_100062072 | 115 |
| 738 | 3300003354 | JGI25160J50197_1014753 | JGI25160J50197_10147533 | 115 |
| 739 | 3300003354 | JGI25160J50197_1054618 | JGI25160J50197_10546182 | 115 |
| 740 | 3300005327 | Ga0070658_10067828 | Ga0070658_100678282 | 115 |
| 741 | 3300005328 | Ga0070676_10255499 | Ga0070676_102554992 | 115 |
| 742 | 3300005335 | Ga0070666_10050419 | Ga0070666_100504192 | 115 |
| 743 | 3300005337 | Ga0070682_100065216 | Ga0070682_1000652162 | 115 |
| 744 | 3300005355 | Ga0070671_100052699 | Ga0070671_1000526992 | 115 |
| 745 | 3300005355 | Ga0070671_100513810 | Ga0070671_1005138101 | 115 |
| 746 | 3300005364 | Ga0070673_100093963 | Ga0070673_1000939632 | 115 |
| 747 | 3300005364 | Ga0070673_100673720 | Ga0070673_1006737202 | 115 |
| 748 | 3300005366 | Ga0070659_101537332 | Ga0070659_1015373321 | 115 |
| 749 | 3300005367 | Ga0070667_100301323 | Ga0070667_1003013232 | 115 |
| 750 | 3300005367 | Ga0070667_100312911 | Ga0070667_1003129111 | 115 |
| 751 | 3300005456 | Ga0070678_100332198 | Ga0070678_1003321982 | 115 |
| 752 | 3300005456 | Ga0070678_100339789 | Ga0070678_1003397891 | 115 |
| 753 | 3300005535 | Ga0070684_101418244 | Ga0070684_1014182441 | 115 |
| 754 | 3300005548 | Ga0070665_100099392 | Ga0070665_1000993923 | 115 |
| 755 | 3300005616 | Ga0068852_100198172 | Ga0068852_1001981723 | 115 |
| 756 | 3300005834 | Ga0068851_10313365 | Ga0068851_103133652 | 115 |
| 757 | 3300006175 | Ga0070712_101474143 | Ga0070712_1014741431 | 115 |
| 758 | 3300006237 | Ga0097621_101177049 | Ga0097621_1011770492 | 115 |
| 759 | 3300009011 | Ga0105251_10080688 | Ga0105251_100806881 | 115 |
| 760 | 3300009092 | Ga0105250_10042193 | Ga0105250_100421931 | 115 |
| 761 | 3300009093 | Ga0105240_10245188 | Ga0105240_102451883 | 115 |
| 762 | 3300009098 | Ga0105245_10079895 | Ga0105245_100798952 | 115 |
| 763 | 3300009101 | Ga0105247_10035340 | Ga0105247_100353403 | 115 |
| 764 | 3300009174 | Ga0105241_10031643 | Ga0105241_100316432 | 115 |
| 765 | 3300009177 | Ga0105248_10232458 | Ga0105248_102324583 | 115 |
| 766 | 3300009177 | Ga0105248_10545735 | Ga0105248_105457352 | 115 |
| 767 | 3300009545 | Ga0105237_10946118 | Ga0105237_109461182 | 115 |
| 768 | 3300009551 | Ga0105238_10021194 | Ga0105238_100211945 | 115 |
| 769 | 3300010375 | Ga0105239_10079390 | Ga0105239_100793903 | 115 |
| 770 | 3300011119 | Ga0105246_10135957 | Ga0105246_101359571 | 115 |
| 771 | 3300013105 | Ga0157369_10140370 | Ga0157369_101403703 | 115 |
| 772 | 3300013296 | Ga0157374_10077502 | Ga0157374_100775022 | 115 |
| 773 | 3300013297 | Ga0157378_10063043 | Ga0157378_100630432 | 115 |
| 774 | 3300013306 | Ga0163162_10154128 | Ga0163162_101541282 | 115 |
| 775 | 3300013308 | Ga0157375_10233048 | Ga0157375_102330482 | 115 |
| 776 | 3300014497 | Ga0182008_10023906 | Ga0182008_100239062 | 115 |
| 777 | 3300014969 | Ga0157376_10332684 | Ga0157376_103326842 | 115 |
| 778 | 3300025302 | Ga0207426_1001804 | Ga0207426_10018047 | 115 |
| 779 | 3300025321 | Ga0207656_10229232 | Ga0207656_102292322 | 115 |
| 780 | 3300025711 | Ga0207696_1014539 | Ga0207696_10145393 | 115 |
| 781 | 3300025728 | Ga0207655_1025765 | Ga0207655_10257652 | 115 |
| 782 | 3300025735 | Ga0207713_1024005 | Ga0207713_10240052 | 115 |
| 783 | 3300025900 | Ga0207710_10019310 | Ga0207710_100193103 | 115 |
| 784 | 3300025900 | Ga0207710_10209388 | Ga0207710_102093881 | 115 |
| 785 | 3300025901 | Ga0207688_10776768 | Ga0207688_107767682 | 115 |
| 786 | 3300025903 | Ga0207680_10066894 | Ga0207680_100668942 | 115 |
| 787 | 3300025903 | Ga0207680_10078681 | Ga0207680_100786812 | 115 |
| 788 | 3300025904 | Ga0207647_10019140 | Ga0207647_100191403 | 115 |
| 789 | 3300025907 | Ga0207645_10390005 | Ga0207645_103900052 | 115 |
| 790 | 3300025909 | Ga0207705_10092025 | Ga0207705_100920252 | 115 |
| 791 | 3300025911 | Ga0207654_10150176 | Ga0207654_101501761 | 115 |
| 792 | 3300025914 | Ga0207671_10245106 | Ga0207671_102451062 | 115 |
| 793 | 3300025915 | Ga0207693_10769017 | Ga0207693_107690172 | 115 |
| 794 | 3300025924 | Ga0207694_10241255 | Ga0207694_102412552 | 115 |
| 795 | 3300025925 | Ga0207650_10076112 | Ga0207650_100761122 | 115 |
| 796 | 3300025927 | Ga0207687_10210617 | Ga0207687_102106171 | 115 |
| 797 | 3300025931 | Ga0207644_10052600 | Ga0207644_100526002 | 115 |
| 798 | 3300025931 | Ga0207644_10683518 | Ga0207644_106835181 | 115 |
| 799 | 3300025932 | Ga0207690_11661209 | Ga0207690_116612091 | 115 |
| 800 | 3300025941 | Ga0207711_10332560 | Ga0207711_103325601 | 115 |
| 801 | 3300025960 | Ga0207651_10554934 | Ga0207651_105549342 | 115 |
| 802 | 3300025986 | Ga0207658_11169373 | Ga0207658_111693731 | 115 |
| 803 | 3300026067 | Ga0207678_10035555 | Ga0207678_100355554 | 115 |
| 804 | 3300026121 | Ga0207683_10177407 | Ga0207683_101774072 | 115 |
| 805 | 3300026121 | Ga0207683_10376503 | Ga0207683_103765032 | 115 |
| 806 | 3300026142 | Ga0207698_10175873 | Ga0207698_101758731 | 115 |
| 807 | 3300028379 | Ga0268266_10137789 | Ga0268266_101377892 | 115 |
| 808 | 3300046452 | Ga0495617_099588 | Ga0495617_099588_520_867 | 115 |
| 809 | 3300046454 | Ga0495592_0161473 | Ga0495592_0161473_1048_1395 | 115 |
| 810 | 3300046455 | Ga0495603_0063339 | Ga0495603_0063339_1774_2121 | 115 |
| 811 | 3300046457 | Ga0495590_0002933 | Ga0495590_0002933_2564_2911 | 115 |
| 812 | 3300046457 | Ga0495590_0036120 | Ga0495590_0036120_158_505 | 115 |
| 813 | 3300046458 | Ga0495591_035547 | Ga0495591_035547_1025_1372 | 115 |
| 814 | 3300046459 | Ga0495629_0013766 | Ga0495629_0013766_5388_5735 | 115 |
| 815 | 3300046462 | Ga0495651_0195108 | Ga0495651_0195108_1001_1348 | 115 |
| 816 | 3300046463 | Ga0495653_0070521 | Ga0495653_0070521_66_413 | 115 |
| 817 | 3300046463 | Ga0495653_0192875 | Ga0495653_0192875_72_419 | 115 |
| 818 | 3300046471 | Ga0495650_0014917 | Ga0495650_0014917_105_452 | 115 |
| 819 | 3300046471 | Ga0495650_0058020 | Ga0495650_0058020_159_506 | 115 |
| 820 | 3300046472 | Ga0495580_0193451 | Ga0495580_0193451_961_1308 | 115 |
| 821 | 3300046473 | Ga0495582_0758195 | Ga0495582_0758195_80_427 | 115 |
| 822 | 3300046474 | Ga0495605_0026412 | Ga0495605_0026412_1644_1991 | 115 |
| 823 | 3300046474 | Ga0495605_0095825 | Ga0495605_0095825_29_376 | 115 |
| 824 | 3300046476 | Ga0495662_0094547 | Ga0495662_0094547_1040_1387 | 115 |
| 825 | 3300046477 | Ga0495664_0101274 | Ga0495664_0101274_128_475 | 115 |
| 826 | 3300046491 | Ga0495584_0022112 | Ga0495584_0022112_1628_1975 | 115 |
| 827 | 3300046492 | Ga0495585_0103948 | Ga0495585_0103948_169_516 | 115 |
| 828 | 3300046499 | Ga0495594_0133609 | Ga0495594_0133609_133_480 | 115 |
| 829 | 3300046500 | Ga0495596_0016715 | Ga0495596_0016715_942_1289 | 115 |
| 830 | 3300046501 | Ga0495607_0113580 | Ga0495607_0113580_138_485 | 115 |
| 831 | 3300046506 | Ga0495583_0000607 | Ga0495583_0000607_41850_42197 | 115 |
| 832 | 3300046506 | Ga0495583_0070194 | Ga0495583_0070194_979_1326 | 115 |
| 833 | 3300046506 | Ga0495583_0078012 | Ga0495583_0078012_83_430 | 115 |
| 834 | 3300046507 | Ga0495606_0024939 | Ga0495606_0024939_2410_2757 | 115 |
| 835 | 3300046507 | Ga0495606_0080001 | Ga0495606_0080001_1626_1973 | 115 |
| 836 | 3300046507 | Ga0495606_0128554 | Ga0495606_0128554_143_490 | 115 |
| 837 | 3300046511 | Ga0495608_0153497 | Ga0495608_0153497_172_519 | 115 |
| 838 | 3300046513 | Ga0495616_0082750 | Ga0495616_0082750_140_487 | 115 |
| 839 | 3300046514 | Ga0495618_0733549 | Ga0495618_0733549_101_448 | 115 |
| 840 | 3300046515 | Ga0495620_0028642 | Ga0495620_0028642_1948_2295 | 115 |
| 841 | 3300046516 | Ga0495628_0181574 | Ga0495628_0181574_948_1295 | 115 |
| 842 | 3300046517 | Ga0495630_0102363 | Ga0495630_0102363_65_412 | 115 |
| 843 | 3300046518 | Ga0495631_0069097 | Ga0495631_0069097_151_498 | 115 |
| 844 | 3300046519 | Ga0495632_0028797 | Ga0495632_0028797_793_1140 | 115 |
| 845 | 3300046520 | Ga0495637_0103823 | Ga0495637_0103823_173_520 | 115 |
| 846 | 3300046522 | Ga0495643_0054843 | Ga0495643_0054843_943_1290 | 115 |
| 847 | 3300046523 | Ga0495644_0062806 | Ga0495644_0062806_96_443 | 115 |
| 848 | 3300046524 | Ga0495648_0063859 | Ga0495648_0063859_752_1099 | 115 |
| 849 | 3300046524 | Ga0495648_0096107 | Ga0495648_0096107_994_1341 | 115 |
| 850 | 3300046526 | Ga0495666_0082360 | Ga0495666_0082360_1060_1407 | 115 |
| 851 | 3300046528 | Ga0495642_0009484 | Ga0495642_0009484_1716_2063 | 115 |
| 852 | 3300046528 | Ga0495642_0080414 | Ga0495642_0080414_70_417 | 115 |
| 853 | 3300046530 | Ga0495654_0021791 | Ga0495654_0021791_1434_1781 | 115 |
| 854 | 3300046535 | Ga0495586_0116765 | Ga0495586_0116765_1013_1360 | 115 |
| 855 | 3300046536 | Ga0495587_0091901 | Ga0495587_0091901_1039_1386 | 115 |
| 856 | 3300046539 | Ga0495621_0052811 | Ga0495621_0052811_124_471 | 115 |
| 857 | 3300046542 | Ga0495597_0026676 | Ga0495597_0026676_1778_2125 | 115 |
| 858 | 3300046543 | Ga0495645_0154713 | Ga0495645_0154713_74_421 | 115 |
| 859 | 3300046557 | Ga0495622_0084598 | Ga0495622_0084598_86_433 | 115 |
| 860 | 3300046558 | Ga0495633_0036382 | Ga0495633_0036382_349_696 | 115 |
| 861 | 3300046559 | Ga0495667_0156455 | Ga0495667_0156455_1035_1382 | 115 |
| 862 | 3300046615 | Ga0495656_0077409 | Ga0495656_0077409_125_472 | 115 |
| 863 | 3300046616 | Ga0495668_0022302 | Ga0495668_0022302_2322_2669 | 115 |
| 864 | 3300046642 | Ga0495634_0152876 | Ga0495634_0152876_165_512 | 115 |
| 865 | 3300046648 | Ga0495611_0077193 | Ga0495611_0077193_1059_1406 | 115 |
| 866 | 3300046660 | Ga0495625_0167084 | Ga0495625_0167084_1036_1383 | 115 |
| 867 | 3300046663 | Ga0495635_0168769 | Ga0495635_0168769_127_474 | 115 |
| 868 | 3300046665 | Ga0495661_0131410 | Ga0495661_0131410_73_420 | 115 |
| 869 | 3300046665 | Ga0495661_0146315 | Ga0495661_0146315_682_1029 | 115 |
| 870 | 3300046674 | Ga0495588_0122191 | Ga0495588_0122191_955_1302 | 115 |
| 871 | 3300046675 | Ga0495657_0136248 | Ga0495657_0136248_136_483 | 115 |
| 872 | 3300046679 | Ga0495623_0152717 | Ga0495623_0152717_75_422 | 115 |
| 873 | 3300046680 | Ga0495646_0123302 | Ga0495646_0123302_1041_1388 | 115 |
| 874 | 3300046683 | Ga0495658_0291352 | Ga0495658_0291352_152_499 | 115 |
| 875 | 3300046684 | Ga0495669_0015473 | Ga0495669_0015473_1772_2119 | 115 |
| 876 | 3300046684 | Ga0495669_0082671 | Ga0495669_0082671_176_523 | 115 |
| 877 | 3300046689 | Ga0495613_0119897 | Ga0495613_0119897_483_830 | 115 |
| 878 | 3300046690 | Ga0495624_0091514 | Ga0495624_0091514_994_1341 | 115 |
| 879 | 3300046691 | Ga0495670_0111560 | Ga0495670_0111560_125_472 | 115 |
| 880 | 3300046691 | Ga0495670_0498140 | Ga0495670_0498140_42_389 | 115 |
| 881 | 3300046692 | Ga0495671_0095388 | Ga0495671_0095388_138_485 | 115 |
| 882 | 3300046692 | Ga0495671_0111397 | Ga0495671_0111397_192_539 | 115 |
| 883 | 3300046692 | Ga0495671_0576274 | Ga0495671_0576274_28_375 | 115 |
| 884 | 3300046694 | Ga0495649_0033028 | Ga0495649_0033028_947_1294 | 115 |
| 885 | 3300046694 | Ga0495649_0104453 | Ga0495649_0104453_978_1325 | 115 |
| 886 | 3300046694 | Ga0495649_0133819 | Ga0495649_0133819_768_1115 | 115 |
| 887 | 3300046794 | Ga0495589_0022625 | Ga0495589_0022625_1817_2164 | 115 |
| 888 | 3300046794 | Ga0495589_0092126 | Ga0495589_0092126_127_474 | 115 |
| 889 | 3300046809 | Ga0495600_0152695 | Ga0495600_0152695_68_415 | 115 |
| 890 | 3300046810 | Ga0495660_0035507 | Ga0495660_0035507_957_1304 | 115 |
| 891 | 3300046810 | Ga0495660_0114475 | Ga0495660_0114475_863_1210 | 115 |
| 892 | 3300047315 | Ga0495581_0081423 | Ga0495581_0081423_176_523 | 115 |
| 893 | 3300047317 | Ga0495604_0328128 | Ga0495604_0328128_184_531 | 115 |
| 894 | 3300047319 | Ga0495674_0044862 | Ga0495674_0044862_975_1322 | 115 |
| 895 | 3300047319 | Ga0495674_0331699 | Ga0495674_0331699_714_1061 | 115 |
| 896 | 3300047320 | Ga0495672_0039428 | Ga0495672_0039428_950_1297 | 115 |
| 897 | 3300047321 | Ga0495676_0187563 | Ga0495676_0187563_1020_1367 | 115 |
| 898 | 3300047322 | Ga0495680_0217714 | Ga0495680_0217714_76_423 | 115 |
| 899 | 3300047323 | Ga0495683_0044650 | Ga0495683_0044650_1589_1936 | 115 |
| 900 | 3300047323 | Ga0495683_0069302 | Ga0495683_0069302_505_852 | 115 |
| 901 | 3300047323 | Ga0495683_0084127 | Ga0495683_0084127_189_536 | 115 |
| 902 | 3300047443 | Ga0495687_020732 | Ga0495687_020732_1641_1988 | 115 |
| 903 | 3300047444 | Ga0495675_0159693 | Ga0495675_0159693_90_437 | 115 |
| 904 | 3300047446 | Ga0495679_000074 | Ga0495679_000074_41709_42056 | 115 |
| 905 | 3300047446 | Ga0495679_028694 | Ga0495679_028694_121_468 | 115 |
| 906 | 3300047447 | Ga0495685_044742 | Ga0495685_044742_132_479 | 115 |
| 907 | 3300047469 | Ga0495673_0005854 | Ga0495673_0005854_779_1126 | 115 |
| 908 | 3300047469 | Ga0495673_0020105 | Ga0495673_0020105_1345_1692 | 115 |
| 909 | 3300047470 | Ga0495681_0077406 | Ga0495681_0077406_1011_1358 | 115 |
| 910 | 3300047471 | Ga0495684_0195463 | Ga0495684_0195463_162_509 | 115 |
| 911 | 3300047472 | Ga0495686_0460773 | Ga0495686_0460773_94_441 | 115 |
| 912 | 3300047673 | Ga0495593_0114613 | Ga0495593_0114613_67_414 | 115 |
| 913 | 3300047673 | Ga0495593_0174866 | Ga0495593_0174866_632_979 | 115 |
| 914 | 3300048088 | Ga0495602_0200463 | Ga0495602_0200463_1024_1371 | 115 |
| 915 | 3300048088 | Ga0495602_0604770 | Ga0495602_0604770_161_508 | 115 |
| 916 | 3300048089 | Ga0495614_0078827 | Ga0495614_0078827_959_1306 | 115 |
| 917 | 3300048091 | Ga0495626_0073016 | Ga0495626_0073016_1093_1440 | 115 |
| 918 | 3300048091 | Ga0495626_0097608 | Ga0495626_0097608_67_414 | 115 |
| 919 | 3300048903 | Ga0496100_0027437 | Ga0496100_0027437_2206_2553 | 115 |
| 920 | 3300048903 | Ga0496100_0173287 | Ga0496100_0173287_1039_1386 | 115 |
| 921 | 3300048904 | Ga0496101_0027851 | Ga0496101_0027851_2565_2912 | 115 |
| 922 | 3300048904 | Ga0496101_0229806 | Ga0496101_0229806_1017_1364 | 115 |
| 923 | 3300048905 | Ga0496102_0060368 | Ga0496102_0060368_2169_2516 | 115 |
| 924 | 3300048905 | Ga0496102_0263907 | Ga0496102_0263907_1017_1364 | 115 |
| 925 | 3300048906 | Ga0496103_0040556 | Ga0496103_0040556_1564_1911 | 115 |
| 926 | 3300048906 | Ga0496103_0143965 | Ga0496103_0143965_1033_1380 | 115 |
| 927 | 3300048907 | Ga0496104_0035316 | Ga0496104_0035316_2420_2767 | 115 |
| 928 | 3300048907 | Ga0496104_0039757 | Ga0496104_0039757_979_1326 | 115 |
| 929 | 3300048907 | Ga0496104_0333967 | Ga0496104_0333967_1010_1357 | 115 |
| 930 | 3300048908 | Ga0496105_0009047 | Ga0496105_0009047_6866_7213 | 115 |
| 931 | 3300048908 | Ga0496105_0083287 | Ga0496105_0083287_2003_2350 | 115 |
| 932 | 3300048908 | Ga0496105_0219080 | Ga0496105_0219080_1048_1395 | 115 |
| 933 | 3300048909 | Ga0496106_0061709 | Ga0496106_0061709_958_1305 | 115 |
| 934 | 3300048909 | Ga0496106_0266342 | Ga0496106_0266342_949_1296 | 115 |
| 935 | 3300048910 | Ga0496107_0030529 | Ga0496107_0030529_1948_2295 | 115 |
| 936 | 3300048910 | Ga0496107_0213913 | Ga0496107_0213913_121_468 | 115 |
| 937 | 3300048911 | Ga0496108_0067635 | Ga0496108_0067635_1595_1942 | 115 |
| 938 | 3300048911 | Ga0496108_0260709 | Ga0496108_0260709_141_488 | 115 |
| 939 | 3300048912 | Ga0496109_0064488 | Ga0496109_0064488_1445_1792 | 115 |
| 940 | 3300048912 | Ga0496109_0273600 | Ga0496109_0273600_1033_1380 | 115 |
| 941 | 3300048913 | Ga0496110_0050639 | Ga0496110_0050639_939_1286 | 115 |
| 942 | 3300048913 | Ga0496110_0242669 | Ga0496110_0242669_1145_1492 | 115 |
| 943 | 3300048914 | Ga0496111_0009138 | Ga0496111_0009138_948_1295 | 115 |
| 944 | 3300048914 | Ga0496111_0097031 | Ga0496111_0097031_727_1074 | 115 |
| 945 | 3300048915 | Ga0496112_0014694 | Ga0496112_0014694_1561_1908 | 115 |
| 946 | 3300048916 | Ga0496113_0023826 | Ga0496113_0023826_1548_1895 | 115 |
| 947 | 3300048917 | Ga0496114_0279570 | Ga0496114_0279570_75_422 | 115 |
| 948 | 3300048917 | Ga0496114_0764264 | Ga0496114_0764264_329_676 | 115 |
| 949 | 3300048918 | Ga0496115_0037264 | Ga0496115_0037264_1516_1863 | 115 |
| 950 | 3300048918 | Ga0496115_0037513 | Ga0496115_0037513_1050_1397 | 115 |
| 951 | 3300048919 | Ga0496116_0068885 | Ga0496116_0068885_293_640 | 115 |
| 952 | 3300048920 | Ga0496117_0045834 | Ga0496117_0045834_2102_2449 | 115 |
| 953 | 3300048920 | Ga0496117_0051367 | Ga0496117_0051367_989_1336 | 115 |
| 954 | 3300048921 | Ga0496118_0010561 | Ga0496118_0010561_5665_6012 | 115 |
| 955 | 3300048921 | Ga0496118_0050708 | Ga0496118_0050708_1290_1637 | 115 |
| 956 | 3300048922 | Ga0496119_0054130 | Ga0496119_0054130_1539_1886 | 115 |
| 957 | 3300048922 | Ga0496119_0122388 | Ga0496119_0122388_985_1332 | 115 |
| 958 | 3300048923 | Ga0496120_0038699 | Ga0496120_0038699_1370_1717 | 115 |
| 959 | 3300048923 | Ga0496120_0103875 | Ga0496120_0103875_159_506 | 115 |
| 960 | 3300048924 | Ga0496121_0076188 | Ga0496121_0076188_2255_2602 | 115 |
| 961 | 3300048924 | Ga0496121_0080032 | Ga0496121_0080032_74_421 | 115 |
| 962 | 3300048924 | Ga0496121_0183574 | Ga0496121_0183574_1036_1383 | 115 |
| 963 | 3300048925 | Ga0496122_0053435 | Ga0496122_0053435_1153_1500 | 115 |
| 964 | 3300048926 | Ga0496123_0048281 | Ga0496123_0048281_970_1317 | 115 |
| 965 | 3300048927 | Ga0496124_0647837 | Ga0496124_0647837_158_505 | 115 |
| 966 | 3300048928 | Ga0496125_0062775 | Ga0496125_0062775_955_1302 | 115 |
| 967 | 3300048929 | Ga0496126_0261655 | Ga0496126_0261655_1029_1376 | 115 |
| 968 | 3300049459 | Ga0495678_015939 | Ga0495678_015939_975_1322 | 115 |
| 969 | 3300049459 | Ga0495678_167237 | Ga0495678_167237_332_679 | 115 |
| 970 | 3300049460 | Ga0495682_0004477 | Ga0495682_0004477_1251_1598 | 115 |
| 971 | 3300049460 | Ga0495682_0013582 | Ga0495682_0013582_781_1128 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1oct-assembly1.cif.gz_C | crystal structure of the oct-1 pou domain bound to an octamer site: dna recognition with tethered dna-binding modules | 0.7852 | 16 | 67 |
| 3f8m-assembly1.cif.gz_B | crystal structure of phnf from mycobacterium smegmatis | 0.7824 | 41 | 71 |
| 7sj3-assembly1.cif.gz_B | structure of cdk4-cyclin d3 bound to abemaciclib | 0.7769 | 23 | 63 |
| 2rn7-assembly1.cif.gz_A | nmr solution structure of tnpe protein from shigella flexneri. northeast structural genomics target sfr125 | 0.7628 | 9 | 74 |
| 1l3l-assembly2.cif.gz_A | crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna | 0.7576 | 23 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKH5_4_69_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9601 | 12 | 74 | 1.10.10.10 |
| af_P9WKH5_4_69_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9051 | 12 | 74 | 1.10.10.10 |
| af_P9WGW7_231_285_1.10.150.240 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.8126 | 20 | 72 | 1.10.150.240 |
| 1octC02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.7852 | 16 | 67 | 1.10.10.60 |
| af_P9WGW7_231_285_1.10.150.240 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.7738 | 20 | 72 | 1.10.150.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R4W4S8-F1-model_v4 | IS3 family transposase | 1.005 | 13 | 58 |
|
| AF-A0A323UP75-F1-model_v4 | IS3 family transposase | 0.9842 | 18 | 98 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A1I7M2Q8-F1-model_v4 | Transposase | 0.9827 | 20 | 115 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-U3PCE4-F1-model_v4 | Transposase | 0.9737 | 14 | 107 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A5B8C2U2-F1-model_v4 | Transposase | 0.9714 | 11 | 105 |
GO:0003677
GO:0004803 GO:0006313 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar