F487077

General Info

Members Datasets Scaffolds Average Seq Length
969 532 905 321

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0040749|Ga0495643_0040749_504_1601
Length 365
Sequence MAMIDVGSAEARAPRDVALPSGPADERAPSAVPQREPGRHAPPPLLRDTLRSNLPPLGQLGPLVALVIACAVFSATTDRFFSGENFSLILQQVMVVGVIAIGQTLVILTAGIDLSCGMIMALGGIVMTSLAAELGLPASXAIVCGMAVTTLFGLMNGLLVTRIGLPPFIVTLGVYNIAFAATQLYSRAQTITDVPPLMVWLGNTFPLAGVSVAFGTVLLLLLYGVTWFCLRETAAGRHIYAVGNNPEAARLVGIPPERVLLGVYMLAGLSYGVASLLSVARTGVGDPNAGQTENLDAITAVVLGGTSLFGGRGAIFGSLIGAVVVGVLRNGLTLMGVSSVYQVLATGILVIAAVTVDQLSRRGVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
9 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
10 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
11 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
12 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
13 2643221570 Acidovorax sp. Root568 Isolate Unclassified
14 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
15 2643221596 Acidovorax sp. Root70 Isolate Unclassified
16 2643221609 Acidovorax sp. Root217 Isolate Unclassified
17 2643221611 Acidovorax sp. Root219 Isolate Unclassified
18 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
19 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
20 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
21 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
22 2643221652 Acidovorax sp. Root402 Isolate Unclassified
23 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
24 2643221658 Variovorax sp. Root411 Isolate Unclassified
25 2643221664 Massilia sp. Root418 Isolate Unclassified
26 2643221672 Variovorax sp. Root434 Isolate Unclassified
27 2643221683 Variovorax sp. Root473 Isolate Unclassified
28 2643221717 Acidovorax sp. Root267 Isolate Unclassified
29 2738541277 Variovorax sp. GV051 Isolate Unclassified
30 2738541280 Massilia sp. GV090 Isolate Unclassified
31 2738541300 Massilia sp. GV016 Isolate Unclassified
32 2738541307 Variovorax sp. GV008 Isolate Unclassified
33 2738543012 Acidovorax sp. CF301 Isolate Unclassified
34 2738543013 Variovorax sp. BT01 Isolate Unclassified
35 2738543018 Massilia sp. GV045 Isolate Unclassified
36 2738543019 Variovorax sp. GV040 Isolate Unclassified
37 2738543030 Massilia sp. GV097 Isolate Unclassified
38 2816332133 Acidovorax radicis 2721A Isolate Unclassified
39 2818991446 Variovorax sp. 1180 Isolate Unclassified
40 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
41 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
42 2842677519 Variovorax sp. R-72495 Isolate Unclassified
43 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
44 2885198086 Variovorax sp. 679 Isolate Unclassified
45 2885211737 Variovorax sp. 553 Isolate Unclassified
46 2899924645 Variovorax sp. 369 Isolate Unclassified
47 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
48 2904456579 Variovorax sp. 2002 Isolate Unclassified
49 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
50 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
51 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
52 2928037797 Variovorax sp. 1126 Isolate Unclassified
53 2928044640 Variovorax sp. 1128 Isolate Unclassified
54 2928051484 Variovorax sp. 1133 Isolate Unclassified
55 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
56 2928070936 Variovorax gossypii 1167 Isolate Unclassified
57 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
58 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
59 2929520902 Variovorax beijingensis 502 Isolate Unclassified
60 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
61 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
62 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
63 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
64 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
65 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
66 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
67 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
68 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
69 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
70 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
75 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
76 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
77 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
80 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
81 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
82 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
83 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
84 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
85 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
86 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
87 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
88 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
93 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
94 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
95 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
96 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
97 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
98 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
99 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
100 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
101 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
102 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
103 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
104 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
105 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
106 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
107 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
108 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
109 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
110 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
111 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
112 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
113 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
114 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
115 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
116 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
117 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
118 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
119 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
120 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
121 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
122 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
123 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
124 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
125 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
126 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
127 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
128 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
129 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
130 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
131 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
132 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
133 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
134 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
135 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
136 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
137 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
138 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
139 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
140 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
141 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
142 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
143 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
144 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
145 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
146 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
147 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
148 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
149 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
150 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
151 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
152 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
153 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
154 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
155 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
156 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
157 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
158 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
159 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
160 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
161 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
162 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
164 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
166 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
167 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
168 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
169 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
170 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
171 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
172 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
173 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
174 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
175 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
176 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
177 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
178 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
185 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
186 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
187 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
188 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
193 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
195 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
196 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
197 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
200 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
201 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
208 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
210 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
213 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
267 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
268 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
269 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
271 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
274 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
275 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
276 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
277 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
278 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
279 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
280 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
281 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
282 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
283 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
284 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
285 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
286 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
287 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
288 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
289 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
290 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
291 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
292 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
293 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
294 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
295 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
296 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
297 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
298 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
299 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
300 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
302 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
303 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
304 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
305 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
306 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
307 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
308 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
309 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
312 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
313 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
317 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
318 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
319 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
320 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
321 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
322 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
323 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
324 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
325 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
326 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
327 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
328 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
329 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
330 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
331 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
332 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
333 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
334 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
335 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
336 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
339 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
340 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
341 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
344 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
345 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
346 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
347 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
348 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
349 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
350 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
351 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
352 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
353 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
354 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
355 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
356 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
357 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
358 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
359 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
360 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
361 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
362 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
363 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
364 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
365 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
369 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
370 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
371 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
372 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
373 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
374 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
375 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
376 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
377 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
378 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
379 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
380 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
381 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
382 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
383 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
384 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
385 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
386 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
387 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
388 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
389 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
390 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
391 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
392 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
393 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
394 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
395 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
399 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
400 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
401 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
402 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
403 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
404 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
405 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
406 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
407 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
408 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
409 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
410 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
411 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
412 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
413 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
414 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
415 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
416 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
417 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
418 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
419 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
420 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
421 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
422 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
423 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
424 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
425 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
426 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
427 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
428 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
429 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
430 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
431 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
432 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
433 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
434 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
435 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
436 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
437 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
438 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
439 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
440 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
442 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
443 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
444 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
448 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
449 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
450 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
451 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
452 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
453 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
454 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
455 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
456 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
457 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
458 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
459 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
460 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
461 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
462 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
463 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
464 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
465 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
466 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
467 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
468 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
469 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
470 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
471 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
472 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
473 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
474 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
475 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
476 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
477 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
478 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
479 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
480 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
481 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
482 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
483 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
484 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
485 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
486 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
487 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
488 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
489 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
490 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
491 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
492 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
493 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
494 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
495 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
496 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
497 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
498 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
499 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
500 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
501 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
502 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
503 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
504 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
505 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.44
Metatranscriptomes 4.95
Isolates 6.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.81
Nodule 0.52
Rhizoplane 1.65
Rhizosphere 63.47
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1470696 2162886007 Bacteria 2119
2 JGI25156J39149_1003834 3300002705 Bacteria 4784
3 JGI25154J39366_1000722 3300002738 Bacteria 14934
4 JGI25154J39366_1003188 3300002738 Bacteria 3614
5 JGI25157J39369_1000018 3300002741 Bacteria 177410
6 JGI25150J39212_1009418 3300002774 Bacteria 1861
7 JGI25159J45721_1009411 3300002987 Bacteria 2580
8 JGI25153J46596_10009509 3300003215 Bacteria 4505
9 JGI25153J46596_10021360 3300003215 Bacteria 2415
10 rootL2_10009352 3300003322 Bacteria 1409
11 JGI25160J50197_1013586 3300003354 Bacteria 2768
12 JGI25161J50226_1003713 3300003374 Bacteria 3406
13 Ga0055539_1000283 3300003752 Bacteria 28988
14 Ga0055539_1001579 3300003752 Bacteria 4126
15 Ga0055533_1004794 3300003756 Bacteria 2334
16 Ga0055525_1000793 3300003759 Bacteria 9998
17 Ga0055535_1000824 3300003761 Bacteria 22261
18 Ga0055535_1009850 3300003761 Bacteria 1612
19 Ga0055542_1000004 3300003762 Bacteria 553532
20 Ga0055529_1000198 3300003763 Bacteria 81554
21 Ga0055526_1000867 3300003771 Bacteria 22551
22 Ga0055537_1000067 3300003773 Bacteria 75689
23 Ga0055524_1000097 3300003775 Bacteria 108145
24 Ga0055536_1002788 3300003781 Bacteria 9662
25 Ga0055536_1004581 3300003781 Bacteria 7014
26 Ga0055534_1000079 3300003784 Bacteria 75689
27 Ga0055534_1000343 3300003784 Bacteria 30091
28 Ga0055534_1009668 3300003784 Bacteria 2077
29 Ga0055528_1003321 3300003790 Bacteria 8152
30 Ga0055530_10001788 3300003791 Bacteria 14935
31 Ga0055530_10004712 3300003791 Bacteria 6900
32 Ga0055530_10024260 3300003791 Bacteria 1724
33 Ga0055540_1000023 3300003792 Bacteria 201131
34 Ga0055540_1001704 3300003792 Bacteria 12646
35 Ga0055540_1004292 3300003792 Bacteria 6506
36 Ga0055540_1005572 3300003792 Bacteria 5250
37 Ga0055531_10002097 3300003794 Bacteria 13692
38 Ga0055531_10012543 3300003794 Bacteria 3977
39 Ga0065165_1003246 3300005262 Bacteria 11779
40 Ga0065714_10040147 3300005288 Bacteria 1234
41 Ga0065704_10086689 3300005289 Bacteria 3094
42 Ga0070658_10007950 3300005327 Bacteria 8535
43 Ga0070658_10012665 3300005327 Bacteria 6764
44 Ga0070676_10001363 3300005328 Bacteria 12301
45 Ga0070676_10089141 3300005328 Bacteria 1886
46 Ga0070683_100015611 3300005329 Bacteria 6675
47 Ga0070683_100031088 3300005329 Bacteria 4851
48 Ga0070690_100007195 3300005330 Bacteria 6367
49 Ga0070670_100014490 3300005331 Bacteria 6769
50 Ga0070670_100021093 3300005331 Bacteria 5603
51 Ga0070670_100053119 3300005331 Bacteria 3479
52 Ga0068869_100010062 3300005334 Bacteria 6151
53 Ga0068869_100141312 3300005334 Bacteria 1859
54 Ga0070680_100031302 3300005336 Bacteria 4277
55 Ga0068868_100049768 3300005338 Bacteria 3289
56 Ga0068868_100241476 3300005338 Bacteria 1518
57 Ga0070689_100286232 3300005340 Bacteria 1368
58 Ga0070661_100023678 3300005344 Bacteria 4403
59 Ga0070661_100091951 3300005344 Bacteria 2247
60 Ga0070661_100109872 3300005344 Bacteria 2058
61 Ga0070668_100070023 3300005347 Bacteria 2730
62 Ga0070669_100007534 3300005353 Bacteria 7795
63 Ga0070675_100086136 3300005354 Bacteria 2625
64 Ga0070675_100105903 3300005354 Bacteria 2373
65 Ga0070671_100100643 3300005355 Bacteria 2425
66 Ga0070674_100189336 3300005356 Bacteria 1582
67 Ga0070673_100132327 3300005364 Bacteria 2095
68 Ga0070673_100242815 3300005364 Bacteria 1567
69 Ga0070659_100011700 3300005366 Bacteria 6495
70 Ga0070659_100052372 3300005366 Bacteria 3210
71 Ga0070659_100062881 3300005366 Bacteria 2935
72 Ga0070659_100239670 3300005366 Bacteria 1500
73 Ga0070667_100298656 3300005367 Bacteria 1450
74 Ga0070667_100354064 3300005367 Bacteria 1330
75 Ga0070667_100356138 3300005367 Bacteria 1326
76 Ga0070709_10007882 3300005434 Bacteria 5849
77 Ga0070714_100003435 3300005435 Bacteria 11801
78 Ga0070714_100034010 3300005435 Bacteria 4267
79 Ga0070713_100000095 3300005436 Bacteria 56677
80 Ga0070711_100100947 3300005439 Bacteria 2099
81 Ga0070708_100072291 3300005445 Bacteria 3107
82 Ga0070663_100048938 3300005455 Bacteria 2999
83 Ga0070663_100387349 3300005455 Bacteria 1140
84 Ga0070678_100148582 3300005456 Bacteria 1885
85 Ga0070662_100033486 3300005457 Bacteria 3618
86 Ga0070662_100137020 3300005457 Bacteria 1893
87 Ga0070662_100179872 3300005457 Bacteria 1666
88 Ga0070681_10000303 3300005458 Bacteria 40005
89 Ga0070681_10004398 3300005458 Bacteria 13426
90 Ga0070681_10013414 3300005458 Bacteria 8140
91 Ga0068867_100000977 3300005459 Bacteria 19533
92 Ga0068867_100005245 3300005459 Bacteria 9150
93 Ga0068867_100032525 3300005459 Bacteria 3773
94 Ga0068867_100034907 3300005459 Bacteria 3646
95 Ga0068867_100035250 3300005459 Bacteria 3628
96 Ga0068867_100183981 3300005459 Bacteria 1663
97 Ga0068867_100211552 3300005459 Bacteria 1558
98 Ga0070706_100000271 3300005467 Bacteria 63046
99 Ga0070706_100034773 3300005467 Bacteria 4654
100 Ga0070699_100210728 3300005518 Bacteria 1730
101 Ga0070679_100005860 3300005530 Bacteria 11407
102 Ga0070679_100302474 3300005530 Bacteria 1550
103 Ga0070684_100036216 3300005535 Bacteria 4228
104 Ga0068853_100006049 3300005539 Bacteria 9574
105 Ga0068853_100080282 3300005539 Bacteria 2854
106 Ga0068853_100477803 3300005539 Bacteria 1175
107 Ga0070672_100051160 3300005543 Bacteria 3220
108 Ga0070665_100008237 3300005548 Bacteria 10552
109 Ga0070665_100358001 3300005548 Bacteria 1465
110 Ga0070665_100375118 3300005548 Bacteria 1430
111 Ga0068855_100094627 3300005563 Bacteria 3444
112 Ga0068855_100185307 3300005563 Bacteria 2351
113 Ga0068855_100317171 3300005563 Bacteria 1724
114 Ga0068857_100001214 3300005577 Bacteria 20079
115 Ga0068857_100006437 3300005577 Bacteria 10069
116 Ga0068857_100099511 3300005577 Bacteria 2608
117 Ga0068854_100005348 3300005578 Bacteria 8106
118 Ga0068854_100148676 3300005578 Bacteria 1804
119 Ga0068856_100003567 3300005614 Bacteria 15664
120 Ga0068852_100105652 3300005616 Bacteria 2551
121 Ga0068852_100157142 3300005616 Bacteria 2119
122 Ga0068864_100047704 3300005618 Bacteria 3680
123 Ga0068866_10056906 3300005718 Bacteria 2012
124 Ga0068866_10077782 3300005718 Bacteria 1773
125 Ga0068866_10156802 3300005718 Bacteria 1324
126 Ga0068861_100000211 3300005719 Bacteria 31401
127 Ga0068861_100025535 3300005719 Bacteria 4286
128 Ga0068861_100035272 3300005719 Bacteria 3704
129 Ga0068858_100194090 3300005842 Bacteria 1919
130 Ga0068860_100011496 3300005843 Bacteria 8722
131 Ga0068860_100403752 3300005843 Bacteria 1352
132 Ga0068862_100016907 3300005844 Bacteria 6072
133 Ga0068862_100104682 3300005844 Bacteria 2479
134 Ga0081539_10000075 3300005985 Bacteria 229419
135 Ga0070717_10002392 3300006028 Bacteria 13228
136 Ga0075365_10004368 3300006038 Bacteria 7476
137 Ga0075365_10013334 3300006038 Bacteria 4911
138 Ga0075368_10044444 3300006042 Bacteria 1752
139 Ga0075363_100023383 3300006048 Bacteria 3131
140 Ga0075363_100096383 3300006048 Bacteria 1633
141 Ga0075432_10012016 3300006058 Bacteria 2941
142 Ga0075432_10032309 3300006058 Bacteria 1814
143 Ga0070712_100032070 3300006175 Bacteria 3545
144 Ga0070712_100049948 3300006175 Bacteria 2907
145 Ga0075362_10003358 3300006177 Bacteria 5578
146 Ga0075362_10005491 3300006177 Bacteria 4645
147 Ga0075367_10002438 3300006178 Bacteria 8497
148 Ga0075367_10008290 3300006178 Bacteria 5381
149 Ga0075367_10009619 3300006178 Bacteria 5060
150 Ga0075367_10086935 3300006178 Bacteria 1898
151 Ga0075369_10003839 3300006186 Bacteria 5512
152 Ga0075366_10000948 3300006195 Bacteria 14121
153 Ga0075366_10004653 3300006195 Bacteria 7375
154 Ga0075366_10010562 3300006195 Bacteria 5183
155 Ga0075366_10020320 3300006195 Bacteria 3851
156 Ga0075366_10033634 3300006195 Bacteria 3020
157 Ga0075366_10039574 3300006195 Bacteria 2787
158 Ga0075366_10054712 3300006195 Bacteria 2370
159 Ga0075366_10057471 3300006195 Bacteria 2312
160 Ga0075366_10085091 3300006195 Bacteria 1891
161 Ga0075366_10088309 3300006195 Bacteria 1856
162 Ga0075366_10121467 3300006195 Bacteria 1574
163 Ga0075366_10122064 3300006195 Bacteria 1570
164 Ga0075366_10127414 3300006195 Bacteria 1536
165 Ga0075370_10000290 3300006353 Bacteria 18016
166 Ga0075370_10001075 3300006353 Bacteria 11363
167 Ga0075370_10002994 3300006353 Bacteria 7951
168 Ga0075370_10006698 3300006353 Bacteria 5811
169 Ga0075370_10011438 3300006353 Bacteria 4663
170 Ga0075370_10019264 3300006353 Bacteria 3715
171 Ga0075370_10026684 3300006353 Bacteria 3201
172 Ga0075370_10029668 3300006353 Bacteria 3047
173 Ga0075370_10063639 3300006353 Bacteria 2103
174 Ga0075370_10116680 3300006353 Bacteria 1552
175 Ga0075370_10157805 3300006353 Bacteria 1331
176 Ga0075428_100002488 3300006844 Bacteria 20004
177 Ga0075430_100006277 3300006846 Bacteria 10026
178 Ga0075430_100065543 3300006846 Bacteria 3051
179 Ga0075430_100109222 3300006846 Bacteria 2307
180 Ga0075431_100131077 3300006847 Bacteria 2586
181 Ga0075431_100165885 3300006847 Bacteria 2270
182 Ga0075431_100266053 3300006847 Bacteria 1739
183 Ga0075431_100348437 3300006847 Bacteria 1489
184 Ga0075433_10220881 3300006852 Bacteria 1683
185 Ga0075434_100032262 3300006871 Bacteria 5165
186 Ga0075434_100033517 3300006871 Bacteria 5069
187 Ga0075434_100444152 3300006871 Bacteria 1318
188 Ga0068865_100007809 3300006881 Bacteria 6600
189 Ga0097620_100180508 3300006931 Bacteria 2194
190 Ga0079104_1000019 3300006946 Bacteria 269313
191 Ga0099826_10004066 3300006948 Bacteria 10156
192 Ga0105244_10010743 3300009036 Bacteria 5532
193 Ga0105240_10076507 3300009093 Bacteria 4125
194 Ga0105240_10103006 3300009093 Bacteria 3468
195 Ga0105240_10121219 3300009093 Bacteria 3148
196 Ga0105240_10253336 3300009093 Bacteria 2035
197 Ga0111539_10001762 3300009094 Bacteria 28733
198 Ga0111539_10017244 3300009094 Bacteria 8936
199 Ga0111539_10069633 3300009094 Bacteria 4154
200 Ga0111539_10512335 3300009094 Bacteria 1397
201 Ga0105245_10045264 3300009098 Bacteria 3930
202 Ga0105245_10157789 3300009098 Bacteria 2150
203 Ga0114129_10004723 3300009147 Bacteria 19238
204 Ga0114129_10019439 3300009147 Bacteria 9671
205 Ga0114129_10487943 3300009147 Bacteria 1611
206 Ga0105243_10002076 3300009148 Bacteria 16970
207 Ga0105243_10006737 3300009148 Bacteria 8865
208 Ga0105243_10009662 3300009148 Bacteria 7343
209 Ga0105243_10121097 3300009148 Bacteria 2206
210 Ga0105243_10195138 3300009148 Bacteria 1771
211 Ga0105243_10347991 3300009148 Bacteria 1360
212 Ga0105242_10308119 3300009176 Bacteria 1448
213 Ga0105248_10200708 3300009177 Bacteria 2247
214 Ga0105237_10005095 3300009545 Bacteria 14917
215 Ga0105237_10023570 3300009545 Bacteria 6304
216 Ga0105237_10055804 3300009545 Bacteria 3956
217 Ga0105237_10066624 3300009545 Bacteria 3596
218 Ga0105238_10014551 3300009551 Bacteria 7957
219 Ga0105238_10099150 3300009551 Bacteria 2897
220 Ga0105249_10011730 3300009553 Bacteria 7704
221 Ga0105239_10000486 3300010375 Bacteria 57901
222 Ga0105239_10013045 3300010375 Bacteria 9236
223 Ga0105239_10051926 3300010375 Bacteria 4494
224 Ga0105239_10079743 3300010375 Bacteria 3602
225 Ga0105239_10084230 3300010375 Bacteria 3501
226 Ga0105246_10089846 3300011119 Bacteria 2211
227 Ga0157373_10060247 3300013100 Bacteria 2689
228 Ga0157371_10060094 3300013102 Bacteria 2695
229 Ga0157370_10004176 3300013104 Bacteria 16711
230 Ga0157369_10034136 3300013105 Bacteria 5585
231 Ga0157369_10034289 3300013105 Bacteria 5572
232 Ga0157369_10035474 3300013105 Bacteria 5468
233 Ga0157374_10204836 3300013296 Bacteria 1933
234 Ga0157374_10268902 3300013296 Bacteria 1680
235 Ga0157378_10329232 3300013297 Bacteria 1486
236 Ga0163162_10009563 3300013306 Bacteria 9433
237 Ga0163162_10017102 3300013306 Bacteria 7095
238 Ga0163162_10056229 3300013306 Bacteria 3963
239 Ga0163162_10151799 3300013306 Bacteria 2435
240 Ga0157372_10192952 3300013307 Bacteria 2359
241 Ga0157375_10009170 3300013308 Bacteria 8672
242 Ga0157375_10077110 3300013308 Bacteria 3362
243 Ga0163163_10047736 3300014325 Bacteria 4209
244 Ga0182008_10010702 3300014497 Bacteria 4904
245 Ga0157377_10000098 3300014745 Bacteria 62330
246 Ga0157377_10014560 3300014745 Bacteria 4003
247 Ga0157379_10032824 3300014968 Bacteria 4629
248 Ga0157379_10156368 3300014968 Bacteria 2057
249 Ga0182006_1001700 3300015261 Bacteria 12853
250 Ga0163161_10000069 3300017792 Bacteria 103861
251 Ga0163161_10040838 3300017792 Bacteria 3332
252 Ga0163161_10155040 3300017792 Bacteria 1743
253 Ga0209674_100003 3300025226 Bacteria 2196646
254 Ga0209672_101260 3300025228 Bacteria 10050
255 Ga0209147_101692 3300025229 Bacteria 7201
256 Ga0209563_100141 3300025230 Bacteria 79513
257 Ga0207427_100546 3300025231 Bacteria 19253
258 Ga0209258_100022 3300025242 Bacteria 553584
259 Ga0209258_100044 3300025242 Bacteria 376336
260 Ga0209258_100895 3300025242 Bacteria 15468
261 Ga0207425_1000454 3300025245 Bacteria 26617
262 Ga0209646_1000010 3300025246 Bacteria 573803
263 Ga0209646_1000067 3300025246 Bacteria 241595
264 Ga0209026_1000033 3300025250 Bacteria 318512
265 Ga0209677_100133 3300025253 Bacteria 69526
266 Ga0209677_100196 3300025253 Bacteria 48682
267 Ga0209677_101707 3300025253 Bacteria 9139
268 Ga0209148_1000034 3300025254 Bacteria 553584
269 Ga0209148_1007575 3300025254 Bacteria 2243
270 Ga0209759_1000024 3300025256 Bacteria 318512
271 Ga0209759_1001188 3300025256 Bacteria 16333
272 Ga0209759_1007638 3300025256 Bacteria 3454
273 Ga0209759_1010820 3300025256 Bacteria 2641
274 Ga0209129_1000119 3300025258 Bacteria 138904
275 Ga0209129_1002491 3300025258 Bacteria 8980
276 Ga0209129_1013750 3300025258 Bacteria 1763
277 Ga0209565_1000146 3300025263 Bacteria 97720
278 Ga0209565_1000294 3300025263 Bacteria 47770
279 Ga0209565_1009636 3300025263 Bacteria 2435
280 Ga0209455_1000048 3300025272 Bacteria 376260
281 Ga0209673_1000701 3300025273 Bacteria 47545
282 Ga0209673_1000860 3300025273 Bacteria 39448
283 Ga0209673_1001758 3300025273 Bacteria 18056
284 Ga0209130_1002114 3300025284 Bacteria 10573
285 Ga0209675_1000024 3300025291 Bacteria 312615
286 Ga0209675_1000765 3300025291 Bacteria 21581
287 Ga0209675_1001622 3300025291 Bacteria 12638
288 Ga0209675_1005663 3300025291 Bacteria 5163
289 Ga0209676_1000005 3300025292 Bacteria 1076001
290 Ga0209676_1000434 3300025292 Bacteria 72286
291 Ga0209676_1001176 3300025292 Bacteria 28320
292 Ga0209676_1003444 3300025292 Bacteria 9733
293 Ga0209025_1000116 3300025294 Bacteria 218293
294 Ga0209025_1000394 3300025294 Bacteria 90347
295 Ga0209025_1001285 3300025294 Bacteria 34421
296 Ga0209025_1039755 3300025294 Bacteria 2047
297 Ga0209025_1076451 3300025294 Bacteria 1160
298 Ga0209564_1000024 3300025295 Bacteria 535041
299 Ga0209564_1000155 3300025295 Bacteria 165859
300 Ga0209564_1000292 3300025295 Bacteria 101735
301 Ga0209758_1000107 3300025297 Bacteria 218293
302 Ga0209758_1000194 3300025297 Bacteria 134196
303 Ga0209758_1000572 3300025297 Bacteria 57723
304 Ga0209050_1000007 3300025298 Bacteria 1187891
305 Ga0209050_1000378 3300025298 Bacteria 83974
306 Ga0209050_1000489 3300025298 Bacteria 68506
307 Ga0209050_1002520 3300025298 Bacteria 15407
308 Ga0209256_1000038 3300025299 Bacteria 375225
309 Ga0209256_1000051 3300025299 Bacteria 307241
310 Ga0209256_1000087 3300025299 Bacteria 218290
311 Ga0209256_1021719 3300025299 Bacteria 1962
312 Ga0207426_1000123 3300025302 Bacteria 218290
313 Ga0207426_1000176 3300025302 Bacteria 159819
314 Ga0209051_1000009 3300025303 Bacteria 706778
315 Ga0209051_1000079 3300025303 Bacteria 201183
316 Ga0209051_1000174 3300025303 Bacteria 116896
317 Ga0209051_1000262 3300025303 Bacteria 87898
318 Ga0209051_1000808 3300025303 Bacteria 32707
319 Ga0209051_1001248 3300025303 Bacteria 22770
320 Ga0209051_1007547 3300025303 Bacteria 5926
321 Ga0209051_1016576 3300025303 Bacteria 3327
322 Ga0209257_1000011 3300025304 Bacteria 1112630
323 Ga0209257_1000139 3300025304 Bacteria 202285
324 Ga0209257_1000183 3300025304 Bacteria 156618
325 Ga0209257_1010519 3300025304 Bacteria 4664
326 Ga0207697_10005258 3300025315 Bacteria 6034
327 Ga0207655_1001900 3300025728 Bacteria 17918
328 Ga0207692_10075906 3300025898 Bacteria 1784
329 Ga0207642_10099462 3300025899 Bacteria 1456
330 Ga0207642_10163533 3300025899 Bacteria 1197
331 Ga0207699_10001164 3300025906 Bacteria 12445
332 Ga0207645_10001218 3300025907 Bacteria 21216
333 Ga0207645_10006902 3300025907 Bacteria 8096
334 Ga0207705_10007480 3300025909 Bacteria 8031
335 Ga0207705_10033874 3300025909 Bacteria 3650
336 Ga0207705_10043255 3300025909 Bacteria 3235
337 Ga0207684_10022416 3300025910 Bacteria 5390
338 Ga0207684_10022867 3300025910 Bacteria 5338
339 Ga0207707_10017440 3300025912 Bacteria 6260
340 Ga0207695_10034076 3300025913 Bacteria 5544
341 Ga0207695_10184031 3300025913 Bacteria 2009
342 Ga0207695_10219618 3300025913 Bacteria 1808
343 Ga0207671_10036946 3300025914 Bacteria 3622
344 Ga0207671_10044758 3300025914 Bacteria 3273
345 Ga0207671_10238207 3300025914 Bacteria 1429
346 Ga0207693_10049312 3300025915 Bacteria 3307
347 Ga0207693_10096332 3300025915 Bacteria 2320
348 Ga0207663_10045480 3300025916 Bacteria 2701
349 Ga0207660_10057729 3300025917 Bacteria 2780
350 Ga0207662_10003468 3300025918 Bacteria 8121
351 Ga0207657_10057170 3300025919 Bacteria 3363
352 Ga0207652_10029606 3300025921 Bacteria 4581
353 Ga0207652_10255779 3300025921 Bacteria 1579
354 Ga0207694_10018463 3300025924 Bacteria 5272
355 Ga0207694_10145778 3300025924 Bacteria 1906
356 Ga0207650_10027819 3300025925 Bacteria 4050
357 Ga0207650_10169958 3300025925 Bacteria 1732
358 Ga0207659_10169739 3300025926 Bacteria 1720
359 Ga0207687_10067765 3300025927 Bacteria 2540
360 Ga0207687_10431595 3300025927 Bacteria 1089
361 Ga0207700_10029460 3300025928 Bacteria 3874
362 Ga0207664_10009748 3300025929 Bacteria 6755
363 Ga0207664_10014644 3300025929 Bacteria 5671
364 Ga0207644_10033476 3300025931 Bacteria 3591
365 Ga0207644_10341088 3300025931 Bacteria 1215
366 Ga0207690_10027761 3300025932 Bacteria 3580
367 Ga0207690_10300680 3300025932 Bacteria 1255
368 Ga0207706_10000333 3300025933 Bacteria 51195
369 Ga0207706_10021056 3300025933 Bacteria 5857
370 Ga0207706_10046814 3300025933 Bacteria 3828
371 Ga0207709_10000242 3300025935 Bacteria 67423
372 Ga0207709_10003704 3300025935 Bacteria 9000
373 Ga0207709_10015707 3300025935 Bacteria 4202
374 Ga0207709_10018244 3300025935 Bacteria 3926
375 Ga0207709_10232822 3300025935 Bacteria 1335
376 Ga0207670_10272540 3300025936 Bacteria 1316
377 Ga0207669_10057744 3300025937 Bacteria 2364
378 Ga0207669_10198293 3300025937 Bacteria 1455
379 Ga0207704_10068833 3300025938 Bacteria 2233
380 Ga0207704_10270041 3300025938 Bacteria 1287
381 Ga0207689_10004626 3300025942 Bacteria 12450
382 Ga0207689_10008711 3300025942 Bacteria 8830
383 Ga0207689_10037128 3300025942 Bacteria 4043
384 Ga0207661_10036941 3300025944 Bacteria 3816
385 Ga0207679_10015159 3300025945 Bacteria 5084
386 Ga0207667_10015058 3300025949 Bacteria 8796
387 Ga0207667_10022788 3300025949 Bacteria 6908
388 Ga0207667_10155762 3300025949 Bacteria 2351
389 Ga0207712_10122406 3300025961 Bacteria 1970
390 Ga0207668_10054701 3300025972 Bacteria 2771
391 Ga0207640_10029183 3300025981 Bacteria 3383
392 Ga0207640_10184987 3300025981 Bacteria 1566
393 Ga0207658_10060391 3300025986 Bacteria 2829
394 Ga0207658_10099972 3300025986 Bacteria 2270
395 Ga0207658_10230334 3300025986 Bacteria 1564
396 Ga0207677_10049757 3300026023 Bacteria 2830
397 Ga0207703_10054670 3300026035 Bacteria 3248
398 Ga0207639_10009566 3300026041 Bacteria 6691
399 Ga0207639_10011578 3300026041 Bacteria 6128
400 Ga0207639_10044289 3300026041 Bacteria 3346
401 Ga0207639_10058016 3300026041 Bacteria 2975
402 Ga0207639_10353905 3300026041 Bacteria 1312
403 Ga0207678_10105731 3300026067 Bacteria 2401
404 Ga0207678_10164151 3300026067 Bacteria 1897
405 Ga0207708_10044263 3300026075 Bacteria 3392
406 Ga0207702_10001078 3300026078 Bacteria 27950
407 Ga0207702_10062662 3300026078 Bacteria 3177
408 Ga0207641_10033648 3300026088 Bacteria 4258
409 Ga0207641_10102369 3300026088 Bacteria 2525
410 Ga0207648_10000614 3300026089 Bacteria 39971
411 Ga0207648_10001597 3300026089 Bacteria 24813
412 Ga0207648_10005261 3300026089 Bacteria 13061
413 Ga0207648_10019266 3300026089 Bacteria 6159
414 Ga0207648_10066755 3300026089 Bacteria 3137
415 Ga0207648_10108530 3300026089 Bacteria 2436
416 Ga0207648_10150071 3300026089 Bacteria 2056
417 Ga0207676_10101719 3300026095 Bacteria 2383
418 Ga0207674_10003592 3300026116 Bacteria 18911
419 Ga0207674_10003720 3300026116 Bacteria 18622
420 Ga0207674_10027625 3300026116 Bacteria 5999
421 Ga0207674_10041448 3300026116 Bacteria 4762
422 Ga0207674_10059264 3300026116 Bacteria 3875
423 Ga0207674_10148350 3300026116 Bacteria 2303
424 Ga0207674_10248806 3300026116 Bacteria 1724
425 Ga0207675_100004236 3300026118 Bacteria 13870
426 Ga0207675_100010073 3300026118 Bacteria 8863
427 Ga0207675_100064585 3300026118 Bacteria 3421
428 Ga0207683_10019535 3300026121 Bacteria 5787
429 Ga0207698_10096196 3300026142 Bacteria 2440
430 Ga0207698_10102407 3300026142 Bacteria 2377
431 Ga0207698_10266586 3300026142 Bacteria 1576
432 Ga0209281_1000160 3300027111 Bacteria 161071
433 Ga0209282_1002689 3300027666 Bacteria 10367
434 Ga0209813_10035431 3300027866 Bacteria 1495
435 Ga0209974_10000950 3300027876 Bacteria 10142
436 Ga0207428_10006795 3300027907 Bacteria 10493
437 Ga0268266_10008775 3300028379 Bacteria 8960
438 Ga0268266_10299413 3300028379 Bacteria 1500
439 Ga0268264_10013578 3300028381 Bacteria 6705
440 Ga0268264_10566654 3300028381 Bacteria 1116
441 Ga0265336_10000053 3300028666 Bacteria 113034
442 Ga0307517_10000918 3300028786 Bacteria 49925
443 Ga0307517_10042428 3300028786 Bacteria 4879
444 Ga0307517_10156830 3300028786 Bacteria 1541
445 Ga0307515_10000109 3300028794 Bacteria 195895
446 Ga0307515_10000180 3300028794 Bacteria 156173
447 Ga0307515_10001052 3300028794 Bacteria 63228
448 Ga0307515_10001755 3300028794 Bacteria 48316
449 Ga0307515_10008086 3300028794 Bacteria 20612
450 Ga0307515_10028385 3300028794 Bacteria 9513
451 Ga0307515_10036146 3300028794 Bacteria 8004
452 Ga0307515_10115941 3300028794 Bacteria 3080
453 Ga0307515_10231632 3300028794 Bacteria 1638
454 Ga0265338_10040752 3300028800 Bacteria 4357
455 Ga0265324_10001024 3300029957 Bacteria 17194
456 Ga0265324_10024174 3300029957 Bacteria 2160
457 Ga0307512_10011673 3300030522 Bacteria 8309
458 Ga0307512_10039143 3300030522 Bacteria 3976
459 Ga0307512_10049067 3300030522 Bacteria 3408
460 Ga0307512_10093899 3300030522 Bacteria 2073
461 Ga0307512_10137097 3300030522 Bacteria 1511
462 Ga0316177_1082843 3300030731 Bacteria 2584
463 Ga0316178_1038078 3300030735 Bacteria 3324
464 Ga0316182_1251449 3300030745 Bacteria 2171
465 Ga0265327_10000108 3300031251 Bacteria 183209
466 Ga0307513_10000004 3300031456 Bacteria 558931
467 Ga0307513_10010428 3300031456 Bacteria 11648
468 Ga0307513_10020823 3300031456 Bacteria 7764
469 Ga0307513_10043585 3300031456 Bacteria 4925
470 Ga0307513_10368293 3300031456 Bacteria 1180
471 Ga0307509_10000509 3300031507 Bacteria 66233
472 Ga0307509_10011291 3300031507 Bacteria 10833
473 Ga0307509_10240228 3300031507 Bacteria 1605
474 Ga0307408_100000486 3300031548 Bacteria 34736
475 Ga0307408_100002069 3300031548 Bacteria 14442
476 Ga0307408_100015362 3300031548 Bacteria 5096
477 Ga0307408_100030077 3300031548 Bacteria 3769
478 Ga0307408_100074954 3300031548 Bacteria 2512
479 Ga0307408_100213304 3300031548 Bacteria 1570
480 Ga0307508_10000099 3300031616 Bacteria 102389
481 Ga0307508_10000237 3300031616 Bacteria 67014
482 Ga0307508_10005913 3300031616 Bacteria 11546
483 Ga0307508_10029594 3300031616 Bacteria 4950
484 Ga0307508_10282134 3300031616 Bacteria 1254
485 Ga0307514_10001936 3300031649 Bacteria 22633
486 Ga0307514_10004431 3300031649 Bacteria 12924
487 Ga0307514_10014300 3300031649 Bacteria 6573
488 Ga0307514_10070423 3300031649 Bacteria 2626
489 Ga0307516_10000488 3300031730 Bacteria 52667
490 Ga0307516_10008370 3300031730 Bacteria 11720
491 Ga0307516_10024759 3300031730 Bacteria 6126
492 Ga0307516_10033702 3300031730 Bacteria 5153
493 Ga0307516_10034231 3300031730 Bacteria 5107
494 Ga0307516_10081209 3300031730 Bacteria 3085
495 Ga0307405_10077442 3300031731 Bacteria 2161
496 Ga0307405_10203994 3300031731 Bacteria 1438
497 Ga0307405_10428207 3300031731 Bacteria 1043
498 Ga0307413_10094015 3300031824 Bacteria 1961
499 Ga0307410_10038930 3300031852 Bacteria 3118
500 Ga0307406_10002798 3300031901 Bacteria 9517
501 Ga0307406_10010897 3300031901 Bacteria 5141
502 Ga0307406_10057634 3300031901 Bacteria 2492
503 Ga0307406_10135307 3300031901 Bacteria 1736
504 Ga0307406_10208775 3300031901 Bacteria 1443
505 Ga0307412_10019946 3300031911 Bacteria 4070
506 Ga0307412_10092388 3300031911 Bacteria 2120
507 Ga0307416_100009752 3300032002 Bacteria 6309
508 Ga0307416_100054803 3300032002 Bacteria 3207
509 Ga0307416_100093151 3300032002 Bacteria 2594
510 Ga0307414_10126122 3300032004 Bacteria 1978
511 Ga0307414_10141118 3300032004 Bacteria 1886
512 Ga0307411_10024459 3300032005 Bacteria 3601
513 Ga0307510_10000794 3300033180 Bacteria 32695
514 Ga0307510_10010876 3300033180 Bacteria 10812
515 Ga0307510_10031892 3300033180 Bacteria 5943
516 Ga0373934_0000172 3300035086 Bacteria 23693
517 Ga0373934_0004886 3300035086 Bacteria 4961
518 Ga0373944_0037891 3300035089 Bacteria 1479
519 Ga0373923_0001124 3300035111 Bacteria 7389
520 Ga0373939_0000028 3300035114 Bacteria 53215
521 Ga0373953_0001178 3300035117 Bacteria 7437
522 Ga0373956_0002530 3300035119 Bacteria 7446
523 Ga0373955_0002332 3300035172 Bacteria 8268
524 Ga0373931_0000156 3300035691 Bacteria 29608
525 Ga0373931_0034988 3300035691 Bacteria 2609
526 Ga0373931_0137602 3300035691 Bacteria 1411
527 Ga0373935_0132491 3300035692 Bacteria 1676
528 Ga0373935_0317886 3300035692 Bacteria 1104
529 Ga0373927_0012844 3300035695 Bacteria 5568
530 Ga0373933_0000064 3300035724 Bacteria 64360
531 Ga0373937_0000104 3300036401 Bacteria 80334
532 Ga0373937_0024629 3300036401 Bacteria 5430
533 Ga0373937_0084373 3300036401 Bacteria 2939
534 Ga0373937_0530986 3300036401 Bacteria 1118
535 Ga0373925_0003082 3300037068 Bacteria 13081
536 Ga0373925_0004860 3300037068 Bacteria 10116
537 Ga0395899_0011426 3300037312 Bacteria 6797
538 Ga0395899_0128066 3300037312 Bacteria 1815
539 Ga0395898_0006478 3300037466 Bacteria 12503
540 Ga0395905_0052544 3300037471 Bacteria 3814
541 Ga0395905_0150396 3300037471 Bacteria 2190
542 Ga0395901_0000336 3300038443 Bacteria 57518
543 Ga0395901_0085167 3300038443 Bacteria 3304
544 Ga0436365_0434710 3300039437 Bacteria 1386
545 Ga0439465_0040615 3300041413 Bacteria 1504
546 Ga0451793_1323104 3300041452 Bacteria 1726
547 Ga0451798_0379219 3300041458 Bacteria 1271
548 Ga0451800_0013398 3300041459 Bacteria 3545
549 Ga0451800_1405191 3300041459 Bacteria 1383
550 Ga0451807_1552671 3300041486 Bacteria 2684
551 Ga0451833_1197908 3300041491 Bacteria 1301
552 Ga0451843_0761211 3300041509 Bacteria 1184
553 Ga0451853_2325733 3300041512 Bacteria 1890
554 Ga0439449_0000640 3300042007 Bacteria 13147
555 Ga0439449_0095586 3300042007 Bacteria 1098
556 Ga0439450_018778 3300042008 Bacteria 1456
557 Ga0439455_0047312 3300042012 Bacteria 1116
558 Ga0450920_026091 3300042122 Bacteria 1139
559 Ga0439434_0025800 3300042435 Bacteria 1775
560 Ga0439434_0031881 3300042435 Bacteria 1603
561 Ga0450918_000247 3300042531 Bacteria 12331
562 Ga0451577_0008497 3300042876 Bacteria 9995
563 Ga0451577_0015851 3300042876 Bacteria 6993
564 Ga0451577_0222079 3300042876 Bacteria 1708
565 Ga0466969_0009071 3300044656 Bacteria 5272
566 Ga0466969_0016884 3300044656 Bacteria 3816
567 Ga0466972_0021366 3300044658 Bacteria 3227
568 Ga0453683_0006829 3300044673 Bacteria 7794
569 Ga0466965_0009202 3300044683 Bacteria 4588
570 Ga0466966_0022053 3300044684 Bacteria 4181
571 Ga0466966_0114046 3300044684 Bacteria 1664
572 Ga0466961_0006616 3300044693 Bacteria 7369
573 Ga0466961_0030906 3300044693 Bacteria 3441
574 Ga0466963_0272151 3300044694 Bacteria 1190
575 Ga0466964_0005747 3300044706 Bacteria 4618
576 Ga0453684_0006064 3300044712 Bacteria 23358
577 Ga0453684_0034636 3300044712 Bacteria 7003
578 Ga0453684_0078506 3300044712 Bacteria 4131
579 Ga0453684_0127382 3300044712 Bacteria 3062
580 Ga0466968_0029569 3300044735 Bacteria 2266
581 Ga0466970_0130052 3300044765 Bacteria 1382
582 Ga0466957_0143728 3300044842 Bacteria 1539
583 Ga0466960_0031545 3300044901 Bacteria 2447
584 Ga0466959_0026511 3300045049 Bacteria 4295
585 Ga0466959_0077185 3300045049 Bacteria 2404
586 Ga0451576_0004309 3300045051 Bacteria 18585
587 Ga0451576_0014933 3300045051 Bacteria 8626
588 Ga0451576_0101178 3300045051 Bacteria 2997
589 Ga0466967_0057233 3300045976 Bacteria 3441
590 Ga0495617_057934 3300046452 Bacteria 1284
591 Ga0495592_0000140 3300046454 Bacteria 63848
592 Ga0495592_0001845 3300046454 Bacteria 14904
593 Ga0495603_0005272 3300046455 Bacteria 7713
594 Ga0495590_0017553 3300046457 Bacteria 2574
595 Ga0495629_0020763 3300046459 Bacteria 4689
596 Ga0495629_0021712 3300046459 Bacteria 4580
597 Ga0495629_0099403 3300046459 Bacteria 2030
598 Ga0495638_0101805 3300046460 Bacteria 1717
599 Ga0495651_0000378 3300046462 Bacteria 34517
600 Ga0495651_0246324 3300046462 Bacteria 1223
601 Ga0495653_0000741 3300046463 Bacteria 24909
602 Ga0495650_0017321 3300046471 Bacteria 3615
603 Ga0495650_0038126 3300046471 Bacteria 2085
604 Ga0495580_0039704 3300046472 Bacteria 3367
605 Ga0495580_0108808 3300046472 Bacteria 1924
606 Ga0495605_0025774 3300046474 Bacteria 3061
607 Ga0495639_0008610 3300046475 Bacteria 4375
608 Ga0495584_0002297 3300046491 Bacteria 10905
609 Ga0495584_0038277 3300046491 Bacteria 2424
610 Ga0495585_0003905 3300046492 Bacteria 9889
611 Ga0495585_0010619 3300046492 Bacteria 5473
612 Ga0495585_0102361 3300046492 Bacteria 1530
613 Ga0495585_0131384 3300046492 Bacteria 1317
614 Ga0495594_0102820 3300046499 Bacteria 1608
615 Ga0495607_0014431 3300046501 Bacteria 5141
616 Ga0495607_0018499 3300046501 Bacteria 4442
617 Ga0495607_0059443 3300046501 Bacteria 2180
618 Ga0495583_0000008 3300046506 Bacteria 411092
619 Ga0495583_0000159 3300046506 Bacteria 113627
620 Ga0495583_0000185 3300046506 Bacteria 105958
621 Ga0495606_0003437 3300046507 Bacteria 16806
622 Ga0495608_0001892 3300046511 Bacteria 14988
623 Ga0495608_0169380 3300046511 Bacteria 1386
624 Ga0495610_0011182 3300046512 Bacteria 5505
625 Ga0495610_0026825 3300046512 Bacteria 3071
626 Ga0495610_0038554 3300046512 Bacteria 2425
627 Ga0495616_0001038 3300046513 Bacteria 19867
628 Ga0495616_0025389 3300046513 Bacteria 3166
629 Ga0495616_0091057 3300046513 Bacteria 1444
630 Ga0495620_0012100 3300046515 Bacteria 4476
631 Ga0495620_0033242 3300046515 Bacteria 2343
632 Ga0495628_0000925 3300046516 Bacteria 26902
633 Ga0495630_0004964 3300046517 Bacteria 9357
634 Ga0495631_0002040 3300046518 Bacteria 11762
635 Ga0495632_0005702 3300046519 Bacteria 8175
636 Ga0495632_0005966 3300046519 Bacteria 7935
637 Ga0495643_0040749 3300046522 Bacteria 2535
638 Ga0495643_0080464 3300046522 Bacteria 1696
639 Ga0495644_0000163 3300046523 Bacteria 31558
640 Ga0495644_0000657 3300046523 Bacteria 14478
641 Ga0495644_0002234 3300046523 Bacteria 7743
642 Ga0495648_0005067 3300046524 Bacteria 11059
643 Ga0495648_0132539 3300046524 Bacteria 1323
644 Ga0495652_0001978 3300046529 Bacteria 21813
645 Ga0495665_0000407 3300046531 Bacteria 21941
646 Ga0495587_0000504 3300046536 Bacteria 27268
647 Ga0495609_0001121 3300046538 Bacteria 18556
648 Ga0495621_0035232 3300046539 Bacteria 1733
649 Ga0495597_0002754 3300046542 Bacteria 10822
650 Ga0495597_0024694 3300046542 Bacteria 2772
651 Ga0495597_0045118 3300046542 Bacteria 1957
652 Ga0495645_0000702 3300046543 Bacteria 22941
653 Ga0495622_0040310 3300046557 Bacteria 2174
654 Ga0495622_0071822 3300046557 Bacteria 1597
655 Ga0495633_0012733 3300046558 Bacteria 4460
656 Ga0495667_0000295 3300046559 Bacteria 32117
657 Ga0495656_0037977 3300046615 Bacteria 1992
658 Ga0495668_0080386 3300046616 Bacteria 1789
659 Ga0495668_0111110 3300046616 Bacteria 1499
660 Ga0495611_0014136 3300046648 Bacteria 3406
661 Ga0495611_0018132 3300046648 Bacteria 3016
662 Ga0495611_0019535 3300046648 Bacteria 2910
663 Ga0495625_0000311 3300046660 Bacteria 74209
664 Ga0495625_0003763 3300046660 Bacteria 14734
665 Ga0495625_0004856 3300046660 Bacteria 12537
666 Ga0495625_0007125 3300046660 Bacteria 9822
667 Ga0495625_0075158 3300046660 Bacteria 2364
668 Ga0495635_0000027 3300046663 Bacteria 123782
669 Ga0495659_0000004 3300046664 Bacteria 143914
670 Ga0495659_0002446 3300046664 Bacteria 5990
671 Ga0495659_0010315 3300046664 Bacteria 2994
672 Ga0495661_0040181 3300046665 Bacteria 2903
673 Ga0495661_0122378 3300046665 Bacteria 1435
674 Ga0495588_0021641 3300046674 Bacteria 3171
675 Ga0495657_0001428 3300046675 Bacteria 20672
676 Ga0495599_0001223 3300046678 Bacteria 14557
677 Ga0495623_0001252 3300046679 Bacteria 17239
678 Ga0495646_0001274 3300046680 Bacteria 14825
679 Ga0495647_0017099 3300046681 Bacteria 2562
680 Ga0495658_0007628 3300046683 Bacteria 5362
681 Ga0495658_0013346 3300046683 Bacteria 4180
682 Ga0495658_0076979 3300046683 Bacteria 1950
683 Ga0495669_0014639 3300046684 Bacteria 3353
684 Ga0495613_0035304 3300046689 Bacteria 3711
685 Ga0495624_0037050 3300046690 Bacteria 3140
686 Ga0495670_0004151 3300046691 Bacteria 7100
687 Ga0495671_0000548 3300046692 Bacteria 28176
688 Ga0495671_0011372 3300046692 Bacteria 4900
689 Ga0495671_0016274 3300046692 Bacteria 3974
690 Ga0495671_0030601 3300046692 Bacteria 2755
691 Ga0495671_0043887 3300046692 Bacteria 2243
692 Ga0495671_0056373 3300046692 Bacteria 1945
693 Ga0495649_0001187 3300046694 Bacteria 20128
694 Ga0495649_0001310 3300046694 Bacteria 19011
695 Ga0495589_0008654 3300046794 Bacteria 5305
696 Ga0495589_0055703 3300046794 Bacteria 1948
697 Ga0495600_0000439 3300046809 Bacteria 21384
698 Ga0495660_0007860 3300046810 Bacteria 6263
699 Ga0495581_0074160 3300047315 Bacteria 1969
700 Ga0495604_0001033 3300047317 Bacteria 23218
701 Ga0495636_0000383 3300047318 Bacteria 16670
702 Ga0495636_0008721 3300047318 Bacteria 3998
703 Ga0495674_0012369 3300047319 Bacteria 8039
704 Ga0495672_0000045 3300047320 Bacteria 255145
705 Ga0495672_0000835 3300047320 Bacteria 32845
706 Ga0495672_0013305 3300047320 Bacteria 5683
707 Ga0495676_0012050 3300047321 Bacteria 7798
708 Ga0495676_0045103 3300047321 Bacteria 3592
709 Ga0495680_0010170 3300047322 Bacteria 8406
710 Ga0495687_000863 3300047443 Bacteria 32127
711 Ga0495687_001223 3300047443 Bacteria 24535
712 Ga0495687_003425 3300047443 Bacteria 11511
713 Ga0495677_0001387 3300047445 Bacteria 9691
714 Ga0495677_0053862 3300047445 Bacteria 1483
715 Ga0495685_000161 3300047447 Bacteria 22547
716 Ga0495684_0000116 3300047471 Bacteria 57957
717 Ga0495686_0001957 3300047472 Bacteria 20470
718 Ga0495593_0000111 3300047673 Bacteria 38262
719 Ga0495593_0100035 3300047673 Bacteria 1487
720 Ga0495602_0002782 3300048088 Bacteria 17882
721 Ga0495614_0000527 3300048089 Bacteria 15768
722 Ga0495614_0099981 3300048089 Bacteria 1266
723 Ga0495626_0015064 3300048091 Bacteria 3963
724 Ga0496104_0299627 3300048907 Bacteria 1520
725 Ga0496109_0079118 3300048912 Bacteria 3028
726 Ga0496109_0258128 3300048912 Bacteria 1641
727 Ga0496110_0295788 3300048913 Bacteria 1475
728 Ga0496112_0075923 3300048915 Bacteria 3324
729 Ga0496113_0172195 3300048916 Bacteria 1715
730 Ga0496114_0026911 3300048917 Bacteria 4711
731 Ga0496116_0034568 3300048919 Bacteria 3564
732 Ga0496117_0070292 3300048920 Bacteria 2352
733 Ga0496118_0005315 3300048921 Bacteria 14678
734 Ga0496118_0034971 3300048921 Bacteria 4089
735 Ga0496119_0142349 3300048922 Bacteria 1293
736 Ga0496120_0133240 3300048923 Bacteria 1270
737 Ga0496121_0007376 3300048924 Bacteria 13291
738 Ga0496123_0159495 3300048926 Bacteria 1204
739 Ga0496124_0008990 3300048927 Bacteria 10338
740 Ga0496124_0238352 3300048927 Bacteria 1355
741 Ga0496125_0071362 3300048928 Bacteria 2713
742 Ga0501304_000207 3300049160 Bacteria 2570
743 Ga0495678_002384 3300049459 Bacteria 12869
744 Ga0495678_008398 3300049459 Bacteria 5210
745 Ga0495682_0000206 3300049460 Bacteria 47410
746 Ga0495682_0000261 3300049460 Bacteria 41788
747 Ga0495682_0012369 3300049460 Bacteria 3272
748 Ga0501292_020890 3300049515 Bacteria 1058
749 Ga0501315_000768 3300049531 Bacteria 2411
750 Ga0501316_000316 3300049532 Bacteria 3112
751 Ga0501034_0153351 3300049571 Bacteria 2279
752 Ga0501202_006817 3300049652 Bacteria 2053
753 Ga0501216_015228 3300049660 Bacteria 1294
754 Ga0501253_010475 3300049683 Bacteria 1398
755 Ga0501225_0003407 3300049705 Bacteria 4824
756 Ga0501262_000459 3300049759 Bacteria 4848
757 Ga0501265_005330 3300049762 Bacteria 1480
758 Ga0501268_004451 3300049765 Bacteria 1976
759 nmdc:mga03683_9478_c1 3300050489 Bacteria 3465
760 nmdc:mga03683_986_c1 3300050489 Bacteria 8300
761 nmdc:mga03n38_165812_c1 3300050490 Bacteria 1122
762 nmdc:mga03n38_5724_c1 3300050490 Bacteria 4259
763 nmdc:mga00v17_2326_c1 3300050491 Bacteria 9735
764 nmdc:mga0yw44_149293_c1 3300050492 Bacteria 1524
765 nmdc:mga0yw44_3664_c1 3300050492 Bacteria 4118
766 nmdc:mga0k408_10561_c1 3300050493 Bacteria 4999
767 nmdc:mga0k408_110387_c1 3300050493 Bacteria 1626
768 nmdc:mga0k408_12245_c1 3300050493 Bacteria 4687
769 nmdc:mga0k408_13437_c1 3300050493 Bacteria 4491
770 nmdc:mga0k408_136611_c1 3300050493 Bacteria 1457
771 nmdc:mga0k408_140678_c1 3300050493 Bacteria 1436
772 nmdc:mga0k408_16255_c1 3300050493 Bacteria 4126
773 nmdc:mga0k408_16868_c1 3300050493 Bacteria 4060
774 nmdc:mga0k408_186836_c1 3300050493 Bacteria 1236
775 nmdc:mga0k408_2622_c1 3300050493 Bacteria 9558
776 nmdc:mga0k408_32057_c1 3300050493 Bacteria 3002
777 nmdc:mga0k408_4590_c1 3300050493 Bacteria 7327
778 nmdc:mga0k408_838_c1 3300050493 Bacteria 10969
779 nmdc:mga0k408_86703_c1 3300050493 Bacteria 1838
780 nmdc:mga06z11_101374_c1 3300050494 Bacteria 1580
781 nmdc:mga06z11_108257_c1 3300050494 Bacteria 1535
782 nmdc:mga06z11_18075_c1 3300050494 Bacteria 3213
783 nmdc:mga06z11_1988_c1 3300050494 Bacteria 7733
784 nmdc:mga06z11_21345_c1 3300050494 Bacteria 3008
785 nmdc:mga04h51_42134_c1 3300050495 Bacteria 1495
786 nmdc:mga07m45_1016_c1 3300050496 Bacteria 12398
787 nmdc:mga07m45_103_c1 3300050496 Bacteria 33229
788 nmdc:mga07m45_104970_c1 3300050496 Bacteria 1625
789 nmdc:mga07m45_131_c1 3300050496 Bacteria 29571
790 nmdc:mga07m45_174168_c1 3300050496 Bacteria 1251
791 nmdc:mga07m45_209191_c1 3300050496 Bacteria 1135
792 nmdc:mga07m45_308_c1 3300050496 Bacteria 19736
793 nmdc:mga07m45_33171_c1 3300050496 Bacteria 2867
794 nmdc:mga07m45_76134_c2 3300050496 Bacteria 1437
795 nmdc:mga07m45_82897_c1 3300050496 Bacteria 1832
796 nmdc:mga05p37_1081_c1 3300050507 Bacteria 31276
797 nmdc:mga05p37_198715_c1 3300050507 Bacteria 2430
798 nmdc:mga05p37_81063_c1 3300050507 Bacteria 3997
799 nmdc:mga09592_1109_c1 3300050508 Bacteria 21409
800 nmdc:mga09592_3150_c2 3300050508 Bacteria 3241
801 nmdc:mga0qj67_39179_c1 3300050509 Bacteria 3721
802 nmdc:mga06r32_195077_c1 3300050510 Bacteria 2012
803 nmdc:mga06r32_74060_c1 3300050510 Bacteria 3300
804 nmdc:mga08y16_73348_c1 3300050511 Bacteria 3566
805 nmdc:mga08y16_8989_c1 3300050511 Bacteria 10493
806 nmdc:mga0n895_295217_c1 3300050512 Bacteria 1643
807 nmdc:mga0n895_63730_c1 3300050512 Bacteria 3645
808 nmdc:mga0a205_123948_c1 3300050515 Bacteria 2484
809 nmdc:mga0sz30_22404_c1 3300050516 Bacteria 2564
810 Ga0500610_0001519 3300053079 Bacteria 7965
811 Ga0500610_0002412 3300053079 Bacteria 6875
812 Ga0500635_0000035 3300053080 Bacteria 94938
813 Ga0495595_0014662 3300053084 Bacteria 3329
814 Ga0495619_0020561 3300053085 Bacteria 4206
815 Ga0500578_0000057 3300053086 Bacteria 120178
816 Ga0500578_0000683 3300053086 Bacteria 40592
817 Ga0500651_0000133 3300053093 Bacteria 46244
818 Ga0500651_0094551 3300053093 Bacteria 1837
819 Ga0500641_0089510 3300053096 Bacteria 1313
820 Ga0500562_038556 3300053108 Bacteria 1269
821 Ga0500569_001196 3300053109 Bacteria 4817
822 Ga0500571_000153 3300053110 Bacteria 23909
823 Ga0500572_056981 3300053111 Bacteria 1179
824 Ga0500592_003544 3300053116 Bacteria 2490
825 Ga0500593_000449 3300053117 Bacteria 16281
826 Ga0500593_004327 3300053117 Bacteria 5490
827 Ga0500594_0000721 3300053118 Bacteria 7037
828 Ga0500594_0000823 3300053118 Bacteria 6610
829 Ga0500597_084989 3300053120 Bacteria 1373
830 Ga0500607_027526 3300053121 Bacteria 3153
831 Ga0500608_016018 3300053122 Bacteria 3379
832 Ga0500623_077352 3300053127 Bacteria 1593
833 Ga0500626_008205 3300053128 Bacteria 4287
834 Ga0500642_0001435 3300053130 Bacteria 6831
835 Ga0500642_0172302 3300053130 Bacteria 1013
836 Ga0500652_000112 3300053131 Bacteria 31738
837 Ga0500658_0000124 3300053134 Bacteria 36729
838 Ga0500658_0000342 3300053134 Bacteria 20710
839 Ga0500658_0001793 3300053134 Bacteria 8476
840 Ga0500559_0000027 3300053136 Bacteria 118758
841 Ga0500564_042638 3300053138 Bacteria 2086
842 Ga0500568_0001367 3300053139 Bacteria 15853
843 Ga0500574_021580 3300053141 Bacteria 1632
844 Ga0500577_0048705 3300053142 Bacteria 1581
845 Ga0500589_115363 3300053147 Bacteria 1146
846 Ga0500622_0000187 3300053156 Bacteria 65366
847 Ga0500622_0018677 3300053156 Bacteria 3684
848 Ga0500627_0000606 3300053158 Bacteria 9577
849 Ga0500627_0001918 3300053158 Bacteria 5974
850 Ga0500634_0001113 3300053161 Bacteria 9973
851 Ga0500634_0025886 3300053161 Bacteria 3193
852 Ga0500634_0123534 3300053161 Bacteria 1255
853 Ga0500638_003846 3300053162 Bacteria 5658
854 Ga0500636_0009012 3300053177 Bacteria 5796
855 Ga0500636_0010811 3300053177 Bacteria 5334
856 Ga0500637_0129145 3300053178 Bacteria 1466
857 Ga0500587_005473 3300053739 Bacteria 1706
858 Ga0587084_006029 3300059477 Bacteria 1457
859 Ga0587093_001079 3300059478 Bacteria 2183
860 Ga0587093_003533 3300059478 Bacteria 1540
861 Ga0587066_006337 3300059490 Bacteria 1558
862 Ga0587070_000447 3300059491 Bacteria 3401
863 Ga0587070_001146 3300059491 Bacteria 2637
864 Ga0587070_008806 3300059491 Bacteria 1441
865 Ga0587077_000158 3300059493 Bacteria 4484
866 Ga0587077_001244 3300059493 Bacteria 2667
867 Ga0587077_003034 3300059493 Bacteria 2072
868 Ga0587083_0000234 3300059505 Bacteria 4227
869 Ga0587083_0000943 3300059505 Bacteria 2998
870 Ga0587083_0007482 3300059505 Bacteria 1675
871 Ga0587085_000466 3300059506 Bacteria 3004
872 Ga0587090_000183 3300059510 Bacteria 4415
873 Ga0587090_007306 3300059510 Bacteria 1447
874 Ga0587091_000456 3300059511 Bacteria 3506
875 Ga0587092_000527 3300059512 Bacteria 3123
876 Ga0587094_002704 3300059513 Bacteria 1856
877 Ga0587094_003838 3300059513 Bacteria 1668
878 Ga0587101_000394 3300059623 Bacteria 3008
879 Ga0587101_000917 3300059623 Bacteria 2359
880 Ga0587101_001108 3300059623 Bacteria 2210
881 Ga0587115_005668 3300059626 Bacteria 1413
882 Ga0587062_000340 3300059639 Bacteria 3104
883 Ga0587068_000926 3300059641 Bacteria 3045
884 Ga0587068_001812 3300059641 Bacteria 2487
885 Ga0587068_002162 3300059641 Bacteria 2350
886 Ga0587069_001296 3300059642 Bacteria 2251
887 Ga0587075_000722 3300059644 Bacteria 2851
888 Ga0587076_000484 3300059645 Bacteria 3271
889 Ga0587076_001845 3300059645 Bacteria 2257
890 Ga0587078_000307 3300059646 Bacteria 3448
891 Ga0587078_002833 3300059646 Bacteria 1707
892 Ga0587079_002858 3300059647 Bacteria 2183
893 Ga0587079_007339 3300059647 Bacteria 1645
894 Ga0587100_000174 3300059648 Bacteria 2647
895 Ga0587102_000521 3300059649 Bacteria 2240
896 Ga0587118_00294 3300059657 Bacteria 2362
897 Ga0587119_000650 3300059658 Bacteria 2433
898 Ga0587124_000224 3300059660 Bacteria 2755
899 Ga0587071_000866 3300060344 Bacteria 3443
900 Ga0587111_0000401 3300060346 Bacteria 4017
901 Ga0587111_0000679 3300060346 Bacteria 3504
902 Ga0587111_0002077 3300060346 Bacteria 2592
903 Ga0466962_0012958 3300061719 Bacteria 4010
904 Ga0466962_0042044 3300061719 Bacteria 2187
905 Ga0466962_0053363 3300061719 Bacteria 1932

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100286232 Ga0070689_1002862322 256
2 3300005539 Ga0068853_100080282 Ga0068853_1000802821 256
3 3300025918 Ga0207662_10003468 Ga0207662_100034686 256
4 3300005347 Ga0070668_100070023 Ga0070668_1000700232 261
5 3300009177 Ga0105248_10200708 Ga0105248_102007082 261
6 3300014968 Ga0157379_10156368 Ga0157379_101563681 261
7 3300025933 Ga0207706_10000333 Ga0207706_1000033315 261
8 3300025938 Ga0207704_10270041 Ga0207704_102700412 261
9 3300025972 Ga0207668_10054701 Ga0207668_100547012 261
10 3300026023 Ga0207677_10049757 Ga0207677_100497573 261
11 3300026075 Ga0207708_10044263 Ga0207708_100442632 261
12 3300045051 Ga0451576_0101178 Ga0451576_0101178_319_1299 261
13 3300005336 Ga0070680_100031302 Ga0070680_1000313023 276
14 3300006847 Ga0075431_100131077 Ga0075431_1001310772 283
15 3300006852 Ga0075433_10220881 Ga0075433_102208812 283
16 3300006871 Ga0075434_100032262 Ga0075434_1000322623 283
17 3300050507 nmdc:mga05p37_198715_c1 nmdc:mga05p37_198715_c1_888_1865 283
18 3300050515 nmdc:mga0a205_123948_c1 nmdc:mga0a205_123948_c1_434_1411 283
19 3300005329 Ga0070683_100031088 Ga0070683_1000310883 287
20 3300005331 Ga0070670_100053119 Ga0070670_1000531193 287
21 3300005344 Ga0070661_100023678 Ga0070661_1000236783 287
22 3300005356 Ga0070674_100189336 Ga0070674_1001893362 287
23 3300005364 Ga0070673_100242815 Ga0070673_1002428152 287
24 3300005366 Ga0070659_100011700 Ga0070659_1000117003 287
25 3300005458 Ga0070681_10000303 Ga0070681_1000030334 287
26 3300005530 Ga0070679_100005860 Ga0070679_1000058603 287
27 3300005535 Ga0070684_100036216 Ga0070684_1000362162 287
28 3300005577 Ga0068857_100001214 Ga0068857_1000012145 287
29 3300025912 Ga0207707_10017440 Ga0207707_100174404 287
30 3300025917 Ga0207660_10057729 Ga0207660_100577293 287
31 3300025921 Ga0207652_10029606 Ga0207652_100296063 287
32 3300026116 Ga0207674_10003720 Ga0207674_100037207 287
33 3300026142 Ga0207698_10096196 Ga0207698_100961963 287
34 3300031824 Ga0307413_10094015 Ga0307413_100940152 287
35 3300031852 Ga0307410_10038930 Ga0307410_100389302 287
36 3300032004 Ga0307414_10126122 Ga0307414_101261222 287
37 3300046452 Ga0495617_057934 Ga0495617_057934_128_1168 287
38 3300002774 JGI25150J39212_1009418 JGI25150J39212_10094182 291
39 3300003215 JGI25153J46596_10009509 JGI25153J46596_100095092 291
40 3300003771 Ga0055526_1000867 Ga0055526_100086717 291
41 3300006178 Ga0075367_10086935 Ga0075367_100869352 291
42 3300006195 Ga0075366_10039574 Ga0075366_100395742 291
43 3300006353 Ga0075370_10019264 Ga0075370_100192643 291
44 3300025245 Ga0207425_1000454 Ga0207425_100045422 291
45 3300025258 Ga0209129_1000119 Ga0209129_100011944 291
46 3300025295 Ga0209564_1000024 Ga0209564_100002444 291
47 3300025297 Ga0209758_1000194 Ga0209758_1000194123 291
48 3300027866 Ga0209813_10035431 Ga0209813_100354312 291
49 3300050494 nmdc:mga06z11_101374_c1 nmdc:mga06z11_101374_c1_262_1215 291
50 3300050495 nmdc:mga04h51_42134_c1 nmdc:mga04h51_42134_c1_245_1198 291
51 3300025303 Ga0209051_1007547 Ga0209051_10075473 292
52 3300003215 JGI25153J46596_10021360 JGI25153J46596_100213602 294
53 3300025297 Ga0209758_1000572 Ga0209758_100057245 294
54 3300053108 Ga0500562_038556 Ga0500562_038556_153_1094 294
55 3300053147 Ga0500589_115363 Ga0500589_115363_197_1126 294
56 3300005329 Ga0070683_100015611 Ga0070683_1000156114 295
57 3300005331 Ga0070670_100021093 Ga0070670_1000210935 295
58 3300005344 Ga0070661_100091951 Ga0070661_1000919512 295
59 3300005366 Ga0070659_100062881 Ga0070659_1000628813 295
60 3300005844 Ga0068862_100104682 Ga0068862_1001046823 295
61 3300013105 Ga0157369_10035474 Ga0157369_100354742 295
62 3300014745 Ga0157377_10014560 Ga0157377_100145602 295
63 3300025942 Ga0207689_10004626 Ga0207689_100046266 295
64 3300025944 Ga0207661_10036941 Ga0207661_100369413 295
65 3300026041 Ga0207639_10044289 Ga0207639_100442892 295
66 3300026116 Ga0207674_10003592 Ga0207674_1000359218 295
67 3300041512 Ga0451853_2325733 Ga0451853_2325733_886_1845 296
68 3300005354 Ga0070675_100086136 Ga0070675_1000861363 297
69 3300005367 Ga0070667_100356138 Ga0070667_1003561382 297
70 3300005455 Ga0070663_100048938 Ga0070663_1000489383 297
71 3300005459 Ga0068867_100211552 Ga0068867_1002115522 297
72 3300005577 Ga0068857_100099511 Ga0068857_1000995112 297
73 3300006058 Ga0075432_10032309 Ga0075432_100323092 297
74 3300006177 Ga0075362_10003358 Ga0075362_100033583 297
75 3300006178 Ga0075367_10002438 Ga0075367_100024389 297
76 3300006353 Ga0075370_10006698 Ga0075370_100066986 297
77 3300009093 Ga0105240_10076507 Ga0105240_100765074 297
78 3300009545 Ga0105237_10023570 Ga0105237_100235702 297
79 3300010375 Ga0105239_10079743 Ga0105239_100797432 297
80 3300025913 Ga0207695_10034076 Ga0207695_100340764 297
81 3300026067 Ga0207678_10105731 Ga0207678_101057312 297
82 3300026116 Ga0207674_10248806 Ga0207674_102488062 297
83 3300026142 Ga0207698_10266586 Ga0207698_102665862 297
84 3300050494 nmdc:mga06z11_21345_c1 nmdc:mga06z11_21345_c1_1449_2411 297
85 3300005459 Ga0068867_100032525 Ga0068867_1000325252 298
86 3300025937 Ga0207669_10057744 Ga0207669_100577443 298
87 3300026089 Ga0207648_10066755 Ga0207648_100667554 298
88 3300046519 Ga0495632_0005966 Ga0495632_0005966_6773_7726 298
89 3300053127 Ga0500623_077352 Ga0500623_077352_460_1413 298
90 3300053156 Ga0500622_0000187 Ga0500622_0000187_11530_12483 298
91 3300031548 Ga0307408_100000486 Ga0307408_1000004865 299
92 3300031901 Ga0307406_10057634 Ga0307406_100576342 299
93 3300005328 Ga0070676_10089141 Ga0070676_100891412 300
94 3300005353 Ga0070669_100007534 Ga0070669_1000075343 300
95 3300005354 Ga0070675_100105903 Ga0070675_1001059033 300
96 3300005457 Ga0070662_100033486 Ga0070662_1000334863 300
97 3300005543 Ga0070672_100051160 Ga0070672_1000511602 300
98 3300005616 Ga0068852_100105652 Ga0068852_1001056522 300
99 3300005719 Ga0068861_100000211 Ga0068861_1000002115 300
100 3300006871 Ga0075434_100033517 Ga0075434_1000335173 300
101 3300010375 Ga0105239_10013045 Ga0105239_100130457 300
102 3300013306 Ga0163162_10017102 Ga0163162_100171023 300
103 3300025315 Ga0207697_10005258 Ga0207697_100052583 300
104 3300025907 Ga0207645_10006902 Ga0207645_100069027 300
105 3300026088 Ga0207641_10102369 Ga0207641_101023692 300
106 3300026118 Ga0207675_100010073 Ga0207675_1000100736 300
107 3300046542 Ga0495597_0024694 Ga0495597_0024694_610_1572 300
108 3300047443 Ga0495687_000863 Ga0495687_000863_4981_5943 300
109 3300050512 nmdc:mga0n895_63730_c1 nmdc:mga0n895_63730_c1_932_1912 300
110 3300005262 Ga0065165_1003246 Ga0065165_10032465 301
111 3300005718 Ga0068866_10056906 Ga0068866_100569062 301
112 3300009094 Ga0111539_10017244 Ga0111539_100172445 301
113 3300013297 Ga0157378_10329232 Ga0157378_103292322 301
114 3300025298 Ga0209050_1000489 Ga0209050_100048916 301
115 3300025303 Ga0209051_1016576 Ga0209051_10165762 301
116 3300025931 Ga0207644_10341088 Ga0207644_103410882 301
117 3300026089 Ga0207648_10108530 Ga0207648_101085302 301
118 3300039437 Ga0436365_0434710 Ga0436365_0434710_179_1186 301
119 3300046506 Ga0495583_0000159 Ga0495583_0000159_15248_16252 302
120 3300046507 Ga0495606_0003437 Ga0495606_0003437_15527_16531 302
121 3300046616 Ga0495668_0111110 Ga0495668_0111110_44_1090 302
122 3300046660 Ga0495625_0003763 Ga0495625_0003763_2563_3567 302
123 3300046684 Ga0495669_0014639 Ga0495669_0014639_1620_2624 302
124 3300046694 Ga0495649_0001310 Ga0495649_0001310_17214_18218 302
125 3300046794 Ga0495589_0008654 Ga0495589_0008654_770_1774 302
126 3300053177 Ga0500636_0010811 Ga0500636_0010811_2464_3468 302
127 3300005366 Ga0070659_100052372 Ga0070659_1000523722 303
128 3300005458 Ga0070681_10004398 Ga0070681_100043988 303
129 3300005458 Ga0070681_10013414 Ga0070681_100134145 303
130 3300005563 Ga0068855_100185307 Ga0068855_1001853071 303
131 3300005578 Ga0068854_100148676 Ga0068854_1001486761 303
132 3300005985 Ga0081539_10000075 Ga0081539_10000075122 303
133 3300006844 Ga0075428_100002488 Ga0075428_10000248822 303
134 3300006846 Ga0075430_100006277 Ga0075430_10000627712 303
135 3300006847 Ga0075431_100165885 Ga0075431_1001658852 303
136 3300009545 Ga0105237_10055804 Ga0105237_100558043 303
137 3300010375 Ga0105239_10051926 Ga0105239_100519262 303
138 3300025932 Ga0207690_10027761 Ga0207690_100277613 303
139 3300025949 Ga0207667_10155762 Ga0207667_101557622 303
140 3300025981 Ga0207640_10184987 Ga0207640_101849871 303
141 3300026041 Ga0207639_10011578 Ga0207639_100115781 303
142 3300027907 Ga0207428_10006795 Ga0207428_1000679511 303
143 3300031548 Ga0307408_100015362 Ga0307408_1000153622 303
144 3300031731 Ga0307405_10077442 Ga0307405_100774422 303
145 3300031901 Ga0307406_10208775 Ga0307406_102087752 303
146 3300042435 Ga0439434_0031881 Ga0439434_0031881_458_1393 303
147 3300050510 nmdc:mga06r32_74060_c1 nmdc:mga06r32_74060_c1_2008_2925 303
148 3300005435 Ga0070714_100003435 Ga0070714_1000034352 304
149 3300006946 Ga0079104_1000019 Ga0079104_100001962 304
150 3300025898 Ga0207692_10075906 Ga0207692_100759062 304
151 3300025929 Ga0207664_10014644 Ga0207664_100146442 304
152 3300027111 Ga0209281_1000160 Ga0209281_100016062 304
153 3300041452 Ga0451793_1323104 Ga0451793_1323104_378_1331 304
154 3300041458 Ga0451798_0379219 Ga0451798_0379219_150_1103 304
155 3300041459 Ga0451800_0013398 Ga0451800_0013398_282_1235 304
156 3300053096 Ga0500641_0089510 Ga0500641_0089510_327_1280 304
157 3300053109 Ga0500569_001196 Ga0500569_001196_886_1839 304
158 3300053130 Ga0500642_0001435 Ga0500642_0001435_357_1310 304
159 3300053131 Ga0500652_000112 Ga0500652_000112_5448_6401 304
160 3300053142 Ga0500577_0048705 Ga0500577_0048705_373_1326 304
161 3300028800 Ga0265338_10040752 Ga0265338_100407522 305
162 3300035692 Ga0373935_0317886 Ga0373935_0317886_70_1011 305
163 3300046459 Ga0495629_0099403 Ga0495629_0099403_381_1322 305
164 3300046683 Ga0495658_0076979 Ga0495658_0076979_709_1650 305
165 3300003775 Ga0055524_1000097 Ga0055524_100009734 307
166 3300003791 Ga0055530_10001788 Ga0055530_100017885 307
167 3300003792 Ga0055540_1000023 Ga0055540_1000023121 307
168 3300003794 Ga0055531_10012543 Ga0055531_100125432 307
169 3300005434 Ga0070709_10007882 Ga0070709_100078823 307
170 3300005435 Ga0070714_100034010 Ga0070714_1000340103 307
171 3300005436 Ga0070713_100000095 Ga0070713_10000009557 307
172 3300005439 Ga0070711_100100947 Ga0070711_1001009472 307
173 3300006028 Ga0070717_10002392 Ga0070717_100023922 307
174 3300006175 Ga0070712_100049948 Ga0070712_1000499483 307
175 3300025263 Ga0209565_1009636 Ga0209565_10096363 307
176 3300025291 Ga0209675_1005663 Ga0209675_10056633 307
177 3300025298 Ga0209050_1000378 Ga0209050_100037811 307
178 3300025299 Ga0209256_1000051 Ga0209256_100005165 307
179 3300025303 Ga0209051_1000079 Ga0209051_100007966 307
180 3300025304 Ga0209257_1000183 Ga0209257_100018324 307
181 3300025906 Ga0207699_10001164 Ga0207699_100011646 307
182 3300025915 Ga0207693_10096332 Ga0207693_100963322 307
183 3300025916 Ga0207663_10045480 Ga0207663_100454802 307
184 3300025928 Ga0207700_10029460 Ga0207700_100294602 307
185 3300025929 Ga0207664_10009748 Ga0207664_100097482 307
186 3300044656 Ga0466969_0009071 Ga0466969_0009071_3867_4823 307
187 3300044684 Ga0466966_0114046 Ga0466966_0114046_85_1041 307
188 3300044693 Ga0466961_0006616 Ga0466961_0006616_2617_3573 307
189 3300044842 Ga0466957_0143728 Ga0466957_0143728_209_1165 307
190 3300045049 Ga0466959_0077185 Ga0466959_0077185_533_1489 307
191 3300048917 Ga0496114_0026911 Ga0496114_0026911_379_1371 307
192 3300061719 Ga0466962_0053363 Ga0466962_0053363_534_1490 307
193 3300026041 Ga0207639_10353905 Ga0207639_103539051 308
194 3300026142 Ga0207698_10102407 Ga0207698_101024072 308
195 3300031731 Ga0307405_10203994 Ga0307405_102039941 308
196 3300041509 Ga0451843_0761211 Ga0451843_0761211_90_1052 308
197 3300044694 Ga0466963_0272151 Ga0466963_0272151_61_1071 308
198 3300006048 Ga0075363_100023383 Ga0075363_1000233833 309
199 3300006177 Ga0075362_10005491 Ga0075362_100054913 309
200 3300006178 Ga0075367_10009619 Ga0075367_100096194 309
201 3300006186 Ga0075369_10003839 Ga0075369_100038393 309
202 3300006195 Ga0075366_10085091 Ga0075366_100850912 309
203 3300006353 Ga0075370_10029668 Ga0075370_100296682 309
204 3300006846 Ga0075430_100109222 Ga0075430_1001092223 309
205 3300006847 Ga0075431_100348437 Ga0075431_1003484372 309
206 3300027876 Ga0209974_10000950 Ga0209974_100009506 309
207 3300028794 Ga0307515_10001755 Ga0307515_1000175510 309
208 3300030522 Ga0307512_10137097 Ga0307512_101370972 309
209 3300031456 Ga0307513_10043585 Ga0307513_100435852 309
210 3300031649 Ga0307514_10001936 Ga0307514_1000193616 309
211 3300046522 Ga0495643_0080464 Ga0495643_0080464_25_975 309
212 3300050489 nmdc:mga03683_986_c1 nmdc:mga03683_986_c1_1286_2242 309
213 3300050490 nmdc:mga03n38_5724_c1 nmdc:mga03n38_5724_c1_463_1419 309
214 3300050493 nmdc:mga0k408_4590_c1 nmdc:mga0k408_4590_c1_1070_2026 309
215 3300050494 nmdc:mga06z11_1988_c1 nmdc:mga06z11_1988_c1_3516_4472 309
216 3300050496 nmdc:mga07m45_308_c1 nmdc:mga07m45_308_c1_7779_8735 309
217 3300050510 nmdc:mga06r32_195077_c1 nmdc:mga06r32_195077_c1_152_1096 309
218 3300050516 nmdc:mga0sz30_22404_c1 nmdc:mga0sz30_22404_c1_503_1459 309
219 3300005445 Ga0070708_100072291 Ga0070708_1000722913 310
220 3300005467 Ga0070706_100034773 Ga0070706_1000347736 310
221 3300005530 Ga0070679_100302474 Ga0070679_1003024742 310
222 3300009094 Ga0111539_10069633 Ga0111539_100696333 310
223 3300025937 Ga0207669_10198293 Ga0207669_101982931 310
224 3300026116 Ga0207674_10041448 Ga0207674_100414484 310
225 3300042876 Ga0451577_0222079 Ga0451577_0222079_633_1574 310
226 3300046501 Ga0495607_0018499 Ga0495607_0018499_1760_2695 310
227 3300046515 Ga0495620_0033242 Ga0495620_0033242_1085_2026 310
228 3300048912 Ga0496109_0079118 Ga0496109_0079118_1800_2741 310
229 3300049515 Ga0501292_020890 Ga0501292_020890_42_1007 310
230 3300009094 Ga0111539_10512335 Ga0111539_105123351 311
231 3300025921 Ga0207652_10255779 Ga0207652_102557792 311
232 3300031548 Ga0307408_100030077 Ga0307408_1000300773 311
233 3300031548 Ga0307408_100213304 Ga0307408_1002133042 311
234 3300044656 Ga0466969_0016884 Ga0466969_0016884_1902_2927 311
235 3300044658 Ga0466972_0021366 Ga0466972_0021366_664_1605 311
236 3300044683 Ga0466965_0009202 Ga0466965_0009202_2229_3254 311
237 3300044684 Ga0466966_0022053 Ga0466966_0022053_753_1778 311
238 3300044693 Ga0466961_0030906 Ga0466961_0030906_1209_2234 311
239 3300044706 Ga0466964_0005747 Ga0466964_0005747_2345_3370 311
240 3300044735 Ga0466968_0029569 Ga0466968_0029569_247_1272 311
241 3300044765 Ga0466970_0130052 Ga0466970_0130052_238_1263 311
242 3300045049 Ga0466959_0026511 Ga0466959_0026511_2290_3315 311
243 3300045976 Ga0466967_0057233 Ga0466967_0057233_158_1183 311
244 3300046557 Ga0495622_0071822 Ga0495622_0071822_77_1015 311
245 3300046690 Ga0495624_0037050 Ga0495624_0037050_2015_2953 311
246 3300049652 Ga0501202_006817 Ga0501202_006817_374_1324 311
247 3300049660 Ga0501216_015228 Ga0501216_015228_197_1147 311
248 3300049765 Ga0501268_004451 Ga0501268_004451_52_1002 311
249 3300053086 Ga0500578_0000057 Ga0500578_0000057_19964_20905 311
250 3300053086 Ga0500578_0000683 Ga0500578_0000683_36150_37091 311
251 3300061719 Ga0466962_0012958 Ga0466962_0012958_1421_2446 311
252 iso_pu_bacteria 2585428057 2587729394 311
253 iso_pu_bacteria 2585428058 2587732782 311
254 iso_pu_bacteria 2588253510 2588290154 311
255 iso_pu_bacteria 2643221592 2643967720 311
256 iso_pu_bacteria 2643221609 2644057939 311
257 iso_pu_bacteria 2643221611 2644072974 311
258 iso_pu_bacteria 2643221625 2644140542 311
259 iso_pu_bacteria 2643221648 2644273509 311
260 iso_pu_bacteria 2738543012 2739242211 311
261 iso_pu_bacteria 2816332133 2816470172 311
262 3300035086 Ga0373934_0000172 Ga0373934_0000172_12513_13466 312
263 3300035111 Ga0373923_0001124 Ga0373923_0001124_5762_6715 312
264 3300035117 Ga0373953_0001178 Ga0373953_0001178_4611_5564 312
265 3300035119 Ga0373956_0002530 Ga0373956_0002530_3012_3965 312
266 3300035172 Ga0373955_0002332 Ga0373955_0002332_1487_2440 312
267 3300035692 Ga0373935_0132491 Ga0373935_0132491_180_1133 312
268 3300035724 Ga0373933_0000064 Ga0373933_0000064_51354_52307 312
269 3300036401 Ga0373937_0000104 Ga0373937_0000104_4671_5624 312
270 3300046454 Ga0495592_0001845 Ga0495592_0001845_1342_2295 312
271 3300046459 Ga0495629_0021712 Ga0495629_0021712_2379_3332 312
272 3300046462 Ga0495651_0000378 Ga0495651_0000378_12667_13620 312
273 3300046463 Ga0495653_0000741 Ga0495653_0000741_2751_3704 312
274 3300046511 Ga0495608_0001892 Ga0495608_0001892_1496_2449 312
275 3300046516 Ga0495628_0000925 Ga0495628_0000925_1180_2133 312
276 3300046517 Ga0495630_0004964 Ga0495630_0004964_6796_7749 312
277 3300046529 Ga0495652_0001978 Ga0495652_0001978_15020_15973 312
278 3300046536 Ga0495587_0000504 Ga0495587_0000504_17619_18572 312
279 3300046543 Ga0495645_0000702 Ga0495645_0000702_19327_20280 312
280 3300046559 Ga0495667_0000295 Ga0495667_0000295_10538_11491 312
281 3300046663 Ga0495635_0000027 Ga0495635_0000027_88011_88964 312
282 3300046675 Ga0495657_0001428 Ga0495657_0001428_10187_11140 312
283 3300046678 Ga0495599_0001223 Ga0495599_0001223_12515_13468 312
284 3300046679 Ga0495623_0001252 Ga0495623_0001252_7994_8947 312
285 3300046680 Ga0495646_0001274 Ga0495646_0001274_12135_13088 312
286 3300046809 Ga0495600_0000439 Ga0495600_0000439_10098_11051 312
287 3300047315 Ga0495581_0074160 Ga0495581_0074160_591_1544 312
288 3300047317 Ga0495604_0001033 Ga0495604_0001033_12568_13521 312
289 3300047319 Ga0495674_0012369 Ga0495674_0012369_2521_3474 312
290 3300047322 Ga0495680_0010170 Ga0495680_0010170_1046_1999 312
291 3300047471 Ga0495684_0000116 Ga0495684_0000116_44357_45310 312
292 3300048088 Ga0495602_0002782 Ga0495602_0002782_1520_2473 312
293 3300053084 Ga0495595_0014662 Ga0495595_0014662_813_1766 312
294 3300053085 Ga0495619_0020561 Ga0495619_0020561_415_1368 312
295 3300006175 Ga0070712_100032070 Ga0070712_1000320702 313
296 3300014325 Ga0163163_10047736 Ga0163163_100477363 313
297 3300025915 Ga0207693_10049312 Ga0207693_100493124 313
298 3300025925 Ga0207650_10169958 Ga0207650_101699582 313
299 3300035089 Ga0373944_0037891 Ga0373944_0037891_403_1362 313
300 3300037068 Ga0373925_0003082 Ga0373925_0003082_1482_2441 313
301 3300046455 Ga0495603_0005272 Ga0495603_0005272_5932_6891 313
302 3300046459 Ga0495629_0020763 Ga0495629_0020763_3216_4175 313
303 3300046472 Ga0495580_0108808 Ga0495580_0108808_804_1763 313
304 3300046475 Ga0495639_0008610 Ga0495639_0008610_1124_2083 313
305 3300046499 Ga0495594_0102820 Ga0495594_0102820_167_1126 313
306 3300046531 Ga0495665_0000407 Ga0495665_0000407_13494_14453 313
307 3300046557 Ga0495622_0040310 Ga0495622_0040310_29_988 313
308 3300046674 Ga0495588_0021641 Ga0495588_0021641_1221_2180 313
309 3300046683 Ga0495658_0007628 Ga0495658_0007628_4242_5201 313
310 3300046689 Ga0495613_0035304 Ga0495613_0035304_1337_2296 313
311 3300047673 Ga0495593_0000111 Ga0495593_0000111_29937_30896 313
312 3300048089 Ga0495614_0000527 Ga0495614_0000527_3564_4523 313
313 3300048915 Ga0496112_0075923 Ga0496112_0075923_2168_3163 313
314 iso_pu_bacteria 2643221654 2644303662 313
315 3300006195 Ga0075366_10020320 Ga0075366_100203204 314
316 3300006846 Ga0075430_100065543 Ga0075430_1000655433 314
317 3300009147 Ga0114129_10487943 Ga0114129_104879432 314
318 3300025253 Ga0209677_101707 Ga0209677_1017079 314
319 3300025919 Ga0207657_10057170 Ga0207657_100571703 314
320 3300026067 Ga0207678_10164151 Ga0207678_101641512 314
321 3300050493 nmdc:mga0k408_16868_c1 nmdc:mga0k408_16868_c1_2995_4005 314
322 3300050508 nmdc:mga09592_1109_c1 nmdc:mga09592_1109_c1_17793_18824 314
323 3300050512 nmdc:mga0n895_295217_c1 nmdc:mga0n895_295217_c1_540_1544 314
324 iso_pu_bacteria 2547132374 2548501637 314
325 iso_pu_bacteria 2585428062 2587757133 314
326 iso_pu_bacteria 2600255292 2601671068 314
327 iso_pu_bacteria 2643221570 2643865097 314
328 iso_pu_bacteria 2643221596 2643990756 314
329 iso_pu_bacteria 2643221652 2644292378 314
330 iso_pu_bacteria 2643221717 2644645420 314
331 iso_pu_bacteria 2857547612 2857547838 314
332 iso_pu_bacteria 2919704043 2919705062 314
333 iso_pu_bacteria 2990710928 2990710988 314
334 3300005330 Ga0070690_100007195 Ga0070690_1000071952 315
335 3300005334 Ga0068869_100010062 Ga0068869_1000100624 315
336 3300005334 Ga0068869_100141312 Ga0068869_1001413122 315
337 3300005338 Ga0068868_100241476 Ga0068868_1002414761 315
338 3300005459 Ga0068867_100000977 Ga0068867_1000009772 315
339 3300005548 Ga0070665_100008237 Ga0070665_1000082372 315
340 3300005548 Ga0070665_100375118 Ga0070665_1003751182 315
341 3300005563 Ga0068855_100317171 Ga0068855_1003171712 315
342 3300005718 Ga0068866_10077782 Ga0068866_100777822 315
343 3300005719 Ga0068861_100025535 Ga0068861_1000255353 315
344 3300005843 Ga0068860_100403752 Ga0068860_1004037522 315
345 3300006847 Ga0075431_100266053 Ga0075431_1002660532 315
346 3300006871 Ga0075434_100444152 Ga0075434_1004441522 315
347 3300009098 Ga0105245_10045264 Ga0105245_100452642 315
348 3300009098 Ga0105245_10157789 Ga0105245_101577892 315
349 3300009148 Ga0105243_10009662 Ga0105243_100096625 315
350 3300009176 Ga0105242_10308119 Ga0105242_103081192 315
351 3300010375 Ga0105239_10084230 Ga0105239_100842302 315
352 3300013296 Ga0157374_10268902 Ga0157374_102689022 315
353 3300013306 Ga0163162_10056229 Ga0163162_100562293 315
354 3300013306 Ga0163162_10151799 Ga0163162_101517992 315
355 3300013308 Ga0157375_10077110 Ga0157375_100771102 315
356 3300014745 Ga0157377_10000098 Ga0157377_1000009823 315
357 3300017792 Ga0163161_10040838 Ga0163161_100408382 315
358 3300025899 Ga0207642_10163533 Ga0207642_101635332 315
359 3300025910 Ga0207684_10022416 Ga0207684_100224163 315
360 3300025927 Ga0207687_10067765 Ga0207687_100677652 315
361 3300025935 Ga0207709_10003704 Ga0207709_100037047 315
362 3300025942 Ga0207689_10037128 Ga0207689_100371282 315
363 3300026035 Ga0207703_10054670 Ga0207703_100546701 315
364 3300026078 Ga0207702_10062662 Ga0207702_100626623 315
365 3300026089 Ga0207648_10000614 Ga0207648_1000061416 315
366 3300026118 Ga0207675_100064585 Ga0207675_1000645853 315
367 3300028379 Ga0268266_10008775 Ga0268266_100087755 315
368 3300028379 Ga0268266_10299413 Ga0268266_102994132 315
369 3300028381 Ga0268264_10566654 Ga0268264_105666541 315
370 3300028786 Ga0307517_10042428 Ga0307517_100424284 315
371 3300028794 Ga0307515_10000180 Ga0307515_1000018085 315
372 3300029957 Ga0265324_10024174 Ga0265324_100241742 315
373 3300031456 Ga0307513_10000004 Ga0307513_10000004461 315
374 3300031456 Ga0307513_10020823 Ga0307513_100208233 315
375 3300031507 Ga0307509_10240228 Ga0307509_102402282 315
376 3300031616 Ga0307508_10005913 Ga0307508_100059133 315
377 3300031730 Ga0307516_10000488 Ga0307516_1000048819 315
378 3300031730 Ga0307516_10008370 Ga0307516_100083704 315
379 3300031730 Ga0307516_10081209 Ga0307516_100812093 315
380 3300032002 Ga0307416_100093151 Ga0307416_1000931512 315
381 3300037312 Ga0395899_0011426 Ga0395899_0011426_4151_5185 315
382 3300037471 Ga0395905_0150396 Ga0395905_0150396_684_1718 315
383 3300041459 Ga0451800_1405191 Ga0451800_1405191_324_1274 315
384 3300041486 Ga0451807_1552671 Ga0451807_1552671_1337_2287 315
385 3300042007 Ga0439449_0000640 Ga0439449_0000640_3848_4846 315
386 3300042876 Ga0451577_0008497 Ga0451577_0008497_7236_8195 315
387 3300044673 Ga0453683_0006829 Ga0453683_0006829_1439_2398 315
388 3300044712 Ga0453684_0034636 Ga0453684_0034636_5481_6440 315
389 3300045051 Ga0451576_0014933 Ga0451576_0014933_5596_6555 315
390 3300046491 Ga0495584_0038277 Ga0495584_0038277_1449_2408 315
391 3300046665 Ga0495661_0122378 Ga0495661_0122378_10_969 315
392 3300049160 Ga0501304_000207 Ga0501304_000207_1017_2060 315
393 3300049571 Ga0501034_0153351 Ga0501034_0153351_168_1196 315
394 3300049683 Ga0501253_010475 Ga0501253_010475_184_1227 315
395 3300049762 Ga0501265_005330 Ga0501265_005330_19_1062 315
396 3300050493 nmdc:mga0k408_186836_c1 nmdc:mga0k408_186836_c1_47_997 315
397 3300050511 nmdc:mga08y16_73348_c1 nmdc:mga08y16_73348_c1_1229_2185 315
398 3300061719 Ga0466962_0042044 Ga0466962_0042044_917_1933 315
399 iso_pu_bacteria 2513020051 2513226573 315
400 iso_pu_bacteria 2599185214 2599625820 315
401 iso_pu_bacteria 2599185226 2599675098 315
402 iso_pu_bacteria 2599185227 2599683992 315
403 iso_pu_bacteria 2599185229 2599695405 315
404 iso_pu_bacteria 2643221628 2644162885 315
405 iso_pu_bacteria 2643221658 2644329476 315
406 iso_pu_bacteria 2643221664 2644356467 315
407 iso_pu_bacteria 2643221672 2644398239 315
408 iso_pu_bacteria 2643221683 2644469295 315
409 iso_pu_bacteria 2738541277 2738722936 315
410 iso_pu_bacteria 2738541280 2738738895 315
411 iso_pu_bacteria 2738541300 2738844796 315
412 iso_pu_bacteria 2738541307 2738881361 315
413 iso_pu_bacteria 2738543018 2739276321 315
414 iso_pu_bacteria 2738543019 2739283507 315
415 iso_pu_bacteria 2738543030 2739345155 315
416 iso_pu_bacteria 2842677519 2842680177 315
417 iso_pu_bacteria 2885198086 2885199823 315
418 iso_pu_bacteria 2885211737 2885213474 315
419 iso_pu_bacteria 2904449895 2904454747 315
420 iso_pu_bacteria 2904456579 2904460330 315
421 iso_pu_bacteria 2904541872 2904546379 315
422 iso_pu_bacteria 2919462493 2919464123 315
423 iso_pu_bacteria 2928070936 2928076419 315
424 iso_pu_bacteria 2928084124 2928088810 315
425 iso_pu_bacteria 2929160207 2929164190 315
426 iso_pu_bacteria 2929520902 2929524523 315
427 iso_pu_bacteria 2945945610 2945946935 315
428 iso_pu_bacteria 2945972063 2945976634 315
429 3300003322 rootL2_10009352 rootL2_100093522 316
430 3300005328 Ga0070676_10001363 Ga0070676_100013634 316
431 3300005331 Ga0070670_100014490 Ga0070670_1000144902 316
432 3300005338 Ga0068868_100049768 Ga0068868_1000497683 316
433 3300005355 Ga0070671_100100643 Ga0070671_1001006432 316
434 3300005364 Ga0070673_100132327 Ga0070673_1001323272 316
435 3300005455 Ga0070663_100387349 Ga0070663_1003873491 316
436 3300005456 Ga0070678_100148582 Ga0070678_1001485822 316
437 3300005457 Ga0070662_100179872 Ga0070662_1001798722 316
438 3300005459 Ga0068867_100034907 Ga0068867_1000349072 316
439 3300005459 Ga0068867_100035250 Ga0068867_1000352501 316
440 3300005459 Ga0068867_100183981 Ga0068867_1001839812 316
441 3300005718 Ga0068866_10156802 Ga0068866_101568022 316
442 3300005719 Ga0068861_100035272 Ga0068861_1000352724 316
443 3300005842 Ga0068858_100194090 Ga0068858_1001940901 316
444 3300005843 Ga0068860_100011496 Ga0068860_1000114969 316
445 3300005844 Ga0068862_100016907 Ga0068862_1000169072 316
446 3300006038 Ga0075365_10013334 Ga0075365_100133342 316
447 3300006042 Ga0075368_10044444 Ga0075368_100444442 316
448 3300006195 Ga0075366_10004653 Ga0075366_100046537 316
449 3300006195 Ga0075366_10010562 Ga0075366_100105625 316
450 3300006195 Ga0075366_10033634 Ga0075366_100336342 316
451 3300006195 Ga0075366_10054712 Ga0075366_100547122 316
452 3300006195 Ga0075366_10121467 Ga0075366_101214672 316
453 3300006195 Ga0075366_10122064 Ga0075366_101220642 316
454 3300006195 Ga0075366_10127414 Ga0075366_101274142 316
455 3300006353 Ga0075370_10011438 Ga0075370_100114382 316
456 3300006353 Ga0075370_10063639 Ga0075370_100636392 316
457 3300006353 Ga0075370_10157805 Ga0075370_101578052 316
458 3300006881 Ga0068865_100007809 Ga0068865_1000078097 316
459 3300009093 Ga0105240_10253336 Ga0105240_102533362 316
460 3300009094 Ga0111539_10001762 Ga0111539_100017624 316
461 3300009147 Ga0114129_10004723 Ga0114129_100047234 316
462 3300009148 Ga0105243_10121097 Ga0105243_101210972 316
463 3300009148 Ga0105243_10347991 Ga0105243_103479912 316
464 3300009545 Ga0105237_10005095 Ga0105237_100050957 316
465 3300009551 Ga0105238_10014551 Ga0105238_100145516 316
466 3300009553 Ga0105249_10011730 Ga0105249_100117305 316
467 3300010375 Ga0105239_10000486 Ga0105239_1000048643 316
468 3300013306 Ga0163162_10009563 Ga0163162_100095638 316
469 3300013308 Ga0157375_10009170 Ga0157375_100091704 316
470 3300014968 Ga0157379_10032824 Ga0157379_100328242 316
471 3300017792 Ga0163161_10155040 Ga0163161_101550401 316
472 3300025899 Ga0207642_10099462 Ga0207642_100994621 316
473 3300025907 Ga0207645_10001218 Ga0207645_1000121815 316
474 3300025913 Ga0207695_10184031 Ga0207695_101840312 316
475 3300025914 Ga0207671_10036946 Ga0207671_100369462 316
476 3300025924 Ga0207694_10018463 Ga0207694_100184632 316
477 3300025925 Ga0207650_10027819 Ga0207650_100278192 316
478 3300025926 Ga0207659_10169739 Ga0207659_101697391 316
479 3300025927 Ga0207687_10431595 Ga0207687_104315951 316
480 3300025938 Ga0207704_10068833 Ga0207704_100688332 316
481 3300025942 Ga0207689_10008711 Ga0207689_100087117 316
482 3300025986 Ga0207658_10060391 Ga0207658_100603913 316
483 3300026089 Ga0207648_10001597 Ga0207648_1000159727 316
484 3300026089 Ga0207648_10005261 Ga0207648_1000526112 316
485 3300026116 Ga0207674_10059264 Ga0207674_100592644 316
486 3300026118 Ga0207675_100004236 Ga0207675_10000423612 316
487 3300026121 Ga0207683_10019535 Ga0207683_100195357 316
488 3300028381 Ga0268264_10013578 Ga0268264_100135785 316
489 3300028786 Ga0307517_10000918 Ga0307517_100009185 316
490 3300028786 Ga0307517_10156830 Ga0307517_101568302 316
491 3300028794 Ga0307515_10000109 Ga0307515_10000109133 316
492 3300028794 Ga0307515_10001052 Ga0307515_1000105227 316
493 3300028794 Ga0307515_10008086 Ga0307515_100080867 316
494 3300028794 Ga0307515_10028385 Ga0307515_100283859 316
495 3300028794 Ga0307515_10036146 Ga0307515_100361464 316
496 3300028794 Ga0307515_10231632 Ga0307515_102316322 316
497 3300030522 Ga0307512_10011673 Ga0307512_100116738 316
498 3300030522 Ga0307512_10039143 Ga0307512_100391432 316
499 3300030522 Ga0307512_10093899 Ga0307512_100938992 316
500 3300031251 Ga0265327_10000108 Ga0265327_1000010890 316
501 3300031456 Ga0307513_10010428 Ga0307513_100104289 316
502 3300031456 Ga0307513_10368293 Ga0307513_103682932 316
503 3300031507 Ga0307509_10000509 Ga0307509_1000050932 316
504 3300031507 Ga0307509_10011291 Ga0307509_100112918 316
505 3300031548 Ga0307408_100002069 Ga0307408_1000020692 316
506 3300031616 Ga0307508_10000099 Ga0307508_1000009933 316
507 3300031616 Ga0307508_10000237 Ga0307508_1000023731 316
508 3300031616 Ga0307508_10282134 Ga0307508_102821342 316
509 3300031649 Ga0307514_10004431 Ga0307514_1000443110 316
510 3300031649 Ga0307514_10014300 Ga0307514_100143002 316
511 3300031730 Ga0307516_10033702 Ga0307516_100337026 316
512 3300031901 Ga0307406_10010897 Ga0307406_100108972 316
513 3300032002 Ga0307416_100009752 Ga0307416_1000097522 316
514 3300032002 Ga0307416_100054803 Ga0307416_1000548032 316
515 3300032005 Ga0307411_10024459 Ga0307411_100244593 316
516 3300033180 Ga0307510_10000794 Ga0307510_1000079428 316
517 3300033180 Ga0307510_10010876 Ga0307510_100108762 316
518 3300033180 Ga0307510_10031892 Ga0307510_100318925 316
519 3300035691 Ga0373931_0034988 Ga0373931_0034988_1059_2021 316
520 3300035695 Ga0373927_0012844 Ga0373927_0012844_730_1713 316
521 3300036401 Ga0373937_0024629 Ga0373937_0024629_3738_4706 316
522 3300036401 Ga0373937_0084373 Ga0373937_0084373_1602_2561 316
523 3300036401 Ga0373937_0530986 Ga0373937_0530986_145_1107 316
524 3300037068 Ga0373925_0004860 Ga0373925_0004860_6571_7554 316
525 3300041491 Ga0451833_1197908 Ga0451833_1197908_126_1085 316
526 3300042008 Ga0439450_018778 Ga0439450_018778_223_1200 316
527 3300042012 Ga0439455_0047312 Ga0439455_0047312_34_1005 316
528 3300042876 Ga0451577_0015851 Ga0451577_0015851_374_1333 316
529 3300044712 Ga0453684_0006064 Ga0453684_0006064_2406_3368 316
530 3300044712 Ga0453684_0078506 Ga0453684_0078506_1347_2306 316
531 3300044712 Ga0453684_0127382 Ga0453684_0127382_1606_2565 316
532 3300046454 Ga0495592_0000140 Ga0495592_0000140_50354_51313 316
533 3300046457 Ga0495590_0017553 Ga0495590_0017553_403_1356 316
534 3300046460 Ga0495638_0101805 Ga0495638_0101805_387_1346 316
535 3300046471 Ga0495650_0038126 Ga0495650_0038126_610_1569 316
536 3300046512 Ga0495610_0011182 Ga0495610_0011182_3206_4165 316
537 3300046512 Ga0495610_0038554 Ga0495610_0038554_50_1003 316
538 3300046513 Ga0495616_0091057 Ga0495616_0091057_39_992 316
539 3300046519 Ga0495632_0005702 Ga0495632_0005702_3341_4294 316
540 3300046524 Ga0495648_0132539 Ga0495648_0132539_308_1267 316
541 3300046681 Ga0495647_0017099 Ga0495647_0017099_1378_2346 316
542 3300046683 Ga0495658_0013346 Ga0495658_0013346_2016_2984 316
543 3300046694 Ga0495649_0001187 Ga0495649_0001187_14786_15739 316
544 3300046794 Ga0495589_0055703 Ga0495589_0055703_139_1092 316
545 3300046810 Ga0495660_0007860 Ga0495660_0007860_809_1762 316
546 3300047443 Ga0495687_003425 Ga0495687_003425_2798_3751 316
547 3300047472 Ga0495686_0001957 Ga0495686_0001957_1006_1968 316
548 3300048091 Ga0495626_0015064 Ga0495626_0015064_2648_3601 316
549 3300048916 Ga0496113_0172195 Ga0496113_0172195_164_1126 316
550 3300048927 Ga0496124_0008990 Ga0496124_0008990_4826_5824 316
551 3300050492 nmdc:mga0yw44_149293_c1 nmdc:mga0yw44_149293_c1_328_1320 316
552 3300050493 nmdc:mga0k408_110387_c1 nmdc:mga0k408_110387_c1_624_1616 316
553 3300050493 nmdc:mga0k408_12245_c1 nmdc:mga0k408_12245_c1_151_1110 316
554 3300050493 nmdc:mga0k408_136611_c1 nmdc:mga0k408_136611_c1_470_1423 316
555 3300050493 nmdc:mga0k408_140678_c1 nmdc:mga0k408_140678_c1_107_1066 316
556 3300050493 nmdc:mga0k408_16255_c1 nmdc:mga0k408_16255_c1_784_1743 316
557 3300050493 nmdc:mga0k408_2622_c1 nmdc:mga0k408_2622_c1_7070_8032 316
558 3300050493 nmdc:mga0k408_32057_c1 nmdc:mga0k408_32057_c1_1028_1987 316
559 3300050494 nmdc:mga06z11_108257_c1 nmdc:mga06z11_108257_c1_160_1119 316
560 3300050496 nmdc:mga07m45_209191_c1 nmdc:mga07m45_209191_c1_104_1063 316
561 3300050496 nmdc:mga07m45_33171_c1 nmdc:mga07m45_33171_c1_1502_2461 316
562 3300050507 nmdc:mga05p37_1081_c1 nmdc:mga05p37_1081_c1_15107_16084 316
563 3300050508 nmdc:mga09592_3150_c2 nmdc:mga09592_3150_c2_2074_3051 316
564 3300050509 nmdc:mga0qj67_39179_c1 nmdc:mga0qj67_39179_c1_2433_3410 316
565 3300050511 nmdc:mga08y16_8989_c1 nmdc:mga08y16_8989_c1_8331_9308 316
566 3300053093 Ga0500651_0094551 Ga0500651_0094551_686_1645 316
567 3300053118 Ga0500594_0000823 Ga0500594_0000823_865_1824 316
568 3300053134 Ga0500658_0001793 Ga0500658_0001793_3825_4778 316
569 3300053136 Ga0500559_0000027 Ga0500559_0000027_97246_98205 316
570 3300053156 Ga0500622_0018677 Ga0500622_0018677_1900_2859 316
571 3300053178 Ga0500637_0129145 Ga0500637_0129145_324_1283 316
572 3300053739 Ga0500587_005473 Ga0500587_005473_312_1271 316
573 iso_pu_bacteria 2643221644 2644246441 316
574 iso_pu_bacteria 2738543013 2739247936 316
575 iso_pu_bacteria 2818991446 2819596311 316
576 iso_pu_bacteria 2831265667 2831270338 316
577 iso_pu_bacteria 2838054893 2838056568 316
578 iso_pu_bacteria 2899924645 2899925694 316
579 iso_pu_bacteria 2928037797 2928038206 316
580 iso_pu_bacteria 2928044640 2928046189 316
581 iso_pu_bacteria 2928051484 2928053884 316
582 iso_pu_bacteria 2928064002 2928067433 316
583 iso_pu_bacteria 2945909444 2945912961 316
584 iso_pu_bacteria 2945984333 2945984758 316
585 iso_pu_bacteria 2954767861 2954771699 316
586 3300003761 Ga0055535_1000824 Ga0055535_100082421 317
587 3300003763 Ga0055529_1000198 Ga0055529_100019852 317
588 3300005327 Ga0070658_10007950 Ga0070658_100079503 317
589 3300005327 Ga0070658_10012665 Ga0070658_100126658 317
590 3300005367 Ga0070667_100298656 Ga0070667_1002986562 317
591 3300005459 Ga0068867_100005245 Ga0068867_1000052456 317
592 3300006195 Ga0075366_10000948 Ga0075366_1000094811 317
593 3300006195 Ga0075366_10057471 Ga0075366_100574712 317
594 3300006195 Ga0075366_10088309 Ga0075366_100883092 317
595 3300006353 Ga0075370_10002994 Ga0075370_100029944 317
596 3300009093 Ga0105240_10103006 Ga0105240_101030062 317
597 3300009093 Ga0105240_10121219 Ga0105240_101212193 317
598 3300009148 Ga0105243_10195138 Ga0105243_101951382 317
599 3300013296 Ga0157374_10204836 Ga0157374_102048362 317
600 3300025231 Ga0207427_100546 Ga0207427_1005466 317
601 3300025242 Ga0209258_100044 Ga0209258_100044124 317
602 3300025254 Ga0209148_1007575 Ga0209148_10075752 317
603 3300025256 Ga0209759_1001188 Ga0209759_100118816 317
604 3300025256 Ga0209759_1007638 Ga0209759_10076381 317
605 3300025256 Ga0209759_1010820 Ga0209759_10108203 317
606 3300025272 Ga0209455_1000048 Ga0209455_1000048124 317
607 3300025909 Ga0207705_10007480 Ga0207705_100074809 317
608 3300025909 Ga0207705_10033874 Ga0207705_100338742 317
609 3300025909 Ga0207705_10043255 Ga0207705_100432553 317
610 3300025913 Ga0207695_10219618 Ga0207695_102196182 317
611 3300025961 Ga0207712_10122406 Ga0207712_101224062 317
612 3300025986 Ga0207658_10099972 Ga0207658_100999722 317
613 3300026089 Ga0207648_10019266 Ga0207648_100192663 317
614 3300028666 Ga0265336_10000053 Ga0265336_1000005331 317
615 3300028794 Ga0307515_10115941 Ga0307515_101159413 317
616 3300029957 Ga0265324_10001024 Ga0265324_100010243 317
617 3300031730 Ga0307516_10024759 Ga0307516_100247596 317
618 3300031730 Ga0307516_10034231 Ga0307516_100342312 317
619 3300035086 Ga0373934_0004886 Ga0373934_0004886_3628_4632 317
620 3300046462 Ga0495651_0246324 Ga0495651_0246324_73_1077 317
621 3300046471 Ga0495650_0017321 Ga0495650_0017321_2076_3080 317
622 3300046511 Ga0495608_0169380 Ga0495608_0169380_224_1234 317
623 3300046660 Ga0495625_0007125 Ga0495625_0007125_23_979 317
624 3300050493 nmdc:mga0k408_10561_c1 nmdc:mga0k408_10561_c1_2027_2983 317
625 3300050493 nmdc:mga0k408_13437_c1 nmdc:mga0k408_13437_c1_546_1502 317
626 3300050493 nmdc:mga0k408_838_c1 nmdc:mga0k408_838_c1_5738_6694 317
627 3300050496 nmdc:mga07m45_131_c1 nmdc:mga07m45_131_c1_21471_22427 317
628 3300050496 nmdc:mga07m45_174168_c1 nmdc:mga07m45_174168_c1_127_1083 317
629 3300050496 nmdc:mga07m45_82897_c1 nmdc:mga07m45_82897_c1_166_1122 317
630 3300053080 Ga0500635_0000035 Ga0500635_0000035_62386_63390 317
631 3300002705 JGI25156J39149_1003834 JGI25156J39149_10038342 318
632 3300002738 JGI25154J39366_1000722 JGI25154J39366_10007226 318
633 3300002738 JGI25154J39366_1003188 JGI25154J39366_10031882 318
634 3300002741 JGI25157J39369_1000018 JGI25157J39369_1000018159 318
635 3300003752 Ga0055539_1000283 Ga0055539_10002831 318
636 3300003752 Ga0055539_1001579 Ga0055539_10015792 318
637 3300003756 Ga0055533_1004794 Ga0055533_10047941 318
638 3300003759 Ga0055525_1000793 Ga0055525_100079310 318
639 3300005467 Ga0070706_100000271 Ga0070706_10000027116 318
640 3300005518 Ga0070699_100210728 Ga0070699_1002107282 318
641 3300005539 Ga0068853_100477803 Ga0068853_1004778031 318
642 3300005563 Ga0068855_100094627 Ga0068855_1000946272 318
643 3300005577 Ga0068857_100006437 Ga0068857_1000064372 318
644 3300005578 Ga0068854_100005348 Ga0068854_1000053482 318
645 3300005614 Ga0068856_100003567 Ga0068856_1000035674 318
646 3300006178 Ga0075367_10008290 Ga0075367_100082904 318
647 3300009551 Ga0105238_10099150 Ga0105238_100991501 318
648 3300011119 Ga0105246_10089846 Ga0105246_100898462 318
649 3300013104 Ga0157370_10004176 Ga0157370_100041762 318
650 3300013105 Ga0157369_10034136 Ga0157369_100341365 318
651 3300013307 Ga0157372_10192952 Ga0157372_101929523 318
652 3300025226 Ga0209674_100003 Ga0209674_100003203 318
653 3300025230 Ga0209563_100141 Ga0209563_10014171 318
654 3300025242 Ga0209258_100895 Ga0209258_1008952 318
655 3300025246 Ga0209646_1000010 Ga0209646_1000010446 318
656 3300025246 Ga0209646_1000067 Ga0209646_100006793 318
657 3300025250 Ga0209026_1000033 Ga0209026_1000033137 318
658 3300025253 Ga0209677_100133 Ga0209677_10013332 318
659 3300025253 Ga0209677_100196 Ga0209677_10019643 318
660 3300025256 Ga0209759_1000024 Ga0209759_1000024137 318
661 3300025303 Ga0209051_1000808 Ga0209051_10008088 318
662 3300025910 Ga0207684_10022867 Ga0207684_100228673 318
663 3300025914 Ga0207671_10238207 Ga0207671_102382072 318
664 3300025935 Ga0207709_10018244 Ga0207709_100182442 318
665 3300025936 Ga0207670_10272540 Ga0207670_102725402 318
666 3300025949 Ga0207667_10015058 Ga0207667_1001505811 318
667 3300025949 Ga0207667_10022788 Ga0207667_100227882 318
668 3300025981 Ga0207640_10029183 Ga0207640_100291832 318
669 3300026041 Ga0207639_10058016 Ga0207639_100580162 318
670 3300026078 Ga0207702_10001078 Ga0207702_100010786 318
671 3300026116 Ga0207674_10027625 Ga0207674_100276252 318
672 3300031616 Ga0307508_10029594 Ga0307508_100295943 318
673 3300035691 Ga0373931_0137602 Ga0373931_0137602_152_1162 318
674 3300037312 Ga0395899_0128066 Ga0395899_0128066_406_1413 318
675 3300037466 Ga0395898_0006478 Ga0395898_0006478_1352_2359 318
676 3300038443 Ga0395901_0000336 Ga0395901_0000336_5814_6821 318
677 3300038443 Ga0395901_0085167 Ga0395901_0085167_504_1517 318
678 3300046474 Ga0495605_0025774 Ga0495605_0025774_159_1199 318
679 3300046491 Ga0495584_0002297 Ga0495584_0002297_4059_5099 318
680 3300046492 Ga0495585_0003905 Ga0495585_0003905_144_1184 318
681 3300046492 Ga0495585_0010619 Ga0495585_0010619_3059_4099 318
682 3300046492 Ga0495585_0102361 Ga0495585_0102361_23_1063 318
683 3300046492 Ga0495585_0131384 Ga0495585_0131384_57_1097 318
684 3300046501 Ga0495607_0014431 Ga0495607_0014431_1574_2614 318
685 3300046501 Ga0495607_0059443 Ga0495607_0059443_690_1730 318
686 3300046506 Ga0495583_0000008 Ga0495583_0000008_381760_382788 318
687 3300046506 Ga0495583_0000185 Ga0495583_0000185_73467_74507 318
688 3300046513 Ga0495616_0025389 Ga0495616_0025389_30_1070 318
689 3300046523 Ga0495644_0000163 Ga0495644_0000163_1399_2439 318
690 3300046523 Ga0495644_0000657 Ga0495644_0000657_9938_10978 318
691 3300046523 Ga0495644_0002234 Ga0495644_0002234_4310_5350 318
692 3300046524 Ga0495648_0005067 Ga0495648_0005067_6381_7421 318
693 3300046538 Ga0495609_0001121 Ga0495609_0001121_1565_2605 318
694 3300046542 Ga0495597_0002754 Ga0495597_0002754_9017_10039 318
695 3300046542 Ga0495597_0045118 Ga0495597_0045118_390_1424 318
696 3300046558 Ga0495633_0012733 Ga0495633_0012733_1717_2757 318
697 3300046615 Ga0495656_0037977 Ga0495656_0037977_334_1374 318
698 3300046648 Ga0495611_0014136 Ga0495611_0014136_2296_3336 318
699 3300046648 Ga0495611_0018132 Ga0495611_0018132_449_1489 318
700 3300046648 Ga0495611_0019535 Ga0495611_0019535_1421_2461 318
701 3300046660 Ga0495625_0004856 Ga0495625_0004856_4242_5264 318
702 3300046660 Ga0495625_0075158 Ga0495625_0075158_152_1192 318
703 3300046664 Ga0495659_0000004 Ga0495659_0000004_112704_113738 318
704 3300046664 Ga0495659_0002446 Ga0495659_0002446_4851_5891 318
705 3300046664 Ga0495659_0010315 Ga0495659_0010315_1555_2595 318
706 3300046665 Ga0495661_0040181 Ga0495661_0040181_469_1509 318
707 3300046691 Ga0495670_0004151 Ga0495670_0004151_2490_3530 318
708 3300046692 Ga0495671_0000548 Ga0495671_0000548_6945_7979 318
709 3300046692 Ga0495671_0011372 Ga0495671_0011372_1694_2707 318
710 3300046692 Ga0495671_0030601 Ga0495671_0030601_890_1930 318
711 3300046692 Ga0495671_0043887 Ga0495671_0043887_1016_2056 318
712 3300046692 Ga0495671_0056373 Ga0495671_0056373_425_1465 318
713 3300047318 Ga0495636_0000383 Ga0495636_0000383_8168_9208 318
714 3300047318 Ga0495636_0008721 Ga0495636_0008721_1784_2824 318
715 3300047320 Ga0495672_0000045 Ga0495672_0000045_51085_52119 318
716 3300047320 Ga0495672_0000835 Ga0495672_0000835_26757_27797 318
717 3300047320 Ga0495672_0013305 Ga0495672_0013305_3587_4627 318
718 3300047321 Ga0495676_0045103 Ga0495676_0045103_2311_3360 318
719 3300047443 Ga0495687_001223 Ga0495687_001223_17733_18773 318
720 3300047445 Ga0495677_0001387 Ga0495677_0001387_5997_7037 318
721 3300047445 Ga0495677_0053862 Ga0495677_0053862_403_1443 318
722 3300047447 Ga0495685_000161 Ga0495685_000161_15814_16854 318
723 3300048907 Ga0496104_0299627 Ga0496104_0299627_109_1119 318
724 3300048912 Ga0496109_0258128 Ga0496109_0258128_35_1045 318
725 3300049459 Ga0495678_002384 Ga0495678_002384_1787_2827 318
726 3300049459 Ga0495678_008398 Ga0495678_008398_678_1718 318
727 3300049460 Ga0495682_0000206 Ga0495682_0000206_24636_25676 318
728 3300049460 Ga0495682_0000261 Ga0495682_0000261_6533_7573 318
729 3300049460 Ga0495682_0012369 Ga0495682_0012369_1276_2316 318
730 3300049531 Ga0501315_000768 Ga0501315_000768_791_1819 318
731 3300049532 Ga0501316_000316 Ga0501316_000316_1048_2076 318
732 3300050494 nmdc:mga06z11_18075_c1 nmdc:mga06z11_18075_c1_423_1403 318
733 3300050496 nmdc:mga07m45_104970_c1 nmdc:mga07m45_104970_c1_204_1184 318
734 3300053079 Ga0500610_0001519 Ga0500610_0001519_3223_4236 318
735 3300053117 Ga0500593_004327 Ga0500593_004327_2206_3219 318
736 3300053158 Ga0500627_0000606 Ga0500627_0000606_6400_7413 318
737 3300053161 Ga0500634_0025886 Ga0500634_0025886_815_1828 318
738 3300059477 Ga0587084_006029 Ga0587084_006029_352_1395 318
739 3300059478 Ga0587093_001079 Ga0587093_001079_986_2038 318
740 3300059478 Ga0587093_003533 Ga0587093_003533_362_1405 318
741 3300059490 Ga0587066_006337 Ga0587066_006337_11_1054 318
742 3300059491 Ga0587070_000447 Ga0587070_000447_1145_2197 318
743 3300059491 Ga0587070_001146 Ga0587070_001146_401_1456 318
744 3300059491 Ga0587070_008806 Ga0587070_008806_41_1084 318
745 3300059493 Ga0587077_000158 Ga0587077_000158_2379_3431 318
746 3300059493 Ga0587077_001244 Ga0587077_001244_415_1452 318
747 3300059493 Ga0587077_003034 Ga0587077_003034_175_1218 318
748 3300059505 Ga0587083_0000234 Ga0587083_0000234_1985_3037 318
749 3300059505 Ga0587083_0000943 Ga0587083_0000943_984_2021 318
750 3300059505 Ga0587083_0007482 Ga0587083_0007482_234_1241 318
751 3300059506 Ga0587085_000466 Ga0587085_000466_1100_2152 318
752 3300059510 Ga0587090_000183 Ga0587090_000183_1185_2237 318
753 3300059510 Ga0587090_007306 Ga0587090_007306_352_1395 318
754 3300059511 Ga0587091_000456 Ga0587091_000456_1011_2063 318
755 3300059512 Ga0587092_000527 Ga0587092_000527_851_1903 318
756 3300059513 Ga0587094_002704 Ga0587094_002704_374_1426 318
757 3300059513 Ga0587094_003838 Ga0587094_003838_268_1311 318
758 3300059623 Ga0587101_000394 Ga0587101_000394_980_2032 318
759 3300059623 Ga0587101_000917 Ga0587101_000917_1057_2094 318
760 3300059623 Ga0587101_001108 Ga0587101_001108_322_1365 318
761 3300059626 Ga0587115_005668 Ga0587115_005668_352_1395 318
762 3300059639 Ga0587062_000340 Ga0587062_000340_853_1905 318
763 3300059641 Ga0587068_000926 Ga0587068_000926_988_2040 318
764 3300059641 Ga0587068_001812 Ga0587068_001812_437_1444 318
765 3300059641 Ga0587068_002162 Ga0587068_002162_466_1509 318
766 3300059642 Ga0587069_001296 Ga0587069_001296_401_1444 318
767 3300059644 Ga0587075_000722 Ga0587075_000722_951_1988 318
768 3300059645 Ga0587076_000484 Ga0587076_000484_1179_2231 318
769 3300059645 Ga0587076_001845 Ga0587076_001845_368_1411 318
770 3300059646 Ga0587078_000307 Ga0587078_000307_1186_2229 318
771 3300059646 Ga0587078_002833 Ga0587078_002833_272_1321 318
772 3300059647 Ga0587079_002858 Ga0587079_002858_299_1342 318
773 3300059647 Ga0587079_007339 Ga0587079_007339_570_1622 318
774 3300059648 Ga0587100_000174 Ga0587100_000174_1281_2333 318
775 3300059649 Ga0587102_000521 Ga0587102_000521_353_1396 318
776 3300059657 Ga0587118_00294 Ga0587118_00294_1202_2254 318
777 3300059658 Ga0587119_000650 Ga0587119_000650_960_2012 318
778 3300059660 Ga0587124_000224 Ga0587124_000224_884_1936 318
779 3300060344 Ga0587071_000866 Ga0587071_000866_1178_2221 318
780 3300060346 Ga0587111_0000401 Ga0587111_0000401_1026_2078 318
781 3300060346 Ga0587111_0000679 Ga0587111_0000679_1148_2191 318
782 3300060346 Ga0587111_0002077 Ga0587111_0002077_524_1531 318
783 2162886007 SwRhRL2b_contig_1470696 SwRhRL2b_0188.00001230 319
784 3300002987 JGI25159J45721_1009411 JGI25159J45721_10094113 319
785 3300003354 JGI25160J50197_1013586 JGI25160J50197_10135862 319
786 3300003374 JGI25161J50226_1003713 JGI25161J50226_10037133 319
787 3300003761 Ga0055535_1009850 Ga0055535_10098502 319
788 3300003762 Ga0055542_1000004 Ga0055542_1000004520 319
789 3300003773 Ga0055537_1000067 Ga0055537_100006748 319
790 3300003781 Ga0055536_1002788 Ga0055536_10027887 319
791 3300003781 Ga0055536_1004581 Ga0055536_10045815 319
792 3300003784 Ga0055534_1000079 Ga0055534_100007920 319
793 3300003784 Ga0055534_1000343 Ga0055534_100034316 319
794 3300003784 Ga0055534_1009668 Ga0055534_10096682 319
795 3300003790 Ga0055528_1003321 Ga0055528_10033212 319
796 3300003791 Ga0055530_10004712 Ga0055530_100047125 319
797 3300003791 Ga0055530_10024260 Ga0055530_100242602 319
798 3300003792 Ga0055540_1001704 Ga0055540_10017047 319
799 3300003792 Ga0055540_1004292 Ga0055540_10042926 319
800 3300003792 Ga0055540_1005572 Ga0055540_10055725 319
801 3300003794 Ga0055531_10002097 Ga0055531_100020978 319
802 3300005288 Ga0065714_10040147 Ga0065714_100401472 319
803 3300005289 Ga0065704_10086689 Ga0065704_100866893 319
804 3300005344 Ga0070661_100109872 Ga0070661_1001098722 319
805 3300005366 Ga0070659_100239670 Ga0070659_1002396701 319
806 3300005367 Ga0070667_100354064 Ga0070667_1003540642 319
807 3300005457 Ga0070662_100137020 Ga0070662_1001370202 319
808 3300005539 Ga0068853_100006049 Ga0068853_1000060496 319
809 3300005548 Ga0070665_100358001 Ga0070665_1003580012 319
810 3300005616 Ga0068852_100157142 Ga0068852_1001571422 319
811 3300005618 Ga0068864_100047704 Ga0068864_1000477043 319
812 3300006038 Ga0075365_10004368 Ga0075365_100043687 319
813 3300006048 Ga0075363_100096383 Ga0075363_1000963832 319
814 3300006058 Ga0075432_10012016 Ga0075432_100120162 319
815 3300006353 Ga0075370_10000290 Ga0075370_100002906 319
816 3300006353 Ga0075370_10001075 Ga0075370_100010758 319
817 3300006353 Ga0075370_10026684 Ga0075370_100266842 319
818 3300006353 Ga0075370_10116680 Ga0075370_101166801 319
819 3300006931 Ga0097620_100180508 Ga0097620_1001805082 319
820 3300006948 Ga0099826_10004066 Ga0099826_100040662 319
821 3300009036 Ga0105244_10010743 Ga0105244_100107432 319
822 3300009147 Ga0114129_10019439 Ga0114129_100194396 319
823 3300009148 Ga0105243_10002076 Ga0105243_1000207616 319
824 3300009148 Ga0105243_10006737 Ga0105243_100067373 319
825 3300009545 Ga0105237_10066624 Ga0105237_100666244 319
826 3300013100 Ga0157373_10060247 Ga0157373_100602472 319
827 3300013102 Ga0157371_10060094 Ga0157371_100600943 319
828 3300013105 Ga0157369_10034289 Ga0157369_100342893 319
829 3300014497 Ga0182008_10010702 Ga0182008_100107024 319
830 3300015261 Ga0182006_1001700 Ga0182006_100170012 319
831 3300017792 Ga0163161_10000069 Ga0163161_1000006941 319
832 3300025228 Ga0209672_101260 Ga0209672_1012602 319
833 3300025229 Ga0209147_101692 Ga0209147_1016925 319
834 3300025242 Ga0209258_100022 Ga0209258_100022519 319
835 3300025254 Ga0209148_1000034 Ga0209148_1000034519 319
836 3300025258 Ga0209129_1002491 Ga0209129_10024915 319
837 3300025258 Ga0209129_1013750 Ga0209129_10137502 319
838 3300025263 Ga0209565_1000146 Ga0209565_10001465 319
839 3300025263 Ga0209565_1000294 Ga0209565_100029421 319
840 3300025273 Ga0209673_1000701 Ga0209673_10007015 319
841 3300025273 Ga0209673_1000860 Ga0209673_100086020 319
842 3300025273 Ga0209673_1001758 Ga0209673_10017582 319
843 3300025284 Ga0209130_1002114 Ga0209130_10021146 319
844 3300025291 Ga0209675_1000024 Ga0209675_1000024287 319
845 3300025291 Ga0209675_1000765 Ga0209675_10007656 319
846 3300025291 Ga0209675_1001622 Ga0209675_10016228 319
847 3300025292 Ga0209676_1000005 Ga0209676_1000005181 319
848 3300025292 Ga0209676_1000434 Ga0209676_100043439 319
849 3300025292 Ga0209676_1001176 Ga0209676_100117616 319
850 3300025292 Ga0209676_1003444 Ga0209676_10034442 319
851 3300025294 Ga0209025_1000116 Ga0209025_10001165 319
852 3300025294 Ga0209025_1000394 Ga0209025_100039486 319
853 3300025294 Ga0209025_1001285 Ga0209025_100128519 319
854 3300025294 Ga0209025_1039755 Ga0209025_10397552 319
855 3300025294 Ga0209025_1076451 Ga0209025_10764512 319
856 3300025295 Ga0209564_1000155 Ga0209564_10001555 319
857 3300025295 Ga0209564_1000292 Ga0209564_100029236 319
858 3300025297 Ga0209758_1000107 Ga0209758_10001075 319
859 3300025298 Ga0209050_1000007 Ga0209050_1000007916 319
860 3300025298 Ga0209050_1002520 Ga0209050_100252013 319
861 3300025299 Ga0209256_1000038 Ga0209256_100003841 319
862 3300025299 Ga0209256_1000087 Ga0209256_10000875 319
863 3300025299 Ga0209256_1021719 Ga0209256_10217192 319
864 3300025302 Ga0207426_1000123 Ga0207426_10001235 319
865 3300025302 Ga0207426_1000176 Ga0207426_100017610 319
866 3300025303 Ga0209051_1000009 Ga0209051_1000009181 319
867 3300025303 Ga0209051_1000174 Ga0209051_100017455 319
868 3300025303 Ga0209051_1000262 Ga0209051_100026241 319
869 3300025303 Ga0209051_1001248 Ga0209051_10012483 319
870 3300025304 Ga0209257_1000011 Ga0209257_1000011155 319
871 3300025304 Ga0209257_1000139 Ga0209257_100013945 319
872 3300025304 Ga0209257_1010519 Ga0209257_10105192 319
873 3300025728 Ga0207655_1001900 Ga0207655_10019007 319
874 3300025914 Ga0207671_10044758 Ga0207671_100447582 319
875 3300025924 Ga0207694_10145778 Ga0207694_101457782 319
876 3300025931 Ga0207644_10033476 Ga0207644_100334763 319
877 3300025932 Ga0207690_10300680 Ga0207690_103006802 319
878 3300025933 Ga0207706_10021056 Ga0207706_100210562 319
879 3300025933 Ga0207706_10046814 Ga0207706_100468144 319
880 3300025935 Ga0207709_10000242 Ga0207709_1000024229 319
881 3300025935 Ga0207709_10015707 Ga0207709_100157075 319
882 3300025935 Ga0207709_10232822 Ga0207709_102328222 319
883 3300025945 Ga0207679_10015159 Ga0207679_100151592 319
884 3300025986 Ga0207658_10230334 Ga0207658_102303342 319
885 3300026041 Ga0207639_10009566 Ga0207639_100095664 319
886 3300026088 Ga0207641_10033648 Ga0207641_100336482 319
887 3300026089 Ga0207648_10150071 Ga0207648_101500712 319
888 3300026095 Ga0207676_10101719 Ga0207676_101017192 319
889 3300026116 Ga0207674_10148350 Ga0207674_101483502 319
890 3300027666 Ga0209282_1002689 Ga0209282_10026892 319
891 3300030522 Ga0307512_10049067 Ga0307512_100490673 319
892 3300030731 Ga0316177_1082843 Ga0316177_10828432 319
893 3300030735 Ga0316178_1038078 Ga0316178_10380781 319
894 3300030745 Ga0316182_1251449 Ga0316182_12514492 319
895 3300031548 Ga0307408_100074954 Ga0307408_1000749542 319
896 3300031649 Ga0307514_10070423 Ga0307514_100704233 319
897 3300031731 Ga0307405_10428207 Ga0307405_104282071 319
898 3300031901 Ga0307406_10002798 Ga0307406_100027982 319
899 3300031901 Ga0307406_10135307 Ga0307406_101353072 319
900 3300031911 Ga0307412_10019946 Ga0307412_100199463 319
901 3300031911 Ga0307412_10092388 Ga0307412_100923882 319
902 3300032004 Ga0307414_10141118 Ga0307414_101411181 319
903 3300035114 Ga0373939_0000028 Ga0373939_0000028_3393_4361 319
904 3300035691 Ga0373931_0000156 Ga0373931_0000156_2723_3691 319
905 3300037471 Ga0395905_0052544 Ga0395905_0052544_1575_2555 319
906 3300041413 Ga0439465_0040615 Ga0439465_0040615_369_1328 319
907 3300042007 Ga0439449_0095586 Ga0439449_0095586_41_1000 319
908 3300042122 Ga0450920_026091 Ga0450920_026091_50_1036 319
909 3300042435 Ga0439434_0025800 Ga0439434_0025800_592_1551 319
910 3300042531 Ga0450918_000247 Ga0450918_000247_4854_5840 319
911 3300044901 Ga0466960_0031545 Ga0466960_0031545_867_1877 319
912 3300045051 Ga0451576_0004309 Ga0451576_0004309_596_1639 319
913 3300046472 Ga0495580_0039704 Ga0495580_0039704_1548_2552 319
914 3300046512 Ga0495610_0026825 Ga0495610_0026825_669_1628 319
915 3300046513 Ga0495616_0001038 Ga0495616_0001038_16165_17124 319
916 3300046515 Ga0495620_0012100 Ga0495620_0012100_2951_3910 319
917 3300046518 Ga0495631_0002040 Ga0495631_0002040_5956_6915 319
918 3300046522 Ga0495643_0040749 Ga0495643_0040749_504_1601 319
919 3300046539 Ga0495621_0035232 Ga0495621_0035232_552_1511 319
920 3300046616 Ga0495668_0080386 Ga0495668_0080386_292_1251 319
921 3300046660 Ga0495625_0000311 Ga0495625_0000311_27321_28280 319
922 3300046692 Ga0495671_0016274 Ga0495671_0016274_431_1390 319
923 3300047321 Ga0495676_0012050 Ga0495676_0012050_2684_3643 319
924 3300047673 Ga0495593_0100035 Ga0495593_0100035_68_1027 319
925 3300048089 Ga0495614_0099981 Ga0495614_0099981_134_1093 319
926 3300048913 Ga0496110_0295788 Ga0496110_0295788_284_1276 319
927 3300048919 Ga0496116_0034568 Ga0496116_0034568_2131_3090 319
928 3300048920 Ga0496117_0070292 Ga0496117_0070292_237_1196 319
929 3300048921 Ga0496118_0005315 Ga0496118_0005315_5747_6706 319
930 3300048921 Ga0496118_0034971 Ga0496118_0034971_624_1583 319
931 3300048922 Ga0496119_0142349 Ga0496119_0142349_192_1151 319
932 3300048923 Ga0496120_0133240 Ga0496120_0133240_139_1098 319
933 3300048924 Ga0496121_0007376 Ga0496121_0007376_7511_8470 319
934 3300048926 Ga0496123_0159495 Ga0496123_0159495_42_1001 319
935 3300048927 Ga0496124_0238352 Ga0496124_0238352_270_1295 319
936 3300048928 Ga0496125_0071362 Ga0496125_0071362_1534_2493 319
937 3300049705 Ga0501225_0003407 Ga0501225_0003407_142_1101 319
938 3300049759 Ga0501262_000459 Ga0501262_000459_3253_4212 319
939 3300050489 nmdc:mga03683_9478_c1 nmdc:mga03683_9478_c1_390_1349 319
940 3300050490 nmdc:mga03n38_165812_c1 nmdc:mga03n38_165812_c1_148_1107 319
941 3300050491 nmdc:mga00v17_2326_c1 nmdc:mga00v17_2326_c1_2830_3789 319
942 3300050492 nmdc:mga0yw44_3664_c1 nmdc:mga0yw44_3664_c1_2703_3662 319
943 3300050493 nmdc:mga0k408_86703_c1 nmdc:mga0k408_86703_c1_23_982 319
944 3300050496 nmdc:mga07m45_1016_c1 nmdc:mga07m45_1016_c1_1640_2599 319
945 3300050496 nmdc:mga07m45_103_c1 nmdc:mga07m45_103_c1_775_1734 319
946 3300050496 nmdc:mga07m45_76134_c2 nmdc:mga07m45_76134_c2_83_1093 319
947 3300050507 nmdc:mga05p37_81063_c1 nmdc:mga05p37_81063_c1_1532_2533 319
948 3300053079 Ga0500610_0002412 Ga0500610_0002412_4444_5403 319
949 3300053093 Ga0500651_0000133 Ga0500651_0000133_4792_5751 319
950 3300053110 Ga0500571_000153 Ga0500571_000153_9268_10227 319
951 3300053111 Ga0500572_056981 Ga0500572_056981_33_992 319
952 3300053116 Ga0500592_003544 Ga0500592_003544_1205_2164 319
953 3300053117 Ga0500593_000449 Ga0500593_000449_6914_7873 319
954 3300053118 Ga0500594_0000721 Ga0500594_0000721_321_1280 319
955 3300053120 Ga0500597_084989 Ga0500597_084989_366_1325 319
956 3300053121 Ga0500607_027526 Ga0500607_027526_568_1527 319
957 3300053122 Ga0500608_016018 Ga0500608_016018_1255_2214 319
958 3300053128 Ga0500626_008205 Ga0500626_008205_2021_2980 319
959 3300053130 Ga0500642_0172302 Ga0500642_0172302_44_1003 319
960 3300053134 Ga0500658_0000124 Ga0500658_0000124_239_1198 319
961 3300053134 Ga0500658_0000342 Ga0500658_0000342_238_1197 319
962 3300053138 Ga0500564_042638 Ga0500564_042638_200_1159 319
963 3300053139 Ga0500568_0001367 Ga0500568_0001367_853_1812 319
964 3300053141 Ga0500574_021580 Ga0500574_021580_538_1497 319
965 3300053158 Ga0500627_0001918 Ga0500627_0001918_351_1310 319
966 3300053161 Ga0500634_0001113 Ga0500634_0001113_6249_7208 319
967 3300053161 Ga0500634_0123534 Ga0500634_0123534_278_1237 319
968 3300053162 Ga0500638_003846 Ga0500638_003846_4215_5174 319
969 3300053177 Ga0500636_0009012 Ga0500636_0009012_515_1474 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

85

354

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.6008 10 308
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5926 10 308
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5924 12 309
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5899 13 309
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5822 10 284
ID Description Score Start End Superfamily
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9442 39 307 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9377 39 307 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9373 39 307 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9323 39 307 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9306 39 307 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1F3C444-F1-model_v4 ABC transporter permease 0.9753 10 316 GO:0005886
GO:0022857
AF-A0A554XA20-F1-model_v4 Ribose import permease protein RbsC 0.9736 12 319 GO:0005886
GO:0022857
AF-A0A5Q4YY88-F1-model_v4 Periplasmic binding protein domain-containing protein 0.9723 12 316 GO:0005886
GO:0022857
AF-A0A1Q7VM85-F1-model_v4 ABC transporter permease 0.9688 12 319 GO:0005886
GO:0022857
AF-A0A2N2SZP4-F1-model_v4 ABC transporter permease 0.9676 43 319 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
88.06 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map