F487114

General Info

Members Datasets Scaffolds Average Seq Length
971 434 940 110

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_101537332|Ga0070659_1015373321
Length 120
Sequence MENSKAESKVKVKKKVTLPYSLEVRARAVRMVFEPQHQYKSHWAAIKSIAPKIGCTAETLRIGVRRAETDRGLRAGQTTQEQERIKALEREVRELRQVNEILRKASAYFAQAALDRRVKT

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
5 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
6 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
7 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
8 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
9 2773857925 Microvirga vignae BR3299 Isolate Unclassified
10 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
11 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
12 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
13 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
14 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
15 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
16 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
17 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
18 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
102 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
103 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
180 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
194 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
195 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
196 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
220 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
231 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
232 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
233 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
234 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
235 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
236 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
239 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
240 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
241 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
242 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
243 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
244 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
247 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
256 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
260 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
277 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
278 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
294 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
318 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
340 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
341 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
342 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
343 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
360 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
361 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
362 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
363 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
370 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
371 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
372 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
373 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
374 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
375 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
376 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
377 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
378 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
379 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
380 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
396 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
397 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
398 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
399 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
400 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
401 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
402 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
403 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
404 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
405 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
406 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
407 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
408 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
409 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
410 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
413 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
414 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
415 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
416 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
417 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
418 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
419 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
420 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
421 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
422 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
423 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
424 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
425 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
428 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
429 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
430 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
431 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
432 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
433 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
434 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.6
Metatranscriptomes 0.21
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0.93
Rhizoplane 7.72
Rhizosphere 84.86
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018797 3300001979 Bacteria 2444
2 JGI24739J22299_10014786 3300001989 Bacteria 2838
3 JGI24739J22299_10014941 3300001989 Bacteria 2823
4 JGI24739J22299_10014954 3300001989 Bacteria 2822
5 JGI24739J22299_10014969 3300001989 Bacteria 2821
6 JGI24737J22298_10011905 3300001990 Bacteria 2841
7 JGI24735J21928_10002116 3300002067 Bacteria 6994
8 JGI24738J21930_10006207 3300002075 Bacteria 2822
9 JGI24742J22300_10030343 3300002244 Bacteria 943
10 JGI25406J46586_10037561 3300003203 Bacteria 1744
11 JGI25406J46586_10040120 3300003203 Bacteria 1663
12 rootH2_10112718 3300003320 Bacteria 4376
13 JGI25160J50197_1014753 3300003354 Bacteria 2598
14 JGI25160J50197_1054618 3300003354 Bacteria 827
15 Ga0065712_10294991 3300005290 Bacteria 870
16 Ga0065715_10328151 3300005293 Bacteria 986
17 Ga0065707_11079123 3300005295 Bacteria 520
18 Ga0070658_10067828 3300005327 Bacteria 2915
19 Ga0070658_10312761 3300005327 Bacteria 1340
20 Ga0070676_10255499 3300005328 Bacteria 1171
21 Ga0070670_100151636 3300005331 Bacteria 2006
22 Ga0070670_100622975 3300005331 Bacteria 966
23 Ga0070670_101244196 3300005331 Bacteria 681
24 Ga0070670_101459568 3300005331 Bacteria 628
25 Ga0068869_100218925 3300005334 Bacteria 1508
26 Ga0068869_100301097 3300005334 Bacteria 1295
27 Ga0070666_10001193 3300005335 Bacteria 15729
28 Ga0070666_10050419 3300005335 Bacteria 2799
29 Ga0070682_100064785 3300005337 Bacteria 2321
30 Ga0070682_100065216 3300005337 Bacteria 2314
31 Ga0068868_100212352 3300005338 Bacteria 1618
32 Ga0070660_100151611 3300005339 Bacteria 1864
33 Ga0070668_100001401 3300005347 Bacteria 17339
34 Ga0070675_100111634 3300005354 Bacteria 2314
35 Ga0070675_100346522 3300005354 Bacteria 1317
36 Ga0070671_100052699 3300005355 Bacteria 3383
37 Ga0070671_100513810 3300005355 Bacteria 1031
38 Ga0070673_100093963 3300005364 Bacteria 2457
39 Ga0070673_100673720 3300005364 Bacteria 948
40 Ga0070673_101113402 3300005364 Bacteria 738
41 Ga0070688_100327416 3300005365 Bacteria 1115
42 Ga0070688_100904759 3300005365 Bacteria 696
43 Ga0070659_101537332 3300005366 Bacteria 593
44 Ga0070659_101699200 3300005366 Bacteria 564
45 Ga0070667_100001946 3300005367 Bacteria 18322
46 Ga0070667_100301323 3300005367 Bacteria 1443
47 Ga0070667_100312911 3300005367 Bacteria 1416
48 Ga0070667_100320820 3300005367 Bacteria 1398
49 Ga0070667_101008652 3300005367 Bacteria 777
50 Ga0070714_100793881 3300005435 Bacteria 917
51 Ga0070710_10153304 3300005437 Bacteria 1423
52 Ga0070711_100151979 3300005439 Bacteria 1747
53 Ga0070663_101107468 3300005455 Bacteria 692
54 Ga0070663_101438891 3300005455 Bacteria 611
55 Ga0070678_100291393 3300005456 Bacteria 1384
56 Ga0070678_100332198 3300005456 Bacteria 1301
57 Ga0070678_100339789 3300005456 Bacteria 1288
58 Ga0070678_100773868 3300005456 Bacteria 870
59 Ga0070685_10106003 3300005466 Bacteria 1724
60 Ga0070685_10145997 3300005466 Bacteria 1494
61 Ga0070707_100970467 3300005468 Bacteria 815
62 Ga0070698_100304462 3300005471 Bacteria 1524
63 Ga0070679_101601707 3300005530 Bacteria 599
64 Ga0070684_101418244 3300005535 Bacteria 654
65 Ga0068853_102065077 3300005539 Bacteria 553
66 Ga0070672_100169555 3300005543 Bacteria 1815
67 Ga0070672_101621371 3300005543 Bacteria 581
68 Ga0070665_100099392 3300005548 Bacteria 2914
69 Ga0070665_100232511 3300005548 Bacteria 1843
70 Ga0070665_100314592 3300005548 Bacteria 1570
71 Ga0070665_100547289 3300005548 Bacteria 1169
72 Ga0070704_100770565 3300005549 Bacteria 858
73 Ga0068855_100349567 3300005563 Bacteria 1629
74 Ga0070664_101005843 3300005564 Bacteria 784
75 Ga0068856_100305166 3300005614 Bacteria 1610
76 Ga0068856_101126525 3300005614 Bacteria 802
77 Ga0068852_100006949 3300005616 Bacteria 8236
78 Ga0068852_100198172 3300005616 Bacteria 1899
79 Ga0068852_101059126 3300005616 Bacteria 830
80 Ga0068859_101278173 3300005617 Bacteria 809
81 Ga0068859_102388689 3300005617 Bacteria 583
82 Ga0068864_100374626 3300005618 Bacteria 1348
83 Ga0068866_10275061 3300005718 Bacteria 1041
84 Ga0068861_102582594 3300005719 Bacteria 512
85 Ga0068851_10313365 3300005834 Bacteria 905
86 Ga0068863_100002488 3300005841 Bacteria 18322
87 Ga0068863_100017312 3300005841 Bacteria 6911
88 Ga0068863_100327227 3300005841 Bacteria 1489
89 Ga0068863_100386720 3300005841 Bacteria 1367
90 Ga0068863_100890361 3300005841 Bacteria 890
91 Ga0068860_100014783 3300005843 Bacteria 7634
92 Ga0081455_10055690 3300005937 Bacteria 3363
93 Ga0081538_10068670 3300005981 Bacteria 1969
94 Ga0081539_10011863 3300005985 Bacteria 6811
95 Ga0081539_10012508 3300005985 Bacteria 6531
96 Ga0081539_10054045 3300005985 Bacteria 2245
97 Ga0075365_11278816 3300006038 Bacteria 516
98 Ga0075432_10407140 3300006058 Bacteria 588
99 Ga0070716_100619356 3300006173 Bacteria 817
100 Ga0070712_100312298 3300006175 Bacteria 1276
101 Ga0070712_100490447 3300006175 Bacteria 1028
102 Ga0070712_101474143 3300006175 Bacteria 594
103 Ga0097621_100132935 3300006237 Bacteria 2119
104 Ga0097621_100177034 3300006237 Bacteria 1841
105 Ga0097621_101177049 3300006237 Bacteria 721
106 Ga0068871_100132447 3300006358 Bacteria 2115
107 Ga0068871_100221464 3300006358 Bacteria 1639
108 Ga0075428_100429855 3300006844 Bacteria 1415
109 Ga0075428_102243809 3300006844 Bacteria 563
110 Ga0075430_100287654 3300006846 Bacteria 1360
111 Ga0075430_101783466 3300006846 Bacteria 505
112 Ga0075431_100378052 3300006847 Bacteria 1421
113 Ga0075429_100378781 3300006880 Bacteria 1239
114 Ga0068865_100198362 3300006881 Bacteria 1557
115 Ga0075436_100143339 3300006914 Bacteria 1680
116 Ga0097620_101278283 3300006931 Bacteria 809
117 Ga0099794_10533633 3300007265 Bacteria 619
118 Ga0105251_10080688 3300009011 Bacteria 1504
119 Ga0105250_10042193 3300009092 Bacteria 1828
120 Ga0105250_10302218 3300009092 Bacteria 692
121 Ga0105240_10245188 3300009093 Bacteria 2075
122 Ga0105240_11187964 3300009093 Bacteria 808
123 Ga0111539_10061134 3300009094 Bacteria 4463
124 Ga0111539_10513727 3300009094 Bacteria 1395
125 Ga0111539_11643268 3300009094 Bacteria 745
126 Ga0105245_10079895 3300009098 Bacteria 2987
127 Ga0105245_11794379 3300009098 Bacteria 666
128 Ga0105247_10035340 3300009101 Bacteria 3046
129 Ga0105247_10216304 3300009101 Bacteria 1295
130 Ga0114129_10548674 3300009147 Bacteria 1503
131 Ga0105241_10031643 3300009174 Bacteria 3961
132 Ga0105248_10232458 3300009177 Bacteria 2075
133 Ga0105248_10545735 3300009177 Bacteria 1308
134 Ga0105248_13044833 3300009177 Bacteria 534
135 Ga0105237_10946118 3300009545 Bacteria 868
136 Ga0105237_11697765 3300009545 Bacteria 639
137 Ga0105238_10021194 3300009551 Bacteria 6624
138 Ga0105239_10079390 3300010375 Bacteria 3611
139 Ga0105246_10135957 3300011119 Bacteria 1842
140 Ga0157344_1006271 3300012476 Bacteria 763
141 Ga0157321_1013110 3300012487 Bacteria 671
142 Ga0157315_1019421 3300012508 Bacteria 704
143 Ga0157370_11295893 3300013104 Bacteria 656
144 Ga0157369_10140370 3300013105 Bacteria 2557
145 Ga0157369_11138615 3300013105 Bacteria 797
146 Ga0157369_11222514 3300013105 Bacteria 767
147 Ga0157374_10077502 3300013296 Bacteria 3146
148 Ga0157378_10063043 3300013297 Bacteria 3311
149 Ga0163162_10154128 3300013306 Bacteria 2417
150 Ga0163162_10449836 3300013306 Bacteria 1420
151 Ga0157375_10233048 3300013308 Bacteria 2000
152 Ga0157375_11602565 3300013308 Bacteria 770
153 Ga0163163_10291901 3300014325 Bacteria 1683
154 Ga0163163_11112003 3300014325 Bacteria 853
155 Ga0157380_13393924 3300014326 Bacteria 510
156 Ga0182008_10023906 3300014497 Bacteria 3115
157 Ga0182008_10094502 3300014497 Bacteria 1475
158 Ga0182008_10204037 3300014497 Bacteria 1007
159 Ga0157379_10068242 3300014968 Bacteria 3179
160 Ga0157379_10151646 3300014968 Bacteria 2090
161 Ga0157376_10332684 3300014969 Bacteria 1448
162 Ga0157376_10348050 3300014969 Bacteria 1417
163 Ga0157376_13099856 3300014969 Bacteria 503
164 Ga0182005_1052547 3300015265 Bacteria 1110
165 Ga0183365_10008 3300015684 Bacteria 74681
166 Ga0163161_10241960 3300017792 Bacteria 1404
167 Ga0163161_10788740 3300017792 Bacteria 797
168 Ga0209050_1039729 3300025298 Bacteria 1321
169 Ga0207426_1001804 3300025302 Bacteria 15918
170 Ga0207697_10163086 3300025315 Bacteria 973
171 Ga0207656_10229232 3300025321 Bacteria 905
172 Ga0207696_1014539 3300025711 Bacteria 2695
173 Ga0207655_1025765 3300025728 Bacteria 2845
174 Ga0207713_1024005 3300025735 Bacteria 2854
175 Ga0207692_10784257 3300025898 Bacteria 622
176 Ga0207642_10407032 3300025899 Bacteria 815
177 Ga0207710_10007973 3300025900 Bacteria 4478
178 Ga0207710_10019310 3300025900 Bacteria 2908
179 Ga0207710_10209388 3300025900 Bacteria 965
180 Ga0207688_10224182 3300025901 Bacteria 1133
181 Ga0207688_10776768 3300025901 Bacteria 607
182 Ga0207680_10001242 3300025903 Bacteria 12054
183 Ga0207680_10066894 3300025903 Bacteria 2212
184 Ga0207680_10078681 3300025903 Bacteria 2065
185 Ga0207680_10265213 3300025903 Bacteria 1190
186 Ga0207647_10019140 3300025904 Bacteria 4609
187 Ga0207645_10390005 3300025907 Bacteria 936
188 Ga0207705_10092025 3300025909 Bacteria 2221
189 Ga0207705_10218017 3300025909 Bacteria 1448
190 Ga0207654_10150176 3300025911 Bacteria 1495
191 Ga0207707_10228670 3300025912 Bacteria 1618
192 Ga0207695_10356273 3300025913 Bacteria 1350
193 Ga0207671_10245106 3300025914 Bacteria 1408
194 Ga0207671_10266968 3300025914 Bacteria 1348
195 Ga0207671_10321905 3300025914 Bacteria 1224
196 Ga0207693_10490732 3300025915 Bacteria 959
197 Ga0207693_10769017 3300025915 Bacteria 743
198 Ga0207663_10345369 3300025916 Bacteria 1125
199 Ga0207657_10137591 3300025919 Bacteria 1997
200 Ga0207657_10312808 3300025919 Bacteria 1243
201 Ga0207652_10355340 3300025921 Bacteria 1322
202 Ga0207681_10049251 3300025923 Bacteria 2847
203 Ga0207694_10241255 3300025924 Bacteria 1477
204 Ga0207650_10076112 3300025925 Bacteria 2535
205 Ga0207650_10125120 3300025925 Bacteria 2006
206 Ga0207650_10890363 3300025925 Bacteria 756
207 Ga0207659_10083362 3300025926 Bacteria 2370
208 Ga0207687_10210617 3300025927 Bacteria 1525
209 Ga0207700_10778108 3300025928 Bacteria 856
210 Ga0207664_10308064 3300025929 Bacteria 1395
211 Ga0207644_10052600 3300025931 Bacteria 2927
212 Ga0207644_10683518 3300025931 Bacteria 855
213 Ga0207690_11661209 3300025932 Bacteria 534
214 Ga0207686_10235736 3300025934 Bacteria 1329
215 Ga0207709_11282694 3300025935 Bacteria 605
216 Ga0207670_11112775 3300025936 Bacteria 667
217 Ga0207669_10477997 3300025937 Bacteria 993
218 Ga0207704_10169615 3300025938 Bacteria 1563
219 Ga0207691_10106659 3300025940 Bacteria 2495
220 Ga0207691_10284678 3300025940 Bacteria 1422
221 Ga0207711_10166274 3300025941 Bacteria 1999
222 Ga0207711_10332560 3300025941 Bacteria 1405
223 Ga0207689_10157847 3300025942 Bacteria 1870
224 Ga0207667_10290741 3300025949 Bacteria 1670
225 Ga0207651_10554934 3300025960 Bacteria 999
226 Ga0207651_11724907 3300025960 Bacteria 564
227 Ga0207668_10000897 3300025972 Bacteria 17991
228 Ga0207658_10000855 3300025986 Bacteria 25454
229 Ga0207658_10439077 3300025986 Bacteria 1154
230 Ga0207658_10585200 3300025986 Bacteria 1001
231 Ga0207658_11169373 3300025986 Bacteria 703
232 Ga0207678_10035555 3300026067 Bacteria 4337
233 Ga0207678_10118679 3300026067 Bacteria 2257
234 Ga0207678_10123486 3300026067 Bacteria 2209
235 Ga0207702_10266954 3300026078 Bacteria 1613
236 Ga0207702_10406238 3300026078 Bacteria 1314
237 Ga0207702_10514142 3300026078 Bacteria 1168
238 Ga0207641_10001239 3300026088 Bacteria 25454
239 Ga0207641_10008857 3300026088 Bacteria 8309
240 Ga0207641_10337801 3300026088 Bacteria 1432
241 Ga0207641_10383447 3300026088 Bacteria 1346
242 Ga0207641_11218551 3300026088 Bacteria 752
243 Ga0207648_10052234 3300026089 Bacteria 3573
244 Ga0207676_11419938 3300026095 Bacteria 690
245 Ga0207683_10177407 3300026121 Bacteria 1931
246 Ga0207683_10260227 3300026121 Bacteria 1584
247 Ga0207683_10376503 3300026121 Bacteria 1305
248 Ga0207698_10012755 3300026142 Bacteria 5515
249 Ga0207698_10175873 3300026142 Bacteria 1890
250 Ga0207698_11106828 3300026142 Bacteria 805
251 Ga0209371_1037806 3300027312 Bacteria 1000
252 Ga0209999_1027953 3300027543 Bacteria 1045
253 Ga0209998_10194753 3300027717 Bacteria 529
254 Ga0209974_10270365 3300027876 Bacteria 644
255 Ga0207428_10049284 3300027907 Bacteria 3375
256 Ga0268266_10137789 3300028379 Bacteria 2187
257 Ga0268266_10272892 3300028379 Bacteria 1570
258 Ga0268266_10306696 3300028379 Bacteria 1482
259 Ga0268265_11038006 3300028380 Bacteria 811
260 Ga0268264_10011283 3300028381 Bacteria 7381
261 Ga0268264_10481848 3300028381 Bacteria 1207
262 Ga0268256_1042966 3300030500 Bacteria 1000
263 Ga0307513_10215539 3300031456 Bacteria 1746
264 Ga0316575_10171221 3300031665 Bacteria 900
265 Ga0316579_10435185 3300031691 Bacteria 634
266 Ga0316576_10001399 3300031727 Bacteria 12906
267 Ga0316576_10237034 3300031727 Bacteria 1371
268 Ga0316576_10674542 3300031727 Bacteria 750
269 Ga0316578_10074903 3300031728 Bacteria 2007
270 Ga0316578_10377055 3300031728 Bacteria 842
271 Ga0316578_10607522 3300031728 Bacteria 640
272 Ga0316577_10001739 3300031733 Bacteria 10470
273 Ga0307413_11321227 3300031824 Bacteria 631
274 Ga0307413_12106688 3300031824 Bacteria 510
275 Ga0307410_10159946 3300031852 Bacteria 1686
276 Ga0307406_10073981 3300031901 Bacteria 2242
277 Ga0307406_10485378 3300031901 Bacteria 999
278 Ga0307407_10622896 3300031903 Bacteria 805
279 Ga0307407_11546073 3300031903 Bacteria 525
280 Ga0307412_11920344 3300031911 Bacteria 547
281 Ga0307409_100238227 3300031995 Bacteria 1654
282 Ga0307409_100333353 3300031995 Bacteria 1425
283 Ga0307409_100462351 3300031995 Bacteria 1227
284 Ga0307409_101136980 3300031995 Bacteria 803
285 Ga0307416_100413121 3300032002 Bacteria 1391
286 Ga0307414_10053637 3300032004 Bacteria 2813
287 Ga0307414_10098116 3300032004 Bacteria 2197
288 Ga0307414_11449263 3300032004 Bacteria 638
289 Ga0307411_11411405 3300032005 Bacteria 637
290 Ga0316583_10062843 3300032133 Bacteria 1300
291 Ga0316583_10076543 3300032133 Bacteria 1170
292 Ga0316583_10291867 3300032133 Bacteria 564
293 Ga0316585_10038761 3300032137 Bacteria 1514
294 Ga0316580_10000387 3300032139 Bacteria 9921
295 Ga0316580_10252808 3300032139 Bacteria 545
296 Ga0316592_1081511 3300033524 Bacteria 736
297 Ga0316596_1230181 3300033541 Bacteria 520
298 Ga0373926_0049132 3300035083 Bacteria 1518
299 Ga0373926_0056492 3300035083 Bacteria 1424
300 Ga0373934_0060884 3300035086 Bacteria 1503
301 Ga0373934_0066572 3300035086 Bacteria 1438
302 Ga0373944_0030361 3300035089 Bacteria 1621
303 Ga0373944_0035120 3300035089 Bacteria 1526
304 Ga0373923_0082802 3300035111 Bacteria 1393
305 Ga0373923_0596879 3300035111 Bacteria 543
306 Ga0373936_0069598 3300035113 Bacteria 1448
307 Ga0373936_0075741 3300035113 Bacteria 1393
308 Ga0373945_0030164 3300035116 Bacteria 1910
309 Ga0373945_0059526 3300035116 Bacteria 1422
310 Ga0373945_0068247 3300035116 Bacteria 1340
311 Ga0373945_0100380 3300035116 Bacteria 1132
312 Ga0373953_0059855 3300035117 Bacteria 1555
313 Ga0373953_0061514 3300035117 Bacteria 1535
314 Ga0373954_0082685 3300035118 Bacteria 1535
315 Ga0373954_0088099 3300035118 Bacteria 1488
316 Ga0373956_0066586 3300035119 Bacteria 1638
317 Ga0373956_0087905 3300035119 Bacteria 1431
318 Ga0373957_0059439 3300035120 Bacteria 1478
319 Ga0373957_0125015 3300035120 Bacteria 1043
320 Ga0373943_0075857 3300035170 Bacteria 1713
321 Ga0373943_0131275 3300035170 Bacteria 1340
322 Ga0373943_0187868 3300035170 Bacteria 1138
323 Ga0373943_0464303 3300035170 Bacteria 737
324 Ga0373946_0084264 3300035171 Bacteria 1397
325 Ga0373946_0086731 3300035171 Bacteria 1380
326 Ga0373946_0087135 3300035171 Bacteria 1377
327 Ga0373946_0130085 3300035171 Bacteria 1157
328 Ga0373946_0153889 3300035171 Bacteria 1075
329 Ga0373955_0117576 3300035172 Bacteria 1542
330 Ga0373955_0384878 3300035172 Bacteria 851
331 Ga0373942_0153805 3300035207 Bacteria 740
332 Ga0316574_0107753 3300035398 Bacteria 1785
333 Ga0373924_0046896 3300035410 Bacteria 1781
334 Ga0373924_0123204 3300035410 Bacteria 1125
335 Ga0373924_0477042 3300035410 Bacteria 560
336 Ga0373935_0151938 3300035692 Bacteria 1571
337 Ga0373935_0212344 3300035692 Bacteria 1341
338 Ga0373935_0415658 3300035692 Bacteria 967
339 Ga0373935_1046655 3300035692 Bacteria 607
340 Ga0373927_0157903 3300035695 Bacteria 1485
341 Ga0373927_0261363 3300035695 Bacteria 1138
342 Ga0373927_0422769 3300035695 Bacteria 879
343 Ga0373927_0487698 3300035695 Bacteria 814
344 Ga0373933_0172272 3300035724 Bacteria 1377
345 Ga0373933_0178808 3300035724 Bacteria 1352
346 Ga0373933_0369420 3300035724 Bacteria 933
347 Ga0373947_0098565 3300035725 Bacteria 1833
348 Ga0373947_0105969 3300035725 Bacteria 1771
349 Ga0373947_0256725 3300035725 Bacteria 1157
350 Ga0373947_0720142 3300035725 Bacteria 681
351 Ga0373937_0110578 3300036401 Bacteria 2555
352 Ga0373937_0317224 3300036401 Bacteria 1474
353 Ga0373937_0328162 3300036401 Bacteria 1448
354 Ga0373937_0370130 3300036401 Bacteria 1358
355 Ga0373937_1205156 3300036401 Bacteria 705
356 Ga0316582_0001824 3300036647 Bacteria 9637
357 Ga0316582_1270999 3300036647 Bacteria 500
358 Ga0316584_0014865 3300036712 Bacteria 5560
359 Ga0316584_0669560 3300036712 Bacteria 714
360 Ga0373925_0058690 3300037068 Bacteria 2885
361 Ga0373925_0096744 3300037068 Bacteria 2263
362 Ga0373925_0449151 3300037068 Bacteria 1055
363 Ga0373925_1436016 3300037068 Bacteria 565
364 Ga0316581_0111762 3300037588 Bacteria 842
365 Ga0436364_0105997 3300037853 Bacteria 2959
366 Ga0436364_0309800 3300037853 Bacteria 505
367 Ga0436364_0573740 3300037853 Bacteria 1326
368 Ga0436364_1125838 3300037853 Bacteria 2470
369 Ga0395901_1522460 3300038443 Bacteria 624
370 Ga0395901_1970073 3300038443 Bacteria 531
371 Ga0395901_2113597 3300038443 Bacteria 508
372 Ga0400491_09399 3300038727 Bacteria 1465
373 Ga0400483_279772 3300039062 Bacteria 1429
374 Ga0436361_0044481 3300039447 Bacteria 1081
375 Ga0439453_0074328 3300041408 Bacteria 724
376 Ga0439466_0178272 3300041411 Bacteria 648
377 Ga0451789_0042650 3300041443 Bacteria 1040
378 Ga0451791_0011144 3300041451 Bacteria 1721
379 Ga0451797_0728442 3300041453 Bacteria 938
380 Ga0451806_650239 3300041462 Bacteria 838
381 Ga0451804_0748938 3300041463 Bacteria 1308
382 Ga0451807_2057432 3300041486 Bacteria 1291
383 Ga0451835_1087131 3300041492 Bacteria 1137
384 Ga0439449_0091366 3300042007 Bacteria 1124
385 Ga0439450_229923 3300042008 Bacteria 501
386 Ga0439452_089516 3300042010 Bacteria 666
387 Ga0439452_126427 3300042010 Bacteria 543
388 Ga0439456_070758 3300042013 Bacteria 773
389 Ga0450923_070741 3300042125 Bacteria 773
390 Ga0450896_014900 3300042133 Bacteria 1111
391 Ga0450898_051491 3300042134 Bacteria 796
392 Ga0450906_059266 3300042145 Bacteria 680
393 Ga0439446_0026564 3300042156 Bacteria 1659
394 Ga0450908_069517 3300042184 Bacteria 624
395 Ga0439434_0076549 3300042435 Bacteria 1058
396 Ga0451577_0258403 3300042876 Bacteria 1577
397 Ga0466969_0402056 3300044656 Bacteria 622
398 Ga0466961_0472845 3300044693 Bacteria 758
399 Ga0466963_0522263 3300044694 Bacteria 838
400 Ga0466970_0260059 3300044765 Bacteria 974
401 Ga0466958_0898205 3300045836 Bacteria 578
402 Ga0466967_0139996 3300045976 Bacteria 2253
403 Ga0466967_1848260 3300045976 Bacteria 601
404 Ga0495617_099588 3300046452 Bacteria 945
405 Ga0495627_212368 3300046453 Bacteria 532
406 Ga0495592_0145694 3300046454 Bacteria 1642
407 Ga0495592_0161473 3300046454 Bacteria 1541
408 Ga0495592_0186558 3300046454 Bacteria 1408
409 Ga0495592_0649089 3300046454 Bacteria 639
410 Ga0495603_0063339 3300046455 Bacteria 2181
411 Ga0495603_0142417 3300046455 Bacteria 1394
412 Ga0495603_0156083 3300046455 Bacteria 1324
413 Ga0495590_0002933 3300046457 Bacteria 7021
414 Ga0495590_0036120 3300046457 Bacteria 1723
415 Ga0495591_035547 3300046458 Bacteria 1457
416 Ga0495629_0013766 3300046459 Bacteria 5836
417 Ga0495629_0112654 3300046459 Bacteria 1896
418 Ga0495629_0200840 3300046459 Bacteria 1378
419 Ga0495629_0403854 3300046459 Bacteria 928
420 Ga0495638_0131412 3300046460 Bacteria 1470
421 Ga0495641_0107752 3300046461 Bacteria 1243
422 Ga0495641_0278327 3300046461 Bacteria 753
423 Ga0495641_0468117 3300046461 Bacteria 574
424 Ga0495641_0607399 3300046461 Bacteria 500
425 Ga0495651_0195108 3300046462 Bacteria 1421
426 Ga0495651_0195109 3300046462 Bacteria 1421
427 Ga0495651_0196676 3300046462 Bacteria 1414
428 Ga0495653_0070521 3300046463 Bacteria 2615
429 Ga0495653_0104864 3300046463 Bacteria 2042
430 Ga0495653_0144197 3300046463 Bacteria 1671
431 Ga0495653_0192875 3300046463 Bacteria 1388
432 Ga0495653_0298876 3300046463 Bacteria 1051
433 Ga0495650_0014917 3300046471 Bacteria 4010
434 Ga0495650_0058020 3300046471 Bacteria 1564
435 Ga0495580_0006397 3300046472 Bacteria 9599
436 Ga0495580_0140155 3300046472 Bacteria 1676
437 Ga0495580_0193451 3300046472 Bacteria 1402
438 Ga0495580_0207802 3300046472 Bacteria 1347
439 Ga0495580_0295518 3300046472 Bacteria 1103
440 Ga0495582_0124759 3300046473 Bacteria 1452
441 Ga0495582_0758195 3300046473 Bacteria 561
442 Ga0495605_0026412 3300046474 Bacteria 3019
443 Ga0495605_0095825 3300046474 Bacteria 1369
444 Ga0495605_0141610 3300046474 Bacteria 1078
445 Ga0495639_0101548 3300046475 Bacteria 1358
446 Ga0495639_0130120 3300046475 Bacteria 1204
447 Ga0495662_0061906 3300046476 Bacteria 1808
448 Ga0495662_0094547 3300046476 Bacteria 1459
449 Ga0495662_0107893 3300046476 Bacteria 1363
450 Ga0495662_0452297 3300046476 Bacteria 630
451 Ga0495662_0582388 3300046476 Bacteria 547
452 Ga0495664_0025368 3300046477 Bacteria 3450
453 Ga0495664_0101274 3300046477 Bacteria 1735
454 Ga0495664_0147601 3300046477 Bacteria 1426
455 Ga0495664_0335953 3300046477 Bacteria 910
456 Ga0495584_0022112 3300046491 Bacteria 3227
457 Ga0495585_0103948 3300046492 Bacteria 1516
458 Ga0495594_0133609 3300046499 Bacteria 1405
459 Ga0495594_0141762 3300046499 Bacteria 1363
460 Ga0495594_0226743 3300046499 Bacteria 1065
461 Ga0495596_0016715 3300046500 Bacteria 3044
462 Ga0495607_0112360 3300046501 Bacteria 1442
463 Ga0495607_0113580 3300046501 Bacteria 1432
464 Ga0495607_0262598 3300046501 Bacteria 826
465 Ga0495583_0000607 3300046506 Bacteria 48463
466 Ga0495583_0007045 3300046506 Bacteria 7187
467 Ga0495583_0070194 3300046506 Bacteria 1541
468 Ga0495583_0078012 3300046506 Bacteria 1443
469 Ga0495606_0024939 3300046507 Bacteria 4294
470 Ga0495606_0080001 3300046507 Bacteria 2034
471 Ga0495606_0128554 3300046507 Bacteria 1508
472 Ga0495606_0279544 3300046507 Bacteria 913
473 Ga0495608_0126676 3300046511 Bacteria 1635
474 Ga0495608_0139248 3300046511 Bacteria 1549
475 Ga0495608_0153497 3300046511 Bacteria 1466
476 Ga0495608_0210495 3300046511 Bacteria 1222
477 Ga0495610_0321045 3300046512 Bacteria 591
478 Ga0495616_0033661 3300046513 Bacteria 2667
479 Ga0495616_0082750 3300046513 Bacteria 1532
480 Ga0495618_0135333 3300046514 Bacteria 1576
481 Ga0495618_0160000 3300046514 Bacteria 1436
482 Ga0495618_0162437 3300046514 Bacteria 1423
483 Ga0495618_0170847 3300046514 Bacteria 1383
484 Ga0495618_0394950 3300046514 Bacteria 847
485 Ga0495618_0733549 3300046514 Bacteria 579
486 Ga0495620_0028642 3300046515 Bacteria 2587
487 Ga0495620_0075585 3300046515 Bacteria 1370
488 Ga0495628_0163854 3300046516 Bacteria 1688
489 Ga0495628_0181574 3300046516 Bacteria 1591
490 Ga0495628_0241651 3300046516 Bacteria 1350
491 Ga0495630_0102363 3300046517 Bacteria 2166
492 Ga0495630_0142679 3300046517 Bacteria 1821
493 Ga0495630_0274292 3300046517 Bacteria 1288
494 Ga0495631_0069097 3300046518 Bacteria 1527
495 Ga0495632_0028797 3300046519 Bacteria 2897
496 Ga0495632_0039124 3300046519 Bacteria 2396
497 Ga0495632_0172232 3300046519 Bacteria 994
498 Ga0495637_0067973 3300046520 Bacteria 1445
499 Ga0495637_0103823 3300046520 Bacteria 1108
500 Ga0495643_0054843 3300046522 Bacteria 2132
501 Ga0495644_0062806 3300046523 Bacteria 1395
502 Ga0495644_0344074 3300046523 Bacteria 587
503 Ga0495648_0003532 3300046524 Bacteria 13691
504 Ga0495648_0013427 3300046524 Bacteria 6056
505 Ga0495648_0063859 3300046524 Bacteria 2171
506 Ga0495648_0081312 3300046524 Bacteria 1843
507 Ga0495648_0096107 3300046524 Bacteria 1647
508 Ga0495666_0082360 3300046526 Bacteria 1521
509 Ga0495666_0088511 3300046526 Bacteria 1462
510 Ga0495666_0247707 3300046526 Bacteria 812
511 Ga0495642_0009484 3300046528 Bacteria 3724
512 Ga0495642_0030353 3300046528 Bacteria 2162
513 Ga0495642_0080414 3300046528 Bacteria 1371
514 Ga0495652_0169789 3300046529 Bacteria 1685
515 Ga0495652_0228735 3300046529 Bacteria 1392
516 Ga0495654_0021791 3300046530 Bacteria 3332
517 Ga0495654_0053012 3300046530 Bacteria 1973
518 Ga0495665_0096293 3300046531 Bacteria 1554
519 Ga0495665_0100445 3300046531 Bacteria 1518
520 Ga0495665_0206683 3300046531 Bacteria 1017
521 Ga0495665_0342277 3300046531 Bacteria 762
522 Ga0495665_0680385 3300046531 Bacteria 511
523 Ga0495640_0119906 3300046533 Bacteria 1711
524 Ga0495640_0153688 3300046533 Bacteria 1477
525 Ga0495640_0167431 3300046533 Bacteria 1405
526 Ga0495640_0444411 3300046533 Bacteria 793
527 Ga0495586_0116765 3300046535 Bacteria 1488
528 Ga0495586_0131655 3300046535 Bacteria 1400
529 Ga0495586_0261099 3300046535 Bacteria 989
530 Ga0495587_0091901 3300046536 Bacteria 1752
531 Ga0495587_0106884 3300046536 Bacteria 1609
532 Ga0495587_0138197 3300046536 Bacteria 1391
533 Ga0495621_0052811 3300046539 Bacteria 1457
534 Ga0495597_0026676 3300046542 Bacteria 2653
535 Ga0495597_0069606 3300046542 Bacteria 1518
536 Ga0495645_0154713 3300046543 Bacteria 1589
537 Ga0495645_0178351 3300046543 Bacteria 1457
538 Ga0495645_0185162 3300046543 Bacteria 1423
539 Ga0495645_0200409 3300046543 Bacteria 1354
540 Ga0495622_0084598 3300046557 Bacteria 1459
541 Ga0495633_0036382 3300046558 Bacteria 2359
542 Ga0495633_0326197 3300046558 Bacteria 696
543 Ga0495667_0136454 3300046559 Bacteria 1581
544 Ga0495667_0138507 3300046559 Bacteria 1568
545 Ga0495667_0156455 3300046559 Bacteria 1466
546 Ga0495667_0258043 3300046559 Bacteria 1109
547 Ga0495667_0442919 3300046559 Bacteria 816
548 Ga0495656_0077409 3300046615 Bacteria 1492
549 Ga0495668_0022302 3300046616 Bacteria 3620
550 Ga0495634_0062285 3300046642 Bacteria 2477
551 Ga0495634_0152876 3300046642 Bacteria 1458
552 Ga0495634_0161678 3300046642 Bacteria 1411
553 Ga0495634_0237357 3300046642 Bacteria 1119
554 Ga0495611_0077193 3300046648 Bacteria 1527
555 Ga0495625_0006453 3300046660 Bacteria 10438
556 Ga0495625_0167084 3300046660 Bacteria 1470
557 Ga0495625_0728047 3300046660 Bacteria 583
558 Ga0495635_0146827 3300046663 Bacteria 1605
559 Ga0495635_0166114 3300046663 Bacteria 1501
560 Ga0495635_0168769 3300046663 Bacteria 1488
561 Ga0495661_0131410 3300046665 Bacteria 1371
562 Ga0495661_0146315 3300046665 Bacteria 1280
563 Ga0495661_0619808 3300046665 Bacteria 507
564 Ga0495588_0122191 3300046674 Bacteria 1372
565 Ga0495588_0292901 3300046674 Bacteria 857
566 Ga0495657_0043261 3300046675 Bacteria 3072
567 Ga0495657_0133466 3300046675 Bacteria 1553
568 Ga0495657_0136248 3300046675 Bacteria 1533
569 Ga0495657_0169660 3300046675 Bacteria 1344
570 Ga0495657_0213624 3300046675 Bacteria 1172
571 Ga0495599_0156749 3300046678 Bacteria 1408
572 Ga0495599_0164734 3300046678 Bacteria 1369
573 Ga0495623_0106379 3300046679 Bacteria 1704
574 Ga0495623_0151466 3300046679 Bacteria 1370
575 Ga0495623_0152717 3300046679 Bacteria 1363
576 Ga0495623_0660887 3300046679 Bacteria 538
577 Ga0495646_0077365 3300046680 Bacteria 1946
578 Ga0495646_0110662 3300046680 Bacteria 1564
579 Ga0495646_0123302 3300046680 Bacteria 1464
580 Ga0495646_0130577 3300046680 Bacteria 1414
581 Ga0495647_0059436 3300046681 Bacteria 1505
582 Ga0495647_0068717 3300046681 Bacteria 1413
583 Ga0495647_0162467 3300046681 Bacteria 963
584 Ga0495658_0201494 3300046683 Bacteria 1240
585 Ga0495658_0247506 3300046683 Bacteria 1120
586 Ga0495658_0291352 3300046683 Bacteria 1031
587 Ga0495669_0007236 3300046684 Bacteria 4649
588 Ga0495669_0015473 3300046684 Bacteria 3267
589 Ga0495669_0082671 3300046684 Bacteria 1475
590 Ga0495613_0116356 3300046689 Bacteria 1923
591 Ga0495613_0119897 3300046689 Bacteria 1889
592 Ga0495613_0173830 3300046689 Bacteria 1527
593 Ga0495613_0186953 3300046689 Bacteria 1465
594 Ga0495624_0091514 3300046690 Bacteria 1876
595 Ga0495624_0133971 3300046690 Bacteria 1518
596 Ga0495624_0157156 3300046690 Bacteria 1389
597 Ga0495624_0429243 3300046690 Bacteria 792
598 Ga0495670_0100618 3300046691 Bacteria 1488
599 Ga0495670_0111560 3300046691 Bacteria 1415
600 Ga0495670_0498140 3300046691 Bacteria 661
601 Ga0495671_0095388 3300046692 Bacteria 1455
602 Ga0495671_0103797 3300046692 Bacteria 1388
603 Ga0495671_0111397 3300046692 Bacteria 1336
604 Ga0495671_0576274 3300046692 Bacteria 535
605 Ga0495649_0033028 3300046694 Bacteria 2848
606 Ga0495649_0104453 3300046694 Bacteria 1504
607 Ga0495649_0129760 3300046694 Bacteria 1330
608 Ga0495649_0133819 3300046694 Bacteria 1307
609 Ga0495589_0022625 3300046794 Bacteria 3206
610 Ga0495589_0058955 3300046794 Bacteria 1887
611 Ga0495589_0092126 3300046794 Bacteria 1471
612 Ga0495600_0045735 3300046809 Bacteria 2856
613 Ga0495600_0151284 3300046809 Bacteria 1502
614 Ga0495600_0152695 3300046809 Bacteria 1495
615 Ga0495600_0158720 3300046809 Bacteria 1462
616 Ga0495660_0035507 3300046810 Bacteria 2784
617 Ga0495660_0113459 3300046810 Bacteria 1380
618 Ga0495660_0114475 3300046810 Bacteria 1372
619 Ga0495581_0081423 3300047315 Bacteria 1874
620 Ga0495581_0123529 3300047315 Bacteria 1507
621 Ga0495581_0127458 3300047315 Bacteria 1482
622 Ga0495581_0137411 3300047315 Bacteria 1425
623 Ga0495604_0207468 3300047317 Bacteria 1355
624 Ga0495604_0278342 3300047317 Bacteria 1131
625 Ga0495604_0328128 3300047317 Bacteria 1021
626 Ga0495604_1028889 3300047317 Bacteria 508
627 Ga0495674_0044862 3300047319 Bacteria 3928
628 Ga0495674_0227103 3300047319 Bacteria 1542
629 Ga0495674_0240872 3300047319 Bacteria 1491
630 Ga0495674_0307220 3300047319 Bacteria 1294
631 Ga0495674_0331699 3300047319 Bacteria 1238
632 Ga0495674_0707261 3300047319 Bacteria 790
633 Ga0495674_0825713 3300047319 Bacteria 719
634 Ga0495672_0012514 3300047320 Bacteria 5917
635 Ga0495672_0039428 3300047320 Bacteria 2871
636 Ga0495676_0079240 3300047321 Bacteria 2498
637 Ga0495676_0186181 3300047321 Bacteria 1451
638 Ga0495676_0187563 3300047321 Bacteria 1444
639 Ga0495676_0245230 3300047321 Bacteria 1225
640 Ga0495676_0313791 3300047321 Bacteria 1054
641 Ga0495680_0066951 3300047322 Bacteria 2747
642 Ga0495680_0196828 3300047322 Bacteria 1447
643 Ga0495680_0217714 3300047322 Bacteria 1364
644 Ga0495680_0219835 3300047322 Bacteria 1356
645 Ga0495680_0615644 3300047322 Bacteria 725
646 Ga0495683_0004881 3300047323 Bacteria 7513
647 Ga0495683_0044650 3300047323 Bacteria 2228
648 Ga0495683_0069302 3300047323 Bacteria 1733
649 Ga0495683_0084127 3300047323 Bacteria 1548
650 Ga0495687_018699 3300047443 Bacteria 3417
651 Ga0495687_020732 3300047443 Bacteria 3199
652 Ga0495675_0151002 3300047444 Bacteria 1435
653 Ga0495675_0159693 3300047444 Bacteria 1388
654 Ga0495675_0163806 3300047444 Bacteria 1368
655 Ga0495675_0164624 3300047444 Bacteria 1364
656 Ga0495675_0435926 3300047444 Bacteria 760
657 Ga0495677_0062008 3300047445 Bacteria 1387
658 Ga0495679_000074 3300047446 Bacteria 95881
659 Ga0495679_028694 3300047446 Bacteria 1823
660 Ga0495679_104231 3300047446 Bacteria 785
661 Ga0495685_044742 3300047447 Bacteria 1509
662 Ga0495673_0005854 3300047469 Bacteria 7351
663 Ga0495673_0010616 3300047469 Bacteria 4997
664 Ga0495673_0020105 3300047469 Bacteria 3330
665 Ga0495681_0077406 3300047470 Bacteria 1492
666 Ga0495684_0188994 3300047471 Bacteria 1523
667 Ga0495684_0195463 3300047471 Bacteria 1493
668 Ga0495684_0806975 3300047471 Bacteria 612
669 Ga0495686_0001044 3300047472 Bacteria 33258
670 Ga0495686_0129795 3300047472 Bacteria 1495
671 Ga0495686_0460773 3300047472 Bacteria 674
672 Ga0495593_0100950 3300047673 Bacteria 1479
673 Ga0495593_0103624 3300047673 Bacteria 1457
674 Ga0495593_0114613 3300047673 Bacteria 1374
675 Ga0495593_0145725 3300047673 Bacteria 1198
676 Ga0495593_0174866 3300047673 Bacteria 1082
677 Ga0495602_0193858 3300048088 Bacteria 1555
678 Ga0495602_0200463 3300048088 Bacteria 1523
679 Ga0495602_0206060 3300048088 Bacteria 1496
680 Ga0495602_0604770 3300048088 Bacteria 754
681 Ga0495602_0655298 3300048088 Bacteria 716
682 Ga0495614_0078827 3300048089 Bacteria 1425
683 Ga0495614_0118121 3300048089 Bacteria 1168
684 Ga0495614_0171859 3300048089 Bacteria 972
685 Ga0495614_0441818 3300048089 Bacteria 615
686 Ga0495626_0073016 3300048091 Bacteria 1537
687 Ga0495626_0097608 3300048091 Bacteria 1284
688 Ga0495626_0150504 3300048091 Bacteria 981
689 Ga0496100_0027437 3300048903 Bacteria 3501
690 Ga0496100_0119526 3300048903 Bacteria 1841
691 Ga0496100_0126890 3300048903 Bacteria 1791
692 Ga0496100_0173287 3300048903 Bacteria 1555
693 Ga0496100_0243775 3300048903 Bacteria 1327
694 Ga0496100_0800290 3300048903 Bacteria 738
695 Ga0496101_0027851 3300048904 Bacteria 3940
696 Ga0496101_0101946 3300048904 Bacteria 2149
697 Ga0496101_0162083 3300048904 Bacteria 1715
698 Ga0496101_0229806 3300048904 Bacteria 1441
699 Ga0496101_0243642 3300048904 Bacteria 1399
700 Ga0496101_0247637 3300048904 Bacteria 1388
701 Ga0496101_0315989 3300048904 Bacteria 1225
702 Ga0496102_0060368 3300048905 Bacteria 3467
703 Ga0496102_0263907 3300048905 Bacteria 1623
704 Ga0496102_0503003 3300048905 Bacteria 1134
705 Ga0496103_0040556 3300048906 Bacteria 2860
706 Ga0496103_0143965 3300048906 Bacteria 1525
707 Ga0496104_0035316 3300048907 Bacteria 4667
708 Ga0496104_0039757 3300048907 Bacteria 4404
709 Ga0496104_0333967 3300048907 Bacteria 1428
710 Ga0496104_0426508 3300048907 Bacteria 1238
711 Ga0496104_0480068 3300048907 Bacteria 1154
712 Ga0496104_0507265 3300048907 Bacteria 1117
713 Ga0496104_0690450 3300048907 Bacteria 929
714 Ga0496104_0691144 3300048907 Bacteria 928
715 Ga0496104_1878235 3300048907 Bacteria 501
716 Ga0496105_0009047 3300048908 Bacteria 7772
717 Ga0496105_0083287 3300048908 Bacteria 2641
718 Ga0496105_0126136 3300048908 Bacteria 2110
719 Ga0496105_0219080 3300048908 Bacteria 1549
720 Ga0496105_0220187 3300048908 Bacteria 1545
721 Ga0496105_0475751 3300048908 Bacteria 983
722 Ga0496105_0896926 3300048908 Bacteria 668
723 Ga0496106_0061709 3300048909 Bacteria 2844
724 Ga0496106_0252121 3300048909 Bacteria 1411
725 Ga0496106_0266342 3300048909 Bacteria 1371
726 Ga0496106_1408451 3300048909 Bacteria 538
727 Ga0496107_0030529 3300048910 Bacteria 3841
728 Ga0496107_0176705 3300048910 Bacteria 1585
729 Ga0496107_0213913 3300048910 Bacteria 1433
730 Ga0496107_0234880 3300048910 Bacteria 1364
731 Ga0496107_0953206 3300048910 Bacteria 624
732 Ga0496108_0067635 3300048911 Bacteria 3013
733 Ga0496108_0260709 3300048911 Bacteria 1508
734 Ga0496108_0413226 3300048911 Bacteria 1178
735 Ga0496109_0064488 3300048912 Bacteria 3352
736 Ga0496109_0203360 3300048912 Bacteria 1862
737 Ga0496109_0273600 3300048912 Bacteria 1591
738 Ga0496109_0682147 3300048912 Bacteria 965
739 Ga0496109_0698070 3300048912 Bacteria 952
740 Ga0496110_0050639 3300048913 Bacteria 3647
741 Ga0496110_0242669 3300048913 Bacteria 1639
742 Ga0496110_0346352 3300048913 Bacteria 1353
743 Ga0496111_0009138 3300048914 Bacteria 6596
744 Ga0496111_0097031 3300048914 Bacteria 2163
745 Ga0496112_0014694 3300048915 Bacteria 7277
746 Ga0496112_0387898 3300048915 Bacteria 1337
747 Ga0496113_0023826 3300048916 Bacteria 4344
748 Ga0496113_0928634 3300048916 Bacteria 687
749 Ga0496114_0161751 3300048917 Bacteria 1947
750 Ga0496114_0279570 3300048917 Bacteria 1471
751 Ga0496114_0396220 3300048917 Bacteria 1223
752 Ga0496114_0764264 3300048917 Bacteria 844
753 Ga0496114_0905341 3300048917 Bacteria 763
754 Ga0496115_0026500 3300048918 Bacteria 4524
755 Ga0496115_0037264 3300048918 Bacteria 3853
756 Ga0496115_0037513 3300048918 Bacteria 3840
757 Ga0496115_0939872 3300048918 Bacteria 664
758 Ga0496116_0068885 3300048919 Bacteria 2252
759 Ga0496116_0147826 3300048919 Bacteria 1310
760 Ga0496117_0045834 3300048920 Bacteria 3152
761 Ga0496117_0051367 3300048920 Bacteria 2914
762 Ga0496117_0092362 3300048920 Bacteria 1944
763 Ga0496118_0010561 3300048921 Bacteria 9126
764 Ga0496118_0050708 3300048921 Bacteria 3181
765 Ga0496118_0107215 3300048921 Bacteria 1866
766 Ga0496119_0054130 3300048922 Bacteria 2445
767 Ga0496119_0122388 3300048922 Bacteria 1428
768 Ga0496120_0038699 3300048923 Bacteria 2819
769 Ga0496120_0103875 3300048923 Bacteria 1496
770 Ga0496121_0000061 3300048924 Bacteria 275757
771 Ga0496121_0025083 3300048924 Bacteria 5674
772 Ga0496121_0076188 3300048924 Bacteria 2675
773 Ga0496121_0080032 3300048924 Bacteria 2592
774 Ga0496121_0183574 3300048924 Bacteria 1507
775 Ga0496122_0003452 3300048925 Bacteria 20787
776 Ga0496122_0053435 3300048925 Bacteria 3045
777 Ga0496122_0185087 3300048925 Bacteria 1236
778 Ga0496123_0000992 3300048926 Bacteria 43625
779 Ga0496123_0048281 3300048926 Bacteria 2864
780 Ga0496123_0153831 3300048926 Bacteria 1236
781 Ga0496124_0068327 3300048927 Bacteria 2953
782 Ga0496124_0647837 3300048927 Bacteria 678
783 Ga0496125_0021360 3300048928 Bacteria 6040
784 Ga0496125_0062775 3300048928 Bacteria 2967
785 Ga0496126_0085820 3300048929 Bacteria 2775
786 Ga0496126_0261655 3300048929 Bacteria 1438
787 Ga0496126_0308439 3300048929 Bacteria 1303
788 Ga0495678_015939 3300049459 Bacteria 3448
789 Ga0495678_037735 3300049459 Bacteria 1960
790 Ga0495678_167237 3300049459 Bacteria 698
791 Ga0495682_0004477 3300049460 Bacteria 5970
792 Ga0495682_0013582 3300049460 Bacteria 3097
793 Ga0495682_0014380 3300049460 Bacteria 3002
794 Ga0501299_103219 3300049522 Bacteria 665
795 Ga0501031_0057845 3300049568 Bacteria 2526
796 Ga0501031_0110428 3300049568 Bacteria 1795
797 Ga0501031_0112732 3300049568 Bacteria 1776
798 Ga0501031_0255607 3300049568 Bacteria 1138
799 Ga0501032_0007349 3300049569 Bacteria 8050
800 Ga0501032_0009618 3300049569 Bacteria 7005
801 Ga0501032_0501770 3300049569 Bacteria 775
802 Ga0501032_0716859 3300049569 Bacteria 633
803 Ga0501033_0004875 3300049570 Bacteria 10685
804 Ga0501033_0120621 3300049570 Bacteria 1903
805 Ga0501033_0206579 3300049570 Bacteria 1401
806 Ga0501034_0369498 3300049571 Bacteria 1360
807 Ga0501034_0394411 3300049571 Bacteria 1307
808 Ga0501036_0100978 3300049572 Bacteria 2440
809 Ga0501036_0196816 3300049572 Bacteria 1695
810 Ga0501036_0197048 3300049572 Bacteria 1694
811 Ga0501036_0264243 3300049572 Bacteria 1441
812 Ga0501036_0436816 3300049572 Bacteria 1091
813 Ga0501036_0824001 3300049572 Bacteria 763
814 Ga0501037_0000216 3300049573 Bacteria 50948
815 Ga0501037_0078431 3300049573 Bacteria 2396
816 Ga0501037_0167355 3300049573 Bacteria 1564
817 Ga0501038_0007407 3300049574 Bacteria 10122
818 Ga0501038_0193931 3300049574 Bacteria 1633
819 Ga0501038_0447733 3300049574 Bacteria 993
820 Ga0501038_0727707 3300049574 Bacteria 741
821 Ga0501039_0035352 3300049575 Bacteria 3855
822 Ga0501039_0040938 3300049575 Bacteria 3577
823 Ga0501039_0267541 3300049575 Bacteria 1343
824 Ga0501039_1054942 3300049575 Bacteria 630
825 Ga0501039_1097078 3300049575 Bacteria 617
826 Ga0501040_0052235 3300049576 Bacteria 2797
827 Ga0501040_1001477 3300049576 Bacteria 606
828 Ga0501040_1379904 3300049576 Bacteria 511
829 Ga0501041_0007807 3300049577 Bacteria 6286
830 Ga0501041_0167662 3300049577 Bacteria 1373
831 Ga0501041_0259976 3300049577 Bacteria 1091
832 Ga0501042_0119433 3300049578 Bacteria 1898
833 Ga0501042_0173927 3300049578 Bacteria 1553
834 Ga0501042_0228098 3300049578 Bacteria 1343
835 Ga0501043_0000132 3300049579 Bacteria 69702
836 Ga0501043_0043939 3300049579 Bacteria 3512
837 Ga0501043_0094351 3300049579 Bacteria 2352
838 Ga0501043_0239224 3300049579 Bacteria 1400
839 Ga0501043_0256985 3300049579 Bacteria 1344
840 Ga0501046_0035473 3300049580 Bacteria 4019
841 Ga0501046_0152727 3300049580 Bacteria 1741
842 Ga0501046_0210012 3300049580 Bacteria 1445
843 Ga0501047_0066064 3300049581 Bacteria 3486
844 Ga0501047_0151585 3300049581 Bacteria 2194
845 Ga0501047_0262995 3300049581 Bacteria 1572
846 Ga0501047_0352672 3300049581 Bacteria 1308
847 Ga0501047_1114437 3300049581 Bacteria 603
848 Ga0501048_0146246 3300049582 Bacteria 1671
849 Ga0501048_0210608 3300049582 Bacteria 1378
850 Ga0501067_0810313 3300049583 Bacteria 527
851 Ga0501068_0029163 3300049584 Bacteria 3266
852 Ga0501068_0080907 3300049584 Bacteria 1993
853 Ga0501068_0171479 3300049584 Bacteria 1369
854 Ga0501069_0000051 3300049585 Bacteria 70783
855 Ga0501069_0139327 3300049585 Bacteria 1391
856 Ga0501069_0659237 3300049585 Bacteria 630
857 Ga0501069_0832802 3300049585 Bacteria 560
858 Ga0501070_0001832 3300049586 Bacteria 18737
859 Ga0501070_0072902 3300049586 Bacteria 2842
860 Ga0501070_0507927 3300049586 Bacteria 968
861 Ga0501070_0601739 3300049586 Bacteria 876
862 Ga0501071_0014770 3300049587 Bacteria 5346
863 Ga0501071_0155621 3300049587 Bacteria 1706
864 Ga0501072_0032112 3300049588 Bacteria 4111
865 Ga0501072_0080175 3300049588 Bacteria 2585
866 Ga0501073_0004947 3300049589 Bacteria 10000
867 Ga0501073_0059743 3300049589 Bacteria 2662
868 Ga0501073_0178121 3300049589 Bacteria 1471
869 Ga0501074_0000043 3300049590 Bacteria 59245
870 Ga0501074_0085629 3300049590 Bacteria 2258
871 Ga0501075_0071265 3300049591 Bacteria 2626
872 Ga0501075_0174326 3300049591 Bacteria 1641
873 Ga0501075_0182724 3300049591 Bacteria 1600
874 Ga0501075_0561076 3300049591 Bacteria 871
875 Ga0501075_0876960 3300049591 Bacteria 682
876 Ga0501076_0058838 3300049592 Bacteria 3055
877 Ga0501076_0237529 3300049592 Bacteria 1490
878 Ga0501076_0460267 3300049592 Bacteria 1047
879 Ga0501076_1372667 3300049592 Bacteria 581
880 Ga0501077_0115112 3300049593 Bacteria 1704
881 Ga0501077_0389035 3300049593 Bacteria 891
882 Ga0501079_0086296 3300049741 Bacteria 2429
883 Ga0501079_0220261 3300049741 Bacteria 1482
884 Ga0501079_0852499 3300049741 Bacteria 717
885 Ga0501080_0001519 3300049742 Bacteria 19586
886 Ga0501080_0001537 3300049742 Bacteria 19481
887 Ga0501080_0259844 3300049742 Bacteria 1582
888 Ga0501080_0322553 3300049742 Bacteria 1398
889 Ga0501081_0155384 3300049743 Bacteria 1645
890 Ga0501081_0201582 3300049743 Bacteria 1443
891 Ga0501083_0000247 3300049744 Bacteria 34317
892 Ga0501083_0173693 3300049744 Bacteria 1408
893 Ga0501083_0599967 3300049744 Bacteria 716
894 Ga0501035_0000280 3300049822 Bacteria 60510
895 Ga0501035_0079197 3300049822 Bacteria 2902
896 Ga0501035_0186790 3300049822 Bacteria 1783
897 Ga0501035_0270789 3300049822 Bacteria 1437
898 Ga0501044_0001427 3300049823 Bacteria 28051
899 Ga0501044_0015615 3300049823 Bacteria 8178
900 Ga0501044_0091608 3300049823 Bacteria 3066
901 Ga0501045_0172807 3300049824 Bacteria 1609
902 Ga0501045_0190959 3300049824 Bacteria 1526
903 nmdc:mga05p37_482271_c1 3300050507 Bacteria 1428
904 nmdc:mga09592_349490_c1 3300050508 Bacteria 1280
905 nmdc:mga0qj67_1250747_c1 3300050509 Bacteria 576
906 nmdc:mga0qj67_242075_c1 3300050509 Bacteria 1464
907 nmdc:mga0qj67_692248_c1 3300050509 Bacteria 811
908 nmdc:mga06r32_1312036_c1 3300050510 Bacteria 667
909 nmdc:mga06r32_325375_c1 3300050510 Bacteria 1523
910 nmdc:mga08y16_136466_c1 3300050511 Bacteria 2550
911 nmdc:mga08x19_125380_c1 3300050514 Bacteria 1724
912 Ga0495601_0133313 3300053077 Bacteria 1619
913 Ga0495601_0141741 3300053077 Bacteria 1568
914 Ga0495601_0165163 3300053077 Bacteria 1447
915 Ga0495601_0490153 3300053077 Bacteria 793
916 Ga0495601_0705542 3300053077 Bacteria 643
917 Ga0495612_0054777 3300053078 Bacteria 1643
918 Ga0495612_0073179 3300053078 Bacteria 1431
919 Ga0495612_0076323 3300053078 Bacteria 1403
920 Ga0495612_0341893 3300053078 Bacteria 675
921 Ga0495595_0091017 3300053084 Bacteria 1463
922 Ga0495595_0108467 3300053084 Bacteria 1344
923 Ga0495595_0428617 3300053084 Bacteria 671
924 Ga0495619_0092116 3300053085 Bacteria 2053
925 Ga0495619_0101847 3300053085 Bacteria 1955
926 Ga0495619_0188490 3300053085 Bacteria 1427
927 Ga0500583_0090653 3300053092 Bacteria 1487
928 Ga0500595_144112 3300053119 Bacteria 667
929 Ga0500618_021111 3300053125 Bacteria 1591
930 Ga0500559_0012819 3300053136 Bacteria 3557
931 Ga0500574_221144 3300053141 Bacteria 524
932 Ga0500616_0061557 3300053153 Bacteria 1942
933 Ga0500645_000352 3300053730 Bacteria 32678
934 Ga0500645_001130 3300053730 Bacteria 14508
935 Ga0501084_0129108 3300054114 Bacteria 2127
936 Ga0501084_0213461 3300054114 Bacteria 1628
937 Ga0501082_0020122 3300060353 Bacteria 5751
938 Ga0501082_0255816 3300060353 Bacteria 1523
939 Ga0501082_0289447 3300060353 Bacteria 1426
940 Ga0530510_0029607 3300061734 Bacteria 3931

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100970467 Ga0070707_1009704672 96
2 3300013105 Ga0157369_11138615 Ga0157369_111386152 97
3 3300015684 Ga0183365_10008 Ga0183365_1000861 97
4 3300042876 Ga0451577_0258403 Ga0451577_0258403_1271_1564 97
5 3300048912 Ga0496109_0698070 Ga0496109_0698070_340_633 97
6 3300048917 Ga0496114_0161751 Ga0496114_0161751_26_319 97
7 3300009094 Ga0111539_11643268 Ga0111539_116432681 99
8 iso_pu_bacteria 2595698237 2596376567 104
9 iso_pu_bacteria 2643221636 2644205032 104
10 iso_pu_bacteria 2773857925 2774872209 104
11 iso_pu_bacteria 2818991438 2819552101 104
12 iso_pu_bacteria 2889306138 2889306563 104
13 iso_pu_bacteria 2889306138 2889309589 104
14 iso_pu_bacteria 8003955200 8003963172 104
15 iso_pu_bacteria 2511231221 2512032772 105
16 iso_pu_bacteria 2511231221 2512033890 105
17 iso_pu_bacteria 2511231221 2512035602 105
18 iso_pu_bacteria 2511231221 2512036032 105
19 iso_pu_bacteria 2511231221 2512036037 105
20 iso_pu_bacteria 2511231221 2512036793 105
21 iso_pu_bacteria 2511231221 2512036878 105
22 iso_pu_bacteria 2513237351 2514588097 105
23 iso_pu_bacteria 2756170246 2756678164 105
24 iso_pu_bacteria 2842333319 2842341700 105
25 iso_pu_bacteria 2885350715 2885352895 105
26 iso_pu_bacteria 2897803580 2897807801 105
27 iso_pu_bacteria 2899275550 2899279439 105
28 iso_pu_bacteria 2917699015 2917705411 105
29 iso_pu_bacteria 8054002106 8054002966 105
30 3300003203 JGI25406J46586_10037561 JGI25406J46586_100375612 106
31 3300003203 JGI25406J46586_10040120 JGI25406J46586_100401202 106
32 3300005290 Ga0065712_10294991 Ga0065712_102949912 106
33 3300005293 Ga0065715_10328151 Ga0065715_103281511 106
34 3300005295 Ga0065707_11079123 Ga0065707_110791231 106
35 3300005331 Ga0070670_100622975 Ga0070670_1006229752 106
36 3300005334 Ga0068869_100218925 Ga0068869_1002189252 106
37 3300005337 Ga0070682_100064785 Ga0070682_1000647852 106
38 3300005354 Ga0070675_100111634 Ga0070675_1001116341 106
39 3300005365 Ga0070688_100327416 Ga0070688_1003274161 106
40 3300005365 Ga0070688_100904759 Ga0070688_1009047592 106
41 3300005367 Ga0070667_101008652 Ga0070667_1010086522 106
42 3300005455 Ga0070663_101438891 Ga0070663_1014388911 106
43 3300005466 Ga0070685_10145997 Ga0070685_101459972 106
44 3300005471 Ga0070698_100304462 Ga0070698_1003044622 106
45 3300005548 Ga0070665_100547289 Ga0070665_1005472892 106
46 3300005549 Ga0070704_100770565 Ga0070704_1007705652 106
47 3300005616 Ga0068852_100006949 Ga0068852_1000069492 106
48 3300005617 Ga0068859_102388689 Ga0068859_1023886892 106
49 3300005719 Ga0068861_102582594 Ga0068861_1025825942 106
50 3300005841 Ga0068863_100386720 Ga0068863_1003867202 106
51 3300005841 Ga0068863_100890361 Ga0068863_1008903612 106
52 3300005985 Ga0081539_10012508 Ga0081539_100125083 106
53 3300005985 Ga0081539_10054045 Ga0081539_100540452 106
54 3300006237 Ga0097621_100177034 Ga0097621_1001770342 106
55 3300006358 Ga0068871_100221464 Ga0068871_1002214643 106
56 3300006844 Ga0075428_100429855 Ga0075428_1004298551 106
57 3300006844 Ga0075428_102243809 Ga0075428_1022438091 106
58 3300006846 Ga0075430_100287654 Ga0075430_1002876542 106
59 3300006846 Ga0075430_101783466 Ga0075430_1017834661 106
60 3300006914 Ga0075436_100143339 Ga0075436_1001433392 106
61 3300009092 Ga0105250_10302218 Ga0105250_103022182 106
62 3300009094 Ga0111539_10061134 Ga0111539_100611342 106
63 3300009101 Ga0105247_10216304 Ga0105247_102163041 106
64 3300014325 Ga0163163_10291901 Ga0163163_102919012 106
65 3300014325 Ga0163163_11112003 Ga0163163_111120032 106
66 3300014968 Ga0157379_10151646 Ga0157379_101516463 106
67 3300014969 Ga0157376_10348050 Ga0157376_103480501 106
68 3300014969 Ga0157376_13099856 Ga0157376_130998561 106
69 3300017792 Ga0163161_10241960 Ga0163161_102419601 106
70 3300017792 Ga0163161_10788740 Ga0163161_107887402 106
71 3300025900 Ga0207710_10007973 Ga0207710_100079733 106
72 3300025912 Ga0207707_10228670 Ga0207707_102286701 106
73 3300025921 Ga0207652_10355340 Ga0207652_103553401 106
74 3300025926 Ga0207659_10083362 Ga0207659_100833623 106
75 3300025938 Ga0207704_10169615 Ga0207704_101696152 106
76 3300025940 Ga0207691_10106659 Ga0207691_101066594 106
77 3300025960 Ga0207651_11724907 Ga0207651_117249072 106
78 3300025986 Ga0207658_10439077 Ga0207658_104390772 106
79 3300026088 Ga0207641_10337801 Ga0207641_103378011 106
80 3300026088 Ga0207641_11218551 Ga0207641_112185512 106
81 3300026089 Ga0207648_10052234 Ga0207648_100522344 106
82 3300026142 Ga0207698_10012755 Ga0207698_100127555 106
83 3300027907 Ga0207428_10049284 Ga0207428_100492844 106
84 3300028381 Ga0268264_10481848 Ga0268264_104818481 106
85 3300032002 Ga0307416_100413121 Ga0307416_1004131212 106
86 3300032133 Ga0316583_10076543 Ga0316583_100765431 106
87 3300036401 Ga0373937_0328162 Ga0373937_0328162_341_661 106
88 3300041451 Ga0451791_0011144 Ga0451791_0011144_1010_1339 106
89 3300041463 Ga0451804_0748938 Ga0451804_0748938_349_678 106
90 3300041486 Ga0451807_2057432 Ga0451807_2057432_668_997 106
91 3300041492 Ga0451835_1087131 Ga0451835_1087131_124_453 106
92 3300042007 Ga0439449_0091366 Ga0439449_0091366_150_479 106
93 3300042156 Ga0439446_0026564 Ga0439446_0026564_30_359 106
94 3300044694 Ga0466963_0522263 Ga0466963_0522263_413_733 106
95 3300045976 Ga0466967_0139996 Ga0466967_0139996_214_534 106
96 3300045976 Ga0466967_1848260 Ga0466967_1848260_155_475 106
97 3300046472 Ga0495580_0140155 Ga0495580_0140155_318_638 106
98 3300046559 Ga0495667_0258043 Ga0495667_0258043_725_1045 106
99 3300046675 Ga0495657_0213624 Ga0495657_0213624_800_1120 106
100 3300047315 Ga0495581_0123529 Ga0495581_0123529_345_665 106
101 3300047322 Ga0495680_0615644 Ga0495680_0615644_98_418 106
102 3300047444 Ga0495675_0435926 Ga0495675_0435926_121_441 106
103 3300048907 Ga0496104_0507265 Ga0496104_0507265_45_365 106
104 3300048907 Ga0496104_1878235 Ga0496104_1878235_92_412 106
105 3300048912 Ga0496109_0682147 Ga0496109_0682147_275_595 106
106 3300049568 Ga0501031_0057845 Ga0501031_0057845_2015_2335 106
107 3300049568 Ga0501031_0255607 Ga0501031_0255607_127_456 106
108 3300049569 Ga0501032_0009618 Ga0501032_0009618_2843_3163 106
109 3300049569 Ga0501032_0501770 Ga0501032_0501770_364_684 106
110 3300049570 Ga0501033_0120621 Ga0501033_0120621_1519_1839 106
111 3300049571 Ga0501034_0394411 Ga0501034_0394411_936_1256 106
112 3300049572 Ga0501036_0100978 Ga0501036_0100978_809_1129 106
113 3300049572 Ga0501036_0196816 Ga0501036_0196816_999_1319 106
114 3300049572 Ga0501036_0264243 Ga0501036_0264243_1025_1354 106
115 3300049572 Ga0501036_0436816 Ga0501036_0436816_215_535 106
116 3300049573 Ga0501037_0167355 Ga0501037_0167355_1104_1424 106
117 3300049574 Ga0501038_0007407 Ga0501038_0007407_16_336 106
118 3300049574 Ga0501038_0193931 Ga0501038_0193931_953_1273 106
119 3300049575 Ga0501039_0035352 Ga0501039_0035352_3449_3769 106
120 3300049575 Ga0501039_0040938 Ga0501039_0040938_245_565 106
121 3300049575 Ga0501039_0267541 Ga0501039_0267541_104_433 106
122 3300049576 Ga0501040_0052235 Ga0501040_0052235_454_774 106
123 3300049576 Ga0501040_1001477 Ga0501040_1001477_35_355 106
124 3300049576 Ga0501040_1379904 Ga0501040_1379904_134_463 106
125 3300049577 Ga0501041_0007807 Ga0501041_0007807_3432_3761 106
126 3300049577 Ga0501041_0167662 Ga0501041_0167662_103_423 106
127 3300049577 Ga0501041_0259976 Ga0501041_0259976_22_351 106
128 3300049578 Ga0501042_0173927 Ga0501042_0173927_231_551 106
129 3300049578 Ga0501042_0228098 Ga0501042_0228098_981_1310 106
130 3300049579 Ga0501043_0043939 Ga0501043_0043939_3041_3370 106
131 3300049579 Ga0501043_0094351 Ga0501043_0094351_447_767 106
132 3300049579 Ga0501043_0256985 Ga0501043_0256985_60_380 106
133 3300049580 Ga0501046_0035473 Ga0501046_0035473_1760_2080 106
134 3300049580 Ga0501046_0152727 Ga0501046_0152727_54_374 106
135 3300049581 Ga0501047_0066064 Ga0501047_0066064_2988_3308 106
136 3300049582 Ga0501048_0146246 Ga0501048_0146246_1026_1346 106
137 3300049583 Ga0501067_0810313 Ga0501067_0810313_137_457 106
138 3300049584 Ga0501068_0080907 Ga0501068_0080907_1514_1834 106
139 3300049584 Ga0501068_0171479 Ga0501068_0171479_89_409 106
140 3300049585 Ga0501069_0139327 Ga0501069_0139327_85_405 106
141 3300049586 Ga0501070_0601739 Ga0501070_0601739_448_768 106
142 3300049587 Ga0501071_0155621 Ga0501071_0155621_1318_1638 106
143 3300049588 Ga0501072_0032112 Ga0501072_0032112_3673_3993 106
144 3300049588 Ga0501072_0080175 Ga0501072_0080175_1820_2140 106
145 3300049589 Ga0501073_0004947 Ga0501073_0004947_5838_6158 106
146 3300049589 Ga0501073_0178121 Ga0501073_0178121_1085_1405 106
147 3300049590 Ga0501074_0085629 Ga0501074_0085629_1691_2011 106
148 3300049591 Ga0501075_0071265 Ga0501075_0071265_2233_2553 106
149 3300049591 Ga0501075_0174326 Ga0501075_0174326_162_491 106
150 3300049591 Ga0501075_0561076 Ga0501075_0561076_38_367 106
151 3300049591 Ga0501075_0876960 Ga0501075_0876960_74_403 106
152 3300049592 Ga0501076_0058838 Ga0501076_0058838_1528_1848 106
153 3300049592 Ga0501076_0237529 Ga0501076_0237529_1077_1406 106
154 3300049593 Ga0501077_0115112 Ga0501077_0115112_1277_1597 106
155 3300049593 Ga0501077_0389035 Ga0501077_0389035_396_716 106
156 3300049741 Ga0501079_0086296 Ga0501079_0086296_71_391 106
157 3300049741 Ga0501079_0220261 Ga0501079_0220261_974_1294 106
158 3300049741 Ga0501079_0852499 Ga0501079_0852499_318_647 106
159 3300049742 Ga0501080_0001537 Ga0501080_0001537_7622_7942 106
160 3300049742 Ga0501080_0259844 Ga0501080_0259844_1175_1495 106
161 3300049743 Ga0501081_0155384 Ga0501081_0155384_1235_1555 106
162 3300049743 Ga0501081_0201582 Ga0501081_0201582_202_531 106
163 3300049744 Ga0501083_0173693 Ga0501083_0173693_967_1287 106
164 3300049822 Ga0501035_0079197 Ga0501035_0079197_1624_1944 106
165 3300049822 Ga0501035_0270789 Ga0501035_0270789_1050_1370 106
166 3300049823 Ga0501044_0015615 Ga0501044_0015615_3781_4101 106
167 3300049824 Ga0501045_0190959 Ga0501045_0190959_1133_1453 106
168 3300050509 nmdc:mga0qj67_692248_c1 nmdc:mga0qj67_692248_c1_130_450 106
169 3300050511 nmdc:mga08y16_136466_c1 nmdc:mga08y16_136466_c1_2048_2368 106
170 3300050514 nmdc:mga08x19_125380_c1 nmdc:mga08x19_125380_c1_43_363 106
171 3300053084 Ga0495595_0428617 Ga0495595_0428617_304_624 106
172 3300053092 Ga0500583_0090653 Ga0500583_0090653_28_348 106
173 3300053730 Ga0500645_000352 Ga0500645_000352_22659_22979 106
174 3300053730 Ga0500645_001130 Ga0500645_001130_7197_7517 106
175 3300054114 Ga0501084_0129108 Ga0501084_0129108_1719_2039 106
176 3300054114 Ga0501084_0213461 Ga0501084_0213461_46_375 106
177 3300060353 Ga0501082_0020122 Ga0501082_0020122_4306_4626 106
178 3300060353 Ga0501082_0255816 Ga0501082_0255816_1163_1483 106
179 3300061734 Ga0530510_0029607 Ga0530510_0029607_2364_2684 106
180 iso_pu_bacteria 2513237082 2513558661 106
181 iso_pu_bacteria 2513237082 2513558874 106
182 iso_pu_bacteria 2902682994 2902684440 106
183 iso_pu_bacteria 2902682994 2902685555 106
184 iso_pu_bacteria 8003955200 8003963254 106
185 3300002244 JGI24742J22300_10030343 JGI24742J22300_100303431 107
186 3300005327 Ga0070658_10312761 Ga0070658_103127611 107
187 3300005331 Ga0070670_101244196 Ga0070670_1012441961 107
188 3300005331 Ga0070670_101459568 Ga0070670_1014595682 107
189 3300005334 Ga0068869_100301097 Ga0068869_1003010971 107
190 3300005338 Ga0068868_100212352 Ga0068868_1002123522 107
191 3300005354 Ga0070675_100346522 Ga0070675_1003465221 107
192 3300005364 Ga0070673_101113402 Ga0070673_1011134022 107
193 3300005367 Ga0070667_100320820 Ga0070667_1003208201 107
194 3300005456 Ga0070678_100291393 Ga0070678_1002913932 107
195 3300005466 Ga0070685_10106003 Ga0070685_101060032 107
196 3300005539 Ga0068853_102065077 Ga0068853_1020650772 107
197 3300005543 Ga0070672_100169555 Ga0070672_1001695552 107
198 3300005548 Ga0070665_100314592 Ga0070665_1003145924 107
199 3300005563 Ga0068855_100349567 Ga0068855_1003495671 107
200 3300005564 Ga0070664_101005843 Ga0070664_1010058431 107
201 3300005614 Ga0068856_100305166 Ga0068856_1003051663 107
202 3300005617 Ga0068859_101278173 Ga0068859_1012781732 107
203 3300005618 Ga0068864_100374626 Ga0068864_1003746261 107
204 3300005718 Ga0068866_10275061 Ga0068866_102750611 107
205 3300005841 Ga0068863_100327227 Ga0068863_1003272272 107
206 3300006237 Ga0097621_100132935 Ga0097621_1001329353 107
207 3300006358 Ga0068871_100132447 Ga0068871_1001324472 107
208 3300006881 Ga0068865_100198362 Ga0068865_1001983621 107
209 3300006931 Ga0097620_101278283 Ga0097620_1012782832 107
210 3300009545 Ga0105237_11697765 Ga0105237_116977652 107
211 3300013306 Ga0163162_10449836 Ga0163162_104498361 107
212 3300025899 Ga0207642_10407032 Ga0207642_104070322 107
213 3300025901 Ga0207688_10224182 Ga0207688_102241821 107
214 3300025903 Ga0207680_10265213 Ga0207680_102652131 107
215 3300025909 Ga0207705_10218017 Ga0207705_102180171 107
216 3300025914 Ga0207671_10321905 Ga0207671_103219051 107
217 3300025934 Ga0207686_10235736 Ga0207686_102357361 107
218 3300025935 Ga0207709_11282694 Ga0207709_112826942 107
219 3300025936 Ga0207670_11112775 Ga0207670_111127751 107
220 3300025940 Ga0207691_10284678 Ga0207691_102846782 107
221 3300025941 Ga0207711_10166274 Ga0207711_101662741 107
222 3300025942 Ga0207689_10157847 Ga0207689_101578472 107
223 3300025949 Ga0207667_10290741 Ga0207667_102907411 107
224 3300025986 Ga0207658_10585200 Ga0207658_105852002 107
225 3300026078 Ga0207702_10266954 Ga0207702_102669541 107
226 3300026088 Ga0207641_10383447 Ga0207641_103834472 107
227 3300026095 Ga0207676_11419938 Ga0207676_114199381 107
228 3300026121 Ga0207683_10260227 Ga0207683_102602272 107
229 3300028379 Ga0268266_10272892 Ga0268266_102728923 107
230 3300031727 Ga0316576_10001399 Ga0316576_1000139911 107
231 3300031727 Ga0316576_10237034 Ga0316576_102370342 107
232 3300031728 Ga0316578_10074903 Ga0316578_100749032 107
233 3300031728 Ga0316578_10377055 Ga0316578_103770552 107
234 3300031733 Ga0316577_10001739 Ga0316577_100017393 107
235 3300032133 Ga0316583_10291867 Ga0316583_102918672 107
236 3300032137 Ga0316585_10038761 Ga0316585_100387612 107
237 3300032139 Ga0316580_10000387 Ga0316580_1000038711 107
238 3300033524 Ga0316592_1081511 Ga0316592_10815112 107
239 3300033541 Ga0316596_1230181 Ga0316596_12301812 107
240 3300035398 Ga0316574_0107753 Ga0316574_0107753_297_620 107
241 3300036647 Ga0316582_0001824 Ga0316582_0001824_1812_2135 107
242 3300036712 Ga0316584_0014865 Ga0316584_0014865_3806_4129 107
243 3300037588 Ga0316581_0111762 Ga0316581_0111762_157_480 107
244 3300038443 Ga0395901_1970073 Ga0395901_1970073_35_358 107
245 3300038443 Ga0395901_2113597 Ga0395901_2113597_47_370 107
246 3300041443 Ga0451789_0042650 Ga0451789_0042650_222_545 107
247 3300041453 Ga0451797_0728442 Ga0451797_0728442_313_636 107
248 3300041462 Ga0451806_650239 Ga0451806_650239_38_361 107
249 3300042133 Ga0450896_014900 Ga0450896_014900_210_533 107
250 3300042145 Ga0450906_059266 Ga0450906_059266_299_622 107
251 3300048903 Ga0496100_0126890 Ga0496100_0126890_1405_1728 107
252 3300048904 Ga0496101_0101946 Ga0496101_0101946_442_765 107
253 3300048908 Ga0496105_0475751 Ga0496105_0475751_110_433 107
254 3300048909 Ga0496106_0252121 Ga0496106_0252121_133_456 107
255 3300049585 Ga0501069_0659237 Ga0501069_0659237_151_474 107
256 3300049586 Ga0501070_0507927 Ga0501070_0507927_217_540 107
257 3300049592 Ga0501076_1372667 Ga0501076_1372667_247_570 107
258 3300049744 Ga0501083_0599967 Ga0501083_0599967_243_566 107
259 iso_pu_bacteria 8003955200 8003963242 107
260 3300003320 rootH2_10112718 rootH2_101127181 108
261 3300005331 Ga0070670_100151636 Ga0070670_1001516362 108
262 3300005335 Ga0070666_10001193 Ga0070666_1000119310 108
263 3300005347 Ga0070668_100001401 Ga0070668_10000140112 108
264 3300005366 Ga0070659_101699200 Ga0070659_1016992001 108
265 3300005367 Ga0070667_100001946 Ga0070667_1000019465 108
266 3300005455 Ga0070663_101107468 Ga0070663_1011074681 108
267 3300005530 Ga0070679_101601707 Ga0070679_1016017071 108
268 3300005841 Ga0068863_100002488 Ga0068863_1000024885 108
269 3300005841 Ga0068863_100017312 Ga0068863_10001731211 108
270 3300005843 Ga0068860_100014783 Ga0068860_1000147835 108
271 3300005985 Ga0081539_10011863 Ga0081539_100118634 108
272 3300006038 Ga0075365_11278816 Ga0075365_112788162 108
273 3300009098 Ga0105245_11794379 Ga0105245_117943791 108
274 3300009177 Ga0105248_13044833 Ga0105248_130448331 108
275 3300014968 Ga0157379_10068242 Ga0157379_100682424 108
276 3300025298 Ga0209050_1039729 Ga0209050_10397292 108
277 3300025315 Ga0207697_10163086 Ga0207697_101630861 108
278 3300025903 Ga0207680_10001242 Ga0207680_100012424 108
279 3300025915 Ga0207693_10490732 Ga0207693_104907321 108
280 3300025923 Ga0207681_10049251 Ga0207681_100492514 108
281 3300025925 Ga0207650_10125120 Ga0207650_101251202 108
282 3300025925 Ga0207650_10890363 Ga0207650_108903632 108
283 3300025972 Ga0207668_10000897 Ga0207668_1000089712 108
284 3300025986 Ga0207658_10000855 Ga0207658_1000085510 108
285 3300026088 Ga0207641_10001239 Ga0207641_1000123910 108
286 3300026088 Ga0207641_10008857 Ga0207641_1000885710 108
287 3300027312 Ga0209371_1037806 Ga0209371_10378062 108
288 3300028380 Ga0268265_11038006 Ga0268265_110380062 108
289 3300028381 Ga0268264_10011283 Ga0268264_100112835 108
290 3300030500 Ga0268256_1042966 Ga0268256_10429661 108
291 3300031665 Ga0316575_10171221 Ga0316575_101712212 108
292 3300031691 Ga0316579_10435185 Ga0316579_104351851 108
293 3300031727 Ga0316576_10674542 Ga0316576_106745422 108
294 3300031728 Ga0316578_10607522 Ga0316578_106075221 108
295 3300031824 Ga0307413_11321227 Ga0307413_113212272 108
296 3300031852 Ga0307410_10159946 Ga0307410_101599462 108
297 3300031901 Ga0307406_10485378 Ga0307406_104853782 108
298 3300031903 Ga0307407_10622896 Ga0307407_106228962 108
299 3300031911 Ga0307412_11920344 Ga0307412_119203442 108
300 3300031995 Ga0307409_100238227 Ga0307409_1002382273 108
301 3300031995 Ga0307409_100333353 Ga0307409_1003333532 108
302 3300032004 Ga0307414_10053637 Ga0307414_100536372 108
303 3300032133 Ga0316583_10062843 Ga0316583_100628432 108
304 3300032139 Ga0316580_10252808 Ga0316580_102528082 108
305 3300038727 Ga0400491_09399 Ga0400491_09399_155_481 108
306 3300044656 Ga0466969_0402056 Ga0466969_0402056_202_528 108
307 3300044693 Ga0466961_0472845 Ga0466961_0472845_117_443 108
308 3300044765 Ga0466970_0260059 Ga0466970_0260059_290_616 108
309 3300045836 Ga0466958_0898205 Ga0466958_0898205_241_567 108
310 3300046453 Ga0495627_212368 Ga0495627_212368_25_351 108
311 3300046501 Ga0495607_0112360 Ga0495607_0112360_129_455 108
312 3300046512 Ga0495610_0321045 Ga0495610_0321045_53_379 108
313 3300046519 Ga0495632_0039124 Ga0495632_0039124_330_656 108
314 3300046520 Ga0495637_0067973 Ga0495637_0067973_958_1284 108
315 3300046524 Ga0495648_0013427 Ga0495648_0013427_338_664 108
316 3300046530 Ga0495654_0053012 Ga0495654_0053012_887_1213 108
317 3300046558 Ga0495633_0326197 Ga0495633_0326197_243_569 108
318 3300046660 Ga0495625_0006453 Ga0495625_0006453_1659_1985 108
319 3300046660 Ga0495625_0728047 Ga0495625_0728047_99_425 108
320 3300046665 Ga0495661_0619808 Ga0495661_0619808_106_432 108
321 3300046691 Ga0495670_0100618 Ga0495670_0100618_1063_1389 108
322 3300047472 Ga0495686_0001044 Ga0495686_0001044_28894_29220 108
323 3300047472 Ga0495686_0129795 Ga0495686_0129795_279_605 108
324 3300048903 Ga0496100_0119526 Ga0496100_0119526_107_433 108
325 3300048904 Ga0496101_0162083 Ga0496101_0162083_1238_1564 108
326 3300048905 Ga0496102_0503003 Ga0496102_0503003_792_1118 108
327 3300048915 Ga0496112_0387898 Ga0496112_0387898_823_1149 108
328 3300048919 Ga0496116_0147826 Ga0496116_0147826_45_371 108
329 3300048920 Ga0496117_0092362 Ga0496117_0092362_1363_1689 108
330 3300048921 Ga0496118_0107215 Ga0496118_0107215_1363_1689 108
331 3300048924 Ga0496121_0000061 Ga0496121_0000061_4086_4412 108
332 3300048924 Ga0496121_0025083 Ga0496121_0025083_2606_2932 108
333 3300048925 Ga0496122_0185087 Ga0496122_0185087_45_371 108
334 3300048926 Ga0496123_0153831 Ga0496123_0153831_45_371 108
335 3300048927 Ga0496124_0068327 Ga0496124_0068327_954_1280 108
336 3300048928 Ga0496125_0021360 Ga0496125_0021360_2067_2393 108
337 3300048929 Ga0496126_0085820 Ga0496126_0085820_1786_2112 108
338 3300048929 Ga0496126_0308439 Ga0496126_0308439_45_371 108
339 3300049581 Ga0501047_0352672 Ga0501047_0352672_343_669 108
340 3300049581 Ga0501047_1114437 Ga0501047_1114437_92_418 108
341 3300053125 Ga0500618_021111 Ga0500618_021111_93_419 108
342 3300053141 Ga0500574_221144 Ga0500574_221144_61_387 108
343 3300005339 Ga0070660_100151611 Ga0070660_1001516113 109
344 3300005435 Ga0070714_100793881 Ga0070714_1007938812 109
345 3300005437 Ga0070710_10153304 Ga0070710_101533042 109
346 3300005439 Ga0070711_100151979 Ga0070711_1001519792 109
347 3300005456 Ga0070678_100773868 Ga0070678_1007738682 109
348 3300005543 Ga0070672_101621371 Ga0070672_1016213712 109
349 3300005548 Ga0070665_100232511 Ga0070665_1002325112 109
350 3300005614 Ga0068856_101126525 Ga0068856_1011265252 109
351 3300005616 Ga0068852_101059126 Ga0068852_1010591262 109
352 3300005937 Ga0081455_10055690 Ga0081455_100556902 109
353 3300006058 Ga0075432_10407140 Ga0075432_104071402 109
354 3300006173 Ga0070716_100619356 Ga0070716_1006193561 109
355 3300006175 Ga0070712_100312298 Ga0070712_1003122982 109
356 3300006175 Ga0070712_100490447 Ga0070712_1004904473 109
357 3300006847 Ga0075431_100378052 Ga0075431_1003780522 109
358 3300006880 Ga0075429_100378781 Ga0075429_1003787812 109
359 3300007265 Ga0099794_10533633 Ga0099794_105336331 109
360 3300009093 Ga0105240_11187964 Ga0105240_111879642 109
361 3300009094 Ga0111539_10513727 Ga0111539_105137272 109
362 3300009147 Ga0114129_10548674 Ga0114129_105486741 109
363 3300012476 Ga0157344_1006271 Ga0157344_10062712 109
364 3300012487 Ga0157321_1013110 Ga0157321_10131102 109
365 3300012508 Ga0157315_1019421 Ga0157315_10194212 109
366 3300013104 Ga0157370_11295893 Ga0157370_112958932 109
367 3300013105 Ga0157369_11222514 Ga0157369_112225142 109
368 3300013308 Ga0157375_11602565 Ga0157375_116025652 109
369 3300014326 Ga0157380_13393924 Ga0157380_133939241 109
370 3300014497 Ga0182008_10204037 Ga0182008_102040372 109
371 3300015265 Ga0182005_1052547 Ga0182005_10525471 109
372 3300025898 Ga0207692_10784257 Ga0207692_107842572 109
373 3300025913 Ga0207695_10356273 Ga0207695_103562731 109
374 3300025914 Ga0207671_10266968 Ga0207671_102669681 109
375 3300025916 Ga0207663_10345369 Ga0207663_103453691 109
376 3300025919 Ga0207657_10137591 Ga0207657_101375913 109
377 3300025919 Ga0207657_10312808 Ga0207657_103128083 109
378 3300025928 Ga0207700_10778108 Ga0207700_107781081 109
379 3300025929 Ga0207664_10308064 Ga0207664_103080642 109
380 3300025937 Ga0207669_10477997 Ga0207669_104779972 109
381 3300026067 Ga0207678_10118679 Ga0207678_101186795 109
382 3300026078 Ga0207702_10406238 Ga0207702_104062382 109
383 3300026078 Ga0207702_10514142 Ga0207702_105141422 109
384 3300026142 Ga0207698_11106828 Ga0207698_111068282 109
385 3300027543 Ga0209999_1027953 Ga0209999_10279531 109
386 3300027717 Ga0209998_10194753 Ga0209998_101947532 109
387 3300027876 Ga0209974_10270365 Ga0209974_102703651 109
388 3300028379 Ga0268266_10306696 Ga0268266_103066962 109
389 3300031456 Ga0307513_10215539 Ga0307513_102155392 109
390 3300031824 Ga0307413_12106688 Ga0307413_121066882 109
391 3300031901 Ga0307406_10073981 Ga0307406_100739812 109
392 3300031903 Ga0307407_11546073 Ga0307407_115460731 109
393 3300031995 Ga0307409_100462351 Ga0307409_1004623512 109
394 3300031995 Ga0307409_101136980 Ga0307409_1011369802 109
395 3300032004 Ga0307414_10098116 Ga0307414_100981163 109
396 3300032004 Ga0307414_11449263 Ga0307414_114492631 109
397 3300032005 Ga0307411_11411405 Ga0307411_114114052 109
398 3300035083 Ga0373926_0049132 Ga0373926_0049132_145_474 109
399 3300035083 Ga0373926_0056492 Ga0373926_0056492_986_1315 109
400 3300035086 Ga0373934_0060884 Ga0373934_0060884_77_406 109
401 3300035086 Ga0373934_0066572 Ga0373934_0066572_159_488 109
402 3300035089 Ga0373944_0030361 Ga0373944_0030361_907_1236 109
403 3300035089 Ga0373944_0035120 Ga0373944_0035120_965_1294 109
404 3300035111 Ga0373923_0082802 Ga0373923_0082802_57_386 109
405 3300035111 Ga0373923_0596879 Ga0373923_0596879_74_403 109
406 3300035113 Ga0373936_0069598 Ga0373936_0069598_90_419 109
407 3300035113 Ga0373936_0075741 Ga0373936_0075741_964_1293 109
408 3300035116 Ga0373945_0059526 Ga0373945_0059526_958_1287 109
409 3300035116 Ga0373945_0068247 Ga0373945_0068247_56_385 109
410 3300035116 Ga0373945_0100380 Ga0373945_0100380_106_435 109
411 3300035117 Ga0373953_0059855 Ga0373953_0059855_266_595 109
412 3300035117 Ga0373953_0061514 Ga0373953_0061514_126_455 109
413 3300035118 Ga0373954_0082685 Ga0373954_0082685_1065_1394 109
414 3300035118 Ga0373954_0088099 Ga0373954_0088099_150_479 109
415 3300035119 Ga0373956_0066586 Ga0373956_0066586_240_569 109
416 3300035119 Ga0373956_0087905 Ga0373956_0087905_949_1278 109
417 3300035120 Ga0373957_0059439 Ga0373957_0059439_952_1281 109
418 3300035120 Ga0373957_0125015 Ga0373957_0125015_91_420 109
419 3300035170 Ga0373943_0075857 Ga0373943_0075857_1116_1445 109
420 3300035170 Ga0373943_0131275 Ga0373943_0131275_61_390 109
421 3300035170 Ga0373943_0464303 Ga0373943_0464303_371_700 109
422 3300035171 Ga0373946_0084264 Ga0373946_0084264_105_434 109
423 3300035171 Ga0373946_0087135 Ga0373946_0087135_959_1288 109
424 3300035171 Ga0373946_0153889 Ga0373946_0153889_572_901 109
425 3300035172 Ga0373955_0117576 Ga0373955_0117576_260_589 109
426 3300035172 Ga0373955_0384878 Ga0373955_0384878_25_354 109
427 3300035410 Ga0373924_0046896 Ga0373924_0046896_412_741 109
428 3300035410 Ga0373924_0123204 Ga0373924_0123204_117_446 109
429 3300035692 Ga0373935_0151938 Ga0373935_0151938_86_415 109
430 3300035692 Ga0373935_0212344 Ga0373935_0212344_958_1287 109
431 3300035692 Ga0373935_1046655 Ga0373935_1046655_214_543 109
432 3300035695 Ga0373927_0157903 Ga0373927_0157903_1055_1384 109
433 3300035695 Ga0373927_0422769 Ga0373927_0422769_79_408 109
434 3300035695 Ga0373927_0487698 Ga0373927_0487698_40_369 109
435 3300035724 Ga0373933_0172272 Ga0373933_0172272_963_1292 109
436 3300035724 Ga0373933_0178808 Ga0373933_0178808_70_399 109
437 3300035724 Ga0373933_0369420 Ga0373933_0369420_195_524 109
438 3300035725 Ga0373947_0098565 Ga0373947_0098565_560_889 109
439 3300035725 Ga0373947_0105969 Ga0373947_0105969_244_573 109
440 3300036401 Ga0373937_0110578 Ga0373937_0110578_946_1275 109
441 3300036401 Ga0373937_0317224 Ga0373937_0317224_190_519 109
442 3300036401 Ga0373937_0370130 Ga0373937_0370130_992_1321 109
443 3300036401 Ga0373937_1205156 Ga0373937_1205156_60_389 109
444 3300036647 Ga0316582_1270999 Ga0316582_1270999_21_356 109
445 3300036712 Ga0316584_0669560 Ga0316584_0669560_39_374 109
446 3300037068 Ga0373925_0058690 Ga0373925_0058690_2495_2824 109
447 3300037068 Ga0373925_0096744 Ga0373925_0096744_72_401 109
448 3300037853 Ga0436364_0105997 Ga0436364_0105997_2165_2494 109
449 3300037853 Ga0436364_0309800 Ga0436364_0309800_119_448 109
450 3300037853 Ga0436364_0573740 Ga0436364_0573740_56_385 109
451 3300037853 Ga0436364_1125838 Ga0436364_1125838_976_1305 109
452 3300038443 Ga0395901_1522460 Ga0395901_1522460_95_424 109
453 3300039447 Ga0436361_0044481 Ga0436361_0044481_620_949 109
454 3300041408 Ga0439453_0074328 Ga0439453_0074328_218_547 109
455 3300041411 Ga0439466_0178272 Ga0439466_0178272_70_399 109
456 3300042008 Ga0439450_229923 Ga0439450_229923_46_375 109
457 3300042010 Ga0439452_089516 Ga0439452_089516_98_427 109
458 3300042010 Ga0439452_126427 Ga0439452_126427_204_533 109
459 3300042013 Ga0439456_070758 Ga0439456_070758_72_401 109
460 3300042125 Ga0450923_070741 Ga0450923_070741_43_372 109
461 3300042134 Ga0450898_051491 Ga0450898_051491_109_438 109
462 3300042184 Ga0450908_069517 Ga0450908_069517_100_429 109
463 3300042435 Ga0439434_0076549 Ga0439434_0076549_125_454 109
464 3300046454 Ga0495592_0145694 Ga0495592_0145694_268_597 109
465 3300046454 Ga0495592_0186558 Ga0495592_0186558_91_420 109
466 3300046455 Ga0495603_0142417 Ga0495603_0142417_95_424 109
467 3300046459 Ga0495629_0112654 Ga0495629_0112654_1366_1695 109
468 3300046459 Ga0495629_0200840 Ga0495629_0200840_72_401 109
469 3300046461 Ga0495641_0107752 Ga0495641_0107752_859_1188 109
470 3300046461 Ga0495641_0607399 Ga0495641_0607399_81_410 109
471 3300046462 Ga0495651_0195109 Ga0495651_0195109_132_461 109
472 3300046462 Ga0495651_0196676 Ga0495651_0196676_1030_1359 109
473 3300046463 Ga0495653_0144197 Ga0495653_0144197_151_480 109
474 3300046463 Ga0495653_0298876 Ga0495653_0298876_324_653 109
475 3300046472 Ga0495580_0207802 Ga0495580_0207802_70_399 109
476 3300046472 Ga0495580_0295518 Ga0495580_0295518_25_354 109
477 3300046473 Ga0495582_0124759 Ga0495582_0124759_1047_1376 109
478 3300046475 Ga0495639_0101548 Ga0495639_0101548_973_1302 109
479 3300046475 Ga0495639_0130120 Ga0495639_0130120_767_1096 109
480 3300046476 Ga0495662_0107893 Ga0495662_0107893_72_401 109
481 3300046476 Ga0495662_0452297 Ga0495662_0452297_278_607 109
482 3300046476 Ga0495662_0582388 Ga0495662_0582388_104_433 109
483 3300046477 Ga0495664_0147601 Ga0495664_0147601_1015_1344 109
484 3300046477 Ga0495664_0335953 Ga0495664_0335953_472_801 109
485 3300046499 Ga0495594_0141762 Ga0495594_0141762_82_411 109
486 3300046511 Ga0495608_0126676 Ga0495608_0126676_77_406 109
487 3300046511 Ga0495608_0139248 Ga0495608_0139248_114_443 109
488 3300046514 Ga0495618_0135333 Ga0495618_0135333_1027_1356 109
489 3300046514 Ga0495618_0160000 Ga0495618_0160000_110_439 109
490 3300046514 Ga0495618_0162437 Ga0495618_0162437_118_447 109
491 3300046514 Ga0495618_0394950 Ga0495618_0394950_48_377 109
492 3300046515 Ga0495620_0075585 Ga0495620_0075585_976_1305 109
493 3300046516 Ga0495628_0163854 Ga0495628_0163854_1254_1583 109
494 3300046516 Ga0495628_0241651 Ga0495628_0241651_73_402 109
495 3300046517 Ga0495630_0142679 Ga0495630_0142679_247_576 109
496 3300046517 Ga0495630_0274292 Ga0495630_0274292_49_378 109
497 3300046523 Ga0495644_0344074 Ga0495644_0344074_44_373 109
498 3300046526 Ga0495666_0088511 Ga0495666_0088511_108_437 109
499 3300046529 Ga0495652_0228735 Ga0495652_0228735_1010_1339 109
500 3300046531 Ga0495665_0096293 Ga0495665_0096293_253_582 109
501 3300046531 Ga0495665_0100445 Ga0495665_0100445_922_1251 109
502 3300046531 Ga0495665_0680385 Ga0495665_0680385_111_440 109
503 3300046533 Ga0495640_0119906 Ga0495640_0119906_1266_1595 109
504 3300046533 Ga0495640_0153688 Ga0495640_0153688_987_1316 109
505 3300046533 Ga0495640_0167431 Ga0495640_0167431_955_1284 109
506 3300046533 Ga0495640_0444411 Ga0495640_0444411_126_455 109
507 3300046535 Ga0495586_0131655 Ga0495586_0131655_88_417 109
508 3300046536 Ga0495587_0106884 Ga0495587_0106884_114_443 109
509 3300046536 Ga0495587_0138197 Ga0495587_0138197_1021_1350 109
510 3300046542 Ga0495597_0069606 Ga0495597_0069606_261_590 109
511 3300046543 Ga0495645_0178351 Ga0495645_0178351_135_464 109
512 3300046543 Ga0495645_0200409 Ga0495645_0200409_950_1279 109
513 3300046559 Ga0495667_0136454 Ga0495667_0136454_1132_1461 109
514 3300046559 Ga0495667_0138507 Ga0495667_0138507_1151_1480 109
515 3300046642 Ga0495634_0062285 Ga0495634_0062285_2064_2393 109
516 3300046642 Ga0495634_0161678 Ga0495634_0161678_70_399 109
517 3300046663 Ga0495635_0146827 Ga0495635_0146827_1231_1560 109
518 3300046663 Ga0495635_0166114 Ga0495635_0166114_78_407 109
519 3300046674 Ga0495588_0292901 Ga0495588_0292901_508_837 109
520 3300046675 Ga0495657_0133466 Ga0495657_0133466_116_445 109
521 3300046675 Ga0495657_0169660 Ga0495657_0169660_946_1275 109
522 3300046678 Ga0495599_0156749 Ga0495599_0156749_964_1293 109
523 3300046678 Ga0495599_0164734 Ga0495599_0164734_988_1317 109
524 3300046679 Ga0495623_0106379 Ga0495623_0106379_384_713 109
525 3300046679 Ga0495623_0151466 Ga0495623_0151466_957_1286 109
526 3300046680 Ga0495646_0110662 Ga0495646_0110662_1173_1502 109
527 3300046680 Ga0495646_0130577 Ga0495646_0130577_1034_1363 109
528 3300046681 Ga0495647_0059436 Ga0495647_0059436_202_531 109
529 3300046681 Ga0495647_0068717 Ga0495647_0068717_103_432 109
530 3300046681 Ga0495647_0162467 Ga0495647_0162467_105_434 109
531 3300046683 Ga0495658_0201494 Ga0495658_0201494_191_520 109
532 3300046689 Ga0495613_0173830 Ga0495613_0173830_989_1318 109
533 3300046689 Ga0495613_0186953 Ga0495613_0186953_96_425 109
534 3300046690 Ga0495624_0133971 Ga0495624_0133971_1045_1374 109
535 3300046690 Ga0495624_0157156 Ga0495624_0157156_115_444 109
536 3300046809 Ga0495600_0045735 Ga0495600_0045735_136_465 109
537 3300046809 Ga0495600_0151284 Ga0495600_0151284_961_1290 109
538 3300047315 Ga0495581_0127458 Ga0495581_0127458_1039_1368 109
539 3300047317 Ga0495604_0207468 Ga0495604_0207468_944_1273 109
540 3300047317 Ga0495604_1028889 Ga0495604_1028889_65_394 109
541 3300047319 Ga0495674_0307220 Ga0495674_0307220_102_431 109
542 3300047319 Ga0495674_0707261 Ga0495674_0707261_84_413 109
543 3300047319 Ga0495674_0825713 Ga0495674_0825713_290_619 109
544 3300047321 Ga0495676_0186181 Ga0495676_0186181_1067_1396 109
545 3300047321 Ga0495676_0313791 Ga0495676_0313791_645_974 109
546 3300047322 Ga0495680_0196828 Ga0495680_0196828_130_459 109
547 3300047322 Ga0495680_0219835 Ga0495680_0219835_57_386 109
548 3300047444 Ga0495675_0151002 Ga0495675_0151002_109_438 109
549 3300047444 Ga0495675_0164624 Ga0495675_0164624_988_1317 109
550 3300047471 Ga0495684_0188994 Ga0495684_0188994_222_551 109
551 3300047471 Ga0495684_0806975 Ga0495684_0806975_143_472 109
552 3300047673 Ga0495593_0100950 Ga0495593_0100950_1029_1358 109
553 3300047673 Ga0495593_0103624 Ga0495593_0103624_159_488 109
554 3300048088 Ga0495602_0206060 Ga0495602_0206060_979_1308 109
555 3300048088 Ga0495602_0655298 Ga0495602_0655298_273_602 109
556 3300048089 Ga0495614_0171859 Ga0495614_0171859_88_417 109
557 3300048089 Ga0495614_0441818 Ga0495614_0441818_228_557 109
558 3300048903 Ga0496100_0243775 Ga0496100_0243775_169_498 109
559 3300048904 Ga0496101_0243642 Ga0496101_0243642_1005_1334 109
560 3300048904 Ga0496101_0315989 Ga0496101_0315989_47_376 109
561 3300048907 Ga0496104_0426508 Ga0496104_0426508_122_451 109
562 3300048907 Ga0496104_0690450 Ga0496104_0690450_511_840 109
563 3300048907 Ga0496104_0691144 Ga0496104_0691144_62_391 109
564 3300048908 Ga0496105_0220187 Ga0496105_0220187_1162_1491 109
565 3300048910 Ga0496107_0176705 Ga0496107_0176705_860_1189 109
566 3300048910 Ga0496107_0234880 Ga0496107_0234880_937_1266 109
567 3300048910 Ga0496107_0953206 Ga0496107_0953206_103_432 109
568 3300048911 Ga0496108_0413226 Ga0496108_0413226_790_1119 109
569 3300048912 Ga0496109_0203360 Ga0496109_0203360_492_821 109
570 3300048913 Ga0496110_0346352 Ga0496110_0346352_967_1296 109
571 3300048917 Ga0496114_0396220 Ga0496114_0396220_130_459 109
572 3300048917 Ga0496114_0905341 Ga0496114_0905341_98_427 109
573 3300048918 Ga0496115_0026500 Ga0496115_0026500_4060_4389 109
574 3300048918 Ga0496115_0939872 Ga0496115_0939872_105_434 109
575 3300048925 Ga0496122_0003452 Ga0496122_0003452_16743_17072 109
576 3300048926 Ga0496123_0000992 Ga0496123_0000992_35480_35809 109
577 3300049459 Ga0495678_037735 Ga0495678_037735_598_927 109
578 3300049522 Ga0501299_103219 Ga0501299_103219_121_450 109
579 3300049568 Ga0501031_0110428 Ga0501031_0110428_1397_1726 109
580 3300049568 Ga0501031_0112732 Ga0501031_0112732_1266_1595 109
581 3300049569 Ga0501032_0007349 Ga0501032_0007349_1444_1773 109
582 3300049569 Ga0501032_0716859 Ga0501032_0716859_233_562 109
583 3300049570 Ga0501033_0004875 Ga0501033_0004875_3155_3484 109
584 3300049570 Ga0501033_0206579 Ga0501033_0206579_946_1275 109
585 3300049571 Ga0501034_0369498 Ga0501034_0369498_60_389 109
586 3300049572 Ga0501036_0197048 Ga0501036_0197048_1266_1595 109
587 3300049572 Ga0501036_0824001 Ga0501036_0824001_361_690 109
588 3300049573 Ga0501037_0000216 Ga0501037_0000216_24433_24762 109
589 3300049573 Ga0501037_0078431 Ga0501037_0078431_1631_1960 109
590 3300049574 Ga0501038_0447733 Ga0501038_0447733_609_938 109
591 3300049574 Ga0501038_0727707 Ga0501038_0727707_361_690 109
592 3300049575 Ga0501039_1054942 Ga0501039_1054942_233_562 109
593 3300049575 Ga0501039_1097078 Ga0501039_1097078_65_394 109
594 3300049578 Ga0501042_0119433 Ga0501042_0119433_660_989 109
595 3300049579 Ga0501043_0000132 Ga0501043_0000132_18189_18518 109
596 3300049579 Ga0501043_0239224 Ga0501043_0239224_116_445 109
597 3300049580 Ga0501046_0210012 Ga0501046_0210012_1030_1359 109
598 3300049581 Ga0501047_0151585 Ga0501047_0151585_1308_1637 109
599 3300049581 Ga0501047_0262995 Ga0501047_0262995_272_601 109
600 3300049582 Ga0501048_0210608 Ga0501048_0210608_989_1318 109
601 3300049584 Ga0501068_0029163 Ga0501068_0029163_1246_1575 109
602 3300049585 Ga0501069_0000051 Ga0501069_0000051_26187_26516 109
603 3300049585 Ga0501069_0832802 Ga0501069_0832802_147_476 109
604 3300049586 Ga0501070_0001832 Ga0501070_0001832_18327_18656 109
605 3300049586 Ga0501070_0072902 Ga0501070_0072902_647_976 109
606 3300049587 Ga0501071_0014770 Ga0501071_0014770_1604_1933 109
607 3300049589 Ga0501073_0059743 Ga0501073_0059743_1432_1761 109
608 3300049590 Ga0501074_0000043 Ga0501074_0000043_51160_51489 109
609 3300049592 Ga0501076_0460267 Ga0501076_0460267_344_673 109
610 3300049742 Ga0501080_0001519 Ga0501080_0001519_1527_1856 109
611 3300049742 Ga0501080_0322553 Ga0501080_0322553_931_1260 109
612 3300049744 Ga0501083_0000247 Ga0501083_0000247_17950_18279 109
613 3300049822 Ga0501035_0000280 Ga0501035_0000280_13749_14078 109
614 3300049822 Ga0501035_0186790 Ga0501035_0186790_361_690 109
615 3300049823 Ga0501044_0001427 Ga0501044_0001427_9534_9863 109
616 3300049823 Ga0501044_0091608 Ga0501044_0091608_1623_1952 109
617 3300049824 Ga0501045_0172807 Ga0501045_0172807_1200_1529 109
618 3300050507 nmdc:mga05p37_482271_c1 nmdc:mga05p37_482271_c1_1042_1371 109
619 3300050508 nmdc:mga09592_349490_c1 nmdc:mga09592_349490_c1_78_407 109
620 3300050509 nmdc:mga0qj67_242075_c1 nmdc:mga0qj67_242075_c1_992_1321 109
621 3300050510 nmdc:mga06r32_1312036_c1 nmdc:mga06r32_1312036_c1_285_614 109
622 3300050510 nmdc:mga06r32_325375_c1 nmdc:mga06r32_325375_c1_234_563 109
623 3300053077 Ga0495601_0133313 Ga0495601_0133313_1065_1394 109
624 3300053077 Ga0495601_0141741 Ga0495601_0141741_113_442 109
625 3300053077 Ga0495601_0490153 Ga0495601_0490153_290_619 109
626 3300053077 Ga0495601_0705542 Ga0495601_0705542_243_572 109
627 3300053078 Ga0495612_0054777 Ga0495612_0054777_1163_1492 109
628 3300053078 Ga0495612_0073179 Ga0495612_0073179_1012_1341 109
629 3300053078 Ga0495612_0076323 Ga0495612_0076323_959_1288 109
630 3300053084 Ga0495595_0091017 Ga0495595_0091017_1067_1396 109
631 3300053084 Ga0495595_0108467 Ga0495595_0108467_945_1274 109
632 3300053085 Ga0495619_0101847 Ga0495619_0101847_1536_1865 109
633 3300053085 Ga0495619_0188490 Ga0495619_0188490_556_885 109
634 3300053119 Ga0500595_144112 Ga0500595_144112_179_508 109
635 3300053136 Ga0500559_0012819 Ga0500559_0012819_1814_2143 109
636 3300053153 Ga0500616_0061557 Ga0500616_0061557_115_444 109
637 3300060353 Ga0501082_0289447 Ga0501082_0289447_981_1310 109
638 3300005981 Ga0081538_10068670 Ga0081538_100686702 110
639 3300026067 Ga0207678_10123486 Ga0207678_101234862 110
640 3300035116 Ga0373945_0030164 Ga0373945_0030164_450_782 110
641 3300035170 Ga0373943_0187868 Ga0373943_0187868_127_459 110
642 3300035171 Ga0373946_0086731 Ga0373946_0086731_988_1320 110
643 3300035171 Ga0373946_0130085 Ga0373946_0130085_112_444 110
644 3300035207 Ga0373942_0153805 Ga0373942_0153805_348_680 110
645 3300035410 Ga0373924_0477042 Ga0373924_0477042_114_446 110
646 3300035692 Ga0373935_0415658 Ga0373935_0415658_561_893 110
647 3300035695 Ga0373927_0261363 Ga0373927_0261363_359_691 110
648 3300035725 Ga0373947_0256725 Ga0373947_0256725_98_430 110
649 3300035725 Ga0373947_0720142 Ga0373947_0720142_17_349 110
650 3300037068 Ga0373925_0449151 Ga0373925_0449151_88_420 110
651 3300037068 Ga0373925_1436016 Ga0373925_1436016_162_494 110
652 3300039062 Ga0400483_279772 Ga0400483_279772_1049_1381 110
653 3300046454 Ga0495592_0649089 Ga0495592_0649089_160_492 110
654 3300046455 Ga0495603_0156083 Ga0495603_0156083_888_1220 110
655 3300046459 Ga0495629_0403854 Ga0495629_0403854_436_768 110
656 3300046460 Ga0495638_0131412 Ga0495638_0131412_908_1240 110
657 3300046461 Ga0495641_0278327 Ga0495641_0278327_377_709 110
658 3300046461 Ga0495641_0468117 Ga0495641_0468117_46_378 110
659 3300046463 Ga0495653_0104864 Ga0495653_0104864_680_1012 110
660 3300046472 Ga0495580_0006397 Ga0495580_0006397_208_540 110
661 3300046474 Ga0495605_0141610 Ga0495605_0141610_323_655 110
662 3300046476 Ga0495662_0061906 Ga0495662_0061906_1277_1609 110
663 3300046477 Ga0495664_0025368 Ga0495664_0025368_2390_2722 110
664 3300046499 Ga0495594_0226743 Ga0495594_0226743_103_435 110
665 3300046501 Ga0495607_0262598 Ga0495607_0262598_326_658 110
666 3300046506 Ga0495583_0007045 Ga0495583_0007045_104_436 110
667 3300046507 Ga0495606_0279544 Ga0495606_0279544_176_508 110
668 3300046511 Ga0495608_0210495 Ga0495608_0210495_816_1148 110
669 3300046513 Ga0495616_0033661 Ga0495616_0033661_2001_2333 110
670 3300046514 Ga0495618_0170847 Ga0495618_0170847_984_1316 110
671 3300046519 Ga0495632_0172232 Ga0495632_0172232_189_521 110
672 3300046524 Ga0495648_0003532 Ga0495648_0003532_768_1100 110
673 3300046524 Ga0495648_0081312 Ga0495648_0081312_1044_1376 110
674 3300046526 Ga0495666_0247707 Ga0495666_0247707_255_587 110
675 3300046528 Ga0495642_0030353 Ga0495642_0030353_1291_1623 110
676 3300046529 Ga0495652_0169789 Ga0495652_0169789_21_353 110
677 3300046531 Ga0495665_0206683 Ga0495665_0206683_122_454 110
678 3300046531 Ga0495665_0342277 Ga0495665_0342277_57_389 110
679 3300046535 Ga0495586_0261099 Ga0495586_0261099_500_832 110
680 3300046543 Ga0495645_0185162 Ga0495645_0185162_986_1318 110
681 3300046559 Ga0495667_0442919 Ga0495667_0442919_324_656 110
682 3300046642 Ga0495634_0237357 Ga0495634_0237357_58_390 110
683 3300046675 Ga0495657_0043261 Ga0495657_0043261_521_853 110
684 3300046679 Ga0495623_0660887 Ga0495623_0660887_131_463 110
685 3300046680 Ga0495646_0077365 Ga0495646_0077365_430_762 110
686 3300046683 Ga0495658_0247506 Ga0495658_0247506_36_368 110
687 3300046684 Ga0495669_0007236 Ga0495669_0007236_4186_4518 110
688 3300046689 Ga0495613_0116356 Ga0495613_0116356_776_1108 110
689 3300046690 Ga0495624_0429243 Ga0495624_0429243_439_771 110
690 3300046692 Ga0495671_0103797 Ga0495671_0103797_1000_1332 110
691 3300046694 Ga0495649_0129760 Ga0495649_0129760_869_1201 110
692 3300046794 Ga0495589_0058955 Ga0495589_0058955_462_794 110
693 3300046809 Ga0495600_0158720 Ga0495600_0158720_1064_1396 110
694 3300046810 Ga0495660_0113459 Ga0495660_0113459_167_499 110
695 3300047315 Ga0495581_0137411 Ga0495581_0137411_1026_1358 110
696 3300047317 Ga0495604_0278342 Ga0495604_0278342_68_400 110
697 3300047319 Ga0495674_0227103 Ga0495674_0227103_1045_1377 110
698 3300047319 Ga0495674_0240872 Ga0495674_0240872_951_1283 110
699 3300047320 Ga0495672_0012514 Ga0495672_0012514_1044_1376 110
700 3300047321 Ga0495676_0079240 Ga0495676_0079240_1873_2205 110
701 3300047321 Ga0495676_0245230 Ga0495676_0245230_70_402 110
702 3300047322 Ga0495680_0066951 Ga0495680_0066951_995_1327 110
703 3300047323 Ga0495683_0004881 Ga0495683_0004881_6758_7090 110
704 3300047443 Ga0495687_018699 Ga0495687_018699_2662_2994 110
705 3300047444 Ga0495675_0163806 Ga0495675_0163806_81_413 110
706 3300047445 Ga0495677_0062008 Ga0495677_0062008_130_462 110
707 3300047446 Ga0495679_104231 Ga0495679_104231_138_470 110
708 3300047469 Ga0495673_0010616 Ga0495673_0010616_655_987 110
709 3300047673 Ga0495593_0145725 Ga0495593_0145725_592_924 110
710 3300048088 Ga0495602_0193858 Ga0495602_0193858_87_419 110
711 3300048089 Ga0495614_0118121 Ga0495614_0118121_690_1022 110
712 3300048091 Ga0495626_0150504 Ga0495626_0150504_552_884 110
713 3300048903 Ga0496100_0800290 Ga0496100_0800290_165_497 110
714 3300048904 Ga0496101_0247637 Ga0496101_0247637_185_517 110
715 3300048907 Ga0496104_0480068 Ga0496104_0480068_601_933 110
716 3300048908 Ga0496105_0126136 Ga0496105_0126136_484_816 110
717 3300048908 Ga0496105_0896926 Ga0496105_0896926_226_558 110
718 3300048909 Ga0496106_1408451 Ga0496106_1408451_75_407 110
719 3300048916 Ga0496113_0928634 Ga0496113_0928634_108_440 110
720 3300049460 Ga0495682_0014380 Ga0495682_0014380_1715_2047 110
721 3300049591 Ga0501075_0182724 Ga0501075_0182724_1048_1380 110
722 3300050509 nmdc:mga0qj67_1250747_c1 nmdc:mga0qj67_1250747_c1_108_440 110
723 3300053077 Ga0495601_0165163 Ga0495601_0165163_1027_1359 110
724 3300053078 Ga0495612_0341893 Ga0495612_0341893_17_349 110
725 3300053085 Ga0495619_0092116 Ga0495619_0092116_662_994 110
726 3300014497 Ga0182008_10094502 Ga0182008_100945022 111
727 iso_pu_bacteria 2501025501 2501070492 111
728 iso_pu_bacteria 2510917015 2511108876 111
729 iso_pu_bacteria 2856287931 2856287946 111
730 3300001979 JGI24740J21852_10018797 JGI24740J21852_100187972 115
731 3300001989 JGI24739J22299_10014786 JGI24739J22299_100147862 115
732 3300001989 JGI24739J22299_10014941 JGI24739J22299_100149412 115
733 3300001989 JGI24739J22299_10014954 JGI24739J22299_100149542 115
734 3300001989 JGI24739J22299_10014969 JGI24739J22299_100149692 115
735 3300001990 JGI24737J22298_10011905 JGI24737J22298_100119052 115
736 3300002067 JGI24735J21928_10002116 JGI24735J21928_100021164 115
737 3300002075 JGI24738J21930_10006207 JGI24738J21930_100062072 115
738 3300003354 JGI25160J50197_1014753 JGI25160J50197_10147533 115
739 3300003354 JGI25160J50197_1054618 JGI25160J50197_10546182 115
740 3300005327 Ga0070658_10067828 Ga0070658_100678282 115
741 3300005328 Ga0070676_10255499 Ga0070676_102554992 115
742 3300005335 Ga0070666_10050419 Ga0070666_100504192 115
743 3300005337 Ga0070682_100065216 Ga0070682_1000652162 115
744 3300005355 Ga0070671_100052699 Ga0070671_1000526992 115
745 3300005355 Ga0070671_100513810 Ga0070671_1005138101 115
746 3300005364 Ga0070673_100093963 Ga0070673_1000939632 115
747 3300005364 Ga0070673_100673720 Ga0070673_1006737202 115
748 3300005366 Ga0070659_101537332 Ga0070659_1015373321 115
749 3300005367 Ga0070667_100301323 Ga0070667_1003013232 115
750 3300005367 Ga0070667_100312911 Ga0070667_1003129111 115
751 3300005456 Ga0070678_100332198 Ga0070678_1003321982 115
752 3300005456 Ga0070678_100339789 Ga0070678_1003397891 115
753 3300005535 Ga0070684_101418244 Ga0070684_1014182441 115
754 3300005548 Ga0070665_100099392 Ga0070665_1000993923 115
755 3300005616 Ga0068852_100198172 Ga0068852_1001981723 115
756 3300005834 Ga0068851_10313365 Ga0068851_103133652 115
757 3300006175 Ga0070712_101474143 Ga0070712_1014741431 115
758 3300006237 Ga0097621_101177049 Ga0097621_1011770492 115
759 3300009011 Ga0105251_10080688 Ga0105251_100806881 115
760 3300009092 Ga0105250_10042193 Ga0105250_100421931 115
761 3300009093 Ga0105240_10245188 Ga0105240_102451883 115
762 3300009098 Ga0105245_10079895 Ga0105245_100798952 115
763 3300009101 Ga0105247_10035340 Ga0105247_100353403 115
764 3300009174 Ga0105241_10031643 Ga0105241_100316432 115
765 3300009177 Ga0105248_10232458 Ga0105248_102324583 115
766 3300009177 Ga0105248_10545735 Ga0105248_105457352 115
767 3300009545 Ga0105237_10946118 Ga0105237_109461182 115
768 3300009551 Ga0105238_10021194 Ga0105238_100211945 115
769 3300010375 Ga0105239_10079390 Ga0105239_100793903 115
770 3300011119 Ga0105246_10135957 Ga0105246_101359571 115
771 3300013105 Ga0157369_10140370 Ga0157369_101403703 115
772 3300013296 Ga0157374_10077502 Ga0157374_100775022 115
773 3300013297 Ga0157378_10063043 Ga0157378_100630432 115
774 3300013306 Ga0163162_10154128 Ga0163162_101541282 115
775 3300013308 Ga0157375_10233048 Ga0157375_102330482 115
776 3300014497 Ga0182008_10023906 Ga0182008_100239062 115
777 3300014969 Ga0157376_10332684 Ga0157376_103326842 115
778 3300025302 Ga0207426_1001804 Ga0207426_10018047 115
779 3300025321 Ga0207656_10229232 Ga0207656_102292322 115
780 3300025711 Ga0207696_1014539 Ga0207696_10145393 115
781 3300025728 Ga0207655_1025765 Ga0207655_10257652 115
782 3300025735 Ga0207713_1024005 Ga0207713_10240052 115
783 3300025900 Ga0207710_10019310 Ga0207710_100193103 115
784 3300025900 Ga0207710_10209388 Ga0207710_102093881 115
785 3300025901 Ga0207688_10776768 Ga0207688_107767682 115
786 3300025903 Ga0207680_10066894 Ga0207680_100668942 115
787 3300025903 Ga0207680_10078681 Ga0207680_100786812 115
788 3300025904 Ga0207647_10019140 Ga0207647_100191403 115
789 3300025907 Ga0207645_10390005 Ga0207645_103900052 115
790 3300025909 Ga0207705_10092025 Ga0207705_100920252 115
791 3300025911 Ga0207654_10150176 Ga0207654_101501761 115
792 3300025914 Ga0207671_10245106 Ga0207671_102451062 115
793 3300025915 Ga0207693_10769017 Ga0207693_107690172 115
794 3300025924 Ga0207694_10241255 Ga0207694_102412552 115
795 3300025925 Ga0207650_10076112 Ga0207650_100761122 115
796 3300025927 Ga0207687_10210617 Ga0207687_102106171 115
797 3300025931 Ga0207644_10052600 Ga0207644_100526002 115
798 3300025931 Ga0207644_10683518 Ga0207644_106835181 115
799 3300025932 Ga0207690_11661209 Ga0207690_116612091 115
800 3300025941 Ga0207711_10332560 Ga0207711_103325601 115
801 3300025960 Ga0207651_10554934 Ga0207651_105549342 115
802 3300025986 Ga0207658_11169373 Ga0207658_111693731 115
803 3300026067 Ga0207678_10035555 Ga0207678_100355554 115
804 3300026121 Ga0207683_10177407 Ga0207683_101774072 115
805 3300026121 Ga0207683_10376503 Ga0207683_103765032 115
806 3300026142 Ga0207698_10175873 Ga0207698_101758731 115
807 3300028379 Ga0268266_10137789 Ga0268266_101377892 115
808 3300046452 Ga0495617_099588 Ga0495617_099588_520_867 115
809 3300046454 Ga0495592_0161473 Ga0495592_0161473_1048_1395 115
810 3300046455 Ga0495603_0063339 Ga0495603_0063339_1774_2121 115
811 3300046457 Ga0495590_0002933 Ga0495590_0002933_2564_2911 115
812 3300046457 Ga0495590_0036120 Ga0495590_0036120_158_505 115
813 3300046458 Ga0495591_035547 Ga0495591_035547_1025_1372 115
814 3300046459 Ga0495629_0013766 Ga0495629_0013766_5388_5735 115
815 3300046462 Ga0495651_0195108 Ga0495651_0195108_1001_1348 115
816 3300046463 Ga0495653_0070521 Ga0495653_0070521_66_413 115
817 3300046463 Ga0495653_0192875 Ga0495653_0192875_72_419 115
818 3300046471 Ga0495650_0014917 Ga0495650_0014917_105_452 115
819 3300046471 Ga0495650_0058020 Ga0495650_0058020_159_506 115
820 3300046472 Ga0495580_0193451 Ga0495580_0193451_961_1308 115
821 3300046473 Ga0495582_0758195 Ga0495582_0758195_80_427 115
822 3300046474 Ga0495605_0026412 Ga0495605_0026412_1644_1991 115
823 3300046474 Ga0495605_0095825 Ga0495605_0095825_29_376 115
824 3300046476 Ga0495662_0094547 Ga0495662_0094547_1040_1387 115
825 3300046477 Ga0495664_0101274 Ga0495664_0101274_128_475 115
826 3300046491 Ga0495584_0022112 Ga0495584_0022112_1628_1975 115
827 3300046492 Ga0495585_0103948 Ga0495585_0103948_169_516 115
828 3300046499 Ga0495594_0133609 Ga0495594_0133609_133_480 115
829 3300046500 Ga0495596_0016715 Ga0495596_0016715_942_1289 115
830 3300046501 Ga0495607_0113580 Ga0495607_0113580_138_485 115
831 3300046506 Ga0495583_0000607 Ga0495583_0000607_41850_42197 115
832 3300046506 Ga0495583_0070194 Ga0495583_0070194_979_1326 115
833 3300046506 Ga0495583_0078012 Ga0495583_0078012_83_430 115
834 3300046507 Ga0495606_0024939 Ga0495606_0024939_2410_2757 115
835 3300046507 Ga0495606_0080001 Ga0495606_0080001_1626_1973 115
836 3300046507 Ga0495606_0128554 Ga0495606_0128554_143_490 115
837 3300046511 Ga0495608_0153497 Ga0495608_0153497_172_519 115
838 3300046513 Ga0495616_0082750 Ga0495616_0082750_140_487 115
839 3300046514 Ga0495618_0733549 Ga0495618_0733549_101_448 115
840 3300046515 Ga0495620_0028642 Ga0495620_0028642_1948_2295 115
841 3300046516 Ga0495628_0181574 Ga0495628_0181574_948_1295 115
842 3300046517 Ga0495630_0102363 Ga0495630_0102363_65_412 115
843 3300046518 Ga0495631_0069097 Ga0495631_0069097_151_498 115
844 3300046519 Ga0495632_0028797 Ga0495632_0028797_793_1140 115
845 3300046520 Ga0495637_0103823 Ga0495637_0103823_173_520 115
846 3300046522 Ga0495643_0054843 Ga0495643_0054843_943_1290 115
847 3300046523 Ga0495644_0062806 Ga0495644_0062806_96_443 115
848 3300046524 Ga0495648_0063859 Ga0495648_0063859_752_1099 115
849 3300046524 Ga0495648_0096107 Ga0495648_0096107_994_1341 115
850 3300046526 Ga0495666_0082360 Ga0495666_0082360_1060_1407 115
851 3300046528 Ga0495642_0009484 Ga0495642_0009484_1716_2063 115
852 3300046528 Ga0495642_0080414 Ga0495642_0080414_70_417 115
853 3300046530 Ga0495654_0021791 Ga0495654_0021791_1434_1781 115
854 3300046535 Ga0495586_0116765 Ga0495586_0116765_1013_1360 115
855 3300046536 Ga0495587_0091901 Ga0495587_0091901_1039_1386 115
856 3300046539 Ga0495621_0052811 Ga0495621_0052811_124_471 115
857 3300046542 Ga0495597_0026676 Ga0495597_0026676_1778_2125 115
858 3300046543 Ga0495645_0154713 Ga0495645_0154713_74_421 115
859 3300046557 Ga0495622_0084598 Ga0495622_0084598_86_433 115
860 3300046558 Ga0495633_0036382 Ga0495633_0036382_349_696 115
861 3300046559 Ga0495667_0156455 Ga0495667_0156455_1035_1382 115
862 3300046615 Ga0495656_0077409 Ga0495656_0077409_125_472 115
863 3300046616 Ga0495668_0022302 Ga0495668_0022302_2322_2669 115
864 3300046642 Ga0495634_0152876 Ga0495634_0152876_165_512 115
865 3300046648 Ga0495611_0077193 Ga0495611_0077193_1059_1406 115
866 3300046660 Ga0495625_0167084 Ga0495625_0167084_1036_1383 115
867 3300046663 Ga0495635_0168769 Ga0495635_0168769_127_474 115
868 3300046665 Ga0495661_0131410 Ga0495661_0131410_73_420 115
869 3300046665 Ga0495661_0146315 Ga0495661_0146315_682_1029 115
870 3300046674 Ga0495588_0122191 Ga0495588_0122191_955_1302 115
871 3300046675 Ga0495657_0136248 Ga0495657_0136248_136_483 115
872 3300046679 Ga0495623_0152717 Ga0495623_0152717_75_422 115
873 3300046680 Ga0495646_0123302 Ga0495646_0123302_1041_1388 115
874 3300046683 Ga0495658_0291352 Ga0495658_0291352_152_499 115
875 3300046684 Ga0495669_0015473 Ga0495669_0015473_1772_2119 115
876 3300046684 Ga0495669_0082671 Ga0495669_0082671_176_523 115
877 3300046689 Ga0495613_0119897 Ga0495613_0119897_483_830 115
878 3300046690 Ga0495624_0091514 Ga0495624_0091514_994_1341 115
879 3300046691 Ga0495670_0111560 Ga0495670_0111560_125_472 115
880 3300046691 Ga0495670_0498140 Ga0495670_0498140_42_389 115
881 3300046692 Ga0495671_0095388 Ga0495671_0095388_138_485 115
882 3300046692 Ga0495671_0111397 Ga0495671_0111397_192_539 115
883 3300046692 Ga0495671_0576274 Ga0495671_0576274_28_375 115
884 3300046694 Ga0495649_0033028 Ga0495649_0033028_947_1294 115
885 3300046694 Ga0495649_0104453 Ga0495649_0104453_978_1325 115
886 3300046694 Ga0495649_0133819 Ga0495649_0133819_768_1115 115
887 3300046794 Ga0495589_0022625 Ga0495589_0022625_1817_2164 115
888 3300046794 Ga0495589_0092126 Ga0495589_0092126_127_474 115
889 3300046809 Ga0495600_0152695 Ga0495600_0152695_68_415 115
890 3300046810 Ga0495660_0035507 Ga0495660_0035507_957_1304 115
891 3300046810 Ga0495660_0114475 Ga0495660_0114475_863_1210 115
892 3300047315 Ga0495581_0081423 Ga0495581_0081423_176_523 115
893 3300047317 Ga0495604_0328128 Ga0495604_0328128_184_531 115
894 3300047319 Ga0495674_0044862 Ga0495674_0044862_975_1322 115
895 3300047319 Ga0495674_0331699 Ga0495674_0331699_714_1061 115
896 3300047320 Ga0495672_0039428 Ga0495672_0039428_950_1297 115
897 3300047321 Ga0495676_0187563 Ga0495676_0187563_1020_1367 115
898 3300047322 Ga0495680_0217714 Ga0495680_0217714_76_423 115
899 3300047323 Ga0495683_0044650 Ga0495683_0044650_1589_1936 115
900 3300047323 Ga0495683_0069302 Ga0495683_0069302_505_852 115
901 3300047323 Ga0495683_0084127 Ga0495683_0084127_189_536 115
902 3300047443 Ga0495687_020732 Ga0495687_020732_1641_1988 115
903 3300047444 Ga0495675_0159693 Ga0495675_0159693_90_437 115
904 3300047446 Ga0495679_000074 Ga0495679_000074_41709_42056 115
905 3300047446 Ga0495679_028694 Ga0495679_028694_121_468 115
906 3300047447 Ga0495685_044742 Ga0495685_044742_132_479 115
907 3300047469 Ga0495673_0005854 Ga0495673_0005854_779_1126 115
908 3300047469 Ga0495673_0020105 Ga0495673_0020105_1345_1692 115
909 3300047470 Ga0495681_0077406 Ga0495681_0077406_1011_1358 115
910 3300047471 Ga0495684_0195463 Ga0495684_0195463_162_509 115
911 3300047472 Ga0495686_0460773 Ga0495686_0460773_94_441 115
912 3300047673 Ga0495593_0114613 Ga0495593_0114613_67_414 115
913 3300047673 Ga0495593_0174866 Ga0495593_0174866_632_979 115
914 3300048088 Ga0495602_0200463 Ga0495602_0200463_1024_1371 115
915 3300048088 Ga0495602_0604770 Ga0495602_0604770_161_508 115
916 3300048089 Ga0495614_0078827 Ga0495614_0078827_959_1306 115
917 3300048091 Ga0495626_0073016 Ga0495626_0073016_1093_1440 115
918 3300048091 Ga0495626_0097608 Ga0495626_0097608_67_414 115
919 3300048903 Ga0496100_0027437 Ga0496100_0027437_2206_2553 115
920 3300048903 Ga0496100_0173287 Ga0496100_0173287_1039_1386 115
921 3300048904 Ga0496101_0027851 Ga0496101_0027851_2565_2912 115
922 3300048904 Ga0496101_0229806 Ga0496101_0229806_1017_1364 115
923 3300048905 Ga0496102_0060368 Ga0496102_0060368_2169_2516 115
924 3300048905 Ga0496102_0263907 Ga0496102_0263907_1017_1364 115
925 3300048906 Ga0496103_0040556 Ga0496103_0040556_1564_1911 115
926 3300048906 Ga0496103_0143965 Ga0496103_0143965_1033_1380 115
927 3300048907 Ga0496104_0035316 Ga0496104_0035316_2420_2767 115
928 3300048907 Ga0496104_0039757 Ga0496104_0039757_979_1326 115
929 3300048907 Ga0496104_0333967 Ga0496104_0333967_1010_1357 115
930 3300048908 Ga0496105_0009047 Ga0496105_0009047_6866_7213 115
931 3300048908 Ga0496105_0083287 Ga0496105_0083287_2003_2350 115
932 3300048908 Ga0496105_0219080 Ga0496105_0219080_1048_1395 115
933 3300048909 Ga0496106_0061709 Ga0496106_0061709_958_1305 115
934 3300048909 Ga0496106_0266342 Ga0496106_0266342_949_1296 115
935 3300048910 Ga0496107_0030529 Ga0496107_0030529_1948_2295 115
936 3300048910 Ga0496107_0213913 Ga0496107_0213913_121_468 115
937 3300048911 Ga0496108_0067635 Ga0496108_0067635_1595_1942 115
938 3300048911 Ga0496108_0260709 Ga0496108_0260709_141_488 115
939 3300048912 Ga0496109_0064488 Ga0496109_0064488_1445_1792 115
940 3300048912 Ga0496109_0273600 Ga0496109_0273600_1033_1380 115
941 3300048913 Ga0496110_0050639 Ga0496110_0050639_939_1286 115
942 3300048913 Ga0496110_0242669 Ga0496110_0242669_1145_1492 115
943 3300048914 Ga0496111_0009138 Ga0496111_0009138_948_1295 115
944 3300048914 Ga0496111_0097031 Ga0496111_0097031_727_1074 115
945 3300048915 Ga0496112_0014694 Ga0496112_0014694_1561_1908 115
946 3300048916 Ga0496113_0023826 Ga0496113_0023826_1548_1895 115
947 3300048917 Ga0496114_0279570 Ga0496114_0279570_75_422 115
948 3300048917 Ga0496114_0764264 Ga0496114_0764264_329_676 115
949 3300048918 Ga0496115_0037264 Ga0496115_0037264_1516_1863 115
950 3300048918 Ga0496115_0037513 Ga0496115_0037513_1050_1397 115
951 3300048919 Ga0496116_0068885 Ga0496116_0068885_293_640 115
952 3300048920 Ga0496117_0045834 Ga0496117_0045834_2102_2449 115
953 3300048920 Ga0496117_0051367 Ga0496117_0051367_989_1336 115
954 3300048921 Ga0496118_0010561 Ga0496118_0010561_5665_6012 115
955 3300048921 Ga0496118_0050708 Ga0496118_0050708_1290_1637 115
956 3300048922 Ga0496119_0054130 Ga0496119_0054130_1539_1886 115
957 3300048922 Ga0496119_0122388 Ga0496119_0122388_985_1332 115
958 3300048923 Ga0496120_0038699 Ga0496120_0038699_1370_1717 115
959 3300048923 Ga0496120_0103875 Ga0496120_0103875_159_506 115
960 3300048924 Ga0496121_0076188 Ga0496121_0076188_2255_2602 115
961 3300048924 Ga0496121_0080032 Ga0496121_0080032_74_421 115
962 3300048924 Ga0496121_0183574 Ga0496121_0183574_1036_1383 115
963 3300048925 Ga0496122_0053435 Ga0496122_0053435_1153_1500 115
964 3300048926 Ga0496123_0048281 Ga0496123_0048281_970_1317 115
965 3300048927 Ga0496124_0647837 Ga0496124_0647837_158_505 115
966 3300048928 Ga0496125_0062775 Ga0496125_0062775_955_1302 115
967 3300048929 Ga0496126_0261655 Ga0496126_0261655_1029_1376 115
968 3300049459 Ga0495678_015939 Ga0495678_015939_975_1322 115
969 3300049459 Ga0495678_167237 Ga0495678_167237_332_679 115
970 3300049460 Ga0495682_0004477 Ga0495682_0004477_1251_1598 115
971 3300049460 Ga0495682_0013582 Ga0495682_0013582_781_1128 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01527

HTH_Tnp_1

Transposase

17

100

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oct-assembly1.cif.gz_C crystal structure of the oct-1 pou domain bound to an octamer site: dna recognition with tethered dna-binding modules 0.7852 16 67
3f8m-assembly1.cif.gz_B crystal structure of phnf from mycobacterium smegmatis 0.7824 41 71
7sj3-assembly1.cif.gz_B structure of cdk4-cyclin d3 bound to abemaciclib 0.7769 23 63
2rn7-assembly1.cif.gz_A nmr solution structure of tnpe protein from shigella flexneri. northeast structural genomics target sfr125 0.7628 9 74
1l3l-assembly2.cif.gz_A crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna 0.7576 23 70
ID Description Score Start End Superfamily
af_P9WKH5_4_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9601 12 74 1.10.10.10
af_P9WKH5_4_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9051 12 74 1.10.10.10
af_P9WGW7_231_285_1.10.150.240 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.8126 20 72 1.10.150.240
1octC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7852 16 67 1.10.10.60
af_P9WGW7_231_285_1.10.150.240 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.7738 20 72 1.10.150.240
ID Description Score Start End GO Terms
AF-A0A4R4W4S8-F1-model_v4 IS3 family transposase 1.005 13 58
AF-A0A323UP75-F1-model_v4 IS3 family transposase 0.9842 18 98 GO:0003677
GO:0004803
GO:0006313
AF-A0A1I7M2Q8-F1-model_v4 Transposase 0.9827 20 115 GO:0003677
GO:0004803
GO:0006313
AF-U3PCE4-F1-model_v4 Transposase 0.9737 14 107 GO:0003677
GO:0004803
GO:0006313
AF-A0A5B8C2U2-F1-model_v4 Transposase 0.9714 11 105 GO:0003677
GO:0004803
GO:0006313

Feature Viewer

pLDDT pTM Quality
84.92 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map