F487077
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 969 | 532 | 905 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300046522|Ga0495643_0040749|Ga0495643_0040749_504_1601 |
| Length | 365 |
| Sequence | MAMIDVGSAEARAPRDVALPSGPADERAPSAVPQREPGRHAPPPLLRDTLRSNLPPLGQLGPLVALVIACAVFSATTDRFFSGENFSLILQQVMVVGVIAIGQTLVILTAGIDLSCGMIMALGGIVMTSLAAELGLPASXAIVCGMAVTTLFGLMNGLLVTRIGLPPFIVTLGVYNIAFAATQLYSRAQTITDVPPLMVWLGNTFPLAGVSVAFGTVLLLLLYGVTWFCLRETAAGRHIYAVGNNPEAARLVGIPPERVLLGVYMLAGLSYGVASLLSVARTGVGDPNAGQTENLDAITAVVLGGTSLFGGRGAIFGSLIGAVVVGVLRNGLTLMGVSSVYQVLATGILVIAAVTVDQLSRRGVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 6 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 7 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 8 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 9 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 10 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 11 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 12 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 13 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 14 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 15 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 16 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 17 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 18 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 19 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 20 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 21 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 22 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 23 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 24 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 25 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 26 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 27 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 28 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 29 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 30 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 31 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 32 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 33 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 34 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 35 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 36 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 37 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 38 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 39 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 40 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 41 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 42 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 43 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 44 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 45 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 46 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 47 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 48 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 49 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 50 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 51 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 52 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 53 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 54 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 55 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 56 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 57 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 58 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 59 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 60 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 61 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 62 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 63 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 64 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 65 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 66 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 67 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 68 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 69 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 70 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 71 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 72 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 73 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 74 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 75 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 80 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 83 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 84 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 85 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 86 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 87 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 88 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 89 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 91 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 92 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 93 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 97 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 99 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 101 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 102 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 120 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 121 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 124 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 126 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 129 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 130 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 131 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 132 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 133 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 134 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 135 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 136 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 137 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 138 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 139 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 140 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 142 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 143 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 144 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 145 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 146 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 147 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 148 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 149 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 150 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 151 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 152 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 153 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 154 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 155 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 156 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 157 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 159 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 160 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 184 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 197 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 200 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 267 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 268 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 271 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 274 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 275 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 276 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 277 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 278 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 279 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 280 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 281 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 282 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 283 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 284 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 285 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 286 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 287 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 288 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 289 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 290 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 291 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 292 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 293 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 294 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 295 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 296 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 297 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 298 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 299 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 300 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 302 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 303 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 305 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 306 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 308 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 309 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 312 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 313 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 314 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 315 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 316 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 317 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 322 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 323 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 324 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 325 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 326 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 327 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 328 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 329 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 330 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 331 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 332 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 333 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 334 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 335 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 336 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 337 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 338 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 339 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 340 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 341 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 342 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 343 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 344 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 345 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 346 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 347 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 426 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 428 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 429 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 430 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 431 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 432 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 433 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 434 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 435 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 436 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 437 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 438 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 439 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 440 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 444 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 448 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 449 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 450 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 451 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 452 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 453 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 454 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 455 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 456 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 459 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 460 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 461 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 462 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 471 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 472 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 475 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 476 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 478 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 479 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 482 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 483 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 485 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 486 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 487 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 488 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 489 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 490 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 491 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 493 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 498 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 499 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 501 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 502 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 504 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 505 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.44 |
| Metatranscriptomes | 4.95 |
| Isolates | 6.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.81 |
| Nodule | 0.52 |
| Rhizoplane | 1.65 |
| Rhizosphere | 63.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1470696 | 2162886007 | Bacteria | 2119 |
| 2 | JGI25156J39149_1003834 | 3300002705 | Bacteria | 4784 |
| 3 | JGI25154J39366_1000722 | 3300002738 | Bacteria | 14934 |
| 4 | JGI25154J39366_1003188 | 3300002738 | Bacteria | 3614 |
| 5 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 6 | JGI25150J39212_1009418 | 3300002774 | Bacteria | 1861 |
| 7 | JGI25159J45721_1009411 | 3300002987 | Bacteria | 2580 |
| 8 | JGI25153J46596_10009509 | 3300003215 | Bacteria | 4505 |
| 9 | JGI25153J46596_10021360 | 3300003215 | Bacteria | 2415 |
| 10 | rootL2_10009352 | 3300003322 | Bacteria | 1409 |
| 11 | JGI25160J50197_1013586 | 3300003354 | Bacteria | 2768 |
| 12 | JGI25161J50226_1003713 | 3300003374 | Bacteria | 3406 |
| 13 | Ga0055539_1000283 | 3300003752 | Bacteria | 28988 |
| 14 | Ga0055539_1001579 | 3300003752 | Bacteria | 4126 |
| 15 | Ga0055533_1004794 | 3300003756 | Bacteria | 2334 |
| 16 | Ga0055525_1000793 | 3300003759 | Bacteria | 9998 |
| 17 | Ga0055535_1000824 | 3300003761 | Bacteria | 22261 |
| 18 | Ga0055535_1009850 | 3300003761 | Bacteria | 1612 |
| 19 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 20 | Ga0055529_1000198 | 3300003763 | Bacteria | 81554 |
| 21 | Ga0055526_1000867 | 3300003771 | Bacteria | 22551 |
| 22 | Ga0055537_1000067 | 3300003773 | Bacteria | 75689 |
| 23 | Ga0055524_1000097 | 3300003775 | Bacteria | 108145 |
| 24 | Ga0055536_1002788 | 3300003781 | Bacteria | 9662 |
| 25 | Ga0055536_1004581 | 3300003781 | Bacteria | 7014 |
| 26 | Ga0055534_1000079 | 3300003784 | Bacteria | 75689 |
| 27 | Ga0055534_1000343 | 3300003784 | Bacteria | 30091 |
| 28 | Ga0055534_1009668 | 3300003784 | Bacteria | 2077 |
| 29 | Ga0055528_1003321 | 3300003790 | Bacteria | 8152 |
| 30 | Ga0055530_10001788 | 3300003791 | Bacteria | 14935 |
| 31 | Ga0055530_10004712 | 3300003791 | Bacteria | 6900 |
| 32 | Ga0055530_10024260 | 3300003791 | Bacteria | 1724 |
| 33 | Ga0055540_1000023 | 3300003792 | Bacteria | 201131 |
| 34 | Ga0055540_1001704 | 3300003792 | Bacteria | 12646 |
| 35 | Ga0055540_1004292 | 3300003792 | Bacteria | 6506 |
| 36 | Ga0055540_1005572 | 3300003792 | Bacteria | 5250 |
| 37 | Ga0055531_10002097 | 3300003794 | Bacteria | 13692 |
| 38 | Ga0055531_10012543 | 3300003794 | Bacteria | 3977 |
| 39 | Ga0065165_1003246 | 3300005262 | Bacteria | 11779 |
| 40 | Ga0065714_10040147 | 3300005288 | Bacteria | 1234 |
| 41 | Ga0065704_10086689 | 3300005289 | Bacteria | 3094 |
| 42 | Ga0070658_10007950 | 3300005327 | Bacteria | 8535 |
| 43 | Ga0070658_10012665 | 3300005327 | Bacteria | 6764 |
| 44 | Ga0070676_10001363 | 3300005328 | Bacteria | 12301 |
| 45 | Ga0070676_10089141 | 3300005328 | Bacteria | 1886 |
| 46 | Ga0070683_100015611 | 3300005329 | Bacteria | 6675 |
| 47 | Ga0070683_100031088 | 3300005329 | Bacteria | 4851 |
| 48 | Ga0070690_100007195 | 3300005330 | Bacteria | 6367 |
| 49 | Ga0070670_100014490 | 3300005331 | Bacteria | 6769 |
| 50 | Ga0070670_100021093 | 3300005331 | Bacteria | 5603 |
| 51 | Ga0070670_100053119 | 3300005331 | Bacteria | 3479 |
| 52 | Ga0068869_100010062 | 3300005334 | Bacteria | 6151 |
| 53 | Ga0068869_100141312 | 3300005334 | Bacteria | 1859 |
| 54 | Ga0070680_100031302 | 3300005336 | Bacteria | 4277 |
| 55 | Ga0068868_100049768 | 3300005338 | Bacteria | 3289 |
| 56 | Ga0068868_100241476 | 3300005338 | Bacteria | 1518 |
| 57 | Ga0070689_100286232 | 3300005340 | Bacteria | 1368 |
| 58 | Ga0070661_100023678 | 3300005344 | Bacteria | 4403 |
| 59 | Ga0070661_100091951 | 3300005344 | Bacteria | 2247 |
| 60 | Ga0070661_100109872 | 3300005344 | Bacteria | 2058 |
| 61 | Ga0070668_100070023 | 3300005347 | Bacteria | 2730 |
| 62 | Ga0070669_100007534 | 3300005353 | Bacteria | 7795 |
| 63 | Ga0070675_100086136 | 3300005354 | Bacteria | 2625 |
| 64 | Ga0070675_100105903 | 3300005354 | Bacteria | 2373 |
| 65 | Ga0070671_100100643 | 3300005355 | Bacteria | 2425 |
| 66 | Ga0070674_100189336 | 3300005356 | Bacteria | 1582 |
| 67 | Ga0070673_100132327 | 3300005364 | Bacteria | 2095 |
| 68 | Ga0070673_100242815 | 3300005364 | Bacteria | 1567 |
| 69 | Ga0070659_100011700 | 3300005366 | Bacteria | 6495 |
| 70 | Ga0070659_100052372 | 3300005366 | Bacteria | 3210 |
| 71 | Ga0070659_100062881 | 3300005366 | Bacteria | 2935 |
| 72 | Ga0070659_100239670 | 3300005366 | Bacteria | 1500 |
| 73 | Ga0070667_100298656 | 3300005367 | Bacteria | 1450 |
| 74 | Ga0070667_100354064 | 3300005367 | Bacteria | 1330 |
| 75 | Ga0070667_100356138 | 3300005367 | Bacteria | 1326 |
| 76 | Ga0070709_10007882 | 3300005434 | Bacteria | 5849 |
| 77 | Ga0070714_100003435 | 3300005435 | Bacteria | 11801 |
| 78 | Ga0070714_100034010 | 3300005435 | Bacteria | 4267 |
| 79 | Ga0070713_100000095 | 3300005436 | Bacteria | 56677 |
| 80 | Ga0070711_100100947 | 3300005439 | Bacteria | 2099 |
| 81 | Ga0070708_100072291 | 3300005445 | Bacteria | 3107 |
| 82 | Ga0070663_100048938 | 3300005455 | Bacteria | 2999 |
| 83 | Ga0070663_100387349 | 3300005455 | Bacteria | 1140 |
| 84 | Ga0070678_100148582 | 3300005456 | Bacteria | 1885 |
| 85 | Ga0070662_100033486 | 3300005457 | Bacteria | 3618 |
| 86 | Ga0070662_100137020 | 3300005457 | Bacteria | 1893 |
| 87 | Ga0070662_100179872 | 3300005457 | Bacteria | 1666 |
| 88 | Ga0070681_10000303 | 3300005458 | Bacteria | 40005 |
| 89 | Ga0070681_10004398 | 3300005458 | Bacteria | 13426 |
| 90 | Ga0070681_10013414 | 3300005458 | Bacteria | 8140 |
| 91 | Ga0068867_100000977 | 3300005459 | Bacteria | 19533 |
| 92 | Ga0068867_100005245 | 3300005459 | Bacteria | 9150 |
| 93 | Ga0068867_100032525 | 3300005459 | Bacteria | 3773 |
| 94 | Ga0068867_100034907 | 3300005459 | Bacteria | 3646 |
| 95 | Ga0068867_100035250 | 3300005459 | Bacteria | 3628 |
| 96 | Ga0068867_100183981 | 3300005459 | Bacteria | 1663 |
| 97 | Ga0068867_100211552 | 3300005459 | Bacteria | 1558 |
| 98 | Ga0070706_100000271 | 3300005467 | Bacteria | 63046 |
| 99 | Ga0070706_100034773 | 3300005467 | Bacteria | 4654 |
| 100 | Ga0070699_100210728 | 3300005518 | Bacteria | 1730 |
| 101 | Ga0070679_100005860 | 3300005530 | Bacteria | 11407 |
| 102 | Ga0070679_100302474 | 3300005530 | Bacteria | 1550 |
| 103 | Ga0070684_100036216 | 3300005535 | Bacteria | 4228 |
| 104 | Ga0068853_100006049 | 3300005539 | Bacteria | 9574 |
| 105 | Ga0068853_100080282 | 3300005539 | Bacteria | 2854 |
| 106 | Ga0068853_100477803 | 3300005539 | Bacteria | 1175 |
| 107 | Ga0070672_100051160 | 3300005543 | Bacteria | 3220 |
| 108 | Ga0070665_100008237 | 3300005548 | Bacteria | 10552 |
| 109 | Ga0070665_100358001 | 3300005548 | Bacteria | 1465 |
| 110 | Ga0070665_100375118 | 3300005548 | Bacteria | 1430 |
| 111 | Ga0068855_100094627 | 3300005563 | Bacteria | 3444 |
| 112 | Ga0068855_100185307 | 3300005563 | Bacteria | 2351 |
| 113 | Ga0068855_100317171 | 3300005563 | Bacteria | 1724 |
| 114 | Ga0068857_100001214 | 3300005577 | Bacteria | 20079 |
| 115 | Ga0068857_100006437 | 3300005577 | Bacteria | 10069 |
| 116 | Ga0068857_100099511 | 3300005577 | Bacteria | 2608 |
| 117 | Ga0068854_100005348 | 3300005578 | Bacteria | 8106 |
| 118 | Ga0068854_100148676 | 3300005578 | Bacteria | 1804 |
| 119 | Ga0068856_100003567 | 3300005614 | Bacteria | 15664 |
| 120 | Ga0068852_100105652 | 3300005616 | Bacteria | 2551 |
| 121 | Ga0068852_100157142 | 3300005616 | Bacteria | 2119 |
| 122 | Ga0068864_100047704 | 3300005618 | Bacteria | 3680 |
| 123 | Ga0068866_10056906 | 3300005718 | Bacteria | 2012 |
| 124 | Ga0068866_10077782 | 3300005718 | Bacteria | 1773 |
| 125 | Ga0068866_10156802 | 3300005718 | Bacteria | 1324 |
| 126 | Ga0068861_100000211 | 3300005719 | Bacteria | 31401 |
| 127 | Ga0068861_100025535 | 3300005719 | Bacteria | 4286 |
| 128 | Ga0068861_100035272 | 3300005719 | Bacteria | 3704 |
| 129 | Ga0068858_100194090 | 3300005842 | Bacteria | 1919 |
| 130 | Ga0068860_100011496 | 3300005843 | Bacteria | 8722 |
| 131 | Ga0068860_100403752 | 3300005843 | Bacteria | 1352 |
| 132 | Ga0068862_100016907 | 3300005844 | Bacteria | 6072 |
| 133 | Ga0068862_100104682 | 3300005844 | Bacteria | 2479 |
| 134 | Ga0081539_10000075 | 3300005985 | Bacteria | 229419 |
| 135 | Ga0070717_10002392 | 3300006028 | Bacteria | 13228 |
| 136 | Ga0075365_10004368 | 3300006038 | Bacteria | 7476 |
| 137 | Ga0075365_10013334 | 3300006038 | Bacteria | 4911 |
| 138 | Ga0075368_10044444 | 3300006042 | Bacteria | 1752 |
| 139 | Ga0075363_100023383 | 3300006048 | Bacteria | 3131 |
| 140 | Ga0075363_100096383 | 3300006048 | Bacteria | 1633 |
| 141 | Ga0075432_10012016 | 3300006058 | Bacteria | 2941 |
| 142 | Ga0075432_10032309 | 3300006058 | Bacteria | 1814 |
| 143 | Ga0070712_100032070 | 3300006175 | Bacteria | 3545 |
| 144 | Ga0070712_100049948 | 3300006175 | Bacteria | 2907 |
| 145 | Ga0075362_10003358 | 3300006177 | Bacteria | 5578 |
| 146 | Ga0075362_10005491 | 3300006177 | Bacteria | 4645 |
| 147 | Ga0075367_10002438 | 3300006178 | Bacteria | 8497 |
| 148 | Ga0075367_10008290 | 3300006178 | Bacteria | 5381 |
| 149 | Ga0075367_10009619 | 3300006178 | Bacteria | 5060 |
| 150 | Ga0075367_10086935 | 3300006178 | Bacteria | 1898 |
| 151 | Ga0075369_10003839 | 3300006186 | Bacteria | 5512 |
| 152 | Ga0075366_10000948 | 3300006195 | Bacteria | 14121 |
| 153 | Ga0075366_10004653 | 3300006195 | Bacteria | 7375 |
| 154 | Ga0075366_10010562 | 3300006195 | Bacteria | 5183 |
| 155 | Ga0075366_10020320 | 3300006195 | Bacteria | 3851 |
| 156 | Ga0075366_10033634 | 3300006195 | Bacteria | 3020 |
| 157 | Ga0075366_10039574 | 3300006195 | Bacteria | 2787 |
| 158 | Ga0075366_10054712 | 3300006195 | Bacteria | 2370 |
| 159 | Ga0075366_10057471 | 3300006195 | Bacteria | 2312 |
| 160 | Ga0075366_10085091 | 3300006195 | Bacteria | 1891 |
| 161 | Ga0075366_10088309 | 3300006195 | Bacteria | 1856 |
| 162 | Ga0075366_10121467 | 3300006195 | Bacteria | 1574 |
| 163 | Ga0075366_10122064 | 3300006195 | Bacteria | 1570 |
| 164 | Ga0075366_10127414 | 3300006195 | Bacteria | 1536 |
| 165 | Ga0075370_10000290 | 3300006353 | Bacteria | 18016 |
| 166 | Ga0075370_10001075 | 3300006353 | Bacteria | 11363 |
| 167 | Ga0075370_10002994 | 3300006353 | Bacteria | 7951 |
| 168 | Ga0075370_10006698 | 3300006353 | Bacteria | 5811 |
| 169 | Ga0075370_10011438 | 3300006353 | Bacteria | 4663 |
| 170 | Ga0075370_10019264 | 3300006353 | Bacteria | 3715 |
| 171 | Ga0075370_10026684 | 3300006353 | Bacteria | 3201 |
| 172 | Ga0075370_10029668 | 3300006353 | Bacteria | 3047 |
| 173 | Ga0075370_10063639 | 3300006353 | Bacteria | 2103 |
| 174 | Ga0075370_10116680 | 3300006353 | Bacteria | 1552 |
| 175 | Ga0075370_10157805 | 3300006353 | Bacteria | 1331 |
| 176 | Ga0075428_100002488 | 3300006844 | Bacteria | 20004 |
| 177 | Ga0075430_100006277 | 3300006846 | Bacteria | 10026 |
| 178 | Ga0075430_100065543 | 3300006846 | Bacteria | 3051 |
| 179 | Ga0075430_100109222 | 3300006846 | Bacteria | 2307 |
| 180 | Ga0075431_100131077 | 3300006847 | Bacteria | 2586 |
| 181 | Ga0075431_100165885 | 3300006847 | Bacteria | 2270 |
| 182 | Ga0075431_100266053 | 3300006847 | Bacteria | 1739 |
| 183 | Ga0075431_100348437 | 3300006847 | Bacteria | 1489 |
| 184 | Ga0075433_10220881 | 3300006852 | Bacteria | 1683 |
| 185 | Ga0075434_100032262 | 3300006871 | Bacteria | 5165 |
| 186 | Ga0075434_100033517 | 3300006871 | Bacteria | 5069 |
| 187 | Ga0075434_100444152 | 3300006871 | Bacteria | 1318 |
| 188 | Ga0068865_100007809 | 3300006881 | Bacteria | 6600 |
| 189 | Ga0097620_100180508 | 3300006931 | Bacteria | 2194 |
| 190 | Ga0079104_1000019 | 3300006946 | Bacteria | 269313 |
| 191 | Ga0099826_10004066 | 3300006948 | Bacteria | 10156 |
| 192 | Ga0105244_10010743 | 3300009036 | Bacteria | 5532 |
| 193 | Ga0105240_10076507 | 3300009093 | Bacteria | 4125 |
| 194 | Ga0105240_10103006 | 3300009093 | Bacteria | 3468 |
| 195 | Ga0105240_10121219 | 3300009093 | Bacteria | 3148 |
| 196 | Ga0105240_10253336 | 3300009093 | Bacteria | 2035 |
| 197 | Ga0111539_10001762 | 3300009094 | Bacteria | 28733 |
| 198 | Ga0111539_10017244 | 3300009094 | Bacteria | 8936 |
| 199 | Ga0111539_10069633 | 3300009094 | Bacteria | 4154 |
| 200 | Ga0111539_10512335 | 3300009094 | Bacteria | 1397 |
| 201 | Ga0105245_10045264 | 3300009098 | Bacteria | 3930 |
| 202 | Ga0105245_10157789 | 3300009098 | Bacteria | 2150 |
| 203 | Ga0114129_10004723 | 3300009147 | Bacteria | 19238 |
| 204 | Ga0114129_10019439 | 3300009147 | Bacteria | 9671 |
| 205 | Ga0114129_10487943 | 3300009147 | Bacteria | 1611 |
| 206 | Ga0105243_10002076 | 3300009148 | Bacteria | 16970 |
| 207 | Ga0105243_10006737 | 3300009148 | Bacteria | 8865 |
| 208 | Ga0105243_10009662 | 3300009148 | Bacteria | 7343 |
| 209 | Ga0105243_10121097 | 3300009148 | Bacteria | 2206 |
| 210 | Ga0105243_10195138 | 3300009148 | Bacteria | 1771 |
| 211 | Ga0105243_10347991 | 3300009148 | Bacteria | 1360 |
| 212 | Ga0105242_10308119 | 3300009176 | Bacteria | 1448 |
| 213 | Ga0105248_10200708 | 3300009177 | Bacteria | 2247 |
| 214 | Ga0105237_10005095 | 3300009545 | Bacteria | 14917 |
| 215 | Ga0105237_10023570 | 3300009545 | Bacteria | 6304 |
| 216 | Ga0105237_10055804 | 3300009545 | Bacteria | 3956 |
| 217 | Ga0105237_10066624 | 3300009545 | Bacteria | 3596 |
| 218 | Ga0105238_10014551 | 3300009551 | Bacteria | 7957 |
| 219 | Ga0105238_10099150 | 3300009551 | Bacteria | 2897 |
| 220 | Ga0105249_10011730 | 3300009553 | Bacteria | 7704 |
| 221 | Ga0105239_10000486 | 3300010375 | Bacteria | 57901 |
| 222 | Ga0105239_10013045 | 3300010375 | Bacteria | 9236 |
| 223 | Ga0105239_10051926 | 3300010375 | Bacteria | 4494 |
| 224 | Ga0105239_10079743 | 3300010375 | Bacteria | 3602 |
| 225 | Ga0105239_10084230 | 3300010375 | Bacteria | 3501 |
| 226 | Ga0105246_10089846 | 3300011119 | Bacteria | 2211 |
| 227 | Ga0157373_10060247 | 3300013100 | Bacteria | 2689 |
| 228 | Ga0157371_10060094 | 3300013102 | Bacteria | 2695 |
| 229 | Ga0157370_10004176 | 3300013104 | Bacteria | 16711 |
| 230 | Ga0157369_10034136 | 3300013105 | Bacteria | 5585 |
| 231 | Ga0157369_10034289 | 3300013105 | Bacteria | 5572 |
| 232 | Ga0157369_10035474 | 3300013105 | Bacteria | 5468 |
| 233 | Ga0157374_10204836 | 3300013296 | Bacteria | 1933 |
| 234 | Ga0157374_10268902 | 3300013296 | Bacteria | 1680 |
| 235 | Ga0157378_10329232 | 3300013297 | Bacteria | 1486 |
| 236 | Ga0163162_10009563 | 3300013306 | Bacteria | 9433 |
| 237 | Ga0163162_10017102 | 3300013306 | Bacteria | 7095 |
| 238 | Ga0163162_10056229 | 3300013306 | Bacteria | 3963 |
| 239 | Ga0163162_10151799 | 3300013306 | Bacteria | 2435 |
| 240 | Ga0157372_10192952 | 3300013307 | Bacteria | 2359 |
| 241 | Ga0157375_10009170 | 3300013308 | Bacteria | 8672 |
| 242 | Ga0157375_10077110 | 3300013308 | Bacteria | 3362 |
| 243 | Ga0163163_10047736 | 3300014325 | Bacteria | 4209 |
| 244 | Ga0182008_10010702 | 3300014497 | Bacteria | 4904 |
| 245 | Ga0157377_10000098 | 3300014745 | Bacteria | 62330 |
| 246 | Ga0157377_10014560 | 3300014745 | Bacteria | 4003 |
| 247 | Ga0157379_10032824 | 3300014968 | Bacteria | 4629 |
| 248 | Ga0157379_10156368 | 3300014968 | Bacteria | 2057 |
| 249 | Ga0182006_1001700 | 3300015261 | Bacteria | 12853 |
| 250 | Ga0163161_10000069 | 3300017792 | Bacteria | 103861 |
| 251 | Ga0163161_10040838 | 3300017792 | Bacteria | 3332 |
| 252 | Ga0163161_10155040 | 3300017792 | Bacteria | 1743 |
| 253 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 254 | Ga0209672_101260 | 3300025228 | Bacteria | 10050 |
| 255 | Ga0209147_101692 | 3300025229 | Bacteria | 7201 |
| 256 | Ga0209563_100141 | 3300025230 | Bacteria | 79513 |
| 257 | Ga0207427_100546 | 3300025231 | Bacteria | 19253 |
| 258 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 259 | Ga0209258_100044 | 3300025242 | Bacteria | 376336 |
| 260 | Ga0209258_100895 | 3300025242 | Bacteria | 15468 |
| 261 | Ga0207425_1000454 | 3300025245 | Bacteria | 26617 |
| 262 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 263 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 264 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 265 | Ga0209677_100133 | 3300025253 | Bacteria | 69526 |
| 266 | Ga0209677_100196 | 3300025253 | Bacteria | 48682 |
| 267 | Ga0209677_101707 | 3300025253 | Bacteria | 9139 |
| 268 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 269 | Ga0209148_1007575 | 3300025254 | Bacteria | 2243 |
| 270 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 271 | Ga0209759_1001188 | 3300025256 | Bacteria | 16333 |
| 272 | Ga0209759_1007638 | 3300025256 | Bacteria | 3454 |
| 273 | Ga0209759_1010820 | 3300025256 | Bacteria | 2641 |
| 274 | Ga0209129_1000119 | 3300025258 | Bacteria | 138904 |
| 275 | Ga0209129_1002491 | 3300025258 | Bacteria | 8980 |
| 276 | Ga0209129_1013750 | 3300025258 | Bacteria | 1763 |
| 277 | Ga0209565_1000146 | 3300025263 | Bacteria | 97720 |
| 278 | Ga0209565_1000294 | 3300025263 | Bacteria | 47770 |
| 279 | Ga0209565_1009636 | 3300025263 | Bacteria | 2435 |
| 280 | Ga0209455_1000048 | 3300025272 | Bacteria | 376260 |
| 281 | Ga0209673_1000701 | 3300025273 | Bacteria | 47545 |
| 282 | Ga0209673_1000860 | 3300025273 | Bacteria | 39448 |
| 283 | Ga0209673_1001758 | 3300025273 | Bacteria | 18056 |
| 284 | Ga0209130_1002114 | 3300025284 | Bacteria | 10573 |
| 285 | Ga0209675_1000024 | 3300025291 | Bacteria | 312615 |
| 286 | Ga0209675_1000765 | 3300025291 | Bacteria | 21581 |
| 287 | Ga0209675_1001622 | 3300025291 | Bacteria | 12638 |
| 288 | Ga0209675_1005663 | 3300025291 | Bacteria | 5163 |
| 289 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 290 | Ga0209676_1000434 | 3300025292 | Bacteria | 72286 |
| 291 | Ga0209676_1001176 | 3300025292 | Bacteria | 28320 |
| 292 | Ga0209676_1003444 | 3300025292 | Bacteria | 9733 |
| 293 | Ga0209025_1000116 | 3300025294 | Bacteria | 218293 |
| 294 | Ga0209025_1000394 | 3300025294 | Bacteria | 90347 |
| 295 | Ga0209025_1001285 | 3300025294 | Bacteria | 34421 |
| 296 | Ga0209025_1039755 | 3300025294 | Bacteria | 2047 |
| 297 | Ga0209025_1076451 | 3300025294 | Bacteria | 1160 |
| 298 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 299 | Ga0209564_1000155 | 3300025295 | Bacteria | 165859 |
| 300 | Ga0209564_1000292 | 3300025295 | Bacteria | 101735 |
| 301 | Ga0209758_1000107 | 3300025297 | Bacteria | 218293 |
| 302 | Ga0209758_1000194 | 3300025297 | Bacteria | 134196 |
| 303 | Ga0209758_1000572 | 3300025297 | Bacteria | 57723 |
| 304 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 305 | Ga0209050_1000378 | 3300025298 | Bacteria | 83974 |
| 306 | Ga0209050_1000489 | 3300025298 | Bacteria | 68506 |
| 307 | Ga0209050_1002520 | 3300025298 | Bacteria | 15407 |
| 308 | Ga0209256_1000038 | 3300025299 | Bacteria | 375225 |
| 309 | Ga0209256_1000051 | 3300025299 | Bacteria | 307241 |
| 310 | Ga0209256_1000087 | 3300025299 | Bacteria | 218290 |
| 311 | Ga0209256_1021719 | 3300025299 | Bacteria | 1962 |
| 312 | Ga0207426_1000123 | 3300025302 | Bacteria | 218290 |
| 313 | Ga0207426_1000176 | 3300025302 | Bacteria | 159819 |
| 314 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 315 | Ga0209051_1000079 | 3300025303 | Bacteria | 201183 |
| 316 | Ga0209051_1000174 | 3300025303 | Bacteria | 116896 |
| 317 | Ga0209051_1000262 | 3300025303 | Bacteria | 87898 |
| 318 | Ga0209051_1000808 | 3300025303 | Bacteria | 32707 |
| 319 | Ga0209051_1001248 | 3300025303 | Bacteria | 22770 |
| 320 | Ga0209051_1007547 | 3300025303 | Bacteria | 5926 |
| 321 | Ga0209051_1016576 | 3300025303 | Bacteria | 3327 |
| 322 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 323 | Ga0209257_1000139 | 3300025304 | Bacteria | 202285 |
| 324 | Ga0209257_1000183 | 3300025304 | Bacteria | 156618 |
| 325 | Ga0209257_1010519 | 3300025304 | Bacteria | 4664 |
| 326 | Ga0207697_10005258 | 3300025315 | Bacteria | 6034 |
| 327 | Ga0207655_1001900 | 3300025728 | Bacteria | 17918 |
| 328 | Ga0207692_10075906 | 3300025898 | Bacteria | 1784 |
| 329 | Ga0207642_10099462 | 3300025899 | Bacteria | 1456 |
| 330 | Ga0207642_10163533 | 3300025899 | Bacteria | 1197 |
| 331 | Ga0207699_10001164 | 3300025906 | Bacteria | 12445 |
| 332 | Ga0207645_10001218 | 3300025907 | Bacteria | 21216 |
| 333 | Ga0207645_10006902 | 3300025907 | Bacteria | 8096 |
| 334 | Ga0207705_10007480 | 3300025909 | Bacteria | 8031 |
| 335 | Ga0207705_10033874 | 3300025909 | Bacteria | 3650 |
| 336 | Ga0207705_10043255 | 3300025909 | Bacteria | 3235 |
| 337 | Ga0207684_10022416 | 3300025910 | Bacteria | 5390 |
| 338 | Ga0207684_10022867 | 3300025910 | Bacteria | 5338 |
| 339 | Ga0207707_10017440 | 3300025912 | Bacteria | 6260 |
| 340 | Ga0207695_10034076 | 3300025913 | Bacteria | 5544 |
| 341 | Ga0207695_10184031 | 3300025913 | Bacteria | 2009 |
| 342 | Ga0207695_10219618 | 3300025913 | Bacteria | 1808 |
| 343 | Ga0207671_10036946 | 3300025914 | Bacteria | 3622 |
| 344 | Ga0207671_10044758 | 3300025914 | Bacteria | 3273 |
| 345 | Ga0207671_10238207 | 3300025914 | Bacteria | 1429 |
| 346 | Ga0207693_10049312 | 3300025915 | Bacteria | 3307 |
| 347 | Ga0207693_10096332 | 3300025915 | Bacteria | 2320 |
| 348 | Ga0207663_10045480 | 3300025916 | Bacteria | 2701 |
| 349 | Ga0207660_10057729 | 3300025917 | Bacteria | 2780 |
| 350 | Ga0207662_10003468 | 3300025918 | Bacteria | 8121 |
| 351 | Ga0207657_10057170 | 3300025919 | Bacteria | 3363 |
| 352 | Ga0207652_10029606 | 3300025921 | Bacteria | 4581 |
| 353 | Ga0207652_10255779 | 3300025921 | Bacteria | 1579 |
| 354 | Ga0207694_10018463 | 3300025924 | Bacteria | 5272 |
| 355 | Ga0207694_10145778 | 3300025924 | Bacteria | 1906 |
| 356 | Ga0207650_10027819 | 3300025925 | Bacteria | 4050 |
| 357 | Ga0207650_10169958 | 3300025925 | Bacteria | 1732 |
| 358 | Ga0207659_10169739 | 3300025926 | Bacteria | 1720 |
| 359 | Ga0207687_10067765 | 3300025927 | Bacteria | 2540 |
| 360 | Ga0207687_10431595 | 3300025927 | Bacteria | 1089 |
| 361 | Ga0207700_10029460 | 3300025928 | Bacteria | 3874 |
| 362 | Ga0207664_10009748 | 3300025929 | Bacteria | 6755 |
| 363 | Ga0207664_10014644 | 3300025929 | Bacteria | 5671 |
| 364 | Ga0207644_10033476 | 3300025931 | Bacteria | 3591 |
| 365 | Ga0207644_10341088 | 3300025931 | Bacteria | 1215 |
| 366 | Ga0207690_10027761 | 3300025932 | Bacteria | 3580 |
| 367 | Ga0207690_10300680 | 3300025932 | Bacteria | 1255 |
| 368 | Ga0207706_10000333 | 3300025933 | Bacteria | 51195 |
| 369 | Ga0207706_10021056 | 3300025933 | Bacteria | 5857 |
| 370 | Ga0207706_10046814 | 3300025933 | Bacteria | 3828 |
| 371 | Ga0207709_10000242 | 3300025935 | Bacteria | 67423 |
| 372 | Ga0207709_10003704 | 3300025935 | Bacteria | 9000 |
| 373 | Ga0207709_10015707 | 3300025935 | Bacteria | 4202 |
| 374 | Ga0207709_10018244 | 3300025935 | Bacteria | 3926 |
| 375 | Ga0207709_10232822 | 3300025935 | Bacteria | 1335 |
| 376 | Ga0207670_10272540 | 3300025936 | Bacteria | 1316 |
| 377 | Ga0207669_10057744 | 3300025937 | Bacteria | 2364 |
| 378 | Ga0207669_10198293 | 3300025937 | Bacteria | 1455 |
| 379 | Ga0207704_10068833 | 3300025938 | Bacteria | 2233 |
| 380 | Ga0207704_10270041 | 3300025938 | Bacteria | 1287 |
| 381 | Ga0207689_10004626 | 3300025942 | Bacteria | 12450 |
| 382 | Ga0207689_10008711 | 3300025942 | Bacteria | 8830 |
| 383 | Ga0207689_10037128 | 3300025942 | Bacteria | 4043 |
| 384 | Ga0207661_10036941 | 3300025944 | Bacteria | 3816 |
| 385 | Ga0207679_10015159 | 3300025945 | Bacteria | 5084 |
| 386 | Ga0207667_10015058 | 3300025949 | Bacteria | 8796 |
| 387 | Ga0207667_10022788 | 3300025949 | Bacteria | 6908 |
| 388 | Ga0207667_10155762 | 3300025949 | Bacteria | 2351 |
| 389 | Ga0207712_10122406 | 3300025961 | Bacteria | 1970 |
| 390 | Ga0207668_10054701 | 3300025972 | Bacteria | 2771 |
| 391 | Ga0207640_10029183 | 3300025981 | Bacteria | 3383 |
| 392 | Ga0207640_10184987 | 3300025981 | Bacteria | 1566 |
| 393 | Ga0207658_10060391 | 3300025986 | Bacteria | 2829 |
| 394 | Ga0207658_10099972 | 3300025986 | Bacteria | 2270 |
| 395 | Ga0207658_10230334 | 3300025986 | Bacteria | 1564 |
| 396 | Ga0207677_10049757 | 3300026023 | Bacteria | 2830 |
| 397 | Ga0207703_10054670 | 3300026035 | Bacteria | 3248 |
| 398 | Ga0207639_10009566 | 3300026041 | Bacteria | 6691 |
| 399 | Ga0207639_10011578 | 3300026041 | Bacteria | 6128 |
| 400 | Ga0207639_10044289 | 3300026041 | Bacteria | 3346 |
| 401 | Ga0207639_10058016 | 3300026041 | Bacteria | 2975 |
| 402 | Ga0207639_10353905 | 3300026041 | Bacteria | 1312 |
| 403 | Ga0207678_10105731 | 3300026067 | Bacteria | 2401 |
| 404 | Ga0207678_10164151 | 3300026067 | Bacteria | 1897 |
| 405 | Ga0207708_10044263 | 3300026075 | Bacteria | 3392 |
| 406 | Ga0207702_10001078 | 3300026078 | Bacteria | 27950 |
| 407 | Ga0207702_10062662 | 3300026078 | Bacteria | 3177 |
| 408 | Ga0207641_10033648 | 3300026088 | Bacteria | 4258 |
| 409 | Ga0207641_10102369 | 3300026088 | Bacteria | 2525 |
| 410 | Ga0207648_10000614 | 3300026089 | Bacteria | 39971 |
| 411 | Ga0207648_10001597 | 3300026089 | Bacteria | 24813 |
| 412 | Ga0207648_10005261 | 3300026089 | Bacteria | 13061 |
| 413 | Ga0207648_10019266 | 3300026089 | Bacteria | 6159 |
| 414 | Ga0207648_10066755 | 3300026089 | Bacteria | 3137 |
| 415 | Ga0207648_10108530 | 3300026089 | Bacteria | 2436 |
| 416 | Ga0207648_10150071 | 3300026089 | Bacteria | 2056 |
| 417 | Ga0207676_10101719 | 3300026095 | Bacteria | 2383 |
| 418 | Ga0207674_10003592 | 3300026116 | Bacteria | 18911 |
| 419 | Ga0207674_10003720 | 3300026116 | Bacteria | 18622 |
| 420 | Ga0207674_10027625 | 3300026116 | Bacteria | 5999 |
| 421 | Ga0207674_10041448 | 3300026116 | Bacteria | 4762 |
| 422 | Ga0207674_10059264 | 3300026116 | Bacteria | 3875 |
| 423 | Ga0207674_10148350 | 3300026116 | Bacteria | 2303 |
| 424 | Ga0207674_10248806 | 3300026116 | Bacteria | 1724 |
| 425 | Ga0207675_100004236 | 3300026118 | Bacteria | 13870 |
| 426 | Ga0207675_100010073 | 3300026118 | Bacteria | 8863 |
| 427 | Ga0207675_100064585 | 3300026118 | Bacteria | 3421 |
| 428 | Ga0207683_10019535 | 3300026121 | Bacteria | 5787 |
| 429 | Ga0207698_10096196 | 3300026142 | Bacteria | 2440 |
| 430 | Ga0207698_10102407 | 3300026142 | Bacteria | 2377 |
| 431 | Ga0207698_10266586 | 3300026142 | Bacteria | 1576 |
| 432 | Ga0209281_1000160 | 3300027111 | Bacteria | 161071 |
| 433 | Ga0209282_1002689 | 3300027666 | Bacteria | 10367 |
| 434 | Ga0209813_10035431 | 3300027866 | Bacteria | 1495 |
| 435 | Ga0209974_10000950 | 3300027876 | Bacteria | 10142 |
| 436 | Ga0207428_10006795 | 3300027907 | Bacteria | 10493 |
| 437 | Ga0268266_10008775 | 3300028379 | Bacteria | 8960 |
| 438 | Ga0268266_10299413 | 3300028379 | Bacteria | 1500 |
| 439 | Ga0268264_10013578 | 3300028381 | Bacteria | 6705 |
| 440 | Ga0268264_10566654 | 3300028381 | Bacteria | 1116 |
| 441 | Ga0265336_10000053 | 3300028666 | Bacteria | 113034 |
| 442 | Ga0307517_10000918 | 3300028786 | Bacteria | 49925 |
| 443 | Ga0307517_10042428 | 3300028786 | Bacteria | 4879 |
| 444 | Ga0307517_10156830 | 3300028786 | Bacteria | 1541 |
| 445 | Ga0307515_10000109 | 3300028794 | Bacteria | 195895 |
| 446 | Ga0307515_10000180 | 3300028794 | Bacteria | 156173 |
| 447 | Ga0307515_10001052 | 3300028794 | Bacteria | 63228 |
| 448 | Ga0307515_10001755 | 3300028794 | Bacteria | 48316 |
| 449 | Ga0307515_10008086 | 3300028794 | Bacteria | 20612 |
| 450 | Ga0307515_10028385 | 3300028794 | Bacteria | 9513 |
| 451 | Ga0307515_10036146 | 3300028794 | Bacteria | 8004 |
| 452 | Ga0307515_10115941 | 3300028794 | Bacteria | 3080 |
| 453 | Ga0307515_10231632 | 3300028794 | Bacteria | 1638 |
| 454 | Ga0265338_10040752 | 3300028800 | Bacteria | 4357 |
| 455 | Ga0265324_10001024 | 3300029957 | Bacteria | 17194 |
| 456 | Ga0265324_10024174 | 3300029957 | Bacteria | 2160 |
| 457 | Ga0307512_10011673 | 3300030522 | Bacteria | 8309 |
| 458 | Ga0307512_10039143 | 3300030522 | Bacteria | 3976 |
| 459 | Ga0307512_10049067 | 3300030522 | Bacteria | 3408 |
| 460 | Ga0307512_10093899 | 3300030522 | Bacteria | 2073 |
| 461 | Ga0307512_10137097 | 3300030522 | Bacteria | 1511 |
| 462 | Ga0316177_1082843 | 3300030731 | Bacteria | 2584 |
| 463 | Ga0316178_1038078 | 3300030735 | Bacteria | 3324 |
| 464 | Ga0316182_1251449 | 3300030745 | Bacteria | 2171 |
| 465 | Ga0265327_10000108 | 3300031251 | Bacteria | 183209 |
| 466 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 467 | Ga0307513_10010428 | 3300031456 | Bacteria | 11648 |
| 468 | Ga0307513_10020823 | 3300031456 | Bacteria | 7764 |
| 469 | Ga0307513_10043585 | 3300031456 | Bacteria | 4925 |
| 470 | Ga0307513_10368293 | 3300031456 | Bacteria | 1180 |
| 471 | Ga0307509_10000509 | 3300031507 | Bacteria | 66233 |
| 472 | Ga0307509_10011291 | 3300031507 | Bacteria | 10833 |
| 473 | Ga0307509_10240228 | 3300031507 | Bacteria | 1605 |
| 474 | Ga0307408_100000486 | 3300031548 | Bacteria | 34736 |
| 475 | Ga0307408_100002069 | 3300031548 | Bacteria | 14442 |
| 476 | Ga0307408_100015362 | 3300031548 | Bacteria | 5096 |
| 477 | Ga0307408_100030077 | 3300031548 | Bacteria | 3769 |
| 478 | Ga0307408_100074954 | 3300031548 | Bacteria | 2512 |
| 479 | Ga0307408_100213304 | 3300031548 | Bacteria | 1570 |
| 480 | Ga0307508_10000099 | 3300031616 | Bacteria | 102389 |
| 481 | Ga0307508_10000237 | 3300031616 | Bacteria | 67014 |
| 482 | Ga0307508_10005913 | 3300031616 | Bacteria | 11546 |
| 483 | Ga0307508_10029594 | 3300031616 | Bacteria | 4950 |
| 484 | Ga0307508_10282134 | 3300031616 | Bacteria | 1254 |
| 485 | Ga0307514_10001936 | 3300031649 | Bacteria | 22633 |
| 486 | Ga0307514_10004431 | 3300031649 | Bacteria | 12924 |
| 487 | Ga0307514_10014300 | 3300031649 | Bacteria | 6573 |
| 488 | Ga0307514_10070423 | 3300031649 | Bacteria | 2626 |
| 489 | Ga0307516_10000488 | 3300031730 | Bacteria | 52667 |
| 490 | Ga0307516_10008370 | 3300031730 | Bacteria | 11720 |
| 491 | Ga0307516_10024759 | 3300031730 | Bacteria | 6126 |
| 492 | Ga0307516_10033702 | 3300031730 | Bacteria | 5153 |
| 493 | Ga0307516_10034231 | 3300031730 | Bacteria | 5107 |
| 494 | Ga0307516_10081209 | 3300031730 | Bacteria | 3085 |
| 495 | Ga0307405_10077442 | 3300031731 | Bacteria | 2161 |
| 496 | Ga0307405_10203994 | 3300031731 | Bacteria | 1438 |
| 497 | Ga0307405_10428207 | 3300031731 | Bacteria | 1043 |
| 498 | Ga0307413_10094015 | 3300031824 | Bacteria | 1961 |
| 499 | Ga0307410_10038930 | 3300031852 | Bacteria | 3118 |
| 500 | Ga0307406_10002798 | 3300031901 | Bacteria | 9517 |
| 501 | Ga0307406_10010897 | 3300031901 | Bacteria | 5141 |
| 502 | Ga0307406_10057634 | 3300031901 | Bacteria | 2492 |
| 503 | Ga0307406_10135307 | 3300031901 | Bacteria | 1736 |
| 504 | Ga0307406_10208775 | 3300031901 | Bacteria | 1443 |
| 505 | Ga0307412_10019946 | 3300031911 | Bacteria | 4070 |
| 506 | Ga0307412_10092388 | 3300031911 | Bacteria | 2120 |
| 507 | Ga0307416_100009752 | 3300032002 | Bacteria | 6309 |
| 508 | Ga0307416_100054803 | 3300032002 | Bacteria | 3207 |
| 509 | Ga0307416_100093151 | 3300032002 | Bacteria | 2594 |
| 510 | Ga0307414_10126122 | 3300032004 | Bacteria | 1978 |
| 511 | Ga0307414_10141118 | 3300032004 | Bacteria | 1886 |
| 512 | Ga0307411_10024459 | 3300032005 | Bacteria | 3601 |
| 513 | Ga0307510_10000794 | 3300033180 | Bacteria | 32695 |
| 514 | Ga0307510_10010876 | 3300033180 | Bacteria | 10812 |
| 515 | Ga0307510_10031892 | 3300033180 | Bacteria | 5943 |
| 516 | Ga0373934_0000172 | 3300035086 | Bacteria | 23693 |
| 517 | Ga0373934_0004886 | 3300035086 | Bacteria | 4961 |
| 518 | Ga0373944_0037891 | 3300035089 | Bacteria | 1479 |
| 519 | Ga0373923_0001124 | 3300035111 | Bacteria | 7389 |
| 520 | Ga0373939_0000028 | 3300035114 | Bacteria | 53215 |
| 521 | Ga0373953_0001178 | 3300035117 | Bacteria | 7437 |
| 522 | Ga0373956_0002530 | 3300035119 | Bacteria | 7446 |
| 523 | Ga0373955_0002332 | 3300035172 | Bacteria | 8268 |
| 524 | Ga0373931_0000156 | 3300035691 | Bacteria | 29608 |
| 525 | Ga0373931_0034988 | 3300035691 | Bacteria | 2609 |
| 526 | Ga0373931_0137602 | 3300035691 | Bacteria | 1411 |
| 527 | Ga0373935_0132491 | 3300035692 | Bacteria | 1676 |
| 528 | Ga0373935_0317886 | 3300035692 | Bacteria | 1104 |
| 529 | Ga0373927_0012844 | 3300035695 | Bacteria | 5568 |
| 530 | Ga0373933_0000064 | 3300035724 | Bacteria | 64360 |
| 531 | Ga0373937_0000104 | 3300036401 | Bacteria | 80334 |
| 532 | Ga0373937_0024629 | 3300036401 | Bacteria | 5430 |
| 533 | Ga0373937_0084373 | 3300036401 | Bacteria | 2939 |
| 534 | Ga0373937_0530986 | 3300036401 | Bacteria | 1118 |
| 535 | Ga0373925_0003082 | 3300037068 | Bacteria | 13081 |
| 536 | Ga0373925_0004860 | 3300037068 | Bacteria | 10116 |
| 537 | Ga0395899_0011426 | 3300037312 | Bacteria | 6797 |
| 538 | Ga0395899_0128066 | 3300037312 | Bacteria | 1815 |
| 539 | Ga0395898_0006478 | 3300037466 | Bacteria | 12503 |
| 540 | Ga0395905_0052544 | 3300037471 | Bacteria | 3814 |
| 541 | Ga0395905_0150396 | 3300037471 | Bacteria | 2190 |
| 542 | Ga0395901_0000336 | 3300038443 | Bacteria | 57518 |
| 543 | Ga0395901_0085167 | 3300038443 | Bacteria | 3304 |
| 544 | Ga0436365_0434710 | 3300039437 | Bacteria | 1386 |
| 545 | Ga0439465_0040615 | 3300041413 | Bacteria | 1504 |
| 546 | Ga0451793_1323104 | 3300041452 | Bacteria | 1726 |
| 547 | Ga0451798_0379219 | 3300041458 | Bacteria | 1271 |
| 548 | Ga0451800_0013398 | 3300041459 | Bacteria | 3545 |
| 549 | Ga0451800_1405191 | 3300041459 | Bacteria | 1383 |
| 550 | Ga0451807_1552671 | 3300041486 | Bacteria | 2684 |
| 551 | Ga0451833_1197908 | 3300041491 | Bacteria | 1301 |
| 552 | Ga0451843_0761211 | 3300041509 | Bacteria | 1184 |
| 553 | Ga0451853_2325733 | 3300041512 | Bacteria | 1890 |
| 554 | Ga0439449_0000640 | 3300042007 | Bacteria | 13147 |
| 555 | Ga0439449_0095586 | 3300042007 | Bacteria | 1098 |
| 556 | Ga0439450_018778 | 3300042008 | Bacteria | 1456 |
| 557 | Ga0439455_0047312 | 3300042012 | Bacteria | 1116 |
| 558 | Ga0450920_026091 | 3300042122 | Bacteria | 1139 |
| 559 | Ga0439434_0025800 | 3300042435 | Bacteria | 1775 |
| 560 | Ga0439434_0031881 | 3300042435 | Bacteria | 1603 |
| 561 | Ga0450918_000247 | 3300042531 | Bacteria | 12331 |
| 562 | Ga0451577_0008497 | 3300042876 | Bacteria | 9995 |
| 563 | Ga0451577_0015851 | 3300042876 | Bacteria | 6993 |
| 564 | Ga0451577_0222079 | 3300042876 | Bacteria | 1708 |
| 565 | Ga0466969_0009071 | 3300044656 | Bacteria | 5272 |
| 566 | Ga0466969_0016884 | 3300044656 | Bacteria | 3816 |
| 567 | Ga0466972_0021366 | 3300044658 | Bacteria | 3227 |
| 568 | Ga0453683_0006829 | 3300044673 | Bacteria | 7794 |
| 569 | Ga0466965_0009202 | 3300044683 | Bacteria | 4588 |
| 570 | Ga0466966_0022053 | 3300044684 | Bacteria | 4181 |
| 571 | Ga0466966_0114046 | 3300044684 | Bacteria | 1664 |
| 572 | Ga0466961_0006616 | 3300044693 | Bacteria | 7369 |
| 573 | Ga0466961_0030906 | 3300044693 | Bacteria | 3441 |
| 574 | Ga0466963_0272151 | 3300044694 | Bacteria | 1190 |
| 575 | Ga0466964_0005747 | 3300044706 | Bacteria | 4618 |
| 576 | Ga0453684_0006064 | 3300044712 | Bacteria | 23358 |
| 577 | Ga0453684_0034636 | 3300044712 | Bacteria | 7003 |
| 578 | Ga0453684_0078506 | 3300044712 | Bacteria | 4131 |
| 579 | Ga0453684_0127382 | 3300044712 | Bacteria | 3062 |
| 580 | Ga0466968_0029569 | 3300044735 | Bacteria | 2266 |
| 581 | Ga0466970_0130052 | 3300044765 | Bacteria | 1382 |
| 582 | Ga0466957_0143728 | 3300044842 | Bacteria | 1539 |
| 583 | Ga0466960_0031545 | 3300044901 | Bacteria | 2447 |
| 584 | Ga0466959_0026511 | 3300045049 | Bacteria | 4295 |
| 585 | Ga0466959_0077185 | 3300045049 | Bacteria | 2404 |
| 586 | Ga0451576_0004309 | 3300045051 | Bacteria | 18585 |
| 587 | Ga0451576_0014933 | 3300045051 | Bacteria | 8626 |
| 588 | Ga0451576_0101178 | 3300045051 | Bacteria | 2997 |
| 589 | Ga0466967_0057233 | 3300045976 | Bacteria | 3441 |
| 590 | Ga0495617_057934 | 3300046452 | Bacteria | 1284 |
| 591 | Ga0495592_0000140 | 3300046454 | Bacteria | 63848 |
| 592 | Ga0495592_0001845 | 3300046454 | Bacteria | 14904 |
| 593 | Ga0495603_0005272 | 3300046455 | Bacteria | 7713 |
| 594 | Ga0495590_0017553 | 3300046457 | Bacteria | 2574 |
| 595 | Ga0495629_0020763 | 3300046459 | Bacteria | 4689 |
| 596 | Ga0495629_0021712 | 3300046459 | Bacteria | 4580 |
| 597 | Ga0495629_0099403 | 3300046459 | Bacteria | 2030 |
| 598 | Ga0495638_0101805 | 3300046460 | Bacteria | 1717 |
| 599 | Ga0495651_0000378 | 3300046462 | Bacteria | 34517 |
| 600 | Ga0495651_0246324 | 3300046462 | Bacteria | 1223 |
| 601 | Ga0495653_0000741 | 3300046463 | Bacteria | 24909 |
| 602 | Ga0495650_0017321 | 3300046471 | Bacteria | 3615 |
| 603 | Ga0495650_0038126 | 3300046471 | Bacteria | 2085 |
| 604 | Ga0495580_0039704 | 3300046472 | Bacteria | 3367 |
| 605 | Ga0495580_0108808 | 3300046472 | Bacteria | 1924 |
| 606 | Ga0495605_0025774 | 3300046474 | Bacteria | 3061 |
| 607 | Ga0495639_0008610 | 3300046475 | Bacteria | 4375 |
| 608 | Ga0495584_0002297 | 3300046491 | Bacteria | 10905 |
| 609 | Ga0495584_0038277 | 3300046491 | Bacteria | 2424 |
| 610 | Ga0495585_0003905 | 3300046492 | Bacteria | 9889 |
| 611 | Ga0495585_0010619 | 3300046492 | Bacteria | 5473 |
| 612 | Ga0495585_0102361 | 3300046492 | Bacteria | 1530 |
| 613 | Ga0495585_0131384 | 3300046492 | Bacteria | 1317 |
| 614 | Ga0495594_0102820 | 3300046499 | Bacteria | 1608 |
| 615 | Ga0495607_0014431 | 3300046501 | Bacteria | 5141 |
| 616 | Ga0495607_0018499 | 3300046501 | Bacteria | 4442 |
| 617 | Ga0495607_0059443 | 3300046501 | Bacteria | 2180 |
| 618 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 619 | Ga0495583_0000159 | 3300046506 | Bacteria | 113627 |
| 620 | Ga0495583_0000185 | 3300046506 | Bacteria | 105958 |
| 621 | Ga0495606_0003437 | 3300046507 | Bacteria | 16806 |
| 622 | Ga0495608_0001892 | 3300046511 | Bacteria | 14988 |
| 623 | Ga0495608_0169380 | 3300046511 | Bacteria | 1386 |
| 624 | Ga0495610_0011182 | 3300046512 | Bacteria | 5505 |
| 625 | Ga0495610_0026825 | 3300046512 | Bacteria | 3071 |
| 626 | Ga0495610_0038554 | 3300046512 | Bacteria | 2425 |
| 627 | Ga0495616_0001038 | 3300046513 | Bacteria | 19867 |
| 628 | Ga0495616_0025389 | 3300046513 | Bacteria | 3166 |
| 629 | Ga0495616_0091057 | 3300046513 | Bacteria | 1444 |
| 630 | Ga0495620_0012100 | 3300046515 | Bacteria | 4476 |
| 631 | Ga0495620_0033242 | 3300046515 | Bacteria | 2343 |
| 632 | Ga0495628_0000925 | 3300046516 | Bacteria | 26902 |
| 633 | Ga0495630_0004964 | 3300046517 | Bacteria | 9357 |
| 634 | Ga0495631_0002040 | 3300046518 | Bacteria | 11762 |
| 635 | Ga0495632_0005702 | 3300046519 | Bacteria | 8175 |
| 636 | Ga0495632_0005966 | 3300046519 | Bacteria | 7935 |
| 637 | Ga0495643_0040749 | 3300046522 | Bacteria | 2535 |
| 638 | Ga0495643_0080464 | 3300046522 | Bacteria | 1696 |
| 639 | Ga0495644_0000163 | 3300046523 | Bacteria | 31558 |
| 640 | Ga0495644_0000657 | 3300046523 | Bacteria | 14478 |
| 641 | Ga0495644_0002234 | 3300046523 | Bacteria | 7743 |
| 642 | Ga0495648_0005067 | 3300046524 | Bacteria | 11059 |
| 643 | Ga0495648_0132539 | 3300046524 | Bacteria | 1323 |
| 644 | Ga0495652_0001978 | 3300046529 | Bacteria | 21813 |
| 645 | Ga0495665_0000407 | 3300046531 | Bacteria | 21941 |
| 646 | Ga0495587_0000504 | 3300046536 | Bacteria | 27268 |
| 647 | Ga0495609_0001121 | 3300046538 | Bacteria | 18556 |
| 648 | Ga0495621_0035232 | 3300046539 | Bacteria | 1733 |
| 649 | Ga0495597_0002754 | 3300046542 | Bacteria | 10822 |
| 650 | Ga0495597_0024694 | 3300046542 | Bacteria | 2772 |
| 651 | Ga0495597_0045118 | 3300046542 | Bacteria | 1957 |
| 652 | Ga0495645_0000702 | 3300046543 | Bacteria | 22941 |
| 653 | Ga0495622_0040310 | 3300046557 | Bacteria | 2174 |
| 654 | Ga0495622_0071822 | 3300046557 | Bacteria | 1597 |
| 655 | Ga0495633_0012733 | 3300046558 | Bacteria | 4460 |
| 656 | Ga0495667_0000295 | 3300046559 | Bacteria | 32117 |
| 657 | Ga0495656_0037977 | 3300046615 | Bacteria | 1992 |
| 658 | Ga0495668_0080386 | 3300046616 | Bacteria | 1789 |
| 659 | Ga0495668_0111110 | 3300046616 | Bacteria | 1499 |
| 660 | Ga0495611_0014136 | 3300046648 | Bacteria | 3406 |
| 661 | Ga0495611_0018132 | 3300046648 | Bacteria | 3016 |
| 662 | Ga0495611_0019535 | 3300046648 | Bacteria | 2910 |
| 663 | Ga0495625_0000311 | 3300046660 | Bacteria | 74209 |
| 664 | Ga0495625_0003763 | 3300046660 | Bacteria | 14734 |
| 665 | Ga0495625_0004856 | 3300046660 | Bacteria | 12537 |
| 666 | Ga0495625_0007125 | 3300046660 | Bacteria | 9822 |
| 667 | Ga0495625_0075158 | 3300046660 | Bacteria | 2364 |
| 668 | Ga0495635_0000027 | 3300046663 | Bacteria | 123782 |
| 669 | Ga0495659_0000004 | 3300046664 | Bacteria | 143914 |
| 670 | Ga0495659_0002446 | 3300046664 | Bacteria | 5990 |
| 671 | Ga0495659_0010315 | 3300046664 | Bacteria | 2994 |
| 672 | Ga0495661_0040181 | 3300046665 | Bacteria | 2903 |
| 673 | Ga0495661_0122378 | 3300046665 | Bacteria | 1435 |
| 674 | Ga0495588_0021641 | 3300046674 | Bacteria | 3171 |
| 675 | Ga0495657_0001428 | 3300046675 | Bacteria | 20672 |
| 676 | Ga0495599_0001223 | 3300046678 | Bacteria | 14557 |
| 677 | Ga0495623_0001252 | 3300046679 | Bacteria | 17239 |
| 678 | Ga0495646_0001274 | 3300046680 | Bacteria | 14825 |
| 679 | Ga0495647_0017099 | 3300046681 | Bacteria | 2562 |
| 680 | Ga0495658_0007628 | 3300046683 | Bacteria | 5362 |
| 681 | Ga0495658_0013346 | 3300046683 | Bacteria | 4180 |
| 682 | Ga0495658_0076979 | 3300046683 | Bacteria | 1950 |
| 683 | Ga0495669_0014639 | 3300046684 | Bacteria | 3353 |
| 684 | Ga0495613_0035304 | 3300046689 | Bacteria | 3711 |
| 685 | Ga0495624_0037050 | 3300046690 | Bacteria | 3140 |
| 686 | Ga0495670_0004151 | 3300046691 | Bacteria | 7100 |
| 687 | Ga0495671_0000548 | 3300046692 | Bacteria | 28176 |
| 688 | Ga0495671_0011372 | 3300046692 | Bacteria | 4900 |
| 689 | Ga0495671_0016274 | 3300046692 | Bacteria | 3974 |
| 690 | Ga0495671_0030601 | 3300046692 | Bacteria | 2755 |
| 691 | Ga0495671_0043887 | 3300046692 | Bacteria | 2243 |
| 692 | Ga0495671_0056373 | 3300046692 | Bacteria | 1945 |
| 693 | Ga0495649_0001187 | 3300046694 | Bacteria | 20128 |
| 694 | Ga0495649_0001310 | 3300046694 | Bacteria | 19011 |
| 695 | Ga0495589_0008654 | 3300046794 | Bacteria | 5305 |
| 696 | Ga0495589_0055703 | 3300046794 | Bacteria | 1948 |
| 697 | Ga0495600_0000439 | 3300046809 | Bacteria | 21384 |
| 698 | Ga0495660_0007860 | 3300046810 | Bacteria | 6263 |
| 699 | Ga0495581_0074160 | 3300047315 | Bacteria | 1969 |
| 700 | Ga0495604_0001033 | 3300047317 | Bacteria | 23218 |
| 701 | Ga0495636_0000383 | 3300047318 | Bacteria | 16670 |
| 702 | Ga0495636_0008721 | 3300047318 | Bacteria | 3998 |
| 703 | Ga0495674_0012369 | 3300047319 | Bacteria | 8039 |
| 704 | Ga0495672_0000045 | 3300047320 | Bacteria | 255145 |
| 705 | Ga0495672_0000835 | 3300047320 | Bacteria | 32845 |
| 706 | Ga0495672_0013305 | 3300047320 | Bacteria | 5683 |
| 707 | Ga0495676_0012050 | 3300047321 | Bacteria | 7798 |
| 708 | Ga0495676_0045103 | 3300047321 | Bacteria | 3592 |
| 709 | Ga0495680_0010170 | 3300047322 | Bacteria | 8406 |
| 710 | Ga0495687_000863 | 3300047443 | Bacteria | 32127 |
| 711 | Ga0495687_001223 | 3300047443 | Bacteria | 24535 |
| 712 | Ga0495687_003425 | 3300047443 | Bacteria | 11511 |
| 713 | Ga0495677_0001387 | 3300047445 | Bacteria | 9691 |
| 714 | Ga0495677_0053862 | 3300047445 | Bacteria | 1483 |
| 715 | Ga0495685_000161 | 3300047447 | Bacteria | 22547 |
| 716 | Ga0495684_0000116 | 3300047471 | Bacteria | 57957 |
| 717 | Ga0495686_0001957 | 3300047472 | Bacteria | 20470 |
| 718 | Ga0495593_0000111 | 3300047673 | Bacteria | 38262 |
| 719 | Ga0495593_0100035 | 3300047673 | Bacteria | 1487 |
| 720 | Ga0495602_0002782 | 3300048088 | Bacteria | 17882 |
| 721 | Ga0495614_0000527 | 3300048089 | Bacteria | 15768 |
| 722 | Ga0495614_0099981 | 3300048089 | Bacteria | 1266 |
| 723 | Ga0495626_0015064 | 3300048091 | Bacteria | 3963 |
| 724 | Ga0496104_0299627 | 3300048907 | Bacteria | 1520 |
| 725 | Ga0496109_0079118 | 3300048912 | Bacteria | 3028 |
| 726 | Ga0496109_0258128 | 3300048912 | Bacteria | 1641 |
| 727 | Ga0496110_0295788 | 3300048913 | Bacteria | 1475 |
| 728 | Ga0496112_0075923 | 3300048915 | Bacteria | 3324 |
| 729 | Ga0496113_0172195 | 3300048916 | Bacteria | 1715 |
| 730 | Ga0496114_0026911 | 3300048917 | Bacteria | 4711 |
| 731 | Ga0496116_0034568 | 3300048919 | Bacteria | 3564 |
| 732 | Ga0496117_0070292 | 3300048920 | Bacteria | 2352 |
| 733 | Ga0496118_0005315 | 3300048921 | Bacteria | 14678 |
| 734 | Ga0496118_0034971 | 3300048921 | Bacteria | 4089 |
| 735 | Ga0496119_0142349 | 3300048922 | Bacteria | 1293 |
| 736 | Ga0496120_0133240 | 3300048923 | Bacteria | 1270 |
| 737 | Ga0496121_0007376 | 3300048924 | Bacteria | 13291 |
| 738 | Ga0496123_0159495 | 3300048926 | Bacteria | 1204 |
| 739 | Ga0496124_0008990 | 3300048927 | Bacteria | 10338 |
| 740 | Ga0496124_0238352 | 3300048927 | Bacteria | 1355 |
| 741 | Ga0496125_0071362 | 3300048928 | Bacteria | 2713 |
| 742 | Ga0501304_000207 | 3300049160 | Bacteria | 2570 |
| 743 | Ga0495678_002384 | 3300049459 | Bacteria | 12869 |
| 744 | Ga0495678_008398 | 3300049459 | Bacteria | 5210 |
| 745 | Ga0495682_0000206 | 3300049460 | Bacteria | 47410 |
| 746 | Ga0495682_0000261 | 3300049460 | Bacteria | 41788 |
| 747 | Ga0495682_0012369 | 3300049460 | Bacteria | 3272 |
| 748 | Ga0501292_020890 | 3300049515 | Bacteria | 1058 |
| 749 | Ga0501315_000768 | 3300049531 | Bacteria | 2411 |
| 750 | Ga0501316_000316 | 3300049532 | Bacteria | 3112 |
| 751 | Ga0501034_0153351 | 3300049571 | Bacteria | 2279 |
| 752 | Ga0501202_006817 | 3300049652 | Bacteria | 2053 |
| 753 | Ga0501216_015228 | 3300049660 | Bacteria | 1294 |
| 754 | Ga0501253_010475 | 3300049683 | Bacteria | 1398 |
| 755 | Ga0501225_0003407 | 3300049705 | Bacteria | 4824 |
| 756 | Ga0501262_000459 | 3300049759 | Bacteria | 4848 |
| 757 | Ga0501265_005330 | 3300049762 | Bacteria | 1480 |
| 758 | Ga0501268_004451 | 3300049765 | Bacteria | 1976 |
| 759 | nmdc:mga03683_9478_c1 | 3300050489 | Bacteria | 3465 |
| 760 | nmdc:mga03683_986_c1 | 3300050489 | Bacteria | 8300 |
| 761 | nmdc:mga03n38_165812_c1 | 3300050490 | Bacteria | 1122 |
| 762 | nmdc:mga03n38_5724_c1 | 3300050490 | Bacteria | 4259 |
| 763 | nmdc:mga00v17_2326_c1 | 3300050491 | Bacteria | 9735 |
| 764 | nmdc:mga0yw44_149293_c1 | 3300050492 | Bacteria | 1524 |
| 765 | nmdc:mga0yw44_3664_c1 | 3300050492 | Bacteria | 4118 |
| 766 | nmdc:mga0k408_10561_c1 | 3300050493 | Bacteria | 4999 |
| 767 | nmdc:mga0k408_110387_c1 | 3300050493 | Bacteria | 1626 |
| 768 | nmdc:mga0k408_12245_c1 | 3300050493 | Bacteria | 4687 |
| 769 | nmdc:mga0k408_13437_c1 | 3300050493 | Bacteria | 4491 |
| 770 | nmdc:mga0k408_136611_c1 | 3300050493 | Bacteria | 1457 |
| 771 | nmdc:mga0k408_140678_c1 | 3300050493 | Bacteria | 1436 |
| 772 | nmdc:mga0k408_16255_c1 | 3300050493 | Bacteria | 4126 |
| 773 | nmdc:mga0k408_16868_c1 | 3300050493 | Bacteria | 4060 |
| 774 | nmdc:mga0k408_186836_c1 | 3300050493 | Bacteria | 1236 |
| 775 | nmdc:mga0k408_2622_c1 | 3300050493 | Bacteria | 9558 |
| 776 | nmdc:mga0k408_32057_c1 | 3300050493 | Bacteria | 3002 |
| 777 | nmdc:mga0k408_4590_c1 | 3300050493 | Bacteria | 7327 |
| 778 | nmdc:mga0k408_838_c1 | 3300050493 | Bacteria | 10969 |
| 779 | nmdc:mga0k408_86703_c1 | 3300050493 | Bacteria | 1838 |
| 780 | nmdc:mga06z11_101374_c1 | 3300050494 | Bacteria | 1580 |
| 781 | nmdc:mga06z11_108257_c1 | 3300050494 | Bacteria | 1535 |
| 782 | nmdc:mga06z11_18075_c1 | 3300050494 | Bacteria | 3213 |
| 783 | nmdc:mga06z11_1988_c1 | 3300050494 | Bacteria | 7733 |
| 784 | nmdc:mga06z11_21345_c1 | 3300050494 | Bacteria | 3008 |
| 785 | nmdc:mga04h51_42134_c1 | 3300050495 | Bacteria | 1495 |
| 786 | nmdc:mga07m45_1016_c1 | 3300050496 | Bacteria | 12398 |
| 787 | nmdc:mga07m45_103_c1 | 3300050496 | Bacteria | 33229 |
| 788 | nmdc:mga07m45_104970_c1 | 3300050496 | Bacteria | 1625 |
| 789 | nmdc:mga07m45_131_c1 | 3300050496 | Bacteria | 29571 |
| 790 | nmdc:mga07m45_174168_c1 | 3300050496 | Bacteria | 1251 |
| 791 | nmdc:mga07m45_209191_c1 | 3300050496 | Bacteria | 1135 |
| 792 | nmdc:mga07m45_308_c1 | 3300050496 | Bacteria | 19736 |
| 793 | nmdc:mga07m45_33171_c1 | 3300050496 | Bacteria | 2867 |
| 794 | nmdc:mga07m45_76134_c2 | 3300050496 | Bacteria | 1437 |
| 795 | nmdc:mga07m45_82897_c1 | 3300050496 | Bacteria | 1832 |
| 796 | nmdc:mga05p37_1081_c1 | 3300050507 | Bacteria | 31276 |
| 797 | nmdc:mga05p37_198715_c1 | 3300050507 | Bacteria | 2430 |
| 798 | nmdc:mga05p37_81063_c1 | 3300050507 | Bacteria | 3997 |
| 799 | nmdc:mga09592_1109_c1 | 3300050508 | Bacteria | 21409 |
| 800 | nmdc:mga09592_3150_c2 | 3300050508 | Bacteria | 3241 |
| 801 | nmdc:mga0qj67_39179_c1 | 3300050509 | Bacteria | 3721 |
| 802 | nmdc:mga06r32_195077_c1 | 3300050510 | Bacteria | 2012 |
| 803 | nmdc:mga06r32_74060_c1 | 3300050510 | Bacteria | 3300 |
| 804 | nmdc:mga08y16_73348_c1 | 3300050511 | Bacteria | 3566 |
| 805 | nmdc:mga08y16_8989_c1 | 3300050511 | Bacteria | 10493 |
| 806 | nmdc:mga0n895_295217_c1 | 3300050512 | Bacteria | 1643 |
| 807 | nmdc:mga0n895_63730_c1 | 3300050512 | Bacteria | 3645 |
| 808 | nmdc:mga0a205_123948_c1 | 3300050515 | Bacteria | 2484 |
| 809 | nmdc:mga0sz30_22404_c1 | 3300050516 | Bacteria | 2564 |
| 810 | Ga0500610_0001519 | 3300053079 | Bacteria | 7965 |
| 811 | Ga0500610_0002412 | 3300053079 | Bacteria | 6875 |
| 812 | Ga0500635_0000035 | 3300053080 | Bacteria | 94938 |
| 813 | Ga0495595_0014662 | 3300053084 | Bacteria | 3329 |
| 814 | Ga0495619_0020561 | 3300053085 | Bacteria | 4206 |
| 815 | Ga0500578_0000057 | 3300053086 | Bacteria | 120178 |
| 816 | Ga0500578_0000683 | 3300053086 | Bacteria | 40592 |
| 817 | Ga0500651_0000133 | 3300053093 | Bacteria | 46244 |
| 818 | Ga0500651_0094551 | 3300053093 | Bacteria | 1837 |
| 819 | Ga0500641_0089510 | 3300053096 | Bacteria | 1313 |
| 820 | Ga0500562_038556 | 3300053108 | Bacteria | 1269 |
| 821 | Ga0500569_001196 | 3300053109 | Bacteria | 4817 |
| 822 | Ga0500571_000153 | 3300053110 | Bacteria | 23909 |
| 823 | Ga0500572_056981 | 3300053111 | Bacteria | 1179 |
| 824 | Ga0500592_003544 | 3300053116 | Bacteria | 2490 |
| 825 | Ga0500593_000449 | 3300053117 | Bacteria | 16281 |
| 826 | Ga0500593_004327 | 3300053117 | Bacteria | 5490 |
| 827 | Ga0500594_0000721 | 3300053118 | Bacteria | 7037 |
| 828 | Ga0500594_0000823 | 3300053118 | Bacteria | 6610 |
| 829 | Ga0500597_084989 | 3300053120 | Bacteria | 1373 |
| 830 | Ga0500607_027526 | 3300053121 | Bacteria | 3153 |
| 831 | Ga0500608_016018 | 3300053122 | Bacteria | 3379 |
| 832 | Ga0500623_077352 | 3300053127 | Bacteria | 1593 |
| 833 | Ga0500626_008205 | 3300053128 | Bacteria | 4287 |
| 834 | Ga0500642_0001435 | 3300053130 | Bacteria | 6831 |
| 835 | Ga0500642_0172302 | 3300053130 | Bacteria | 1013 |
| 836 | Ga0500652_000112 | 3300053131 | Bacteria | 31738 |
| 837 | Ga0500658_0000124 | 3300053134 | Bacteria | 36729 |
| 838 | Ga0500658_0000342 | 3300053134 | Bacteria | 20710 |
| 839 | Ga0500658_0001793 | 3300053134 | Bacteria | 8476 |
| 840 | Ga0500559_0000027 | 3300053136 | Bacteria | 118758 |
| 841 | Ga0500564_042638 | 3300053138 | Bacteria | 2086 |
| 842 | Ga0500568_0001367 | 3300053139 | Bacteria | 15853 |
| 843 | Ga0500574_021580 | 3300053141 | Bacteria | 1632 |
| 844 | Ga0500577_0048705 | 3300053142 | Bacteria | 1581 |
| 845 | Ga0500589_115363 | 3300053147 | Bacteria | 1146 |
| 846 | Ga0500622_0000187 | 3300053156 | Bacteria | 65366 |
| 847 | Ga0500622_0018677 | 3300053156 | Bacteria | 3684 |
| 848 | Ga0500627_0000606 | 3300053158 | Bacteria | 9577 |
| 849 | Ga0500627_0001918 | 3300053158 | Bacteria | 5974 |
| 850 | Ga0500634_0001113 | 3300053161 | Bacteria | 9973 |
| 851 | Ga0500634_0025886 | 3300053161 | Bacteria | 3193 |
| 852 | Ga0500634_0123534 | 3300053161 | Bacteria | 1255 |
| 853 | Ga0500638_003846 | 3300053162 | Bacteria | 5658 |
| 854 | Ga0500636_0009012 | 3300053177 | Bacteria | 5796 |
| 855 | Ga0500636_0010811 | 3300053177 | Bacteria | 5334 |
| 856 | Ga0500637_0129145 | 3300053178 | Bacteria | 1466 |
| 857 | Ga0500587_005473 | 3300053739 | Bacteria | 1706 |
| 858 | Ga0587084_006029 | 3300059477 | Bacteria | 1457 |
| 859 | Ga0587093_001079 | 3300059478 | Bacteria | 2183 |
| 860 | Ga0587093_003533 | 3300059478 | Bacteria | 1540 |
| 861 | Ga0587066_006337 | 3300059490 | Bacteria | 1558 |
| 862 | Ga0587070_000447 | 3300059491 | Bacteria | 3401 |
| 863 | Ga0587070_001146 | 3300059491 | Bacteria | 2637 |
| 864 | Ga0587070_008806 | 3300059491 | Bacteria | 1441 |
| 865 | Ga0587077_000158 | 3300059493 | Bacteria | 4484 |
| 866 | Ga0587077_001244 | 3300059493 | Bacteria | 2667 |
| 867 | Ga0587077_003034 | 3300059493 | Bacteria | 2072 |
| 868 | Ga0587083_0000234 | 3300059505 | Bacteria | 4227 |
| 869 | Ga0587083_0000943 | 3300059505 | Bacteria | 2998 |
| 870 | Ga0587083_0007482 | 3300059505 | Bacteria | 1675 |
| 871 | Ga0587085_000466 | 3300059506 | Bacteria | 3004 |
| 872 | Ga0587090_000183 | 3300059510 | Bacteria | 4415 |
| 873 | Ga0587090_007306 | 3300059510 | Bacteria | 1447 |
| 874 | Ga0587091_000456 | 3300059511 | Bacteria | 3506 |
| 875 | Ga0587092_000527 | 3300059512 | Bacteria | 3123 |
| 876 | Ga0587094_002704 | 3300059513 | Bacteria | 1856 |
| 877 | Ga0587094_003838 | 3300059513 | Bacteria | 1668 |
| 878 | Ga0587101_000394 | 3300059623 | Bacteria | 3008 |
| 879 | Ga0587101_000917 | 3300059623 | Bacteria | 2359 |
| 880 | Ga0587101_001108 | 3300059623 | Bacteria | 2210 |
| 881 | Ga0587115_005668 | 3300059626 | Bacteria | 1413 |
| 882 | Ga0587062_000340 | 3300059639 | Bacteria | 3104 |
| 883 | Ga0587068_000926 | 3300059641 | Bacteria | 3045 |
| 884 | Ga0587068_001812 | 3300059641 | Bacteria | 2487 |
| 885 | Ga0587068_002162 | 3300059641 | Bacteria | 2350 |
| 886 | Ga0587069_001296 | 3300059642 | Bacteria | 2251 |
| 887 | Ga0587075_000722 | 3300059644 | Bacteria | 2851 |
| 888 | Ga0587076_000484 | 3300059645 | Bacteria | 3271 |
| 889 | Ga0587076_001845 | 3300059645 | Bacteria | 2257 |
| 890 | Ga0587078_000307 | 3300059646 | Bacteria | 3448 |
| 891 | Ga0587078_002833 | 3300059646 | Bacteria | 1707 |
| 892 | Ga0587079_002858 | 3300059647 | Bacteria | 2183 |
| 893 | Ga0587079_007339 | 3300059647 | Bacteria | 1645 |
| 894 | Ga0587100_000174 | 3300059648 | Bacteria | 2647 |
| 895 | Ga0587102_000521 | 3300059649 | Bacteria | 2240 |
| 896 | Ga0587118_00294 | 3300059657 | Bacteria | 2362 |
| 897 | Ga0587119_000650 | 3300059658 | Bacteria | 2433 |
| 898 | Ga0587124_000224 | 3300059660 | Bacteria | 2755 |
| 899 | Ga0587071_000866 | 3300060344 | Bacteria | 3443 |
| 900 | Ga0587111_0000401 | 3300060346 | Bacteria | 4017 |
| 901 | Ga0587111_0000679 | 3300060346 | Bacteria | 3504 |
| 902 | Ga0587111_0002077 | 3300060346 | Bacteria | 2592 |
| 903 | Ga0466962_0012958 | 3300061719 | Bacteria | 4010 |
| 904 | Ga0466962_0042044 | 3300061719 | Bacteria | 2187 |
| 905 | Ga0466962_0053363 | 3300061719 | Bacteria | 1932 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100286232 | Ga0070689_1002862322 | 256 |
| 2 | 3300005539 | Ga0068853_100080282 | Ga0068853_1000802821 | 256 |
| 3 | 3300025918 | Ga0207662_10003468 | Ga0207662_100034686 | 256 |
| 4 | 3300005347 | Ga0070668_100070023 | Ga0070668_1000700232 | 261 |
| 5 | 3300009177 | Ga0105248_10200708 | Ga0105248_102007082 | 261 |
| 6 | 3300014968 | Ga0157379_10156368 | Ga0157379_101563681 | 261 |
| 7 | 3300025933 | Ga0207706_10000333 | Ga0207706_1000033315 | 261 |
| 8 | 3300025938 | Ga0207704_10270041 | Ga0207704_102700412 | 261 |
| 9 | 3300025972 | Ga0207668_10054701 | Ga0207668_100547012 | 261 |
| 10 | 3300026023 | Ga0207677_10049757 | Ga0207677_100497573 | 261 |
| 11 | 3300026075 | Ga0207708_10044263 | Ga0207708_100442632 | 261 |
| 12 | 3300045051 | Ga0451576_0101178 | Ga0451576_0101178_319_1299 | 261 |
| 13 | 3300005336 | Ga0070680_100031302 | Ga0070680_1000313023 | 276 |
| 14 | 3300006847 | Ga0075431_100131077 | Ga0075431_1001310772 | 283 |
| 15 | 3300006852 | Ga0075433_10220881 | Ga0075433_102208812 | 283 |
| 16 | 3300006871 | Ga0075434_100032262 | Ga0075434_1000322623 | 283 |
| 17 | 3300050507 | nmdc:mga05p37_198715_c1 | nmdc:mga05p37_198715_c1_888_1865 | 283 |
| 18 | 3300050515 | nmdc:mga0a205_123948_c1 | nmdc:mga0a205_123948_c1_434_1411 | 283 |
| 19 | 3300005329 | Ga0070683_100031088 | Ga0070683_1000310883 | 287 |
| 20 | 3300005331 | Ga0070670_100053119 | Ga0070670_1000531193 | 287 |
| 21 | 3300005344 | Ga0070661_100023678 | Ga0070661_1000236783 | 287 |
| 22 | 3300005356 | Ga0070674_100189336 | Ga0070674_1001893362 | 287 |
| 23 | 3300005364 | Ga0070673_100242815 | Ga0070673_1002428152 | 287 |
| 24 | 3300005366 | Ga0070659_100011700 | Ga0070659_1000117003 | 287 |
| 25 | 3300005458 | Ga0070681_10000303 | Ga0070681_1000030334 | 287 |
| 26 | 3300005530 | Ga0070679_100005860 | Ga0070679_1000058603 | 287 |
| 27 | 3300005535 | Ga0070684_100036216 | Ga0070684_1000362162 | 287 |
| 28 | 3300005577 | Ga0068857_100001214 | Ga0068857_1000012145 | 287 |
| 29 | 3300025912 | Ga0207707_10017440 | Ga0207707_100174404 | 287 |
| 30 | 3300025917 | Ga0207660_10057729 | Ga0207660_100577293 | 287 |
| 31 | 3300025921 | Ga0207652_10029606 | Ga0207652_100296063 | 287 |
| 32 | 3300026116 | Ga0207674_10003720 | Ga0207674_100037207 | 287 |
| 33 | 3300026142 | Ga0207698_10096196 | Ga0207698_100961963 | 287 |
| 34 | 3300031824 | Ga0307413_10094015 | Ga0307413_100940152 | 287 |
| 35 | 3300031852 | Ga0307410_10038930 | Ga0307410_100389302 | 287 |
| 36 | 3300032004 | Ga0307414_10126122 | Ga0307414_101261222 | 287 |
| 37 | 3300046452 | Ga0495617_057934 | Ga0495617_057934_128_1168 | 287 |
| 38 | 3300002774 | JGI25150J39212_1009418 | JGI25150J39212_10094182 | 291 |
| 39 | 3300003215 | JGI25153J46596_10009509 | JGI25153J46596_100095092 | 291 |
| 40 | 3300003771 | Ga0055526_1000867 | Ga0055526_100086717 | 291 |
| 41 | 3300006178 | Ga0075367_10086935 | Ga0075367_100869352 | 291 |
| 42 | 3300006195 | Ga0075366_10039574 | Ga0075366_100395742 | 291 |
| 43 | 3300006353 | Ga0075370_10019264 | Ga0075370_100192643 | 291 |
| 44 | 3300025245 | Ga0207425_1000454 | Ga0207425_100045422 | 291 |
| 45 | 3300025258 | Ga0209129_1000119 | Ga0209129_100011944 | 291 |
| 46 | 3300025295 | Ga0209564_1000024 | Ga0209564_100002444 | 291 |
| 47 | 3300025297 | Ga0209758_1000194 | Ga0209758_1000194123 | 291 |
| 48 | 3300027866 | Ga0209813_10035431 | Ga0209813_100354312 | 291 |
| 49 | 3300050494 | nmdc:mga06z11_101374_c1 | nmdc:mga06z11_101374_c1_262_1215 | 291 |
| 50 | 3300050495 | nmdc:mga04h51_42134_c1 | nmdc:mga04h51_42134_c1_245_1198 | 291 |
| 51 | 3300025303 | Ga0209051_1007547 | Ga0209051_10075473 | 292 |
| 52 | 3300003215 | JGI25153J46596_10021360 | JGI25153J46596_100213602 | 294 |
| 53 | 3300025297 | Ga0209758_1000572 | Ga0209758_100057245 | 294 |
| 54 | 3300053108 | Ga0500562_038556 | Ga0500562_038556_153_1094 | 294 |
| 55 | 3300053147 | Ga0500589_115363 | Ga0500589_115363_197_1126 | 294 |
| 56 | 3300005329 | Ga0070683_100015611 | Ga0070683_1000156114 | 295 |
| 57 | 3300005331 | Ga0070670_100021093 | Ga0070670_1000210935 | 295 |
| 58 | 3300005344 | Ga0070661_100091951 | Ga0070661_1000919512 | 295 |
| 59 | 3300005366 | Ga0070659_100062881 | Ga0070659_1000628813 | 295 |
| 60 | 3300005844 | Ga0068862_100104682 | Ga0068862_1001046823 | 295 |
| 61 | 3300013105 | Ga0157369_10035474 | Ga0157369_100354742 | 295 |
| 62 | 3300014745 | Ga0157377_10014560 | Ga0157377_100145602 | 295 |
| 63 | 3300025942 | Ga0207689_10004626 | Ga0207689_100046266 | 295 |
| 64 | 3300025944 | Ga0207661_10036941 | Ga0207661_100369413 | 295 |
| 65 | 3300026041 | Ga0207639_10044289 | Ga0207639_100442892 | 295 |
| 66 | 3300026116 | Ga0207674_10003592 | Ga0207674_1000359218 | 295 |
| 67 | 3300041512 | Ga0451853_2325733 | Ga0451853_2325733_886_1845 | 296 |
| 68 | 3300005354 | Ga0070675_100086136 | Ga0070675_1000861363 | 297 |
| 69 | 3300005367 | Ga0070667_100356138 | Ga0070667_1003561382 | 297 |
| 70 | 3300005455 | Ga0070663_100048938 | Ga0070663_1000489383 | 297 |
| 71 | 3300005459 | Ga0068867_100211552 | Ga0068867_1002115522 | 297 |
| 72 | 3300005577 | Ga0068857_100099511 | Ga0068857_1000995112 | 297 |
| 73 | 3300006058 | Ga0075432_10032309 | Ga0075432_100323092 | 297 |
| 74 | 3300006177 | Ga0075362_10003358 | Ga0075362_100033583 | 297 |
| 75 | 3300006178 | Ga0075367_10002438 | Ga0075367_100024389 | 297 |
| 76 | 3300006353 | Ga0075370_10006698 | Ga0075370_100066986 | 297 |
| 77 | 3300009093 | Ga0105240_10076507 | Ga0105240_100765074 | 297 |
| 78 | 3300009545 | Ga0105237_10023570 | Ga0105237_100235702 | 297 |
| 79 | 3300010375 | Ga0105239_10079743 | Ga0105239_100797432 | 297 |
| 80 | 3300025913 | Ga0207695_10034076 | Ga0207695_100340764 | 297 |
| 81 | 3300026067 | Ga0207678_10105731 | Ga0207678_101057312 | 297 |
| 82 | 3300026116 | Ga0207674_10248806 | Ga0207674_102488062 | 297 |
| 83 | 3300026142 | Ga0207698_10266586 | Ga0207698_102665862 | 297 |
| 84 | 3300050494 | nmdc:mga06z11_21345_c1 | nmdc:mga06z11_21345_c1_1449_2411 | 297 |
| 85 | 3300005459 | Ga0068867_100032525 | Ga0068867_1000325252 | 298 |
| 86 | 3300025937 | Ga0207669_10057744 | Ga0207669_100577443 | 298 |
| 87 | 3300026089 | Ga0207648_10066755 | Ga0207648_100667554 | 298 |
| 88 | 3300046519 | Ga0495632_0005966 | Ga0495632_0005966_6773_7726 | 298 |
| 89 | 3300053127 | Ga0500623_077352 | Ga0500623_077352_460_1413 | 298 |
| 90 | 3300053156 | Ga0500622_0000187 | Ga0500622_0000187_11530_12483 | 298 |
| 91 | 3300031548 | Ga0307408_100000486 | Ga0307408_1000004865 | 299 |
| 92 | 3300031901 | Ga0307406_10057634 | Ga0307406_100576342 | 299 |
| 93 | 3300005328 | Ga0070676_10089141 | Ga0070676_100891412 | 300 |
| 94 | 3300005353 | Ga0070669_100007534 | Ga0070669_1000075343 | 300 |
| 95 | 3300005354 | Ga0070675_100105903 | Ga0070675_1001059033 | 300 |
| 96 | 3300005457 | Ga0070662_100033486 | Ga0070662_1000334863 | 300 |
| 97 | 3300005543 | Ga0070672_100051160 | Ga0070672_1000511602 | 300 |
| 98 | 3300005616 | Ga0068852_100105652 | Ga0068852_1001056522 | 300 |
| 99 | 3300005719 | Ga0068861_100000211 | Ga0068861_1000002115 | 300 |
| 100 | 3300006871 | Ga0075434_100033517 | Ga0075434_1000335173 | 300 |
| 101 | 3300010375 | Ga0105239_10013045 | Ga0105239_100130457 | 300 |
| 102 | 3300013306 | Ga0163162_10017102 | Ga0163162_100171023 | 300 |
| 103 | 3300025315 | Ga0207697_10005258 | Ga0207697_100052583 | 300 |
| 104 | 3300025907 | Ga0207645_10006902 | Ga0207645_100069027 | 300 |
| 105 | 3300026088 | Ga0207641_10102369 | Ga0207641_101023692 | 300 |
| 106 | 3300026118 | Ga0207675_100010073 | Ga0207675_1000100736 | 300 |
| 107 | 3300046542 | Ga0495597_0024694 | Ga0495597_0024694_610_1572 | 300 |
| 108 | 3300047443 | Ga0495687_000863 | Ga0495687_000863_4981_5943 | 300 |
| 109 | 3300050512 | nmdc:mga0n895_63730_c1 | nmdc:mga0n895_63730_c1_932_1912 | 300 |
| 110 | 3300005262 | Ga0065165_1003246 | Ga0065165_10032465 | 301 |
| 111 | 3300005718 | Ga0068866_10056906 | Ga0068866_100569062 | 301 |
| 112 | 3300009094 | Ga0111539_10017244 | Ga0111539_100172445 | 301 |
| 113 | 3300013297 | Ga0157378_10329232 | Ga0157378_103292322 | 301 |
| 114 | 3300025298 | Ga0209050_1000489 | Ga0209050_100048916 | 301 |
| 115 | 3300025303 | Ga0209051_1016576 | Ga0209051_10165762 | 301 |
| 116 | 3300025931 | Ga0207644_10341088 | Ga0207644_103410882 | 301 |
| 117 | 3300026089 | Ga0207648_10108530 | Ga0207648_101085302 | 301 |
| 118 | 3300039437 | Ga0436365_0434710 | Ga0436365_0434710_179_1186 | 301 |
| 119 | 3300046506 | Ga0495583_0000159 | Ga0495583_0000159_15248_16252 | 302 |
| 120 | 3300046507 | Ga0495606_0003437 | Ga0495606_0003437_15527_16531 | 302 |
| 121 | 3300046616 | Ga0495668_0111110 | Ga0495668_0111110_44_1090 | 302 |
| 122 | 3300046660 | Ga0495625_0003763 | Ga0495625_0003763_2563_3567 | 302 |
| 123 | 3300046684 | Ga0495669_0014639 | Ga0495669_0014639_1620_2624 | 302 |
| 124 | 3300046694 | Ga0495649_0001310 | Ga0495649_0001310_17214_18218 | 302 |
| 125 | 3300046794 | Ga0495589_0008654 | Ga0495589_0008654_770_1774 | 302 |
| 126 | 3300053177 | Ga0500636_0010811 | Ga0500636_0010811_2464_3468 | 302 |
| 127 | 3300005366 | Ga0070659_100052372 | Ga0070659_1000523722 | 303 |
| 128 | 3300005458 | Ga0070681_10004398 | Ga0070681_100043988 | 303 |
| 129 | 3300005458 | Ga0070681_10013414 | Ga0070681_100134145 | 303 |
| 130 | 3300005563 | Ga0068855_100185307 | Ga0068855_1001853071 | 303 |
| 131 | 3300005578 | Ga0068854_100148676 | Ga0068854_1001486761 | 303 |
| 132 | 3300005985 | Ga0081539_10000075 | Ga0081539_10000075122 | 303 |
| 133 | 3300006844 | Ga0075428_100002488 | Ga0075428_10000248822 | 303 |
| 134 | 3300006846 | Ga0075430_100006277 | Ga0075430_10000627712 | 303 |
| 135 | 3300006847 | Ga0075431_100165885 | Ga0075431_1001658852 | 303 |
| 136 | 3300009545 | Ga0105237_10055804 | Ga0105237_100558043 | 303 |
| 137 | 3300010375 | Ga0105239_10051926 | Ga0105239_100519262 | 303 |
| 138 | 3300025932 | Ga0207690_10027761 | Ga0207690_100277613 | 303 |
| 139 | 3300025949 | Ga0207667_10155762 | Ga0207667_101557622 | 303 |
| 140 | 3300025981 | Ga0207640_10184987 | Ga0207640_101849871 | 303 |
| 141 | 3300026041 | Ga0207639_10011578 | Ga0207639_100115781 | 303 |
| 142 | 3300027907 | Ga0207428_10006795 | Ga0207428_1000679511 | 303 |
| 143 | 3300031548 | Ga0307408_100015362 | Ga0307408_1000153622 | 303 |
| 144 | 3300031731 | Ga0307405_10077442 | Ga0307405_100774422 | 303 |
| 145 | 3300031901 | Ga0307406_10208775 | Ga0307406_102087752 | 303 |
| 146 | 3300042435 | Ga0439434_0031881 | Ga0439434_0031881_458_1393 | 303 |
| 147 | 3300050510 | nmdc:mga06r32_74060_c1 | nmdc:mga06r32_74060_c1_2008_2925 | 303 |
| 148 | 3300005435 | Ga0070714_100003435 | Ga0070714_1000034352 | 304 |
| 149 | 3300006946 | Ga0079104_1000019 | Ga0079104_100001962 | 304 |
| 150 | 3300025898 | Ga0207692_10075906 | Ga0207692_100759062 | 304 |
| 151 | 3300025929 | Ga0207664_10014644 | Ga0207664_100146442 | 304 |
| 152 | 3300027111 | Ga0209281_1000160 | Ga0209281_100016062 | 304 |
| 153 | 3300041452 | Ga0451793_1323104 | Ga0451793_1323104_378_1331 | 304 |
| 154 | 3300041458 | Ga0451798_0379219 | Ga0451798_0379219_150_1103 | 304 |
| 155 | 3300041459 | Ga0451800_0013398 | Ga0451800_0013398_282_1235 | 304 |
| 156 | 3300053096 | Ga0500641_0089510 | Ga0500641_0089510_327_1280 | 304 |
| 157 | 3300053109 | Ga0500569_001196 | Ga0500569_001196_886_1839 | 304 |
| 158 | 3300053130 | Ga0500642_0001435 | Ga0500642_0001435_357_1310 | 304 |
| 159 | 3300053131 | Ga0500652_000112 | Ga0500652_000112_5448_6401 | 304 |
| 160 | 3300053142 | Ga0500577_0048705 | Ga0500577_0048705_373_1326 | 304 |
| 161 | 3300028800 | Ga0265338_10040752 | Ga0265338_100407522 | 305 |
| 162 | 3300035692 | Ga0373935_0317886 | Ga0373935_0317886_70_1011 | 305 |
| 163 | 3300046459 | Ga0495629_0099403 | Ga0495629_0099403_381_1322 | 305 |
| 164 | 3300046683 | Ga0495658_0076979 | Ga0495658_0076979_709_1650 | 305 |
| 165 | 3300003775 | Ga0055524_1000097 | Ga0055524_100009734 | 307 |
| 166 | 3300003791 | Ga0055530_10001788 | Ga0055530_100017885 | 307 |
| 167 | 3300003792 | Ga0055540_1000023 | Ga0055540_1000023121 | 307 |
| 168 | 3300003794 | Ga0055531_10012543 | Ga0055531_100125432 | 307 |
| 169 | 3300005434 | Ga0070709_10007882 | Ga0070709_100078823 | 307 |
| 170 | 3300005435 | Ga0070714_100034010 | Ga0070714_1000340103 | 307 |
| 171 | 3300005436 | Ga0070713_100000095 | Ga0070713_10000009557 | 307 |
| 172 | 3300005439 | Ga0070711_100100947 | Ga0070711_1001009472 | 307 |
| 173 | 3300006028 | Ga0070717_10002392 | Ga0070717_100023922 | 307 |
| 174 | 3300006175 | Ga0070712_100049948 | Ga0070712_1000499483 | 307 |
| 175 | 3300025263 | Ga0209565_1009636 | Ga0209565_10096363 | 307 |
| 176 | 3300025291 | Ga0209675_1005663 | Ga0209675_10056633 | 307 |
| 177 | 3300025298 | Ga0209050_1000378 | Ga0209050_100037811 | 307 |
| 178 | 3300025299 | Ga0209256_1000051 | Ga0209256_100005165 | 307 |
| 179 | 3300025303 | Ga0209051_1000079 | Ga0209051_100007966 | 307 |
| 180 | 3300025304 | Ga0209257_1000183 | Ga0209257_100018324 | 307 |
| 181 | 3300025906 | Ga0207699_10001164 | Ga0207699_100011646 | 307 |
| 182 | 3300025915 | Ga0207693_10096332 | Ga0207693_100963322 | 307 |
| 183 | 3300025916 | Ga0207663_10045480 | Ga0207663_100454802 | 307 |
| 184 | 3300025928 | Ga0207700_10029460 | Ga0207700_100294602 | 307 |
| 185 | 3300025929 | Ga0207664_10009748 | Ga0207664_100097482 | 307 |
| 186 | 3300044656 | Ga0466969_0009071 | Ga0466969_0009071_3867_4823 | 307 |
| 187 | 3300044684 | Ga0466966_0114046 | Ga0466966_0114046_85_1041 | 307 |
| 188 | 3300044693 | Ga0466961_0006616 | Ga0466961_0006616_2617_3573 | 307 |
| 189 | 3300044842 | Ga0466957_0143728 | Ga0466957_0143728_209_1165 | 307 |
| 190 | 3300045049 | Ga0466959_0077185 | Ga0466959_0077185_533_1489 | 307 |
| 191 | 3300048917 | Ga0496114_0026911 | Ga0496114_0026911_379_1371 | 307 |
| 192 | 3300061719 | Ga0466962_0053363 | Ga0466962_0053363_534_1490 | 307 |
| 193 | 3300026041 | Ga0207639_10353905 | Ga0207639_103539051 | 308 |
| 194 | 3300026142 | Ga0207698_10102407 | Ga0207698_101024072 | 308 |
| 195 | 3300031731 | Ga0307405_10203994 | Ga0307405_102039941 | 308 |
| 196 | 3300041509 | Ga0451843_0761211 | Ga0451843_0761211_90_1052 | 308 |
| 197 | 3300044694 | Ga0466963_0272151 | Ga0466963_0272151_61_1071 | 308 |
| 198 | 3300006048 | Ga0075363_100023383 | Ga0075363_1000233833 | 309 |
| 199 | 3300006177 | Ga0075362_10005491 | Ga0075362_100054913 | 309 |
| 200 | 3300006178 | Ga0075367_10009619 | Ga0075367_100096194 | 309 |
| 201 | 3300006186 | Ga0075369_10003839 | Ga0075369_100038393 | 309 |
| 202 | 3300006195 | Ga0075366_10085091 | Ga0075366_100850912 | 309 |
| 203 | 3300006353 | Ga0075370_10029668 | Ga0075370_100296682 | 309 |
| 204 | 3300006846 | Ga0075430_100109222 | Ga0075430_1001092223 | 309 |
| 205 | 3300006847 | Ga0075431_100348437 | Ga0075431_1003484372 | 309 |
| 206 | 3300027876 | Ga0209974_10000950 | Ga0209974_100009506 | 309 |
| 207 | 3300028794 | Ga0307515_10001755 | Ga0307515_1000175510 | 309 |
| 208 | 3300030522 | Ga0307512_10137097 | Ga0307512_101370972 | 309 |
| 209 | 3300031456 | Ga0307513_10043585 | Ga0307513_100435852 | 309 |
| 210 | 3300031649 | Ga0307514_10001936 | Ga0307514_1000193616 | 309 |
| 211 | 3300046522 | Ga0495643_0080464 | Ga0495643_0080464_25_975 | 309 |
| 212 | 3300050489 | nmdc:mga03683_986_c1 | nmdc:mga03683_986_c1_1286_2242 | 309 |
| 213 | 3300050490 | nmdc:mga03n38_5724_c1 | nmdc:mga03n38_5724_c1_463_1419 | 309 |
| 214 | 3300050493 | nmdc:mga0k408_4590_c1 | nmdc:mga0k408_4590_c1_1070_2026 | 309 |
| 215 | 3300050494 | nmdc:mga06z11_1988_c1 | nmdc:mga06z11_1988_c1_3516_4472 | 309 |
| 216 | 3300050496 | nmdc:mga07m45_308_c1 | nmdc:mga07m45_308_c1_7779_8735 | 309 |
| 217 | 3300050510 | nmdc:mga06r32_195077_c1 | nmdc:mga06r32_195077_c1_152_1096 | 309 |
| 218 | 3300050516 | nmdc:mga0sz30_22404_c1 | nmdc:mga0sz30_22404_c1_503_1459 | 309 |
| 219 | 3300005445 | Ga0070708_100072291 | Ga0070708_1000722913 | 310 |
| 220 | 3300005467 | Ga0070706_100034773 | Ga0070706_1000347736 | 310 |
| 221 | 3300005530 | Ga0070679_100302474 | Ga0070679_1003024742 | 310 |
| 222 | 3300009094 | Ga0111539_10069633 | Ga0111539_100696333 | 310 |
| 223 | 3300025937 | Ga0207669_10198293 | Ga0207669_101982931 | 310 |
| 224 | 3300026116 | Ga0207674_10041448 | Ga0207674_100414484 | 310 |
| 225 | 3300042876 | Ga0451577_0222079 | Ga0451577_0222079_633_1574 | 310 |
| 226 | 3300046501 | Ga0495607_0018499 | Ga0495607_0018499_1760_2695 | 310 |
| 227 | 3300046515 | Ga0495620_0033242 | Ga0495620_0033242_1085_2026 | 310 |
| 228 | 3300048912 | Ga0496109_0079118 | Ga0496109_0079118_1800_2741 | 310 |
| 229 | 3300049515 | Ga0501292_020890 | Ga0501292_020890_42_1007 | 310 |
| 230 | 3300009094 | Ga0111539_10512335 | Ga0111539_105123351 | 311 |
| 231 | 3300025921 | Ga0207652_10255779 | Ga0207652_102557792 | 311 |
| 232 | 3300031548 | Ga0307408_100030077 | Ga0307408_1000300773 | 311 |
| 233 | 3300031548 | Ga0307408_100213304 | Ga0307408_1002133042 | 311 |
| 234 | 3300044656 | Ga0466969_0016884 | Ga0466969_0016884_1902_2927 | 311 |
| 235 | 3300044658 | Ga0466972_0021366 | Ga0466972_0021366_664_1605 | 311 |
| 236 | 3300044683 | Ga0466965_0009202 | Ga0466965_0009202_2229_3254 | 311 |
| 237 | 3300044684 | Ga0466966_0022053 | Ga0466966_0022053_753_1778 | 311 |
| 238 | 3300044693 | Ga0466961_0030906 | Ga0466961_0030906_1209_2234 | 311 |
| 239 | 3300044706 | Ga0466964_0005747 | Ga0466964_0005747_2345_3370 | 311 |
| 240 | 3300044735 | Ga0466968_0029569 | Ga0466968_0029569_247_1272 | 311 |
| 241 | 3300044765 | Ga0466970_0130052 | Ga0466970_0130052_238_1263 | 311 |
| 242 | 3300045049 | Ga0466959_0026511 | Ga0466959_0026511_2290_3315 | 311 |
| 243 | 3300045976 | Ga0466967_0057233 | Ga0466967_0057233_158_1183 | 311 |
| 244 | 3300046557 | Ga0495622_0071822 | Ga0495622_0071822_77_1015 | 311 |
| 245 | 3300046690 | Ga0495624_0037050 | Ga0495624_0037050_2015_2953 | 311 |
| 246 | 3300049652 | Ga0501202_006817 | Ga0501202_006817_374_1324 | 311 |
| 247 | 3300049660 | Ga0501216_015228 | Ga0501216_015228_197_1147 | 311 |
| 248 | 3300049765 | Ga0501268_004451 | Ga0501268_004451_52_1002 | 311 |
| 249 | 3300053086 | Ga0500578_0000057 | Ga0500578_0000057_19964_20905 | 311 |
| 250 | 3300053086 | Ga0500578_0000683 | Ga0500578_0000683_36150_37091 | 311 |
| 251 | 3300061719 | Ga0466962_0012958 | Ga0466962_0012958_1421_2446 | 311 |
| 252 | iso_pu_bacteria | 2585428057 | 2587729394 | 311 |
| 253 | iso_pu_bacteria | 2585428058 | 2587732782 | 311 |
| 254 | iso_pu_bacteria | 2588253510 | 2588290154 | 311 |
| 255 | iso_pu_bacteria | 2643221592 | 2643967720 | 311 |
| 256 | iso_pu_bacteria | 2643221609 | 2644057939 | 311 |
| 257 | iso_pu_bacteria | 2643221611 | 2644072974 | 311 |
| 258 | iso_pu_bacteria | 2643221625 | 2644140542 | 311 |
| 259 | iso_pu_bacteria | 2643221648 | 2644273509 | 311 |
| 260 | iso_pu_bacteria | 2738543012 | 2739242211 | 311 |
| 261 | iso_pu_bacteria | 2816332133 | 2816470172 | 311 |
| 262 | 3300035086 | Ga0373934_0000172 | Ga0373934_0000172_12513_13466 | 312 |
| 263 | 3300035111 | Ga0373923_0001124 | Ga0373923_0001124_5762_6715 | 312 |
| 264 | 3300035117 | Ga0373953_0001178 | Ga0373953_0001178_4611_5564 | 312 |
| 265 | 3300035119 | Ga0373956_0002530 | Ga0373956_0002530_3012_3965 | 312 |
| 266 | 3300035172 | Ga0373955_0002332 | Ga0373955_0002332_1487_2440 | 312 |
| 267 | 3300035692 | Ga0373935_0132491 | Ga0373935_0132491_180_1133 | 312 |
| 268 | 3300035724 | Ga0373933_0000064 | Ga0373933_0000064_51354_52307 | 312 |
| 269 | 3300036401 | Ga0373937_0000104 | Ga0373937_0000104_4671_5624 | 312 |
| 270 | 3300046454 | Ga0495592_0001845 | Ga0495592_0001845_1342_2295 | 312 |
| 271 | 3300046459 | Ga0495629_0021712 | Ga0495629_0021712_2379_3332 | 312 |
| 272 | 3300046462 | Ga0495651_0000378 | Ga0495651_0000378_12667_13620 | 312 |
| 273 | 3300046463 | Ga0495653_0000741 | Ga0495653_0000741_2751_3704 | 312 |
| 274 | 3300046511 | Ga0495608_0001892 | Ga0495608_0001892_1496_2449 | 312 |
| 275 | 3300046516 | Ga0495628_0000925 | Ga0495628_0000925_1180_2133 | 312 |
| 276 | 3300046517 | Ga0495630_0004964 | Ga0495630_0004964_6796_7749 | 312 |
| 277 | 3300046529 | Ga0495652_0001978 | Ga0495652_0001978_15020_15973 | 312 |
| 278 | 3300046536 | Ga0495587_0000504 | Ga0495587_0000504_17619_18572 | 312 |
| 279 | 3300046543 | Ga0495645_0000702 | Ga0495645_0000702_19327_20280 | 312 |
| 280 | 3300046559 | Ga0495667_0000295 | Ga0495667_0000295_10538_11491 | 312 |
| 281 | 3300046663 | Ga0495635_0000027 | Ga0495635_0000027_88011_88964 | 312 |
| 282 | 3300046675 | Ga0495657_0001428 | Ga0495657_0001428_10187_11140 | 312 |
| 283 | 3300046678 | Ga0495599_0001223 | Ga0495599_0001223_12515_13468 | 312 |
| 284 | 3300046679 | Ga0495623_0001252 | Ga0495623_0001252_7994_8947 | 312 |
| 285 | 3300046680 | Ga0495646_0001274 | Ga0495646_0001274_12135_13088 | 312 |
| 286 | 3300046809 | Ga0495600_0000439 | Ga0495600_0000439_10098_11051 | 312 |
| 287 | 3300047315 | Ga0495581_0074160 | Ga0495581_0074160_591_1544 | 312 |
| 288 | 3300047317 | Ga0495604_0001033 | Ga0495604_0001033_12568_13521 | 312 |
| 289 | 3300047319 | Ga0495674_0012369 | Ga0495674_0012369_2521_3474 | 312 |
| 290 | 3300047322 | Ga0495680_0010170 | Ga0495680_0010170_1046_1999 | 312 |
| 291 | 3300047471 | Ga0495684_0000116 | Ga0495684_0000116_44357_45310 | 312 |
| 292 | 3300048088 | Ga0495602_0002782 | Ga0495602_0002782_1520_2473 | 312 |
| 293 | 3300053084 | Ga0495595_0014662 | Ga0495595_0014662_813_1766 | 312 |
| 294 | 3300053085 | Ga0495619_0020561 | Ga0495619_0020561_415_1368 | 312 |
| 295 | 3300006175 | Ga0070712_100032070 | Ga0070712_1000320702 | 313 |
| 296 | 3300014325 | Ga0163163_10047736 | Ga0163163_100477363 | 313 |
| 297 | 3300025915 | Ga0207693_10049312 | Ga0207693_100493124 | 313 |
| 298 | 3300025925 | Ga0207650_10169958 | Ga0207650_101699582 | 313 |
| 299 | 3300035089 | Ga0373944_0037891 | Ga0373944_0037891_403_1362 | 313 |
| 300 | 3300037068 | Ga0373925_0003082 | Ga0373925_0003082_1482_2441 | 313 |
| 301 | 3300046455 | Ga0495603_0005272 | Ga0495603_0005272_5932_6891 | 313 |
| 302 | 3300046459 | Ga0495629_0020763 | Ga0495629_0020763_3216_4175 | 313 |
| 303 | 3300046472 | Ga0495580_0108808 | Ga0495580_0108808_804_1763 | 313 |
| 304 | 3300046475 | Ga0495639_0008610 | Ga0495639_0008610_1124_2083 | 313 |
| 305 | 3300046499 | Ga0495594_0102820 | Ga0495594_0102820_167_1126 | 313 |
| 306 | 3300046531 | Ga0495665_0000407 | Ga0495665_0000407_13494_14453 | 313 |
| 307 | 3300046557 | Ga0495622_0040310 | Ga0495622_0040310_29_988 | 313 |
| 308 | 3300046674 | Ga0495588_0021641 | Ga0495588_0021641_1221_2180 | 313 |
| 309 | 3300046683 | Ga0495658_0007628 | Ga0495658_0007628_4242_5201 | 313 |
| 310 | 3300046689 | Ga0495613_0035304 | Ga0495613_0035304_1337_2296 | 313 |
| 311 | 3300047673 | Ga0495593_0000111 | Ga0495593_0000111_29937_30896 | 313 |
| 312 | 3300048089 | Ga0495614_0000527 | Ga0495614_0000527_3564_4523 | 313 |
| 313 | 3300048915 | Ga0496112_0075923 | Ga0496112_0075923_2168_3163 | 313 |
| 314 | iso_pu_bacteria | 2643221654 | 2644303662 | 313 |
| 315 | 3300006195 | Ga0075366_10020320 | Ga0075366_100203204 | 314 |
| 316 | 3300006846 | Ga0075430_100065543 | Ga0075430_1000655433 | 314 |
| 317 | 3300009147 | Ga0114129_10487943 | Ga0114129_104879432 | 314 |
| 318 | 3300025253 | Ga0209677_101707 | Ga0209677_1017079 | 314 |
| 319 | 3300025919 | Ga0207657_10057170 | Ga0207657_100571703 | 314 |
| 320 | 3300026067 | Ga0207678_10164151 | Ga0207678_101641512 | 314 |
| 321 | 3300050493 | nmdc:mga0k408_16868_c1 | nmdc:mga0k408_16868_c1_2995_4005 | 314 |
| 322 | 3300050508 | nmdc:mga09592_1109_c1 | nmdc:mga09592_1109_c1_17793_18824 | 314 |
| 323 | 3300050512 | nmdc:mga0n895_295217_c1 | nmdc:mga0n895_295217_c1_540_1544 | 314 |
| 324 | iso_pu_bacteria | 2547132374 | 2548501637 | 314 |
| 325 | iso_pu_bacteria | 2585428062 | 2587757133 | 314 |
| 326 | iso_pu_bacteria | 2600255292 | 2601671068 | 314 |
| 327 | iso_pu_bacteria | 2643221570 | 2643865097 | 314 |
| 328 | iso_pu_bacteria | 2643221596 | 2643990756 | 314 |
| 329 | iso_pu_bacteria | 2643221652 | 2644292378 | 314 |
| 330 | iso_pu_bacteria | 2643221717 | 2644645420 | 314 |
| 331 | iso_pu_bacteria | 2857547612 | 2857547838 | 314 |
| 332 | iso_pu_bacteria | 2919704043 | 2919705062 | 314 |
| 333 | iso_pu_bacteria | 2990710928 | 2990710988 | 314 |
| 334 | 3300005330 | Ga0070690_100007195 | Ga0070690_1000071952 | 315 |
| 335 | 3300005334 | Ga0068869_100010062 | Ga0068869_1000100624 | 315 |
| 336 | 3300005334 | Ga0068869_100141312 | Ga0068869_1001413122 | 315 |
| 337 | 3300005338 | Ga0068868_100241476 | Ga0068868_1002414761 | 315 |
| 338 | 3300005459 | Ga0068867_100000977 | Ga0068867_1000009772 | 315 |
| 339 | 3300005548 | Ga0070665_100008237 | Ga0070665_1000082372 | 315 |
| 340 | 3300005548 | Ga0070665_100375118 | Ga0070665_1003751182 | 315 |
| 341 | 3300005563 | Ga0068855_100317171 | Ga0068855_1003171712 | 315 |
| 342 | 3300005718 | Ga0068866_10077782 | Ga0068866_100777822 | 315 |
| 343 | 3300005719 | Ga0068861_100025535 | Ga0068861_1000255353 | 315 |
| 344 | 3300005843 | Ga0068860_100403752 | Ga0068860_1004037522 | 315 |
| 345 | 3300006847 | Ga0075431_100266053 | Ga0075431_1002660532 | 315 |
| 346 | 3300006871 | Ga0075434_100444152 | Ga0075434_1004441522 | 315 |
| 347 | 3300009098 | Ga0105245_10045264 | Ga0105245_100452642 | 315 |
| 348 | 3300009098 | Ga0105245_10157789 | Ga0105245_101577892 | 315 |
| 349 | 3300009148 | Ga0105243_10009662 | Ga0105243_100096625 | 315 |
| 350 | 3300009176 | Ga0105242_10308119 | Ga0105242_103081192 | 315 |
| 351 | 3300010375 | Ga0105239_10084230 | Ga0105239_100842302 | 315 |
| 352 | 3300013296 | Ga0157374_10268902 | Ga0157374_102689022 | 315 |
| 353 | 3300013306 | Ga0163162_10056229 | Ga0163162_100562293 | 315 |
| 354 | 3300013306 | Ga0163162_10151799 | Ga0163162_101517992 | 315 |
| 355 | 3300013308 | Ga0157375_10077110 | Ga0157375_100771102 | 315 |
| 356 | 3300014745 | Ga0157377_10000098 | Ga0157377_1000009823 | 315 |
| 357 | 3300017792 | Ga0163161_10040838 | Ga0163161_100408382 | 315 |
| 358 | 3300025899 | Ga0207642_10163533 | Ga0207642_101635332 | 315 |
| 359 | 3300025910 | Ga0207684_10022416 | Ga0207684_100224163 | 315 |
| 360 | 3300025927 | Ga0207687_10067765 | Ga0207687_100677652 | 315 |
| 361 | 3300025935 | Ga0207709_10003704 | Ga0207709_100037047 | 315 |
| 362 | 3300025942 | Ga0207689_10037128 | Ga0207689_100371282 | 315 |
| 363 | 3300026035 | Ga0207703_10054670 | Ga0207703_100546701 | 315 |
| 364 | 3300026078 | Ga0207702_10062662 | Ga0207702_100626623 | 315 |
| 365 | 3300026089 | Ga0207648_10000614 | Ga0207648_1000061416 | 315 |
| 366 | 3300026118 | Ga0207675_100064585 | Ga0207675_1000645853 | 315 |
| 367 | 3300028379 | Ga0268266_10008775 | Ga0268266_100087755 | 315 |
| 368 | 3300028379 | Ga0268266_10299413 | Ga0268266_102994132 | 315 |
| 369 | 3300028381 | Ga0268264_10566654 | Ga0268264_105666541 | 315 |
| 370 | 3300028786 | Ga0307517_10042428 | Ga0307517_100424284 | 315 |
| 371 | 3300028794 | Ga0307515_10000180 | Ga0307515_1000018085 | 315 |
| 372 | 3300029957 | Ga0265324_10024174 | Ga0265324_100241742 | 315 |
| 373 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004461 | 315 |
| 374 | 3300031456 | Ga0307513_10020823 | Ga0307513_100208233 | 315 |
| 375 | 3300031507 | Ga0307509_10240228 | Ga0307509_102402282 | 315 |
| 376 | 3300031616 | Ga0307508_10005913 | Ga0307508_100059133 | 315 |
| 377 | 3300031730 | Ga0307516_10000488 | Ga0307516_1000048819 | 315 |
| 378 | 3300031730 | Ga0307516_10008370 | Ga0307516_100083704 | 315 |
| 379 | 3300031730 | Ga0307516_10081209 | Ga0307516_100812093 | 315 |
| 380 | 3300032002 | Ga0307416_100093151 | Ga0307416_1000931512 | 315 |
| 381 | 3300037312 | Ga0395899_0011426 | Ga0395899_0011426_4151_5185 | 315 |
| 382 | 3300037471 | Ga0395905_0150396 | Ga0395905_0150396_684_1718 | 315 |
| 383 | 3300041459 | Ga0451800_1405191 | Ga0451800_1405191_324_1274 | 315 |
| 384 | 3300041486 | Ga0451807_1552671 | Ga0451807_1552671_1337_2287 | 315 |
| 385 | 3300042007 | Ga0439449_0000640 | Ga0439449_0000640_3848_4846 | 315 |
| 386 | 3300042876 | Ga0451577_0008497 | Ga0451577_0008497_7236_8195 | 315 |
| 387 | 3300044673 | Ga0453683_0006829 | Ga0453683_0006829_1439_2398 | 315 |
| 388 | 3300044712 | Ga0453684_0034636 | Ga0453684_0034636_5481_6440 | 315 |
| 389 | 3300045051 | Ga0451576_0014933 | Ga0451576_0014933_5596_6555 | 315 |
| 390 | 3300046491 | Ga0495584_0038277 | Ga0495584_0038277_1449_2408 | 315 |
| 391 | 3300046665 | Ga0495661_0122378 | Ga0495661_0122378_10_969 | 315 |
| 392 | 3300049160 | Ga0501304_000207 | Ga0501304_000207_1017_2060 | 315 |
| 393 | 3300049571 | Ga0501034_0153351 | Ga0501034_0153351_168_1196 | 315 |
| 394 | 3300049683 | Ga0501253_010475 | Ga0501253_010475_184_1227 | 315 |
| 395 | 3300049762 | Ga0501265_005330 | Ga0501265_005330_19_1062 | 315 |
| 396 | 3300050493 | nmdc:mga0k408_186836_c1 | nmdc:mga0k408_186836_c1_47_997 | 315 |
| 397 | 3300050511 | nmdc:mga08y16_73348_c1 | nmdc:mga08y16_73348_c1_1229_2185 | 315 |
| 398 | 3300061719 | Ga0466962_0042044 | Ga0466962_0042044_917_1933 | 315 |
| 399 | iso_pu_bacteria | 2513020051 | 2513226573 | 315 |
| 400 | iso_pu_bacteria | 2599185214 | 2599625820 | 315 |
| 401 | iso_pu_bacteria | 2599185226 | 2599675098 | 315 |
| 402 | iso_pu_bacteria | 2599185227 | 2599683992 | 315 |
| 403 | iso_pu_bacteria | 2599185229 | 2599695405 | 315 |
| 404 | iso_pu_bacteria | 2643221628 | 2644162885 | 315 |
| 405 | iso_pu_bacteria | 2643221658 | 2644329476 | 315 |
| 406 | iso_pu_bacteria | 2643221664 | 2644356467 | 315 |
| 407 | iso_pu_bacteria | 2643221672 | 2644398239 | 315 |
| 408 | iso_pu_bacteria | 2643221683 | 2644469295 | 315 |
| 409 | iso_pu_bacteria | 2738541277 | 2738722936 | 315 |
| 410 | iso_pu_bacteria | 2738541280 | 2738738895 | 315 |
| 411 | iso_pu_bacteria | 2738541300 | 2738844796 | 315 |
| 412 | iso_pu_bacteria | 2738541307 | 2738881361 | 315 |
| 413 | iso_pu_bacteria | 2738543018 | 2739276321 | 315 |
| 414 | iso_pu_bacteria | 2738543019 | 2739283507 | 315 |
| 415 | iso_pu_bacteria | 2738543030 | 2739345155 | 315 |
| 416 | iso_pu_bacteria | 2842677519 | 2842680177 | 315 |
| 417 | iso_pu_bacteria | 2885198086 | 2885199823 | 315 |
| 418 | iso_pu_bacteria | 2885211737 | 2885213474 | 315 |
| 419 | iso_pu_bacteria | 2904449895 | 2904454747 | 315 |
| 420 | iso_pu_bacteria | 2904456579 | 2904460330 | 315 |
| 421 | iso_pu_bacteria | 2904541872 | 2904546379 | 315 |
| 422 | iso_pu_bacteria | 2919462493 | 2919464123 | 315 |
| 423 | iso_pu_bacteria | 2928070936 | 2928076419 | 315 |
| 424 | iso_pu_bacteria | 2928084124 | 2928088810 | 315 |
| 425 | iso_pu_bacteria | 2929160207 | 2929164190 | 315 |
| 426 | iso_pu_bacteria | 2929520902 | 2929524523 | 315 |
| 427 | iso_pu_bacteria | 2945945610 | 2945946935 | 315 |
| 428 | iso_pu_bacteria | 2945972063 | 2945976634 | 315 |
| 429 | 3300003322 | rootL2_10009352 | rootL2_100093522 | 316 |
| 430 | 3300005328 | Ga0070676_10001363 | Ga0070676_100013634 | 316 |
| 431 | 3300005331 | Ga0070670_100014490 | Ga0070670_1000144902 | 316 |
| 432 | 3300005338 | Ga0068868_100049768 | Ga0068868_1000497683 | 316 |
| 433 | 3300005355 | Ga0070671_100100643 | Ga0070671_1001006432 | 316 |
| 434 | 3300005364 | Ga0070673_100132327 | Ga0070673_1001323272 | 316 |
| 435 | 3300005455 | Ga0070663_100387349 | Ga0070663_1003873491 | 316 |
| 436 | 3300005456 | Ga0070678_100148582 | Ga0070678_1001485822 | 316 |
| 437 | 3300005457 | Ga0070662_100179872 | Ga0070662_1001798722 | 316 |
| 438 | 3300005459 | Ga0068867_100034907 | Ga0068867_1000349072 | 316 |
| 439 | 3300005459 | Ga0068867_100035250 | Ga0068867_1000352501 | 316 |
| 440 | 3300005459 | Ga0068867_100183981 | Ga0068867_1001839812 | 316 |
| 441 | 3300005718 | Ga0068866_10156802 | Ga0068866_101568022 | 316 |
| 442 | 3300005719 | Ga0068861_100035272 | Ga0068861_1000352724 | 316 |
| 443 | 3300005842 | Ga0068858_100194090 | Ga0068858_1001940901 | 316 |
| 444 | 3300005843 | Ga0068860_100011496 | Ga0068860_1000114969 | 316 |
| 445 | 3300005844 | Ga0068862_100016907 | Ga0068862_1000169072 | 316 |
| 446 | 3300006038 | Ga0075365_10013334 | Ga0075365_100133342 | 316 |
| 447 | 3300006042 | Ga0075368_10044444 | Ga0075368_100444442 | 316 |
| 448 | 3300006195 | Ga0075366_10004653 | Ga0075366_100046537 | 316 |
| 449 | 3300006195 | Ga0075366_10010562 | Ga0075366_100105625 | 316 |
| 450 | 3300006195 | Ga0075366_10033634 | Ga0075366_100336342 | 316 |
| 451 | 3300006195 | Ga0075366_10054712 | Ga0075366_100547122 | 316 |
| 452 | 3300006195 | Ga0075366_10121467 | Ga0075366_101214672 | 316 |
| 453 | 3300006195 | Ga0075366_10122064 | Ga0075366_101220642 | 316 |
| 454 | 3300006195 | Ga0075366_10127414 | Ga0075366_101274142 | 316 |
| 455 | 3300006353 | Ga0075370_10011438 | Ga0075370_100114382 | 316 |
| 456 | 3300006353 | Ga0075370_10063639 | Ga0075370_100636392 | 316 |
| 457 | 3300006353 | Ga0075370_10157805 | Ga0075370_101578052 | 316 |
| 458 | 3300006881 | Ga0068865_100007809 | Ga0068865_1000078097 | 316 |
| 459 | 3300009093 | Ga0105240_10253336 | Ga0105240_102533362 | 316 |
| 460 | 3300009094 | Ga0111539_10001762 | Ga0111539_100017624 | 316 |
| 461 | 3300009147 | Ga0114129_10004723 | Ga0114129_100047234 | 316 |
| 462 | 3300009148 | Ga0105243_10121097 | Ga0105243_101210972 | 316 |
| 463 | 3300009148 | Ga0105243_10347991 | Ga0105243_103479912 | 316 |
| 464 | 3300009545 | Ga0105237_10005095 | Ga0105237_100050957 | 316 |
| 465 | 3300009551 | Ga0105238_10014551 | Ga0105238_100145516 | 316 |
| 466 | 3300009553 | Ga0105249_10011730 | Ga0105249_100117305 | 316 |
| 467 | 3300010375 | Ga0105239_10000486 | Ga0105239_1000048643 | 316 |
| 468 | 3300013306 | Ga0163162_10009563 | Ga0163162_100095638 | 316 |
| 469 | 3300013308 | Ga0157375_10009170 | Ga0157375_100091704 | 316 |
| 470 | 3300014968 | Ga0157379_10032824 | Ga0157379_100328242 | 316 |
| 471 | 3300017792 | Ga0163161_10155040 | Ga0163161_101550401 | 316 |
| 472 | 3300025899 | Ga0207642_10099462 | Ga0207642_100994621 | 316 |
| 473 | 3300025907 | Ga0207645_10001218 | Ga0207645_1000121815 | 316 |
| 474 | 3300025913 | Ga0207695_10184031 | Ga0207695_101840312 | 316 |
| 475 | 3300025914 | Ga0207671_10036946 | Ga0207671_100369462 | 316 |
| 476 | 3300025924 | Ga0207694_10018463 | Ga0207694_100184632 | 316 |
| 477 | 3300025925 | Ga0207650_10027819 | Ga0207650_100278192 | 316 |
| 478 | 3300025926 | Ga0207659_10169739 | Ga0207659_101697391 | 316 |
| 479 | 3300025927 | Ga0207687_10431595 | Ga0207687_104315951 | 316 |
| 480 | 3300025938 | Ga0207704_10068833 | Ga0207704_100688332 | 316 |
| 481 | 3300025942 | Ga0207689_10008711 | Ga0207689_100087117 | 316 |
| 482 | 3300025986 | Ga0207658_10060391 | Ga0207658_100603913 | 316 |
| 483 | 3300026089 | Ga0207648_10001597 | Ga0207648_1000159727 | 316 |
| 484 | 3300026089 | Ga0207648_10005261 | Ga0207648_1000526112 | 316 |
| 485 | 3300026116 | Ga0207674_10059264 | Ga0207674_100592644 | 316 |
| 486 | 3300026118 | Ga0207675_100004236 | Ga0207675_10000423612 | 316 |
| 487 | 3300026121 | Ga0207683_10019535 | Ga0207683_100195357 | 316 |
| 488 | 3300028381 | Ga0268264_10013578 | Ga0268264_100135785 | 316 |
| 489 | 3300028786 | Ga0307517_10000918 | Ga0307517_100009185 | 316 |
| 490 | 3300028786 | Ga0307517_10156830 | Ga0307517_101568302 | 316 |
| 491 | 3300028794 | Ga0307515_10000109 | Ga0307515_10000109133 | 316 |
| 492 | 3300028794 | Ga0307515_10001052 | Ga0307515_1000105227 | 316 |
| 493 | 3300028794 | Ga0307515_10008086 | Ga0307515_100080867 | 316 |
| 494 | 3300028794 | Ga0307515_10028385 | Ga0307515_100283859 | 316 |
| 495 | 3300028794 | Ga0307515_10036146 | Ga0307515_100361464 | 316 |
| 496 | 3300028794 | Ga0307515_10231632 | Ga0307515_102316322 | 316 |
| 497 | 3300030522 | Ga0307512_10011673 | Ga0307512_100116738 | 316 |
| 498 | 3300030522 | Ga0307512_10039143 | Ga0307512_100391432 | 316 |
| 499 | 3300030522 | Ga0307512_10093899 | Ga0307512_100938992 | 316 |
| 500 | 3300031251 | Ga0265327_10000108 | Ga0265327_1000010890 | 316 |
| 501 | 3300031456 | Ga0307513_10010428 | Ga0307513_100104289 | 316 |
| 502 | 3300031456 | Ga0307513_10368293 | Ga0307513_103682932 | 316 |
| 503 | 3300031507 | Ga0307509_10000509 | Ga0307509_1000050932 | 316 |
| 504 | 3300031507 | Ga0307509_10011291 | Ga0307509_100112918 | 316 |
| 505 | 3300031548 | Ga0307408_100002069 | Ga0307408_1000020692 | 316 |
| 506 | 3300031616 | Ga0307508_10000099 | Ga0307508_1000009933 | 316 |
| 507 | 3300031616 | Ga0307508_10000237 | Ga0307508_1000023731 | 316 |
| 508 | 3300031616 | Ga0307508_10282134 | Ga0307508_102821342 | 316 |
| 509 | 3300031649 | Ga0307514_10004431 | Ga0307514_1000443110 | 316 |
| 510 | 3300031649 | Ga0307514_10014300 | Ga0307514_100143002 | 316 |
| 511 | 3300031730 | Ga0307516_10033702 | Ga0307516_100337026 | 316 |
| 512 | 3300031901 | Ga0307406_10010897 | Ga0307406_100108972 | 316 |
| 513 | 3300032002 | Ga0307416_100009752 | Ga0307416_1000097522 | 316 |
| 514 | 3300032002 | Ga0307416_100054803 | Ga0307416_1000548032 | 316 |
| 515 | 3300032005 | Ga0307411_10024459 | Ga0307411_100244593 | 316 |
| 516 | 3300033180 | Ga0307510_10000794 | Ga0307510_1000079428 | 316 |
| 517 | 3300033180 | Ga0307510_10010876 | Ga0307510_100108762 | 316 |
| 518 | 3300033180 | Ga0307510_10031892 | Ga0307510_100318925 | 316 |
| 519 | 3300035691 | Ga0373931_0034988 | Ga0373931_0034988_1059_2021 | 316 |
| 520 | 3300035695 | Ga0373927_0012844 | Ga0373927_0012844_730_1713 | 316 |
| 521 | 3300036401 | Ga0373937_0024629 | Ga0373937_0024629_3738_4706 | 316 |
| 522 | 3300036401 | Ga0373937_0084373 | Ga0373937_0084373_1602_2561 | 316 |
| 523 | 3300036401 | Ga0373937_0530986 | Ga0373937_0530986_145_1107 | 316 |
| 524 | 3300037068 | Ga0373925_0004860 | Ga0373925_0004860_6571_7554 | 316 |
| 525 | 3300041491 | Ga0451833_1197908 | Ga0451833_1197908_126_1085 | 316 |
| 526 | 3300042008 | Ga0439450_018778 | Ga0439450_018778_223_1200 | 316 |
| 527 | 3300042012 | Ga0439455_0047312 | Ga0439455_0047312_34_1005 | 316 |
| 528 | 3300042876 | Ga0451577_0015851 | Ga0451577_0015851_374_1333 | 316 |
| 529 | 3300044712 | Ga0453684_0006064 | Ga0453684_0006064_2406_3368 | 316 |
| 530 | 3300044712 | Ga0453684_0078506 | Ga0453684_0078506_1347_2306 | 316 |
| 531 | 3300044712 | Ga0453684_0127382 | Ga0453684_0127382_1606_2565 | 316 |
| 532 | 3300046454 | Ga0495592_0000140 | Ga0495592_0000140_50354_51313 | 316 |
| 533 | 3300046457 | Ga0495590_0017553 | Ga0495590_0017553_403_1356 | 316 |
| 534 | 3300046460 | Ga0495638_0101805 | Ga0495638_0101805_387_1346 | 316 |
| 535 | 3300046471 | Ga0495650_0038126 | Ga0495650_0038126_610_1569 | 316 |
| 536 | 3300046512 | Ga0495610_0011182 | Ga0495610_0011182_3206_4165 | 316 |
| 537 | 3300046512 | Ga0495610_0038554 | Ga0495610_0038554_50_1003 | 316 |
| 538 | 3300046513 | Ga0495616_0091057 | Ga0495616_0091057_39_992 | 316 |
| 539 | 3300046519 | Ga0495632_0005702 | Ga0495632_0005702_3341_4294 | 316 |
| 540 | 3300046524 | Ga0495648_0132539 | Ga0495648_0132539_308_1267 | 316 |
| 541 | 3300046681 | Ga0495647_0017099 | Ga0495647_0017099_1378_2346 | 316 |
| 542 | 3300046683 | Ga0495658_0013346 | Ga0495658_0013346_2016_2984 | 316 |
| 543 | 3300046694 | Ga0495649_0001187 | Ga0495649_0001187_14786_15739 | 316 |
| 544 | 3300046794 | Ga0495589_0055703 | Ga0495589_0055703_139_1092 | 316 |
| 545 | 3300046810 | Ga0495660_0007860 | Ga0495660_0007860_809_1762 | 316 |
| 546 | 3300047443 | Ga0495687_003425 | Ga0495687_003425_2798_3751 | 316 |
| 547 | 3300047472 | Ga0495686_0001957 | Ga0495686_0001957_1006_1968 | 316 |
| 548 | 3300048091 | Ga0495626_0015064 | Ga0495626_0015064_2648_3601 | 316 |
| 549 | 3300048916 | Ga0496113_0172195 | Ga0496113_0172195_164_1126 | 316 |
| 550 | 3300048927 | Ga0496124_0008990 | Ga0496124_0008990_4826_5824 | 316 |
| 551 | 3300050492 | nmdc:mga0yw44_149293_c1 | nmdc:mga0yw44_149293_c1_328_1320 | 316 |
| 552 | 3300050493 | nmdc:mga0k408_110387_c1 | nmdc:mga0k408_110387_c1_624_1616 | 316 |
| 553 | 3300050493 | nmdc:mga0k408_12245_c1 | nmdc:mga0k408_12245_c1_151_1110 | 316 |
| 554 | 3300050493 | nmdc:mga0k408_136611_c1 | nmdc:mga0k408_136611_c1_470_1423 | 316 |
| 555 | 3300050493 | nmdc:mga0k408_140678_c1 | nmdc:mga0k408_140678_c1_107_1066 | 316 |
| 556 | 3300050493 | nmdc:mga0k408_16255_c1 | nmdc:mga0k408_16255_c1_784_1743 | 316 |
| 557 | 3300050493 | nmdc:mga0k408_2622_c1 | nmdc:mga0k408_2622_c1_7070_8032 | 316 |
| 558 | 3300050493 | nmdc:mga0k408_32057_c1 | nmdc:mga0k408_32057_c1_1028_1987 | 316 |
| 559 | 3300050494 | nmdc:mga06z11_108257_c1 | nmdc:mga06z11_108257_c1_160_1119 | 316 |
| 560 | 3300050496 | nmdc:mga07m45_209191_c1 | nmdc:mga07m45_209191_c1_104_1063 | 316 |
| 561 | 3300050496 | nmdc:mga07m45_33171_c1 | nmdc:mga07m45_33171_c1_1502_2461 | 316 |
| 562 | 3300050507 | nmdc:mga05p37_1081_c1 | nmdc:mga05p37_1081_c1_15107_16084 | 316 |
| 563 | 3300050508 | nmdc:mga09592_3150_c2 | nmdc:mga09592_3150_c2_2074_3051 | 316 |
| 564 | 3300050509 | nmdc:mga0qj67_39179_c1 | nmdc:mga0qj67_39179_c1_2433_3410 | 316 |
| 565 | 3300050511 | nmdc:mga08y16_8989_c1 | nmdc:mga08y16_8989_c1_8331_9308 | 316 |
| 566 | 3300053093 | Ga0500651_0094551 | Ga0500651_0094551_686_1645 | 316 |
| 567 | 3300053118 | Ga0500594_0000823 | Ga0500594_0000823_865_1824 | 316 |
| 568 | 3300053134 | Ga0500658_0001793 | Ga0500658_0001793_3825_4778 | 316 |
| 569 | 3300053136 | Ga0500559_0000027 | Ga0500559_0000027_97246_98205 | 316 |
| 570 | 3300053156 | Ga0500622_0018677 | Ga0500622_0018677_1900_2859 | 316 |
| 571 | 3300053178 | Ga0500637_0129145 | Ga0500637_0129145_324_1283 | 316 |
| 572 | 3300053739 | Ga0500587_005473 | Ga0500587_005473_312_1271 | 316 |
| 573 | iso_pu_bacteria | 2643221644 | 2644246441 | 316 |
| 574 | iso_pu_bacteria | 2738543013 | 2739247936 | 316 |
| 575 | iso_pu_bacteria | 2818991446 | 2819596311 | 316 |
| 576 | iso_pu_bacteria | 2831265667 | 2831270338 | 316 |
| 577 | iso_pu_bacteria | 2838054893 | 2838056568 | 316 |
| 578 | iso_pu_bacteria | 2899924645 | 2899925694 | 316 |
| 579 | iso_pu_bacteria | 2928037797 | 2928038206 | 316 |
| 580 | iso_pu_bacteria | 2928044640 | 2928046189 | 316 |
| 581 | iso_pu_bacteria | 2928051484 | 2928053884 | 316 |
| 582 | iso_pu_bacteria | 2928064002 | 2928067433 | 316 |
| 583 | iso_pu_bacteria | 2945909444 | 2945912961 | 316 |
| 584 | iso_pu_bacteria | 2945984333 | 2945984758 | 316 |
| 585 | iso_pu_bacteria | 2954767861 | 2954771699 | 316 |
| 586 | 3300003761 | Ga0055535_1000824 | Ga0055535_100082421 | 317 |
| 587 | 3300003763 | Ga0055529_1000198 | Ga0055529_100019852 | 317 |
| 588 | 3300005327 | Ga0070658_10007950 | Ga0070658_100079503 | 317 |
| 589 | 3300005327 | Ga0070658_10012665 | Ga0070658_100126658 | 317 |
| 590 | 3300005367 | Ga0070667_100298656 | Ga0070667_1002986562 | 317 |
| 591 | 3300005459 | Ga0068867_100005245 | Ga0068867_1000052456 | 317 |
| 592 | 3300006195 | Ga0075366_10000948 | Ga0075366_1000094811 | 317 |
| 593 | 3300006195 | Ga0075366_10057471 | Ga0075366_100574712 | 317 |
| 594 | 3300006195 | Ga0075366_10088309 | Ga0075366_100883092 | 317 |
| 595 | 3300006353 | Ga0075370_10002994 | Ga0075370_100029944 | 317 |
| 596 | 3300009093 | Ga0105240_10103006 | Ga0105240_101030062 | 317 |
| 597 | 3300009093 | Ga0105240_10121219 | Ga0105240_101212193 | 317 |
| 598 | 3300009148 | Ga0105243_10195138 | Ga0105243_101951382 | 317 |
| 599 | 3300013296 | Ga0157374_10204836 | Ga0157374_102048362 | 317 |
| 600 | 3300025231 | Ga0207427_100546 | Ga0207427_1005466 | 317 |
| 601 | 3300025242 | Ga0209258_100044 | Ga0209258_100044124 | 317 |
| 602 | 3300025254 | Ga0209148_1007575 | Ga0209148_10075752 | 317 |
| 603 | 3300025256 | Ga0209759_1001188 | Ga0209759_100118816 | 317 |
| 604 | 3300025256 | Ga0209759_1007638 | Ga0209759_10076381 | 317 |
| 605 | 3300025256 | Ga0209759_1010820 | Ga0209759_10108203 | 317 |
| 606 | 3300025272 | Ga0209455_1000048 | Ga0209455_1000048124 | 317 |
| 607 | 3300025909 | Ga0207705_10007480 | Ga0207705_100074809 | 317 |
| 608 | 3300025909 | Ga0207705_10033874 | Ga0207705_100338742 | 317 |
| 609 | 3300025909 | Ga0207705_10043255 | Ga0207705_100432553 | 317 |
| 610 | 3300025913 | Ga0207695_10219618 | Ga0207695_102196182 | 317 |
| 611 | 3300025961 | Ga0207712_10122406 | Ga0207712_101224062 | 317 |
| 612 | 3300025986 | Ga0207658_10099972 | Ga0207658_100999722 | 317 |
| 613 | 3300026089 | Ga0207648_10019266 | Ga0207648_100192663 | 317 |
| 614 | 3300028666 | Ga0265336_10000053 | Ga0265336_1000005331 | 317 |
| 615 | 3300028794 | Ga0307515_10115941 | Ga0307515_101159413 | 317 |
| 616 | 3300029957 | Ga0265324_10001024 | Ga0265324_100010243 | 317 |
| 617 | 3300031730 | Ga0307516_10024759 | Ga0307516_100247596 | 317 |
| 618 | 3300031730 | Ga0307516_10034231 | Ga0307516_100342312 | 317 |
| 619 | 3300035086 | Ga0373934_0004886 | Ga0373934_0004886_3628_4632 | 317 |
| 620 | 3300046462 | Ga0495651_0246324 | Ga0495651_0246324_73_1077 | 317 |
| 621 | 3300046471 | Ga0495650_0017321 | Ga0495650_0017321_2076_3080 | 317 |
| 622 | 3300046511 | Ga0495608_0169380 | Ga0495608_0169380_224_1234 | 317 |
| 623 | 3300046660 | Ga0495625_0007125 | Ga0495625_0007125_23_979 | 317 |
| 624 | 3300050493 | nmdc:mga0k408_10561_c1 | nmdc:mga0k408_10561_c1_2027_2983 | 317 |
| 625 | 3300050493 | nmdc:mga0k408_13437_c1 | nmdc:mga0k408_13437_c1_546_1502 | 317 |
| 626 | 3300050493 | nmdc:mga0k408_838_c1 | nmdc:mga0k408_838_c1_5738_6694 | 317 |
| 627 | 3300050496 | nmdc:mga07m45_131_c1 | nmdc:mga07m45_131_c1_21471_22427 | 317 |
| 628 | 3300050496 | nmdc:mga07m45_174168_c1 | nmdc:mga07m45_174168_c1_127_1083 | 317 |
| 629 | 3300050496 | nmdc:mga07m45_82897_c1 | nmdc:mga07m45_82897_c1_166_1122 | 317 |
| 630 | 3300053080 | Ga0500635_0000035 | Ga0500635_0000035_62386_63390 | 317 |
| 631 | 3300002705 | JGI25156J39149_1003834 | JGI25156J39149_10038342 | 318 |
| 632 | 3300002738 | JGI25154J39366_1000722 | JGI25154J39366_10007226 | 318 |
| 633 | 3300002738 | JGI25154J39366_1003188 | JGI25154J39366_10031882 | 318 |
| 634 | 3300002741 | JGI25157J39369_1000018 | JGI25157J39369_1000018159 | 318 |
| 635 | 3300003752 | Ga0055539_1000283 | Ga0055539_10002831 | 318 |
| 636 | 3300003752 | Ga0055539_1001579 | Ga0055539_10015792 | 318 |
| 637 | 3300003756 | Ga0055533_1004794 | Ga0055533_10047941 | 318 |
| 638 | 3300003759 | Ga0055525_1000793 | Ga0055525_100079310 | 318 |
| 639 | 3300005467 | Ga0070706_100000271 | Ga0070706_10000027116 | 318 |
| 640 | 3300005518 | Ga0070699_100210728 | Ga0070699_1002107282 | 318 |
| 641 | 3300005539 | Ga0068853_100477803 | Ga0068853_1004778031 | 318 |
| 642 | 3300005563 | Ga0068855_100094627 | Ga0068855_1000946272 | 318 |
| 643 | 3300005577 | Ga0068857_100006437 | Ga0068857_1000064372 | 318 |
| 644 | 3300005578 | Ga0068854_100005348 | Ga0068854_1000053482 | 318 |
| 645 | 3300005614 | Ga0068856_100003567 | Ga0068856_1000035674 | 318 |
| 646 | 3300006178 | Ga0075367_10008290 | Ga0075367_100082904 | 318 |
| 647 | 3300009551 | Ga0105238_10099150 | Ga0105238_100991501 | 318 |
| 648 | 3300011119 | Ga0105246_10089846 | Ga0105246_100898462 | 318 |
| 649 | 3300013104 | Ga0157370_10004176 | Ga0157370_100041762 | 318 |
| 650 | 3300013105 | Ga0157369_10034136 | Ga0157369_100341365 | 318 |
| 651 | 3300013307 | Ga0157372_10192952 | Ga0157372_101929523 | 318 |
| 652 | 3300025226 | Ga0209674_100003 | Ga0209674_100003203 | 318 |
| 653 | 3300025230 | Ga0209563_100141 | Ga0209563_10014171 | 318 |
| 654 | 3300025242 | Ga0209258_100895 | Ga0209258_1008952 | 318 |
| 655 | 3300025246 | Ga0209646_1000010 | Ga0209646_1000010446 | 318 |
| 656 | 3300025246 | Ga0209646_1000067 | Ga0209646_100006793 | 318 |
| 657 | 3300025250 | Ga0209026_1000033 | Ga0209026_1000033137 | 318 |
| 658 | 3300025253 | Ga0209677_100133 | Ga0209677_10013332 | 318 |
| 659 | 3300025253 | Ga0209677_100196 | Ga0209677_10019643 | 318 |
| 660 | 3300025256 | Ga0209759_1000024 | Ga0209759_1000024137 | 318 |
| 661 | 3300025303 | Ga0209051_1000808 | Ga0209051_10008088 | 318 |
| 662 | 3300025910 | Ga0207684_10022867 | Ga0207684_100228673 | 318 |
| 663 | 3300025914 | Ga0207671_10238207 | Ga0207671_102382072 | 318 |
| 664 | 3300025935 | Ga0207709_10018244 | Ga0207709_100182442 | 318 |
| 665 | 3300025936 | Ga0207670_10272540 | Ga0207670_102725402 | 318 |
| 666 | 3300025949 | Ga0207667_10015058 | Ga0207667_1001505811 | 318 |
| 667 | 3300025949 | Ga0207667_10022788 | Ga0207667_100227882 | 318 |
| 668 | 3300025981 | Ga0207640_10029183 | Ga0207640_100291832 | 318 |
| 669 | 3300026041 | Ga0207639_10058016 | Ga0207639_100580162 | 318 |
| 670 | 3300026078 | Ga0207702_10001078 | Ga0207702_100010786 | 318 |
| 671 | 3300026116 | Ga0207674_10027625 | Ga0207674_100276252 | 318 |
| 672 | 3300031616 | Ga0307508_10029594 | Ga0307508_100295943 | 318 |
| 673 | 3300035691 | Ga0373931_0137602 | Ga0373931_0137602_152_1162 | 318 |
| 674 | 3300037312 | Ga0395899_0128066 | Ga0395899_0128066_406_1413 | 318 |
| 675 | 3300037466 | Ga0395898_0006478 | Ga0395898_0006478_1352_2359 | 318 |
| 676 | 3300038443 | Ga0395901_0000336 | Ga0395901_0000336_5814_6821 | 318 |
| 677 | 3300038443 | Ga0395901_0085167 | Ga0395901_0085167_504_1517 | 318 |
| 678 | 3300046474 | Ga0495605_0025774 | Ga0495605_0025774_159_1199 | 318 |
| 679 | 3300046491 | Ga0495584_0002297 | Ga0495584_0002297_4059_5099 | 318 |
| 680 | 3300046492 | Ga0495585_0003905 | Ga0495585_0003905_144_1184 | 318 |
| 681 | 3300046492 | Ga0495585_0010619 | Ga0495585_0010619_3059_4099 | 318 |
| 682 | 3300046492 | Ga0495585_0102361 | Ga0495585_0102361_23_1063 | 318 |
| 683 | 3300046492 | Ga0495585_0131384 | Ga0495585_0131384_57_1097 | 318 |
| 684 | 3300046501 | Ga0495607_0014431 | Ga0495607_0014431_1574_2614 | 318 |
| 685 | 3300046501 | Ga0495607_0059443 | Ga0495607_0059443_690_1730 | 318 |
| 686 | 3300046506 | Ga0495583_0000008 | Ga0495583_0000008_381760_382788 | 318 |
| 687 | 3300046506 | Ga0495583_0000185 | Ga0495583_0000185_73467_74507 | 318 |
| 688 | 3300046513 | Ga0495616_0025389 | Ga0495616_0025389_30_1070 | 318 |
| 689 | 3300046523 | Ga0495644_0000163 | Ga0495644_0000163_1399_2439 | 318 |
| 690 | 3300046523 | Ga0495644_0000657 | Ga0495644_0000657_9938_10978 | 318 |
| 691 | 3300046523 | Ga0495644_0002234 | Ga0495644_0002234_4310_5350 | 318 |
| 692 | 3300046524 | Ga0495648_0005067 | Ga0495648_0005067_6381_7421 | 318 |
| 693 | 3300046538 | Ga0495609_0001121 | Ga0495609_0001121_1565_2605 | 318 |
| 694 | 3300046542 | Ga0495597_0002754 | Ga0495597_0002754_9017_10039 | 318 |
| 695 | 3300046542 | Ga0495597_0045118 | Ga0495597_0045118_390_1424 | 318 |
| 696 | 3300046558 | Ga0495633_0012733 | Ga0495633_0012733_1717_2757 | 318 |
| 697 | 3300046615 | Ga0495656_0037977 | Ga0495656_0037977_334_1374 | 318 |
| 698 | 3300046648 | Ga0495611_0014136 | Ga0495611_0014136_2296_3336 | 318 |
| 699 | 3300046648 | Ga0495611_0018132 | Ga0495611_0018132_449_1489 | 318 |
| 700 | 3300046648 | Ga0495611_0019535 | Ga0495611_0019535_1421_2461 | 318 |
| 701 | 3300046660 | Ga0495625_0004856 | Ga0495625_0004856_4242_5264 | 318 |
| 702 | 3300046660 | Ga0495625_0075158 | Ga0495625_0075158_152_1192 | 318 |
| 703 | 3300046664 | Ga0495659_0000004 | Ga0495659_0000004_112704_113738 | 318 |
| 704 | 3300046664 | Ga0495659_0002446 | Ga0495659_0002446_4851_5891 | 318 |
| 705 | 3300046664 | Ga0495659_0010315 | Ga0495659_0010315_1555_2595 | 318 |
| 706 | 3300046665 | Ga0495661_0040181 | Ga0495661_0040181_469_1509 | 318 |
| 707 | 3300046691 | Ga0495670_0004151 | Ga0495670_0004151_2490_3530 | 318 |
| 708 | 3300046692 | Ga0495671_0000548 | Ga0495671_0000548_6945_7979 | 318 |
| 709 | 3300046692 | Ga0495671_0011372 | Ga0495671_0011372_1694_2707 | 318 |
| 710 | 3300046692 | Ga0495671_0030601 | Ga0495671_0030601_890_1930 | 318 |
| 711 | 3300046692 | Ga0495671_0043887 | Ga0495671_0043887_1016_2056 | 318 |
| 712 | 3300046692 | Ga0495671_0056373 | Ga0495671_0056373_425_1465 | 318 |
| 713 | 3300047318 | Ga0495636_0000383 | Ga0495636_0000383_8168_9208 | 318 |
| 714 | 3300047318 | Ga0495636_0008721 | Ga0495636_0008721_1784_2824 | 318 |
| 715 | 3300047320 | Ga0495672_0000045 | Ga0495672_0000045_51085_52119 | 318 |
| 716 | 3300047320 | Ga0495672_0000835 | Ga0495672_0000835_26757_27797 | 318 |
| 717 | 3300047320 | Ga0495672_0013305 | Ga0495672_0013305_3587_4627 | 318 |
| 718 | 3300047321 | Ga0495676_0045103 | Ga0495676_0045103_2311_3360 | 318 |
| 719 | 3300047443 | Ga0495687_001223 | Ga0495687_001223_17733_18773 | 318 |
| 720 | 3300047445 | Ga0495677_0001387 | Ga0495677_0001387_5997_7037 | 318 |
| 721 | 3300047445 | Ga0495677_0053862 | Ga0495677_0053862_403_1443 | 318 |
| 722 | 3300047447 | Ga0495685_000161 | Ga0495685_000161_15814_16854 | 318 |
| 723 | 3300048907 | Ga0496104_0299627 | Ga0496104_0299627_109_1119 | 318 |
| 724 | 3300048912 | Ga0496109_0258128 | Ga0496109_0258128_35_1045 | 318 |
| 725 | 3300049459 | Ga0495678_002384 | Ga0495678_002384_1787_2827 | 318 |
| 726 | 3300049459 | Ga0495678_008398 | Ga0495678_008398_678_1718 | 318 |
| 727 | 3300049460 | Ga0495682_0000206 | Ga0495682_0000206_24636_25676 | 318 |
| 728 | 3300049460 | Ga0495682_0000261 | Ga0495682_0000261_6533_7573 | 318 |
| 729 | 3300049460 | Ga0495682_0012369 | Ga0495682_0012369_1276_2316 | 318 |
| 730 | 3300049531 | Ga0501315_000768 | Ga0501315_000768_791_1819 | 318 |
| 731 | 3300049532 | Ga0501316_000316 | Ga0501316_000316_1048_2076 | 318 |
| 732 | 3300050494 | nmdc:mga06z11_18075_c1 | nmdc:mga06z11_18075_c1_423_1403 | 318 |
| 733 | 3300050496 | nmdc:mga07m45_104970_c1 | nmdc:mga07m45_104970_c1_204_1184 | 318 |
| 734 | 3300053079 | Ga0500610_0001519 | Ga0500610_0001519_3223_4236 | 318 |
| 735 | 3300053117 | Ga0500593_004327 | Ga0500593_004327_2206_3219 | 318 |
| 736 | 3300053158 | Ga0500627_0000606 | Ga0500627_0000606_6400_7413 | 318 |
| 737 | 3300053161 | Ga0500634_0025886 | Ga0500634_0025886_815_1828 | 318 |
| 738 | 3300059477 | Ga0587084_006029 | Ga0587084_006029_352_1395 | 318 |
| 739 | 3300059478 | Ga0587093_001079 | Ga0587093_001079_986_2038 | 318 |
| 740 | 3300059478 | Ga0587093_003533 | Ga0587093_003533_362_1405 | 318 |
| 741 | 3300059490 | Ga0587066_006337 | Ga0587066_006337_11_1054 | 318 |
| 742 | 3300059491 | Ga0587070_000447 | Ga0587070_000447_1145_2197 | 318 |
| 743 | 3300059491 | Ga0587070_001146 | Ga0587070_001146_401_1456 | 318 |
| 744 | 3300059491 | Ga0587070_008806 | Ga0587070_008806_41_1084 | 318 |
| 745 | 3300059493 | Ga0587077_000158 | Ga0587077_000158_2379_3431 | 318 |
| 746 | 3300059493 | Ga0587077_001244 | Ga0587077_001244_415_1452 | 318 |
| 747 | 3300059493 | Ga0587077_003034 | Ga0587077_003034_175_1218 | 318 |
| 748 | 3300059505 | Ga0587083_0000234 | Ga0587083_0000234_1985_3037 | 318 |
| 749 | 3300059505 | Ga0587083_0000943 | Ga0587083_0000943_984_2021 | 318 |
| 750 | 3300059505 | Ga0587083_0007482 | Ga0587083_0007482_234_1241 | 318 |
| 751 | 3300059506 | Ga0587085_000466 | Ga0587085_000466_1100_2152 | 318 |
| 752 | 3300059510 | Ga0587090_000183 | Ga0587090_000183_1185_2237 | 318 |
| 753 | 3300059510 | Ga0587090_007306 | Ga0587090_007306_352_1395 | 318 |
| 754 | 3300059511 | Ga0587091_000456 | Ga0587091_000456_1011_2063 | 318 |
| 755 | 3300059512 | Ga0587092_000527 | Ga0587092_000527_851_1903 | 318 |
| 756 | 3300059513 | Ga0587094_002704 | Ga0587094_002704_374_1426 | 318 |
| 757 | 3300059513 | Ga0587094_003838 | Ga0587094_003838_268_1311 | 318 |
| 758 | 3300059623 | Ga0587101_000394 | Ga0587101_000394_980_2032 | 318 |
| 759 | 3300059623 | Ga0587101_000917 | Ga0587101_000917_1057_2094 | 318 |
| 760 | 3300059623 | Ga0587101_001108 | Ga0587101_001108_322_1365 | 318 |
| 761 | 3300059626 | Ga0587115_005668 | Ga0587115_005668_352_1395 | 318 |
| 762 | 3300059639 | Ga0587062_000340 | Ga0587062_000340_853_1905 | 318 |
| 763 | 3300059641 | Ga0587068_000926 | Ga0587068_000926_988_2040 | 318 |
| 764 | 3300059641 | Ga0587068_001812 | Ga0587068_001812_437_1444 | 318 |
| 765 | 3300059641 | Ga0587068_002162 | Ga0587068_002162_466_1509 | 318 |
| 766 | 3300059642 | Ga0587069_001296 | Ga0587069_001296_401_1444 | 318 |
| 767 | 3300059644 | Ga0587075_000722 | Ga0587075_000722_951_1988 | 318 |
| 768 | 3300059645 | Ga0587076_000484 | Ga0587076_000484_1179_2231 | 318 |
| 769 | 3300059645 | Ga0587076_001845 | Ga0587076_001845_368_1411 | 318 |
| 770 | 3300059646 | Ga0587078_000307 | Ga0587078_000307_1186_2229 | 318 |
| 771 | 3300059646 | Ga0587078_002833 | Ga0587078_002833_272_1321 | 318 |
| 772 | 3300059647 | Ga0587079_002858 | Ga0587079_002858_299_1342 | 318 |
| 773 | 3300059647 | Ga0587079_007339 | Ga0587079_007339_570_1622 | 318 |
| 774 | 3300059648 | Ga0587100_000174 | Ga0587100_000174_1281_2333 | 318 |
| 775 | 3300059649 | Ga0587102_000521 | Ga0587102_000521_353_1396 | 318 |
| 776 | 3300059657 | Ga0587118_00294 | Ga0587118_00294_1202_2254 | 318 |
| 777 | 3300059658 | Ga0587119_000650 | Ga0587119_000650_960_2012 | 318 |
| 778 | 3300059660 | Ga0587124_000224 | Ga0587124_000224_884_1936 | 318 |
| 779 | 3300060344 | Ga0587071_000866 | Ga0587071_000866_1178_2221 | 318 |
| 780 | 3300060346 | Ga0587111_0000401 | Ga0587111_0000401_1026_2078 | 318 |
| 781 | 3300060346 | Ga0587111_0000679 | Ga0587111_0000679_1148_2191 | 318 |
| 782 | 3300060346 | Ga0587111_0002077 | Ga0587111_0002077_524_1531 | 318 |
| 783 | 2162886007 | SwRhRL2b_contig_1470696 | SwRhRL2b_0188.00001230 | 319 |
| 784 | 3300002987 | JGI25159J45721_1009411 | JGI25159J45721_10094113 | 319 |
| 785 | 3300003354 | JGI25160J50197_1013586 | JGI25160J50197_10135862 | 319 |
| 786 | 3300003374 | JGI25161J50226_1003713 | JGI25161J50226_10037133 | 319 |
| 787 | 3300003761 | Ga0055535_1009850 | Ga0055535_10098502 | 319 |
| 788 | 3300003762 | Ga0055542_1000004 | Ga0055542_1000004520 | 319 |
| 789 | 3300003773 | Ga0055537_1000067 | Ga0055537_100006748 | 319 |
| 790 | 3300003781 | Ga0055536_1002788 | Ga0055536_10027887 | 319 |
| 791 | 3300003781 | Ga0055536_1004581 | Ga0055536_10045815 | 319 |
| 792 | 3300003784 | Ga0055534_1000079 | Ga0055534_100007920 | 319 |
| 793 | 3300003784 | Ga0055534_1000343 | Ga0055534_100034316 | 319 |
| 794 | 3300003784 | Ga0055534_1009668 | Ga0055534_10096682 | 319 |
| 795 | 3300003790 | Ga0055528_1003321 | Ga0055528_10033212 | 319 |
| 796 | 3300003791 | Ga0055530_10004712 | Ga0055530_100047125 | 319 |
| 797 | 3300003791 | Ga0055530_10024260 | Ga0055530_100242602 | 319 |
| 798 | 3300003792 | Ga0055540_1001704 | Ga0055540_10017047 | 319 |
| 799 | 3300003792 | Ga0055540_1004292 | Ga0055540_10042926 | 319 |
| 800 | 3300003792 | Ga0055540_1005572 | Ga0055540_10055725 | 319 |
| 801 | 3300003794 | Ga0055531_10002097 | Ga0055531_100020978 | 319 |
| 802 | 3300005288 | Ga0065714_10040147 | Ga0065714_100401472 | 319 |
| 803 | 3300005289 | Ga0065704_10086689 | Ga0065704_100866893 | 319 |
| 804 | 3300005344 | Ga0070661_100109872 | Ga0070661_1001098722 | 319 |
| 805 | 3300005366 | Ga0070659_100239670 | Ga0070659_1002396701 | 319 |
| 806 | 3300005367 | Ga0070667_100354064 | Ga0070667_1003540642 | 319 |
| 807 | 3300005457 | Ga0070662_100137020 | Ga0070662_1001370202 | 319 |
| 808 | 3300005539 | Ga0068853_100006049 | Ga0068853_1000060496 | 319 |
| 809 | 3300005548 | Ga0070665_100358001 | Ga0070665_1003580012 | 319 |
| 810 | 3300005616 | Ga0068852_100157142 | Ga0068852_1001571422 | 319 |
| 811 | 3300005618 | Ga0068864_100047704 | Ga0068864_1000477043 | 319 |
| 812 | 3300006038 | Ga0075365_10004368 | Ga0075365_100043687 | 319 |
| 813 | 3300006048 | Ga0075363_100096383 | Ga0075363_1000963832 | 319 |
| 814 | 3300006058 | Ga0075432_10012016 | Ga0075432_100120162 | 319 |
| 815 | 3300006353 | Ga0075370_10000290 | Ga0075370_100002906 | 319 |
| 816 | 3300006353 | Ga0075370_10001075 | Ga0075370_100010758 | 319 |
| 817 | 3300006353 | Ga0075370_10026684 | Ga0075370_100266842 | 319 |
| 818 | 3300006353 | Ga0075370_10116680 | Ga0075370_101166801 | 319 |
| 819 | 3300006931 | Ga0097620_100180508 | Ga0097620_1001805082 | 319 |
| 820 | 3300006948 | Ga0099826_10004066 | Ga0099826_100040662 | 319 |
| 821 | 3300009036 | Ga0105244_10010743 | Ga0105244_100107432 | 319 |
| 822 | 3300009147 | Ga0114129_10019439 | Ga0114129_100194396 | 319 |
| 823 | 3300009148 | Ga0105243_10002076 | Ga0105243_1000207616 | 319 |
| 824 | 3300009148 | Ga0105243_10006737 | Ga0105243_100067373 | 319 |
| 825 | 3300009545 | Ga0105237_10066624 | Ga0105237_100666244 | 319 |
| 826 | 3300013100 | Ga0157373_10060247 | Ga0157373_100602472 | 319 |
| 827 | 3300013102 | Ga0157371_10060094 | Ga0157371_100600943 | 319 |
| 828 | 3300013105 | Ga0157369_10034289 | Ga0157369_100342893 | 319 |
| 829 | 3300014497 | Ga0182008_10010702 | Ga0182008_100107024 | 319 |
| 830 | 3300015261 | Ga0182006_1001700 | Ga0182006_100170012 | 319 |
| 831 | 3300017792 | Ga0163161_10000069 | Ga0163161_1000006941 | 319 |
| 832 | 3300025228 | Ga0209672_101260 | Ga0209672_1012602 | 319 |
| 833 | 3300025229 | Ga0209147_101692 | Ga0209147_1016925 | 319 |
| 834 | 3300025242 | Ga0209258_100022 | Ga0209258_100022519 | 319 |
| 835 | 3300025254 | Ga0209148_1000034 | Ga0209148_1000034519 | 319 |
| 836 | 3300025258 | Ga0209129_1002491 | Ga0209129_10024915 | 319 |
| 837 | 3300025258 | Ga0209129_1013750 | Ga0209129_10137502 | 319 |
| 838 | 3300025263 | Ga0209565_1000146 | Ga0209565_10001465 | 319 |
| 839 | 3300025263 | Ga0209565_1000294 | Ga0209565_100029421 | 319 |
| 840 | 3300025273 | Ga0209673_1000701 | Ga0209673_10007015 | 319 |
| 841 | 3300025273 | Ga0209673_1000860 | Ga0209673_100086020 | 319 |
| 842 | 3300025273 | Ga0209673_1001758 | Ga0209673_10017582 | 319 |
| 843 | 3300025284 | Ga0209130_1002114 | Ga0209130_10021146 | 319 |
| 844 | 3300025291 | Ga0209675_1000024 | Ga0209675_1000024287 | 319 |
| 845 | 3300025291 | Ga0209675_1000765 | Ga0209675_10007656 | 319 |
| 846 | 3300025291 | Ga0209675_1001622 | Ga0209675_10016228 | 319 |
| 847 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005181 | 319 |
| 848 | 3300025292 | Ga0209676_1000434 | Ga0209676_100043439 | 319 |
| 849 | 3300025292 | Ga0209676_1001176 | Ga0209676_100117616 | 319 |
| 850 | 3300025292 | Ga0209676_1003444 | Ga0209676_10034442 | 319 |
| 851 | 3300025294 | Ga0209025_1000116 | Ga0209025_10001165 | 319 |
| 852 | 3300025294 | Ga0209025_1000394 | Ga0209025_100039486 | 319 |
| 853 | 3300025294 | Ga0209025_1001285 | Ga0209025_100128519 | 319 |
| 854 | 3300025294 | Ga0209025_1039755 | Ga0209025_10397552 | 319 |
| 855 | 3300025294 | Ga0209025_1076451 | Ga0209025_10764512 | 319 |
| 856 | 3300025295 | Ga0209564_1000155 | Ga0209564_10001555 | 319 |
| 857 | 3300025295 | Ga0209564_1000292 | Ga0209564_100029236 | 319 |
| 858 | 3300025297 | Ga0209758_1000107 | Ga0209758_10001075 | 319 |
| 859 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007916 | 319 |
| 860 | 3300025298 | Ga0209050_1002520 | Ga0209050_100252013 | 319 |
| 861 | 3300025299 | Ga0209256_1000038 | Ga0209256_100003841 | 319 |
| 862 | 3300025299 | Ga0209256_1000087 | Ga0209256_10000875 | 319 |
| 863 | 3300025299 | Ga0209256_1021719 | Ga0209256_10217192 | 319 |
| 864 | 3300025302 | Ga0207426_1000123 | Ga0207426_10001235 | 319 |
| 865 | 3300025302 | Ga0207426_1000176 | Ga0207426_100017610 | 319 |
| 866 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009181 | 319 |
| 867 | 3300025303 | Ga0209051_1000174 | Ga0209051_100017455 | 319 |
| 868 | 3300025303 | Ga0209051_1000262 | Ga0209051_100026241 | 319 |
| 869 | 3300025303 | Ga0209051_1001248 | Ga0209051_10012483 | 319 |
| 870 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011155 | 319 |
| 871 | 3300025304 | Ga0209257_1000139 | Ga0209257_100013945 | 319 |
| 872 | 3300025304 | Ga0209257_1010519 | Ga0209257_10105192 | 319 |
| 873 | 3300025728 | Ga0207655_1001900 | Ga0207655_10019007 | 319 |
| 874 | 3300025914 | Ga0207671_10044758 | Ga0207671_100447582 | 319 |
| 875 | 3300025924 | Ga0207694_10145778 | Ga0207694_101457782 | 319 |
| 876 | 3300025931 | Ga0207644_10033476 | Ga0207644_100334763 | 319 |
| 877 | 3300025932 | Ga0207690_10300680 | Ga0207690_103006802 | 319 |
| 878 | 3300025933 | Ga0207706_10021056 | Ga0207706_100210562 | 319 |
| 879 | 3300025933 | Ga0207706_10046814 | Ga0207706_100468144 | 319 |
| 880 | 3300025935 | Ga0207709_10000242 | Ga0207709_1000024229 | 319 |
| 881 | 3300025935 | Ga0207709_10015707 | Ga0207709_100157075 | 319 |
| 882 | 3300025935 | Ga0207709_10232822 | Ga0207709_102328222 | 319 |
| 883 | 3300025945 | Ga0207679_10015159 | Ga0207679_100151592 | 319 |
| 884 | 3300025986 | Ga0207658_10230334 | Ga0207658_102303342 | 319 |
| 885 | 3300026041 | Ga0207639_10009566 | Ga0207639_100095664 | 319 |
| 886 | 3300026088 | Ga0207641_10033648 | Ga0207641_100336482 | 319 |
| 887 | 3300026089 | Ga0207648_10150071 | Ga0207648_101500712 | 319 |
| 888 | 3300026095 | Ga0207676_10101719 | Ga0207676_101017192 | 319 |
| 889 | 3300026116 | Ga0207674_10148350 | Ga0207674_101483502 | 319 |
| 890 | 3300027666 | Ga0209282_1002689 | Ga0209282_10026892 | 319 |
| 891 | 3300030522 | Ga0307512_10049067 | Ga0307512_100490673 | 319 |
| 892 | 3300030731 | Ga0316177_1082843 | Ga0316177_10828432 | 319 |
| 893 | 3300030735 | Ga0316178_1038078 | Ga0316178_10380781 | 319 |
| 894 | 3300030745 | Ga0316182_1251449 | Ga0316182_12514492 | 319 |
| 895 | 3300031548 | Ga0307408_100074954 | Ga0307408_1000749542 | 319 |
| 896 | 3300031649 | Ga0307514_10070423 | Ga0307514_100704233 | 319 |
| 897 | 3300031731 | Ga0307405_10428207 | Ga0307405_104282071 | 319 |
| 898 | 3300031901 | Ga0307406_10002798 | Ga0307406_100027982 | 319 |
| 899 | 3300031901 | Ga0307406_10135307 | Ga0307406_101353072 | 319 |
| 900 | 3300031911 | Ga0307412_10019946 | Ga0307412_100199463 | 319 |
| 901 | 3300031911 | Ga0307412_10092388 | Ga0307412_100923882 | 319 |
| 902 | 3300032004 | Ga0307414_10141118 | Ga0307414_101411181 | 319 |
| 903 | 3300035114 | Ga0373939_0000028 | Ga0373939_0000028_3393_4361 | 319 |
| 904 | 3300035691 | Ga0373931_0000156 | Ga0373931_0000156_2723_3691 | 319 |
| 905 | 3300037471 | Ga0395905_0052544 | Ga0395905_0052544_1575_2555 | 319 |
| 906 | 3300041413 | Ga0439465_0040615 | Ga0439465_0040615_369_1328 | 319 |
| 907 | 3300042007 | Ga0439449_0095586 | Ga0439449_0095586_41_1000 | 319 |
| 908 | 3300042122 | Ga0450920_026091 | Ga0450920_026091_50_1036 | 319 |
| 909 | 3300042435 | Ga0439434_0025800 | Ga0439434_0025800_592_1551 | 319 |
| 910 | 3300042531 | Ga0450918_000247 | Ga0450918_000247_4854_5840 | 319 |
| 911 | 3300044901 | Ga0466960_0031545 | Ga0466960_0031545_867_1877 | 319 |
| 912 | 3300045051 | Ga0451576_0004309 | Ga0451576_0004309_596_1639 | 319 |
| 913 | 3300046472 | Ga0495580_0039704 | Ga0495580_0039704_1548_2552 | 319 |
| 914 | 3300046512 | Ga0495610_0026825 | Ga0495610_0026825_669_1628 | 319 |
| 915 | 3300046513 | Ga0495616_0001038 | Ga0495616_0001038_16165_17124 | 319 |
| 916 | 3300046515 | Ga0495620_0012100 | Ga0495620_0012100_2951_3910 | 319 |
| 917 | 3300046518 | Ga0495631_0002040 | Ga0495631_0002040_5956_6915 | 319 |
| 918 | 3300046522 | Ga0495643_0040749 | Ga0495643_0040749_504_1601 | 319 |
| 919 | 3300046539 | Ga0495621_0035232 | Ga0495621_0035232_552_1511 | 319 |
| 920 | 3300046616 | Ga0495668_0080386 | Ga0495668_0080386_292_1251 | 319 |
| 921 | 3300046660 | Ga0495625_0000311 | Ga0495625_0000311_27321_28280 | 319 |
| 922 | 3300046692 | Ga0495671_0016274 | Ga0495671_0016274_431_1390 | 319 |
| 923 | 3300047321 | Ga0495676_0012050 | Ga0495676_0012050_2684_3643 | 319 |
| 924 | 3300047673 | Ga0495593_0100035 | Ga0495593_0100035_68_1027 | 319 |
| 925 | 3300048089 | Ga0495614_0099981 | Ga0495614_0099981_134_1093 | 319 |
| 926 | 3300048913 | Ga0496110_0295788 | Ga0496110_0295788_284_1276 | 319 |
| 927 | 3300048919 | Ga0496116_0034568 | Ga0496116_0034568_2131_3090 | 319 |
| 928 | 3300048920 | Ga0496117_0070292 | Ga0496117_0070292_237_1196 | 319 |
| 929 | 3300048921 | Ga0496118_0005315 | Ga0496118_0005315_5747_6706 | 319 |
| 930 | 3300048921 | Ga0496118_0034971 | Ga0496118_0034971_624_1583 | 319 |
| 931 | 3300048922 | Ga0496119_0142349 | Ga0496119_0142349_192_1151 | 319 |
| 932 | 3300048923 | Ga0496120_0133240 | Ga0496120_0133240_139_1098 | 319 |
| 933 | 3300048924 | Ga0496121_0007376 | Ga0496121_0007376_7511_8470 | 319 |
| 934 | 3300048926 | Ga0496123_0159495 | Ga0496123_0159495_42_1001 | 319 |
| 935 | 3300048927 | Ga0496124_0238352 | Ga0496124_0238352_270_1295 | 319 |
| 936 | 3300048928 | Ga0496125_0071362 | Ga0496125_0071362_1534_2493 | 319 |
| 937 | 3300049705 | Ga0501225_0003407 | Ga0501225_0003407_142_1101 | 319 |
| 938 | 3300049759 | Ga0501262_000459 | Ga0501262_000459_3253_4212 | 319 |
| 939 | 3300050489 | nmdc:mga03683_9478_c1 | nmdc:mga03683_9478_c1_390_1349 | 319 |
| 940 | 3300050490 | nmdc:mga03n38_165812_c1 | nmdc:mga03n38_165812_c1_148_1107 | 319 |
| 941 | 3300050491 | nmdc:mga00v17_2326_c1 | nmdc:mga00v17_2326_c1_2830_3789 | 319 |
| 942 | 3300050492 | nmdc:mga0yw44_3664_c1 | nmdc:mga0yw44_3664_c1_2703_3662 | 319 |
| 943 | 3300050493 | nmdc:mga0k408_86703_c1 | nmdc:mga0k408_86703_c1_23_982 | 319 |
| 944 | 3300050496 | nmdc:mga07m45_1016_c1 | nmdc:mga07m45_1016_c1_1640_2599 | 319 |
| 945 | 3300050496 | nmdc:mga07m45_103_c1 | nmdc:mga07m45_103_c1_775_1734 | 319 |
| 946 | 3300050496 | nmdc:mga07m45_76134_c2 | nmdc:mga07m45_76134_c2_83_1093 | 319 |
| 947 | 3300050507 | nmdc:mga05p37_81063_c1 | nmdc:mga05p37_81063_c1_1532_2533 | 319 |
| 948 | 3300053079 | Ga0500610_0002412 | Ga0500610_0002412_4444_5403 | 319 |
| 949 | 3300053093 | Ga0500651_0000133 | Ga0500651_0000133_4792_5751 | 319 |
| 950 | 3300053110 | Ga0500571_000153 | Ga0500571_000153_9268_10227 | 319 |
| 951 | 3300053111 | Ga0500572_056981 | Ga0500572_056981_33_992 | 319 |
| 952 | 3300053116 | Ga0500592_003544 | Ga0500592_003544_1205_2164 | 319 |
| 953 | 3300053117 | Ga0500593_000449 | Ga0500593_000449_6914_7873 | 319 |
| 954 | 3300053118 | Ga0500594_0000721 | Ga0500594_0000721_321_1280 | 319 |
| 955 | 3300053120 | Ga0500597_084989 | Ga0500597_084989_366_1325 | 319 |
| 956 | 3300053121 | Ga0500607_027526 | Ga0500607_027526_568_1527 | 319 |
| 957 | 3300053122 | Ga0500608_016018 | Ga0500608_016018_1255_2214 | 319 |
| 958 | 3300053128 | Ga0500626_008205 | Ga0500626_008205_2021_2980 | 319 |
| 959 | 3300053130 | Ga0500642_0172302 | Ga0500642_0172302_44_1003 | 319 |
| 960 | 3300053134 | Ga0500658_0000124 | Ga0500658_0000124_239_1198 | 319 |
| 961 | 3300053134 | Ga0500658_0000342 | Ga0500658_0000342_238_1197 | 319 |
| 962 | 3300053138 | Ga0500564_042638 | Ga0500564_042638_200_1159 | 319 |
| 963 | 3300053139 | Ga0500568_0001367 | Ga0500568_0001367_853_1812 | 319 |
| 964 | 3300053141 | Ga0500574_021580 | Ga0500574_021580_538_1497 | 319 |
| 965 | 3300053158 | Ga0500627_0001918 | Ga0500627_0001918_351_1310 | 319 |
| 966 | 3300053161 | Ga0500634_0001113 | Ga0500634_0001113_6249_7208 | 319 |
| 967 | 3300053161 | Ga0500634_0123534 | Ga0500634_0123534_278_1237 | 319 |
| 968 | 3300053162 | Ga0500638_003846 | Ga0500638_003846_4215_5174 | 319 |
| 969 | 3300053177 | Ga0500636_0009012 | Ga0500636_0009012_515_1474 | 319 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.6008 | 10 | 308 |
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.5926 | 10 | 308 |
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5924 | 12 | 309 |
| 2nq2-assembly1.cif.gz_A | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5899 | 13 | 309 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5822 | 10 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77315_52_317_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9442 | 39 | 307 | 1.10.3470.10 |
| af_P0AGI4_56_383_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9377 | 39 | 307 | 1.10.3470.10 |
| af_P77315_52_317_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9373 | 39 | 307 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9323 | 39 | 307 | 1.10.3470.10 |
| af_P23200_41_325_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9306 | 39 | 307 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3C444-F1-model_v4 | ABC transporter permease | 0.9753 | 10 | 316 |
GO:0005886
GO:0022857 |
| AF-A0A554XA20-F1-model_v4 | Ribose import permease protein RbsC | 0.9736 | 12 | 319 |
GO:0005886
GO:0022857 |
| AF-A0A5Q4YY88-F1-model_v4 | Periplasmic binding protein domain-containing protein | 0.9723 | 12 | 316 |
GO:0005886
GO:0022857 |
| AF-A0A1Q7VM85-F1-model_v4 | ABC transporter permease | 0.9688 | 12 | 319 |
GO:0005886
GO:0022857 |
| AF-A0A2N2SZP4-F1-model_v4 | ABC transporter permease | 0.9676 | 43 | 319 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar