F486972

General Info

Members Datasets Scaffolds Average Seq Length
965 397 1930 183

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10063757|Ga0213876_100637572
Length 183
Sequence MSIDVGARLRGLRTTFGLSQRELARRAGVTNGLISLIEQNRVSPSVSSLKKVLDGVPMSLAEFFTLDPGTAVPQSVFAADELVELGNEELSLRLVAAQRPGRQLTILHERYAAGAGTGEDMLMHRGEEGGVVVRGKVELTVGGVARVLSPGEAYYFSSQLPHRFRNVGREPCEIISASTPPTF

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
237 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
238 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
239 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
240 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
241 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
246 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
250 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
251 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
252 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
257 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
282 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
355 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
356 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
373 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
376 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
377 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
378 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
379 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
380 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
381 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
382 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
383 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
384 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
387 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
388 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
389 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
390 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
391 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.01
Nodule 0
Rhizoplane 4.97
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10063757 3300021384 Bacteria 1946
2 RicEn_C9875 2010549000 Bacteria 838
3 SwRhRL2b_contig_2220656 2162886007 Bacteria 2287
4 rootH1_10101733 3300003316 Bacteria 2135
5 rootH2_10016870 3300003320 Bacteria 1461
6 rootH1_10033537 3300003323 Bacteria 6912
7 Ga0065704_10011697 3300005289 Bacteria 4054
8 Ga0065712_10070294 3300005290 Bacteria 6136
9 Ga0065715_10136644 3300005293 Bacteria 1919
10 Ga0070676_10111192 3300005328 Bacteria 1706
11 Ga0070683_100509493 3300005329 Unclassified 1150
12 Ga0070690_100012452 3300005330 Bacteria 5003
13 Ga0070690_100034482 3300005330 Bacteria 3171
14 Ga0070690_100442761 3300005330 Bacteria 962
15 Ga0070690_101014645 3300005330 Bacteria 654
16 Ga0070670_100150538 3300005331 Bacteria 2014
17 Ga0070670_100176738 3300005331 Bacteria 1853
18 Ga0070677_10246646 3300005333 Bacteria 884
19 Ga0068869_100387362 3300005334 Bacteria 1147
20 Ga0070666_10084334 3300005335 Bacteria 2174
21 Ga0070666_10160843 3300005335 Bacteria 1569
22 Ga0070680_100005497 3300005336 Bacteria 9590
23 Ga0070680_100169769 3300005336 Bacteria 1835
24 Ga0070680_100232785 3300005336 Bacteria 1556
25 Ga0070682_100197138 3300005337 Bacteria 1418
26 Ga0070682_100380023 3300005337 Bacteria 1062
27 Ga0070682_100579687 3300005337 Bacteria 882
28 Ga0068868_100028250 3300005338 Bacteria 4287
29 Ga0070689_100002266 3300005340 Bacteria 12501
30 Ga0070689_100003597 3300005340 Bacteria 10332
31 Ga0070689_100641499 3300005340 Bacteria 923
32 Ga0070691_10107204 3300005341 Bacteria 1394
33 Ga0070687_100274690 3300005343 Bacteria 1058
34 Ga0070687_100779705 3300005343 Bacteria 675
35 Ga0070687_100883988 3300005343 Bacteria 639
36 Ga0070661_100070943 3300005344 Bacteria 2563
37 Ga0070661_100694517 3300005344 Bacteria 829
38 Ga0070668_100107972 3300005347 Bacteria 2213
39 Ga0070669_100176852 3300005353 Bacteria 1667
40 Ga0070669_100320947 3300005353 Bacteria 1250
41 Ga0070675_100001269 3300005354 Bacteria 18440
42 Ga0070675_100187299 3300005354 Bacteria 1792
43 Ga0070675_100444151 3300005354 Bacteria 1162
44 Ga0070675_100457919 3300005354 Bacteria 1145
45 Ga0070671_100000657 3300005355 Bacteria 24836
46 Ga0070671_100110753 3300005355 Bacteria 2306
47 Ga0070673_100020159 3300005364 Bacteria 4804
48 Ga0070673_100092132 3300005364 Bacteria 2478
49 Ga0070673_100173114 3300005364 Bacteria 1843
50 Ga0070673_100364754 3300005364 Bacteria 1285
51 Ga0070673_100548881 3300005364 Bacteria 1049
52 Ga0070688_100005304 3300005365 Bacteria 6781
53 Ga0070667_100022143 3300005367 Bacteria 5272
54 Ga0070667_100037857 3300005367 Bacteria 4044
55 Ga0070667_100296137 3300005367 Bacteria 1456
56 Ga0070709_10116089 3300005434 Bacteria 1807
57 Ga0070709_10156402 3300005434 Bacteria 1581
58 Ga0070709_10789025 3300005434 Unclassified 745
59 Ga0070714_100004027 3300005435 Bacteria 11045
60 Ga0070714_100058875 3300005435 Bacteria 3293
61 Ga0070714_100263841 3300005435 Bacteria 1595
62 Ga0070713_100003765 3300005436 Bacteria 10041
63 Ga0070713_100004406 3300005436 Bacteria 9453
64 Ga0070713_100112568 3300005436 Bacteria 2375
65 Ga0070713_100231427 3300005436 Unclassified 1680
66 Ga0070710_10002005 3300005437 Bacteria 9640
67 Ga0070710_10102895 3300005437 Bacteria 1704
68 Ga0070710_10987364 3300005437 Bacteria 613
69 Ga0070701_10024998 3300005438 Bacteria 2895
70 Ga0070701_10205419 3300005438 Bacteria 1167
71 Ga0070701_10227177 3300005438 Bacteria 1116
72 Ga0070711_100062958 3300005439 Bacteria 2587
73 Ga0070711_100135726 3300005439 Bacteria 1838
74 Ga0070705_100005025 3300005440 Bacteria 6434
75 Ga0070705_100141213 3300005440 Bacteria 1585
76 Ga0070705_101001623 3300005440 Bacteria 678
77 Ga0070700_100179598 3300005441 Bacteria 1472
78 Ga0070700_100195867 3300005441 Bacteria 1416
79 Ga0070700_100246164 3300005441 Bacteria 1280
80 Ga0070694_100039533 3300005444 Bacteria 3140
81 Ga0070694_100257513 3300005444 Bacteria 1322
82 Ga0070694_100289354 3300005444 Bacteria 1252
83 Ga0070663_100628945 3300005455 Bacteria 906
84 Ga0070663_100828828 3300005455 Bacteria 795
85 Ga0070663_101623125 3300005455 Bacteria 577
86 Ga0070678_100001882 3300005456 Bacteria 11328
87 Ga0070678_101182414 3300005456 Bacteria 709
88 Ga0070678_101341327 3300005456 Bacteria 666
89 Ga0070662_100106771 3300005457 Bacteria 2127
90 Ga0070662_100121887 3300005457 Bacteria 2000
91 Ga0070681_10000738 3300005458 Bacteria 27069
92 Ga0070681_10001577 3300005458 Bacteria 20233
93 Ga0070681_10015379 3300005458 Bacteria 7614
94 Ga0070681_10024230 3300005458 Bacteria 6109
95 Ga0070681_10048512 3300005458 Bacteria 4243
96 Ga0070681_10049548 3300005458 Bacteria 4194
97 Ga0070681_10141489 3300005458 Bacteria 2336
98 Ga0070681_10740875 3300005458 Bacteria 899
99 Ga0068867_100012777 3300005459 Bacteria 5940
100 Ga0068867_100047736 3300005459 Bacteria 3148
101 Ga0068867_100179522 3300005459 Bacteria 1682
102 Ga0070685_10002528 3300005466 Bacteria 9382
103 Ga0070685_10083125 3300005466 Bacteria 1923
104 Ga0070685_10480368 3300005466 Unclassified 876
105 Ga0070706_100293187 3300005467 Bacteria 1518
106 Ga0070699_100022483 3300005518 Bacteria 5435
107 Ga0070699_101116196 3300005518 Bacteria 723
108 Ga0070679_100000469 3300005530 Bacteria 34407
109 Ga0070679_100005515 3300005530 Bacteria 11722
110 Ga0070679_100087639 3300005530 Bacteria 3100
111 Ga0070679_100116286 3300005530 Bacteria 2659
112 Ga0070679_100155886 3300005530 Bacteria 2258
113 Ga0070679_101525989 3300005530 Bacteria 615
114 Ga0070684_100513922 3300005535 Bacteria 1110
115 Ga0070684_100575395 3300005535 Bacteria 1046
116 Ga0068853_100250645 3300005539 Bacteria 1624
117 Ga0068853_100286241 3300005539 Bacteria 1520
118 Ga0068853_100526451 3300005539 Bacteria 1118
119 Ga0068853_100570492 3300005539 Bacteria 1073
120 Ga0070672_100027580 3300005543 Bacteria 4238
121 Ga0070672_100029661 3300005543 Bacteria 4104
122 Ga0070672_100054834 3300005543 Bacteria 3122
123 Ga0070672_100167369 3300005543 Bacteria 1826
124 Ga0070672_100530695 3300005543 Bacteria 1020
125 Ga0070686_100002735 3300005544 Bacteria 9706
126 Ga0070695_100009460 3300005545 Bacteria 5804
127 Ga0070696_100020484 3300005546 Bacteria 4481
128 Ga0070696_100092350 3300005546 Bacteria 2157
129 Ga0070693_100040423 3300005547 Bacteria 2618
130 Ga0070693_100287006 3300005547 Bacteria 1104
131 Ga0070665_100000543 3300005548 Bacteria 52995
132 Ga0070665_100006529 3300005548 Bacteria 11855
133 Ga0070665_100009640 3300005548 Bacteria 9766
134 Ga0070665_100029937 3300005548 Bacteria 5479
135 Ga0070665_100032219 3300005548 Bacteria 5276
136 Ga0070665_100053459 3300005548 Bacteria 4050
137 Ga0070665_100107978 3300005548 Bacteria 2785
138 Ga0070665_100341674 3300005548 Bacteria 1502
139 Ga0070665_100391338 3300005548 Bacteria 1398
140 Ga0070704_100053103 3300005549 Bacteria 2863
141 Ga0070704_100405079 3300005549 Bacteria 1165
142 Ga0068855_100001482 3300005563 Bacteria 29366
143 Ga0068855_100001838 3300005563 Bacteria 26405
144 Ga0068855_100094225 3300005563 Bacteria 3453
145 Ga0068855_100169063 3300005563 Bacteria 2477
146 Ga0068855_100318422 3300005563 Bacteria 1720
147 Ga0070664_100276073 3300005564 Bacteria 1515
148 Ga0070664_100966490 3300005564 Bacteria 800
149 Ga0068857_100035066 3300005577 Bacteria 4441
150 Ga0068857_100154869 3300005577 Bacteria 2078
151 Ga0068857_100223179 3300005577 Bacteria 1722
152 Ga0068854_100446984 3300005578 Bacteria 1079
153 Ga0068856_100004498 3300005614 Bacteria 13867
154 Ga0068856_100529173 3300005614 Bacteria 1200
155 Ga0068856_100546507 3300005614 Bacteria 1179
156 Ga0068856_100626688 3300005614 Bacteria 1096
157 Ga0068856_100832996 3300005614 Unclassified 942
158 Ga0070702_100006702 3300005615 Bacteria 5471
159 Ga0070702_100009527 3300005615 Bacteria 4757
160 Ga0068852_100366968 3300005616 Bacteria 1409
161 Ga0068852_100439742 3300005616 Bacteria 1289
162 Ga0068859_100000929 3300005617 Bacteria 29994
163 Ga0068859_100009204 3300005617 Bacteria 9973
164 Ga0068859_100125227 3300005617 Bacteria 2638
165 Ga0068859_100228640 3300005617 Bacteria 1948
166 Ga0068859_100354535 3300005617 Bacteria 1562
167 Ga0068859_102080647 3300005617 Bacteria 627
168 Ga0068864_100004892 3300005618 Bacteria 10973
169 Ga0068866_10137770 3300005718 Bacteria 1397
170 Ga0068861_100001663 3300005719 Bacteria 14225
171 Ga0068861_100002156 3300005719 Bacteria 12755
172 Ga0068861_100012276 3300005719 Bacteria 5975
173 Ga0068861_100036200 3300005719 Bacteria 3661
174 Ga0068861_100226488 3300005719 Bacteria 1583
175 Ga0068861_101289985 3300005719 Bacteria 710
176 Ga0068851_10179076 3300005834 Bacteria 1173
177 Ga0068870_10134943 3300005840 Bacteria 1438
178 Ga0068863_100001099 3300005841 Bacteria 27025
179 Ga0068863_100048854 3300005841 Bacteria 4011
180 Ga0068863_100060367 3300005841 Bacteria 3586
181 Ga0068863_100414724 3300005841 Bacteria 1318
182 Ga0068863_100469460 3300005841 Bacteria 1236
183 Ga0068863_100500360 3300005841 Bacteria 1197
184 Ga0068858_100002788 3300005842 Bacteria 17562
185 Ga0068858_100024983 3300005842 Bacteria 5560
186 Ga0068858_100029209 3300005842 Bacteria 5119
187 Ga0068858_100029595 3300005842 Bacteria 5086
188 Ga0068858_100110818 3300005842 Bacteria 2563
189 Ga0068858_100253828 3300005842 Bacteria 1671
190 Ga0068860_100002907 3300005843 Bacteria 17741
191 Ga0068860_100055609 3300005843 Bacteria 3762
192 Ga0068860_100171261 3300005843 Bacteria 2097
193 Ga0068862_100013694 3300005844 Bacteria 6718
194 Ga0068862_100024285 3300005844 Bacteria 5085
195 Ga0068862_100158654 3300005844 Bacteria 2018
196 Ga0068862_100162582 3300005844 Bacteria 1994
197 Ga0068862_101006079 3300005844 Bacteria 825
198 Ga0081455_10016058 3300005937 Bacteria 7243
199 Ga0081539_10000028 3300005985 Bacteria 328182
200 Ga0070717_10044415 3300006028 Bacteria 3628
201 Ga0075432_10048877 3300006058 Bacteria 1489
202 Ga0070715_10000714 3300006163 Bacteria 8928
203 Ga0070716_100007820 3300006173 Bacteria 5283
204 Ga0070716_100342283 3300006173 Bacteria 1055
205 Ga0070712_100000750 3300006175 Bacteria 19154
206 Ga0070712_100082000 3300006175 Bacteria 2339
207 Ga0097621_100072320 3300006237 Bacteria 2852
208 Ga0097621_100114721 3300006237 Bacteria 2280
209 Ga0097621_100126691 3300006237 Bacteria 2169
210 Ga0097621_100141911 3300006237 Bacteria 2053
211 Ga0097621_100564154 3300006237 Bacteria 1037
212 Ga0068871_100062807 3300006358 Bacteria 3036
213 Ga0068871_100094236 3300006358 Bacteria 2499
214 Ga0068871_100415797 3300006358 Bacteria 1200
215 Ga0068871_100544488 3300006358 Bacteria 1051
216 Ga0068871_100654374 3300006358 Unclassified 959
217 Ga0075428_100002070 3300006844 Bacteria 21641
218 Ga0075428_100004658 3300006844 Bacteria 15175
219 Ga0075428_100012224 3300006844 Bacteria 9545
220 Ga0075428_100038164 3300006844 Bacteria 5286
221 Ga0075428_100380745 3300006844 Bacteria 1513
222 Ga0075430_100075385 3300006846 Bacteria 2828
223 Ga0075430_100336650 3300006846 Bacteria 1247
224 Ga0075431_100000030 3300006847 Bacteria 72683
225 Ga0075431_100018484 3300006847 Bacteria 7099
226 Ga0075431_100256976 3300006847 Bacteria 1774
227 Ga0075434_100551957 3300006871 Bacteria 1172
228 Ga0075429_100006776 3300006880 Bacteria 9936
229 Ga0075429_100100005 3300006880 Bacteria 2531
230 Ga0075429_100107637 3300006880 Bacteria 2436
231 Ga0075429_100679284 3300006880 Bacteria 902
232 Ga0075429_101278567 3300006880 Bacteria 640
233 Ga0068865_100005989 3300006881 Bacteria 7408
234 Ga0068865_100032027 3300006881 Bacteria 3509
235 Ga0068865_100154253 3300006881 Bacteria 1745
236 Ga0068865_100256914 3300006881 Bacteria 1381
237 Ga0097620_100000929 3300006931 Bacteria 29994
238 Ga0097620_100009203 3300006931 Bacteria 9973
239 Ga0097620_100125225 3300006931 Bacteria 2638
240 Ga0097620_100228650 3300006931 Bacteria 1948
241 Ga0097620_100354551 3300006931 Bacteria 1562
242 Ga0097620_102080195 3300006931 Bacteria 627
243 Ga0075435_100389863 3300007076 Bacteria 1197
244 Ga0075435_100609771 3300007076 Bacteria 947
245 Ga0099794_10011136 3300007265 Bacteria 3844
246 Ga0099794_10021256 3300007265 Bacteria 2946
247 Ga0099795_10037368 3300007788 Bacteria 1708
248 Ga0105240_10002127 3300009093 Bacteria 32338
249 Ga0105240_10002705 3300009093 Bacteria 28172
250 Ga0105240_10009513 3300009093 Bacteria 13757
251 Ga0105240_10019061 3300009093 Bacteria 9177
252 Ga0105240_10043180 3300009093 Bacteria 5739
253 Ga0105240_10062866 3300009093 Bacteria 4620
254 Ga0105240_10268433 3300009093 Bacteria 1966
255 Ga0105240_10578905 3300009093 Bacteria 1239
256 Ga0105240_10779600 3300009093 Bacteria 1037
257 Ga0105240_11130489 3300009093 Unclassified 832
258 Ga0111539_10009762 3300009094 Bacteria 12114
259 Ga0111539_10065955 3300009094 Bacteria 4276
260 Ga0111539_10168629 3300009094 Bacteria 2558
261 Ga0111539_10233281 3300009094 Bacteria 2142
262 Ga0111539_10284440 3300009094 Bacteria 1925
263 Ga0111539_10498440 3300009094 Bacteria 1418
264 Ga0111539_10704175 3300009094 Bacteria 1176
265 Ga0111539_11374338 3300009094 Bacteria 819
266 Ga0105245_10019110 3300009098 Bacteria 5998
267 Ga0105245_10541684 3300009098 Bacteria 1185
268 Ga0105247_10000390 3300009101 Bacteria 37263
269 Ga0105247_10008064 3300009101 Bacteria 6435
270 Ga0105247_10065548 3300009101 Bacteria 2260
271 Ga0105247_10434298 3300009101 Unclassified 943
272 Ga0114129_10153233 3300009147 Bacteria 3154
273 Ga0114129_10272428 3300009147 Bacteria 2264
274 Ga0114129_10939058 3300009147 Bacteria 1093
275 Ga0105243_10102731 3300009148 Bacteria 2376
276 Ga0105243_10168742 3300009148 Bacteria 1893
277 Ga0105243_10391033 3300009148 Bacteria 1289
278 Ga0105243_11630474 3300009148 Bacteria 672
279 Ga0105241_10034500 3300009174 Bacteria 3802
280 Ga0105241_10473736 3300009174 Bacteria 1112
281 Ga0105241_10541193 3300009174 Bacteria 1044
282 Ga0105241_10940212 3300009174 Bacteria 805
283 Ga0105242_10006693 3300009176 Bacteria 8894
284 Ga0105242_10019979 3300009176 Bacteria 5248
285 Ga0105242_10648072 3300009176 Bacteria 1027
286 Ga0105248_10001404 3300009177 Bacteria 26898
287 Ga0105248_10010920 3300009177 Bacteria 10020
288 Ga0105248_10030432 3300009177 Bacteria 6027
289 Ga0105248_10075402 3300009177 Bacteria 3791
290 Ga0105248_11171076 3300009177 Bacteria 869
291 Ga0105248_11812101 3300009177 Bacteria 692
292 Ga0105237_10007658 3300009545 Bacteria 11802
293 Ga0105237_10162994 3300009545 Bacteria 2228
294 Ga0105237_10217056 3300009545 Bacteria 1913
295 Ga0105237_10793924 3300009545 Bacteria 953
296 Ga0105238_10005376 3300009551 Bacteria 12659
297 Ga0105238_10078897 3300009551 Bacteria 3282
298 Ga0105238_10131609 3300009551 Bacteria 2480
299 Ga0105238_10406644 3300009551 Bacteria 1355
300 Ga0105238_10486809 3300009551 Bacteria 1233
301 Ga0105238_10947601 3300009551 Unclassified 880
302 Ga0105249_10036444 3300009553 Bacteria 4461
303 Ga0105249_10073971 3300009553 Bacteria 3153
304 Ga0105249_10186168 3300009553 Bacteria 2023
305 Ga0105249_10349425 3300009553 Bacteria 1498
306 Ga0105249_10459195 3300009553 Bacteria 1313
307 Ga0105249_10559372 3300009553 Bacteria 1195
308 Ga0099796_10004014 3300010159 Bacteria 3503
309 Ga0099796_10027107 3300010159 Bacteria 1827
310 Ga0105239_10019263 3300010375 Bacteria 7537
311 Ga0105239_10233748 3300010375 Bacteria 2063
312 Ga0105239_11375874 3300010375 Bacteria 815
313 Ga0105246_10333158 3300011119 Bacteria 1238
314 Ga0105246_10836110 3300011119 Bacteria 820
315 Ga0157370_10001472 3300013104 Bacteria 29117
316 Ga0157370_10263999 3300013104 Bacteria 1591
317 Ga0157369_10000841 3300013105 Bacteria 39257
318 Ga0157369_10068740 3300013105 Bacteria 3806
319 Ga0157369_10102450 3300013105 Bacteria 3051
320 Ga0157369_11025486 3300013105 Bacteria 844
321 Ga0157374_10032183 3300013296 Bacteria 4773
322 Ga0157374_11018673 3300013296 Bacteria 847
323 Ga0157374_11110920 3300013296 Bacteria 811
324 Ga0157378_10019771 3300013297 Bacteria 5922
325 Ga0163162_10080582 3300013306 Bacteria 3324
326 Ga0163162_10598608 3300013306 Bacteria 1229
327 Ga0163162_10608667 3300013306 Bacteria 1218
328 Ga0163162_10892668 3300013306 Bacteria 1002
329 Ga0157372_10473686 3300013307 Bacteria 1460
330 Ga0157375_10007357 3300013308 Bacteria 9640
331 Ga0157375_10052757 3300013308 Bacteria 3999
332 Ga0157375_10094100 3300013308 Bacteria 3064
333 Ga0157375_10465439 3300013308 Bacteria 1430
334 Ga0157375_12095973 3300013308 Bacteria 673
335 Ga0163163_10003787 3300014325 Bacteria 12882
336 Ga0163163_10109595 3300014325 Bacteria 2788
337 Ga0163163_10426054 3300014325 Bacteria 1386
338 Ga0163163_10444905 3300014325 Bacteria 1356
339 Ga0157380_10000110 3300014326 Bacteria 44612
340 Ga0157380_10121662 3300014326 Bacteria 2212
341 Ga0157380_10182007 3300014326 Bacteria 1847
342 Ga0157380_10288471 3300014326 Bacteria 1505
343 Ga0157380_10752052 3300014326 Bacteria 986
344 Ga0157380_11600129 3300014326 Unclassified 707
345 Ga0157377_10289230 3300014745 Bacteria 1077
346 Ga0157377_10686463 3300014745 Bacteria 742
347 Ga0157379_10020721 3300014968 Bacteria 5818
348 Ga0157379_10029861 3300014968 Bacteria 4848
349 Ga0157379_10063423 3300014968 Bacteria 3304
350 Ga0157379_10254981 3300014968 Bacteria 1593
351 Ga0157379_10276329 3300014968 Bacteria 1528
352 Ga0157379_10373013 3300014968 Bacteria 1308
353 Ga0157376_10144586 3300014969 Bacteria 2137
354 Ga0157376_10150207 3300014969 Bacteria 2100
355 Ga0157376_10290937 3300014969 Bacteria 1542
356 Ga0157376_10553980 3300014969 Bacteria 1138
357 Ga0163161_10131136 3300017792 Bacteria 1891
358 Ga0163161_10197194 3300017792 Bacteria 1550
359 Ga0213874_10003273 3300021377 Bacteria 3575
360 Ga0213874_10015214 3300021377 Bacteria 2026
361 Ga0207682_10003425 3300025893 Bacteria 6901
362 Ga0207682_10010135 3300025893 Bacteria 3698
363 Ga0207692_10119187 3300025898 Bacteria 1475
364 Ga0207692_10322806 3300025898 Bacteria 945
365 Ga0207642_10056367 3300025899 Bacteria 1802
366 Ga0207642_10605368 3300025899 Bacteria 682
367 Ga0207710_10000349 3300025900 Bacteria 33438
368 Ga0207710_10039830 3300025900 Bacteria 2081
369 Ga0207688_10073680 3300025901 Bacteria 1941
370 Ga0207680_10009849 3300025903 Bacteria 4758
371 Ga0207680_10024115 3300025903 Bacteria 3333
372 Ga0207680_10036291 3300025903 Bacteria 2838
373 Ga0207680_10315088 3300025903 Bacteria 1093
374 Ga0207685_10010026 3300025905 Bacteria 2778
375 Ga0207699_10017383 3300025906 Bacteria 3783
376 Ga0207699_10067788 3300025906 Bacteria 2171
377 Ga0207699_10094380 3300025906 Bacteria 1884
378 Ga0207699_10122333 3300025906 Bacteria 1685
379 Ga0207699_10279916 3300025906 Bacteria 1159
380 Ga0207645_10054717 3300025907 Bacteria 2548
381 Ga0207645_10063416 3300025907 Bacteria 2361
382 Ga0207645_10716960 3300025907 Bacteria 680
383 Ga0207643_10046737 3300025908 Bacteria 2447
384 Ga0207654_10037130 3300025911 Bacteria 2725
385 Ga0207707_10000122 3300025912 Bacteria 80159
386 Ga0207707_10001614 3300025912 Bacteria 20779
387 Ga0207707_10014611 3300025912 Bacteria 6840
388 Ga0207707_10025599 3300025912 Bacteria 5161
389 Ga0207707_10054459 3300025912 Bacteria 3482
390 Ga0207707_10083736 3300025912 Bacteria 2785
391 Ga0207695_10003540 3300025913 Bacteria 21874
392 Ga0207695_10032858 3300025913 Bacteria 5672
393 Ga0207695_10045635 3300025913 Bacteria 4650
394 Ga0207695_10051308 3300025913 Bacteria 4332
395 Ga0207695_10070636 3300025913 Bacteria 3568
396 Ga0207695_10094832 3300025913 Bacteria 2990
397 Ga0207695_10195446 3300025913 Bacteria 1939
398 Ga0207695_10615611 3300025913 Bacteria 967
399 Ga0207671_10020859 3300025914 Bacteria 4982
400 Ga0207671_10869086 3300025914 Unclassified 714
401 Ga0207693_10000083 3300025915 Bacteria 84611
402 Ga0207693_10045814 3300025915 Bacteria 3436
403 Ga0207663_10036366 3300025916 Bacteria 2962
404 Ga0207663_10365554 3300025916 Bacteria 1096
405 Ga0207660_10001933 3300025917 Bacteria 13827
406 Ga0207660_10024344 3300025917 Bacteria 4099
407 Ga0207660_10131916 3300025917 Bacteria 1902
408 Ga0207660_10169745 3300025917 Bacteria 1688
409 Ga0207662_10003138 3300025918 Bacteria 8448
410 Ga0207662_10039816 3300025918 Bacteria 2759
411 Ga0207662_10172241 3300025918 Bacteria 1388
412 Ga0207662_10331532 3300025918 Bacteria 1018
413 Ga0207657_10286473 3300025919 Bacteria 1307
414 Ga0207649_10098602 3300025920 Bacteria 1929
415 Ga0207649_10376931 3300025920 Bacteria 1056
416 Ga0207649_10934033 3300025920 Bacteria 681
417 Ga0207652_10000613 3300025921 Bacteria 35518
418 Ga0207652_10008803 3300025921 Bacteria 8128
419 Ga0207652_10127330 3300025921 Bacteria 2269
420 Ga0207652_10398702 3300025921 Bacteria 1241
421 Ga0207681_10105768 3300025923 Bacteria 2038
422 Ga0207681_10252197 3300025923 Bacteria 1378
423 Ga0207694_10041971 3300025924 Bacteria 3527
424 Ga0207694_10044756 3300025924 Bacteria 3417
425 Ga0207694_10092589 3300025924 Bacteria 2386
426 Ga0207694_10481610 3300025924 Bacteria 1038
427 Ga0207694_10830833 3300025924 Bacteria 781
428 Ga0207694_10846327 3300025924 Unclassified 773
429 Ga0207650_10446284 3300025925 Bacteria 1076
430 Ga0207650_10478583 3300025925 Bacteria 1039
431 Ga0207659_10006597 3300025926 Bacteria 7125
432 Ga0207659_10128580 3300025926 Bacteria 1951
433 Ga0207659_10545303 3300025926 Bacteria 985
434 Ga0207659_10566304 3300025926 Bacteria 967
435 Ga0207700_10011337 3300025928 Bacteria 5679
436 Ga0207700_10026505 3300025928 Bacteria 4042
437 Ga0207664_10013517 3300025929 Bacteria 5863
438 Ga0207664_10043030 3300025929 Bacteria 3529
439 Ga0207664_10047267 3300025929 Bacteria 3380
440 Ga0207644_10000660 3300025931 Bacteria 21820
441 Ga0207644_10174134 3300025931 Bacteria 1682
442 Ga0207706_10055844 3300025933 Bacteria 3482
443 Ga0207706_10323827 3300025933 Bacteria 1341
444 Ga0207686_10411020 3300025934 Bacteria 1033
445 Ga0207670_10019610 3300025936 Bacteria 4134
446 Ga0207670_10204666 3300025936 Bacteria 1501
447 Ga0207669_10035440 3300025937 Bacteria 2839
448 Ga0207669_10097759 3300025937 Bacteria 1931
449 Ga0207669_10319320 3300025937 Bacteria 1188
450 Ga0207704_10047013 3300025938 Bacteria 2577
451 Ga0207704_10050165 3300025938 Bacteria 2516
452 Ga0207704_10090212 3300025938 Bacteria 2010
453 Ga0207704_10151418 3300025938 Bacteria 1637
454 Ga0207704_10175278 3300025938 Bacteria 1543
455 Ga0207665_10000587 3300025939 Bacteria 24539
456 Ga0207665_10015240 3300025939 Bacteria 5049
457 Ga0207665_10141497 3300025939 Bacteria 1716
458 Ga0207691_10000808 3300025940 Bacteria 31167
459 Ga0207691_10020237 3300025940 Bacteria 6293
460 Ga0207691_10155413 3300025940 Bacteria 2009
461 Ga0207691_10269659 3300025940 Bacteria 1466
462 Ga0207711_10019836 3300025941 Bacteria 5603
463 Ga0207711_10020918 3300025941 Bacteria 5462
464 Ga0207711_10175845 3300025941 Bacteria 1945
465 Ga0207689_10006816 3300025942 Bacteria 10046
466 Ga0207689_10068790 3300025942 Bacteria 2910
467 Ga0207689_10586526 3300025942 Bacteria 937
468 Ga0207661_10393241 3300025944 Bacteria 1256
469 Ga0207661_10967791 3300025944 Unclassified 784
470 Ga0207679_10035222 3300025945 Bacteria 3539
471 Ga0207679_10255264 3300025945 Bacteria 1493
472 Ga0207679_11287257 3300025945 Unclassified 671
473 Ga0207667_10000798 3300025949 Bacteria 40876
474 Ga0207667_10004634 3300025949 Bacteria 16866
475 Ga0207667_10049362 3300025949 Bacteria 4444
476 Ga0207667_10297061 3300025949 Bacteria 1650
477 Ga0207667_10419651 3300025949 Bacteria 1361
478 Ga0207651_10012726 3300025960 Bacteria 4777
479 Ga0207651_10021532 3300025960 Bacteria 3921
480 Ga0207651_10044659 3300025960 Bacteria 2967
481 Ga0207651_10130569 3300025960 Bacteria 1922
482 Ga0207651_10420972 3300025960 Bacteria 1140
483 Ga0207712_10041797 3300025961 Bacteria 3153
484 Ga0207712_10046720 3300025961 Bacteria 3003
485 Ga0207668_10044717 3300025972 Bacteria 3015
486 Ga0207668_10621621 3300025972 Bacteria 943
487 Ga0207658_10435869 3300025986 Bacteria 1158
488 Ga0207658_10768776 3300025986 Bacteria 873
489 Ga0207658_11501410 3300025986 Bacteria 616
490 Ga0207677_10044619 3300026023 Bacteria 2955
491 Ga0207677_10497306 3300026023 Bacteria 1053
492 Ga0207703_10002919 3300026035 Bacteria 14548
493 Ga0207703_10004149 3300026035 Bacteria 11947
494 Ga0207703_10071608 3300026035 Bacteria 2864
495 Ga0207703_10122843 3300026035 Bacteria 2231
496 Ga0207703_10226563 3300026035 Bacteria 1674
497 Ga0207703_10463879 3300026035 Unclassified 1185
498 Ga0207639_10174985 3300026041 Bacteria 1821
499 Ga0207639_10197304 3300026041 Bacteria 1723
500 Ga0207678_10057667 3300026067 Bacteria 3342
501 Ga0207678_10143351 3300026067 Bacteria 2039
502 Ga0207708_10126206 3300026075 Bacteria 1997
503 Ga0207708_10143037 3300026075 Bacteria 1878
504 Ga0207708_10262327 3300026075 Bacteria 1395
505 Ga0207702_10021375 3300026078 Bacteria 5357
506 Ga0207702_10024278 3300026078 Bacteria 5030
507 Ga0207702_10449937 3300026078 Bacteria 1249
508 Ga0207702_11134358 3300026078 Bacteria 776
509 Ga0207641_10000266 3300026088 Bacteria 66298
510 Ga0207641_10004267 3300026088 Bacteria 12427
511 Ga0207641_10072695 3300026088 Bacteria 2962
512 Ga0207641_10078506 3300026088 Bacteria 2859
513 Ga0207648_10011589 3300026089 Bacteria 8302
514 Ga0207648_10307452 3300026089 Bacteria 1423
515 Ga0207648_10420128 3300026089 Bacteria 1214
516 Ga0207648_10538471 3300026089 Bacteria 1071
517 Ga0207648_10550578 3300026089 Bacteria 1060
518 Ga0207676_10000965 3300026095 Bacteria 22224
519 Ga0207674_10045038 3300026116 Bacteria 4541
520 Ga0207674_10324191 3300026116 Bacteria 1490
521 Ga0207675_100001909 3300026118 Bacteria 20795
522 Ga0207675_100017235 3300026118 Bacteria 6745
523 Ga0207675_100021368 3300026118 Bacteria 6028
524 Ga0207675_100108282 3300026118 Bacteria 2621
525 Ga0207675_100262014 3300026118 Bacteria 1676
526 Ga0207683_10002455 3300026121 Bacteria 16158
527 Ga0207683_10012739 3300026121 Bacteria 7176
528 Ga0207683_10418636 3300026121 Bacteria 1234
529 Ga0207683_10988293 3300026121 Bacteria 781
530 Ga0207428_10018642 3300027907 Bacteria 5924
531 Ga0207428_10037638 3300027907 Bacteria 3935
532 Ga0207428_10053868 3300027907 Bacteria 3206
533 Ga0207428_10077052 3300027907 Bacteria 2610
534 Ga0265356_1001033 3300028017 Bacteria 4386
535 Ga0268266_10000159 3300028379 Bacteria 126969
536 Ga0268266_10004018 3300028379 Bacteria 14227
537 Ga0268266_10018604 3300028379 Bacteria 5921
538 Ga0268266_10020525 3300028379 Bacteria 5631
539 Ga0268266_10021131 3300028379 Bacteria 5545
540 Ga0268266_10021707 3300028379 Bacteria 5471
541 Ga0268266_10036776 3300028379 Bacteria 4170
542 Ga0268266_10103250 3300028379 Bacteria 2515
543 Ga0268266_10113600 3300028379 Bacteria 2402
544 Ga0268266_10229263 3300028379 Bacteria 1710
545 Ga0268266_10474874 3300028379 Bacteria 1191
546 Ga0268265_10015831 3300028380 Bacteria 5170
547 Ga0268265_10026933 3300028380 Bacteria 4096
548 Ga0268265_10085663 3300028380 Bacteria 2502
549 Ga0268265_10269110 3300028380 Bacteria 1519
550 Ga0268265_10400670 3300028380 Bacteria 1268
551 Ga0268265_10421531 3300028380 Bacteria 1239
552 Ga0268265_10486922 3300028380 Bacteria 1160
553 Ga0268265_10513957 3300028380 Bacteria 1131
554 Ga0268264_10000047 3300028381 Bacteria 349944
555 Ga0268264_10000140 3300028381 Bacteria 171592
556 Ga0268264_10037266 3300028381 Bacteria 4009
557 Ga0268264_10326291 3300028381 Bacteria 1453
558 Ga0265334_10012381 3300028573 Bacteria 3585
559 Ga0307517_10215405 3300028786 Unclassified 1176
560 Ga0307515_10001652 3300028794 Bacteria 49628
561 Ga0307515_10121290 3300028794 Bacteria 2958
562 Ga0307515_10195041 3300028794 Bacteria 1921
563 Ga0307515_10606956 3300028794 Unclassified 705
564 Ga0307511_10000268 3300030521 Bacteria 54105
565 Ga0307511_10051996 3300030521 Bacteria 3273
566 Ga0265770_1000007 3300030878 Bacteria 20558
567 Ga0265760_10005135 3300031090 Bacteria 3751
568 Ga0265760_10098769 3300031090 Bacteria 921
569 Ga0265340_10275247 3300031247 Bacteria 748
570 Ga0265339_10226767 3300031249 Bacteria 912
571 Ga0265331_10002039 3300031250 Bacteria 13998
572 Ga0307513_10049297 3300031456 Bacteria 4563
573 Ga0307513_10053175 3300031456 Bacteria 4355
574 Ga0307513_10113314 3300031456 Bacteria 2700
575 Ga0307513_10115262 3300031456 Bacteria 2670
576 Ga0307513_10181146 3300031456 Bacteria 1970
577 Ga0307509_10001396 3300031507 Bacteria 40975
578 Ga0307509_10042256 3300031507 Bacteria 4942
579 Ga0307509_10059381 3300031507 Bacteria 4047
580 Ga0307509_10643087 3300031507 Bacteria 730
581 Ga0307408_100134284 3300031548 Bacteria 1934
582 Ga0307508_10207321 3300031616 Bacteria 1561
583 Ga0316576_10051790 3300031727 Bacteria 2988
584 Ga0316576_10068868 3300031727 Bacteria 2609
585 Ga0316576_10096611 3300031727 Bacteria 2205
586 Ga0316576_10201666 3300031727 Bacteria 1499
587 Ga0316578_10431437 3300031728 Bacteria 780
588 Ga0307516_10002208 3300031730 Bacteria 26358
589 Ga0307405_10048178 3300031731 Bacteria 2627
590 Ga0307405_10620416 3300031731 Bacteria 885
591 Ga0307413_10010738 3300031824 Bacteria 4460
592 Ga0307413_10030393 3300031824 Bacteria 3034
593 Ga0307413_10254987 3300031824 Bacteria 1304
594 Ga0307413_10282177 3300031824 Bacteria 1250
595 Ga0307410_10006032 3300031852 Bacteria 6496
596 Ga0307410_10111930 3300031852 Bacteria 1976
597 Ga0307406_10010319 3300031901 Bacteria 5264
598 Ga0307406_10220386 3300031901 Bacteria 1410
599 Ga0307406_10271691 3300031901 Bacteria 1288
600 Ga0307406_10609286 3300031901 Bacteria 901
601 Ga0307406_10859982 3300031901 Bacteria 769
602 Ga0307407_10015668 3300031903 Bacteria 3756
603 Ga0307407_10041476 3300031903 Bacteria 2574
604 Ga0307412_10286848 3300031911 Bacteria 1295
605 Ga0307412_10691078 3300031911 Bacteria 875
606 Ga0307412_11447345 3300031911 Bacteria 623
607 Ga0307409_100189418 3300031995 Bacteria 1830
608 Ga0307409_100427238 3300031995 Bacteria 1272
609 Ga0307409_100677127 3300031995 Bacteria 1028
610 Ga0307416_100192517 3300032002 Bacteria 1925
611 Ga0307416_100368594 3300032002 Bacteria 1461
612 Ga0307416_100458569 3300032002 Bacteria 1329
613 Ga0307416_101119484 3300032002 Bacteria 892
614 Ga0307416_102014556 3300032002 Bacteria 680
615 Ga0307414_10459409 3300032004 Bacteria 1119
616 Ga0307414_11059891 3300032004 Bacteria 748
617 Ga0307411_10014764 3300032005 Bacteria 4359
618 Ga0307411_10078816 3300032005 Bacteria 2259
619 Ga0307411_10160080 3300032005 Bacteria 1685
620 Ga0307411_10272327 3300032005 Bacteria 1343
621 Ga0307411_10399134 3300032005 Bacteria 1136
622 Ga0307411_10544499 3300032005 Bacteria 989
623 Ga0307411_10763428 3300032005 Unclassified 848
624 Ga0307411_11100196 3300032005 Bacteria 716
625 Ga0307411_11380182 3300032005 Bacteria 644
626 Ga0307415_100061002 3300032126 Bacteria 2609
627 Ga0307415_100115502 3300032126 Bacteria 2001
628 Ga0307415_100171048 3300032126 Bacteria 1694
629 Ga0307415_100180680 3300032126 Bacteria 1655
630 Ga0307415_100511231 3300032126 Bacteria 1052
631 Ga0307415_100534046 3300032126 Bacteria 1032
632 Ga0307415_100825375 3300032126 Bacteria 848
633 Ga0307507_10426193 3300033179 Unclassified 743
634 Ga0307510_10005539 3300033180 Bacteria 15049
635 Ga0307510_10256592 3300033180 Bacteria 1232
636 Ga0373923_0009894 3300035111 Bacteria 3454
637 Ga0373923_0077208 3300035111 Bacteria 1440
638 Ga0373936_0013613 3300035113 Bacteria 3104
639 Ga0373945_0211837 3300035116 Bacteria 808
640 Ga0373956_0164325 3300035119 Bacteria 1047
641 Ga0373957_0055727 3300035120 Bacteria 1521
642 Ga0373957_0068871 3300035120 Bacteria 1381
643 Ga0373957_0131475 3300035120 Bacteria 1019
644 Ga0373960_0077475 3300035121 Bacteria 1040
645 Ga0373943_0326457 3300035170 Bacteria 876
646 Ga0373946_0234066 3300035171 Bacteria 891
647 Ga0373955_0009251 3300035172 Bacteria 4613
648 Ga0373955_0069928 3300035172 Bacteria 1960
649 Ga0373961_0016704 3300035241 Bacteria 1894
650 Ga0373962_0115306 3300035242 Bacteria 852
651 Ga0316574_0010344 3300035398 Bacteria 5269
652 Ga0316574_0014494 3300035398 Bacteria 4557
653 Ga0316574_0016384 3300035398 Bacteria 4319
654 Ga0316574_0025283 3300035398 Bacteria 3563
655 Ga0316574_0138730 3300035398 Bacteria 1566
656 Ga0316574_0141004 3300035398 Unclassified 1553
657 Ga0316574_0264702 3300035398 Bacteria 1097
658 Ga0373931_0775174 3300035691 Bacteria 638
659 Ga0373927_0020690 3300035695 Bacteria 4315
660 Ga0373927_0269784 3300035695 Bacteria 1119
661 Ga0373933_0180346 3300035724 Bacteria 1347
662 Ga0373937_0006608 3300036401 Bacteria 10014
663 Ga0373937_0025980 3300036401 Bacteria 5289
664 Ga0373937_0088213 3300036401 Bacteria 2872
665 Ga0373937_0259964 3300036401 Bacteria 1637
666 Ga0316584_0003331 3300036712 Bacteria 10410
667 Ga0316584_0187258 3300036712 Bacteria 1531
668 Ga0436364_1238211 3300037853 Bacteria 791
669 Ga0436365_1772567 3300039437 Bacteria 10964
670 Ga0436365_1859648 3300039437 Bacteria 1448
671 Ga0436360_0066373 3300039438 Bacteria 2182
672 Ga0436360_0659686 3300039438 Bacteria 2043
673 Ga0436360_0995015 3300039438 Bacteria 3240
674 Ga0436361_0066890 3300039447 Bacteria 3227
675 Ga0436361_0251740 3300039447 Bacteria 1320
676 Ga0436363_0461713 3300039450 Bacteria 4270
677 Ga0436363_0641697 3300039450 Bacteria 6231
678 Ga0436363_1646651 3300039450 Bacteria 6351
679 Ga0436362_0815706 3300039453 Bacteria 796
680 Ga0436362_1231019 3300039453 Bacteria 1153
681 Ga0451789_0293465 3300041443 Bacteria 1492
682 Ga0451791_0653772 3300041451 Bacteria 3342
683 Ga0451793_0640635 3300041452 Bacteria 2133
684 Ga0451793_0947639 3300041452 Bacteria 869
685 Ga0451797_0966810 3300041453 Bacteria 2540
686 Ga0451800_0973983 3300041459 Bacteria 808
687 Ga0451800_1658630 3300041459 Unclassified 1312
688 Ga0451802_1934902 3300041460 Bacteria 1327
689 Ga0451802_1935343 3300041460 Bacteria 2703
690 Ga0451807_0065623 3300041486 Bacteria 5261
691 Ga0451807_2246987 3300041486 Bacteria 4233
692 Ga0451807_2285000 3300041486 Unclassified 892
693 Ga0451833_1190085 3300041491 Bacteria 1016
694 Ga0451849_1405876 3300041505 Bacteria 783
695 Ga0451851_1138035 3300041507 Bacteria 1048
696 Ga0439442_023326 3300042002 Bacteria 1286
697 Ga0439448_0113438 3300042005 Bacteria 927
698 Ga0439449_0052926 3300042007 Bacteria 1501
699 Ga0450896_037636 3300042133 Bacteria 747
700 Ga0439444_0024418 3300042437 Bacteria 1092
701 Ga0439459_0093011 3300042438 Bacteria 728
702 Ga0439464_0045734 3300042439 Bacteria 1257
703 Ga0451577_0017859 3300042876 Bacteria 6544
704 Ga0451577_0076774 3300042876 Bacteria 2978
705 Ga0451577_0158358 3300042876 Bacteria 2038
706 Ga0466969_0010650 3300044656 Bacteria 4872
707 Ga0466969_0018694 3300044656 Bacteria 3608
708 Ga0466972_0099651 3300044658 Bacteria 1375
709 Ga0453683_0071396 3300044673 Bacteria 2172
710 Ga0466965_0121950 3300044683 Bacteria 1347
711 Ga0466965_0176878 3300044683 Bacteria 1125
712 Ga0466966_0018782 3300044684 Bacteria 4554
713 Ga0466966_0211198 3300044684 Unclassified 1173
714 Ga0466966_0581404 3300044684 Bacteria 674
715 Ga0466961_0005738 3300044693 Bacteria 7854
716 Ga0466964_0017568 3300044706 Bacteria 2737
717 Ga0453684_0032214 3300044712 Bacteria 7344
718 Ga0453684_0068289 3300044712 Bacteria 4514
719 Ga0453684_0476960 3300044712 Bacteria 1384
720 Ga0453684_0934179 3300044712 Bacteria 927
721 Ga0466971_0000216 3300044719 Bacteria 22087
722 Ga0466970_0002740 3300044765 Bacteria 8508
723 Ga0466957_0001530 3300044842 Bacteria 12173
724 Ga0466960_0061910 3300044901 Bacteria 1838
725 Ga0466959_0002645 3300045049 Bacteria 11497
726 Ga0466959_0010436 3300045049 Bacteria 6641
727 Ga0466959_0014163 3300045049 Bacteria 5789
728 Ga0466959_0100728 3300045049 Bacteria 2067
729 Ga0451576_0023536 3300045051 Bacteria 6668
730 Ga0451576_0215678 3300045051 Bacteria 2004
731 Ga0451576_1038706 3300045051 Bacteria 858
732 Ga0466958_0011057 3300045836 Bacteria 5074
733 Ga0495592_0122645 3300046454 Bacteria 1826
734 Ga0495590_0026392 3300046457 Bacteria 2039
735 Ga0495591_019311 3300046458 Bacteria 2285
736 Ga0495638_0029681 3300046460 Bacteria 3526
737 Ga0495638_0042983 3300046460 Bacteria 2853
738 Ga0495638_0467349 3300046460 Unclassified 641
739 Ga0495580_0002317 3300046472 Bacteria 16600
740 Ga0495580_0011390 3300046472 Bacteria 6882
741 Ga0495580_0038431 3300046472 Bacteria 3428
742 Ga0495580_0250819 3300046472 Bacteria 1212
743 Ga0495580_0745606 3300046472 Bacteria 638
744 Ga0495582_0171548 3300046473 Bacteria 1235
745 Ga0495594_0225796 3300046499 Bacteria 1068
746 Ga0495610_0299294 3300046512 Bacteria 621
747 Ga0495616_0003520 3300046513 Bacteria 10013
748 Ga0495618_0070893 3300046514 Bacteria 2217
749 Ga0495620_0181440 3300046515 Bacteria 814
750 Ga0495632_0030336 3300046519 Bacteria 2807
751 Ga0495632_0030443 3300046519 Bacteria 2801
752 Ga0495632_0319753 3300046519 Bacteria 686
753 Ga0495644_0019850 3300046523 Bacteria 2566
754 Ga0495648_0058796 3300046524 Bacteria 2297
755 Ga0495652_0258438 3300046529 Bacteria 1287
756 Ga0495665_0044595 3300046531 Bacteria 2356
757 Ga0495586_0055117 3300046535 Bacteria 2155
758 Ga0495586_0484897 3300046535 Bacteria 713
759 Ga0495621_0024354 3300046539 Bacteria 2021
760 Ga0495621_0048158 3300046539 Bacteria 1517
761 Ga0495621_0088361 3300046539 Bacteria 1165
762 Ga0495633_0156593 3300046558 Bacteria 1051
763 Ga0495656_0054433 3300046615 Bacteria 1722
764 Ga0495668_0489013 3300046616 Bacteria 678
765 Ga0495625_0004128 3300046660 Bacteria 13860
766 Ga0495625_0056977 3300046660 Bacteria 2780
767 Ga0495625_0084823 3300046660 Bacteria 2200
768 Ga0495625_0150529 3300046660 Bacteria 1565
769 Ga0495625_0277573 3300046660 Bacteria 1079
770 Ga0495659_0160024 3300046664 Bacteria 908
771 Ga0495657_0072326 3300046675 Bacteria 2249
772 Ga0495599_0099033 3300046678 Bacteria 1817
773 Ga0495623_0061473 3300046679 Bacteria 2356
774 Ga0495647_0022229 3300046681 Bacteria 2290
775 Ga0495647_0028574 3300046681 Bacteria 2057
776 Ga0495647_0141218 3300046681 Bacteria 1027
777 Ga0495658_0010043 3300046683 Bacteria 4728
778 Ga0495658_0510274 3300046683 Bacteria 769
779 Ga0495669_0357713 3300046684 Bacteria 706
780 Ga0495649_0070992 3300046694 Bacteria 1867
781 Ga0495581_0149843 3300047315 Bacteria 1362
782 Ga0495604_0031892 3300047317 Bacteria 4178
783 Ga0495674_0449767 3300047319 Unclassified 1035
784 Ga0495672_0063383 3300047320 Bacteria 2122
785 Ga0495681_0037726 3300047470 Bacteria 2377
786 Ga0495686_0068125 3300047472 Bacteria 2196
787 Ga0495602_0035047 3300048088 Bacteria 4685
788 Ga0495626_0223542 3300048091 Unclassified 764
789 Ga0496100_0014282 3300048903 Bacteria 4607
790 Ga0496100_0924555 3300048903 Bacteria 685
791 Ga0496101_0002781 3300048904 Bacteria 10726
792 Ga0496101_0058777 3300048904 Bacteria 2786
793 Ga0496102_0004283 3300048905 Bacteria 12064
794 Ga0496102_0015204 3300048905 Bacteria 6700
795 Ga0496102_0025670 3300048905 Bacteria 5249
796 Ga0496102_0239250 3300048905 Bacteria 1712
797 Ga0496103_0054969 3300048906 Bacteria 2468
798 Ga0496103_0157107 3300048906 Bacteria 1458
799 Ga0496104_0166549 3300048907 Bacteria 2113
800 Ga0496104_0183740 3300048907 Bacteria 2001
801 Ga0496104_0205567 3300048907 Bacteria 1881
802 Ga0496105_0038751 3300048908 Bacteria 3926
803 Ga0496106_0023670 3300048909 Bacteria 4564
804 Ga0496106_0092723 3300048909 Bacteria 2333
805 Ga0496106_0131648 3300048909 Bacteria 1962
806 Ga0496106_0232287 3300048909 Bacteria 1473
807 Ga0496106_1019094 3300048909 Bacteria 651
808 Ga0496107_0014224 3300048910 Bacteria 5572
809 Ga0496107_0704523 3300048910 Bacteria 742
810 Ga0496108_0012714 3300048911 Bacteria 6856
811 Ga0496108_0578231 3300048911 Bacteria 979
812 Ga0496110_0000749 3300048913 Bacteria 22420
813 Ga0496110_0352827 3300048913 Bacteria 1340
814 Ga0496111_0007317 3300048914 Bacteria 7223
815 Ga0496112_0005843 3300048915 Bacteria 10714
816 Ga0496112_0149992 3300048915 Bacteria 2299
817 Ga0496113_0024231 3300048916 Bacteria 4310
818 Ga0496113_0034940 3300048916 Bacteria 3672
819 Ga0496114_0001864 3300048917 Bacteria 15980
820 Ga0496114_0031729 3300048917 Bacteria 4346
821 Ga0496114_0139070 3300048917 Bacteria 2101
822 Ga0496114_0546027 3300048917 Bacteria 1024
823 Ga0496115_0019186 3300048918 Bacteria 5260
824 Ga0496115_0255565 3300048918 Bacteria 1442
825 Ga0496116_0009552 3300048919 Bacteria 8261
826 Ga0496117_0000151 3300048920 Bacteria 148304
827 Ga0496117_0365928 3300048920 Bacteria 739
828 Ga0496118_0000016 3300048921 Bacteria 549586
829 Ga0496118_0053120 3300048921 Bacteria 3084
830 Ga0496118_0061427 3300048921 Bacteria 2783
831 Ga0496118_0071775 3300048921 Bacteria 2491
832 Ga0496119_0007663 3300048922 Bacteria 9669
833 Ga0496119_0026068 3300048922 Bacteria 4063
834 Ga0496120_0002631 3300048923 Bacteria 17782
835 Ga0496120_0079655 3300048923 Bacteria 1777
836 Ga0496121_0003216 3300048924 Bacteria 23498
837 Ga0496121_0062952 3300048924 Bacteria 3035
838 Ga0496121_0088943 3300048924 Bacteria 2419
839 Ga0496124_0036662 3300048927 Bacteria 4274
840 Ga0496125_0000759 3300048928 Bacteria 52858
841 Ga0496125_0015343 3300048928 Bacteria 7416
842 Ga0496125_0042383 3300048928 Bacteria 3877
843 Ga0496126_0001875 3300048929 Bacteria 30586
844 Ga0496126_0059047 3300048929 Bacteria 3455
845 Ga0501299_089863 3300049522 Bacteria 696
846 Ga0501031_0108948 3300049568 Bacteria 1809
847 Ga0501031_0189438 3300049568 Bacteria 1343
848 Ga0501032_0198951 3300049569 Bacteria 1308
849 Ga0501033_0125845 3300049570 Bacteria 1858
850 Ga0501033_0331458 3300049570 Bacteria 1068
851 Ga0501034_1339501 3300049571 Bacteria 592
852 Ga0501036_0019918 3300049572 Bacteria 5632
853 Ga0501036_0030927 3300049572 Bacteria 4524
854 Ga0501036_0314169 3300049572 Bacteria 1310
855 Ga0501037_0029609 3300049573 Bacteria 4045
856 Ga0501037_0074819 3300049573 Bacteria 2460
857 Ga0501038_0025407 3300049574 Bacteria 5280
858 Ga0501038_0110786 3300049574 Bacteria 2274
859 Ga0501039_0005021 3300049575 Bacteria 10042
860 Ga0501039_0534782 3300049575 Bacteria 920
861 Ga0501040_0001902 3300049576 Bacteria 13423
862 Ga0501040_0020637 3300049576 Bacteria 4392
863 Ga0501041_0003543 3300049577 Bacteria 8977
864 Ga0501041_0027415 3300049577 Bacteria 3432
865 Ga0501042_0020076 3300049578 Bacteria 4648
866 Ga0501042_0069390 3300049578 Bacteria 2520
867 Ga0501043_0047241 3300049579 Bacteria 3384
868 Ga0501046_0008614 3300049580 Bacteria 8870
869 Ga0501046_0065359 3300049580 Bacteria 2838
870 Ga0501046_0071635 3300049580 Bacteria 2693
871 Ga0501046_0447081 3300049580 Bacteria 930
872 Ga0501048_0031048 3300049582 Bacteria 3866
873 Ga0501048_0122126 3300049582 Bacteria 1840
874 Ga0501068_0039428 3300049584 Bacteria 2832
875 Ga0501068_0040215 3300049584 Bacteria 2806
876 Ga0501069_0069086 3300049585 Bacteria 1978
877 Ga0501070_0235381 3300049586 Bacteria 1500
878 Ga0501071_0000689 3300049587 Bacteria 17671
879 Ga0501071_0050039 3300049587 Bacteria 3009
880 Ga0501072_0002540 3300049588 Bacteria 13673
881 Ga0501072_0027868 3300049588 Bacteria 4408
882 Ga0501072_0785763 3300049588 Bacteria 746
883 Ga0501075_0003894 3300049591 Bacteria 10047
884 Ga0501076_0000782 3300049592 Bacteria 20500
885 Ga0501076_0025012 3300049592 Bacteria 4618
886 Ga0501077_0009125 3300049593 Bacteria 6158
887 Ga0501077_0069821 3300049593 Bacteria 2226
888 Ga0501209_026366 3300049656 Bacteria 1434
889 Ga0501249_007490 3300049679 Bacteria 2256
890 Ga0501257_089169 3300049686 Bacteria 801
891 Ga0501079_0001340 3300049741 Bacteria 17314
892 Ga0501079_0017298 3300049741 Bacteria 5505
893 Ga0501080_0005127 3300049742 Bacteria 11672
894 Ga0501080_0185062 3300049742 Bacteria 1915
895 Ga0501080_0839020 3300049742 Bacteria 804
896 Ga0501081_0010808 3300049743 Bacteria 5962
897 Ga0501081_0051401 3300049743 Bacteria 2842
898 Ga0501081_0544209 3300049743 Bacteria 867
899 Ga0501083_0259029 3300049744 Bacteria 1132
900 Ga0501035_0038912 3300049822 Bacteria 4306
901 Ga0501035_0052512 3300049822 Bacteria 3647
902 Ga0501044_0121003 3300049823 Bacteria 2619
903 Ga0501044_0648569 3300049823 Bacteria 945
904 Ga0501045_0000401 3300049824 Bacteria 26284
905 Ga0501045_0020016 3300049824 Bacteria 4777
906 Ga0501045_0116565 3300049824 Bacteria 1982
907 nmdc:mga05p37_1003701_c1 3300050507 Bacteria 886
908 nmdc:mga09592_139542_c1 3300050508 Bacteria 2089
909 nmdc:mga09592_79156_c1 3300050508 Bacteria 2798
910 nmdc:mga0qj67_105459_c1 3300050509 Bacteria 2274
911 nmdc:mga0qj67_119265_c1 3300050509 Bacteria 2133
912 nmdc:mga0qj67_369301_c1 3300050509 Bacteria 1159
913 nmdc:mga0qj67_441560_c1 3300050509 Bacteria 1048
914 nmdc:mga06r32_12456_c1 3300050510 Bacteria 7675
915 nmdc:mga06r32_140547_c1 3300050510 Bacteria 2390
916 nmdc:mga06r32_24616_c1 3300050510 Bacteria 5591
917 nmdc:mga06r32_259443_c1 3300050510 Bacteria 1726
918 nmdc:mga06r32_87594_c1 3300050510 Bacteria 3038
919 nmdc:mga08y16_1026529_c1 3300050511 Bacteria 803
920 nmdc:mga08y16_117632_c1 3300050511 Bacteria 2766
921 nmdc:mga08y16_1181637_c1 3300050511 Bacteria 736
922 nmdc:mga08y16_2161_c1 3300050511 Bacteria 20167
923 nmdc:mga08y16_24822_c1 3300050511 Bacteria 6325
924 nmdc:mga08y16_508240_c1 3300050511 Bacteria 1223
925 nmdc:mga08y16_66436_c1 3300050511 Bacteria 3764
926 nmdc:mga08y16_920464_c1 3300050511 Bacteria 859
927 nmdc:mga0rr50_297944_c1 3300050513 Bacteria 1348
928 nmdc:mga0rr50_430501_c1 3300050513 Bacteria 1117
929 nmdc:mga0a205_692174_c1 3300050515 Bacteria 869
930 Ga0495612_0160887 3300053078 Bacteria 980
931 Ga0495612_0352621 3300053078 Bacteria 664
932 Ga0500646_0119074 3300053090 Bacteria 847
933 Ga0500583_0051673 3300053092 Bacteria 1910
934 Ga0500583_0068826 3300053092 Bacteria 1689
935 Ga0500651_0187399 3300053093 Bacteria 1226
936 Ga0500641_0348540 3300053096 Bacteria 596
937 Ga0500660_127142 3300053100 Bacteria 1046
938 Ga0500556_0085210 3300053104 Bacteria 1200
939 Ga0500556_0095777 3300053104 Bacteria 1138
940 Ga0500562_080488 3300053108 Bacteria 881
941 Ga0500569_010238 3300053109 Bacteria 2202
942 Ga0500592_025572 3300053116 Bacteria 953
943 Ga0500595_095061 3300053119 Bacteria 859
944 Ga0500652_081380 3300053131 Bacteria 1348
945 Ga0500652_139261 3300053131 Bacteria 1010
946 Ga0500658_0008480 3300053134 Bacteria 3796
947 Ga0500559_0039884 3300053136 Bacteria 2044
948 Ga0500568_0037122 3300053139 Bacteria 1978
949 Ga0500588_0002779 3300053146 Bacteria 3617
950 Ga0500616_0000073 3300053153 Bacteria 231290
951 Ga0500622_0002406 3300053156 Bacteria 13523
952 Ga0500622_0005698 3300053156 Bacteria 7404
953 Ga0500622_0014061 3300053156 Bacteria 4302
954 Ga0500627_0073504 3300053158 Bacteria 1517
955 Ga0500630_043962 3300053159 Bacteria 2174
956 Ga0500633_0092643 3300053160 Bacteria 1105
957 Ga0500633_0133288 3300053160 Bacteria 928
958 Ga0500636_0101843 3300053177 Bacteria 1632
959 Ga0500637_0000126 3300053178 Bacteria 27714
960 Ga0501084_0120250 3300054114 Bacteria 2208
961 Ga0501084_0321710 3300054114 Bacteria 1306
962 Ga0501082_0006995 3300060353 Bacteria 9738
963 Ga0466962_0038104 3300061719 Bacteria 2302
964 Ga0530510_0018068 3300061734 Bacteria 4998
965 Ga0530510_0034834 3300061734 Bacteria 3627
966 Ga0213876_10063757
967 RicEn_C9875
968 SwRhRL2b_contig_2220656
969 rootH1_10101733
970 rootH2_10016870
971 rootH1_10033537
972 Ga0065704_10011697
973 Ga0065712_10070294
974 Ga0065715_10136644
975 Ga0070676_10111192
976 Ga0070683_100509493
977 Ga0070690_100012452
978 Ga0070690_100034482
979 Ga0070690_100442761
980 Ga0070690_101014645
981 Ga0070670_100150538
982 Ga0070670_100176738
983 Ga0070677_10246646
984 Ga0068869_100387362
985 Ga0070666_10084334
986 Ga0070666_10160843
987 Ga0070680_100005497
988 Ga0070680_100169769
989 Ga0070680_100232785
990 Ga0070682_100197138
991 Ga0070682_100380023
992 Ga0070682_100579687
993 Ga0068868_100028250
994 Ga0070689_100002266
995 Ga0070689_100003597
996 Ga0070689_100641499
997 Ga0070691_10107204
998 Ga0070687_100274690
999 Ga0070687_100779705
1000 Ga0070687_100883988
1001 Ga0070661_100070943
1002 Ga0070661_100694517
1003 Ga0070668_100107972
1004 Ga0070669_100176852
1005 Ga0070669_100320947
1006 Ga0070675_100001269
1007 Ga0070675_100187299
1008 Ga0070675_100444151
1009 Ga0070675_100457919
1010 Ga0070671_100000657
1011 Ga0070671_100110753
1012 Ga0070673_100020159
1013 Ga0070673_100092132
1014 Ga0070673_100173114
1015 Ga0070673_100364754
1016 Ga0070673_100548881
1017 Ga0070688_100005304
1018 Ga0070667_100022143
1019 Ga0070667_100037857
1020 Ga0070667_100296137
1021 Ga0070709_10116089
1022 Ga0070709_10156402
1023 Ga0070709_10789025
1024 Ga0070714_100004027
1025 Ga0070714_100058875
1026 Ga0070714_100263841
1027 Ga0070713_100003765
1028 Ga0070713_100004406
1029 Ga0070713_100112568
1030 Ga0070713_100231427
1031 Ga0070710_10002005
1032 Ga0070710_10102895
1033 Ga0070710_10987364
1034 Ga0070701_10024998
1035 Ga0070701_10205419
1036 Ga0070701_10227177
1037 Ga0070711_100062958
1038 Ga0070711_100135726
1039 Ga0070705_100005025
1040 Ga0070705_100141213
1041 Ga0070705_101001623
1042 Ga0070700_100179598
1043 Ga0070700_100195867
1044 Ga0070700_100246164
1045 Ga0070694_100039533
1046 Ga0070694_100257513
1047 Ga0070694_100289354
1048 Ga0070663_100628945
1049 Ga0070663_100828828
1050 Ga0070663_101623125
1051 Ga0070678_100001882
1052 Ga0070678_101182414
1053 Ga0070678_101341327
1054 Ga0070662_100106771
1055 Ga0070662_100121887
1056 Ga0070681_10000738
1057 Ga0070681_10001577
1058 Ga0070681_10015379
1059 Ga0070681_10024230
1060 Ga0070681_10048512
1061 Ga0070681_10049548
1062 Ga0070681_10141489
1063 Ga0070681_10740875
1064 Ga0068867_100012777
1065 Ga0068867_100047736
1066 Ga0068867_100179522
1067 Ga0070685_10002528
1068 Ga0070685_10083125
1069 Ga0070685_10480368
1070 Ga0070706_100293187
1071 Ga0070699_100022483
1072 Ga0070699_101116196
1073 Ga0070679_100000469
1074 Ga0070679_100005515
1075 Ga0070679_100087639
1076 Ga0070679_100116286
1077 Ga0070679_100155886
1078 Ga0070679_101525989
1079 Ga0070684_100513922
1080 Ga0070684_100575395
1081 Ga0068853_100250645
1082 Ga0068853_100286241
1083 Ga0068853_100526451
1084 Ga0068853_100570492
1085 Ga0070672_100027580
1086 Ga0070672_100029661
1087 Ga0070672_100054834
1088 Ga0070672_100167369
1089 Ga0070672_100530695
1090 Ga0070686_100002735
1091 Ga0070695_100009460
1092 Ga0070696_100020484
1093 Ga0070696_100092350
1094 Ga0070693_100040423
1095 Ga0070693_100287006
1096 Ga0070665_100000543
1097 Ga0070665_100006529
1098 Ga0070665_100009640
1099 Ga0070665_100029937
1100 Ga0070665_100032219
1101 Ga0070665_100053459
1102 Ga0070665_100107978
1103 Ga0070665_100341674
1104 Ga0070665_100391338
1105 Ga0070704_100053103
1106 Ga0070704_100405079
1107 Ga0068855_100001482
1108 Ga0068855_100001838
1109 Ga0068855_100094225
1110 Ga0068855_100169063
1111 Ga0068855_100318422
1112 Ga0070664_100276073
1113 Ga0070664_100966490
1114 Ga0068857_100035066
1115 Ga0068857_100154869
1116 Ga0068857_100223179
1117 Ga0068854_100446984
1118 Ga0068856_100004498
1119 Ga0068856_100529173
1120 Ga0068856_100546507
1121 Ga0068856_100626688
1122 Ga0068856_100832996
1123 Ga0070702_100006702
1124 Ga0070702_100009527
1125 Ga0068852_100366968
1126 Ga0068852_100439742
1127 Ga0068859_100000929
1128 Ga0068859_100009204
1129 Ga0068859_100125227
1130 Ga0068859_100228640
1131 Ga0068859_100354535
1132 Ga0068859_102080647
1133 Ga0068864_100004892
1134 Ga0068866_10137770
1135 Ga0068861_100001663
1136 Ga0068861_100002156
1137 Ga0068861_100012276
1138 Ga0068861_100036200
1139 Ga0068861_100226488
1140 Ga0068861_101289985
1141 Ga0068851_10179076
1142 Ga0068870_10134943
1143 Ga0068863_100001099
1144 Ga0068863_100048854
1145 Ga0068863_100060367
1146 Ga0068863_100414724
1147 Ga0068863_100469460
1148 Ga0068863_100500360
1149 Ga0068858_100002788
1150 Ga0068858_100024983
1151 Ga0068858_100029209
1152 Ga0068858_100029595
1153 Ga0068858_100110818
1154 Ga0068858_100253828
1155 Ga0068860_100002907
1156 Ga0068860_100055609
1157 Ga0068860_100171261
1158 Ga0068862_100013694
1159 Ga0068862_100024285
1160 Ga0068862_100158654
1161 Ga0068862_100162582
1162 Ga0068862_101006079
1163 Ga0081455_10016058
1164 Ga0081539_10000028
1165 Ga0070717_10044415
1166 Ga0075432_10048877
1167 Ga0070715_10000714
1168 Ga0070716_100007820
1169 Ga0070716_100342283
1170 Ga0070712_100000750
1171 Ga0070712_100082000
1172 Ga0097621_100072320
1173 Ga0097621_100114721
1174 Ga0097621_100126691
1175 Ga0097621_100141911
1176 Ga0097621_100564154
1177 Ga0068871_100062807
1178 Ga0068871_100094236
1179 Ga0068871_100415797
1180 Ga0068871_100544488
1181 Ga0068871_100654374
1182 Ga0075428_100002070
1183 Ga0075428_100004658
1184 Ga0075428_100012224
1185 Ga0075428_100038164
1186 Ga0075428_100380745
1187 Ga0075430_100075385
1188 Ga0075430_100336650
1189 Ga0075431_100000030
1190 Ga0075431_100018484
1191 Ga0075431_100256976
1192 Ga0075434_100551957
1193 Ga0075429_100006776
1194 Ga0075429_100100005
1195 Ga0075429_100107637
1196 Ga0075429_100679284
1197 Ga0075429_101278567
1198 Ga0068865_100005989
1199 Ga0068865_100032027
1200 Ga0068865_100154253
1201 Ga0068865_100256914
1202 Ga0097620_100000929
1203 Ga0097620_100009203
1204 Ga0097620_100125225
1205 Ga0097620_100228650
1206 Ga0097620_100354551
1207 Ga0097620_102080195
1208 Ga0075435_100389863
1209 Ga0075435_100609771
1210 Ga0099794_10011136
1211 Ga0099794_10021256
1212 Ga0099795_10037368
1213 Ga0105240_10002127
1214 Ga0105240_10002705
1215 Ga0105240_10009513
1216 Ga0105240_10019061
1217 Ga0105240_10043180
1218 Ga0105240_10062866
1219 Ga0105240_10268433
1220 Ga0105240_10578905
1221 Ga0105240_10779600
1222 Ga0105240_11130489
1223 Ga0111539_10009762
1224 Ga0111539_10065955
1225 Ga0111539_10168629
1226 Ga0111539_10233281
1227 Ga0111539_10284440
1228 Ga0111539_10498440
1229 Ga0111539_10704175
1230 Ga0111539_11374338
1231 Ga0105245_10019110
1232 Ga0105245_10541684
1233 Ga0105247_10000390
1234 Ga0105247_10008064
1235 Ga0105247_10065548
1236 Ga0105247_10434298
1237 Ga0114129_10153233
1238 Ga0114129_10272428
1239 Ga0114129_10939058
1240 Ga0105243_10102731
1241 Ga0105243_10168742
1242 Ga0105243_10391033
1243 Ga0105243_11630474
1244 Ga0105241_10034500
1245 Ga0105241_10473736
1246 Ga0105241_10541193
1247 Ga0105241_10940212
1248 Ga0105242_10006693
1249 Ga0105242_10019979
1250 Ga0105242_10648072
1251 Ga0105248_10001404
1252 Ga0105248_10010920
1253 Ga0105248_10030432
1254 Ga0105248_10075402
1255 Ga0105248_11171076
1256 Ga0105248_11812101
1257 Ga0105237_10007658
1258 Ga0105237_10162994
1259 Ga0105237_10217056
1260 Ga0105237_10793924
1261 Ga0105238_10005376
1262 Ga0105238_10078897
1263 Ga0105238_10131609
1264 Ga0105238_10406644
1265 Ga0105238_10486809
1266 Ga0105238_10947601
1267 Ga0105249_10036444
1268 Ga0105249_10073971
1269 Ga0105249_10186168
1270 Ga0105249_10349425
1271 Ga0105249_10459195
1272 Ga0105249_10559372
1273 Ga0099796_10004014
1274 Ga0099796_10027107
1275 Ga0105239_10019263
1276 Ga0105239_10233748
1277 Ga0105239_11375874
1278 Ga0105246_10333158
1279 Ga0105246_10836110
1280 Ga0157370_10001472
1281 Ga0157370_10263999
1282 Ga0157369_10000841
1283 Ga0157369_10068740
1284 Ga0157369_10102450
1285 Ga0157369_11025486
1286 Ga0157374_10032183
1287 Ga0157374_11018673
1288 Ga0157374_11110920
1289 Ga0157378_10019771
1290 Ga0163162_10080582
1291 Ga0163162_10598608
1292 Ga0163162_10608667
1293 Ga0163162_10892668
1294 Ga0157372_10473686
1295 Ga0157375_10007357
1296 Ga0157375_10052757
1297 Ga0157375_10094100
1298 Ga0157375_10465439
1299 Ga0157375_12095973
1300 Ga0163163_10003787
1301 Ga0163163_10109595
1302 Ga0163163_10426054
1303 Ga0163163_10444905
1304 Ga0157380_10000110
1305 Ga0157380_10121662
1306 Ga0157380_10182007
1307 Ga0157380_10288471
1308 Ga0157380_10752052
1309 Ga0157380_11600129
1310 Ga0157377_10289230
1311 Ga0157377_10686463
1312 Ga0157379_10020721
1313 Ga0157379_10029861
1314 Ga0157379_10063423
1315 Ga0157379_10254981
1316 Ga0157379_10276329
1317 Ga0157379_10373013
1318 Ga0157376_10144586
1319 Ga0157376_10150207
1320 Ga0157376_10290937
1321 Ga0157376_10553980
1322 Ga0163161_10131136
1323 Ga0163161_10197194
1324 Ga0213874_10003273
1325 Ga0213874_10015214
1326 Ga0207682_10003425
1327 Ga0207682_10010135
1328 Ga0207692_10119187
1329 Ga0207692_10322806
1330 Ga0207642_10056367
1331 Ga0207642_10605368
1332 Ga0207710_10000349
1333 Ga0207710_10039830
1334 Ga0207688_10073680
1335 Ga0207680_10009849
1336 Ga0207680_10024115
1337 Ga0207680_10036291
1338 Ga0207680_10315088
1339 Ga0207685_10010026
1340 Ga0207699_10017383
1341 Ga0207699_10067788
1342 Ga0207699_10094380
1343 Ga0207699_10122333
1344 Ga0207699_10279916
1345 Ga0207645_10054717
1346 Ga0207645_10063416
1347 Ga0207645_10716960
1348 Ga0207643_10046737
1349 Ga0207654_10037130
1350 Ga0207707_10000122
1351 Ga0207707_10001614
1352 Ga0207707_10014611
1353 Ga0207707_10025599
1354 Ga0207707_10054459
1355 Ga0207707_10083736
1356 Ga0207695_10003540
1357 Ga0207695_10032858
1358 Ga0207695_10045635
1359 Ga0207695_10051308
1360 Ga0207695_10070636
1361 Ga0207695_10094832
1362 Ga0207695_10195446
1363 Ga0207695_10615611
1364 Ga0207671_10020859
1365 Ga0207671_10869086
1366 Ga0207693_10000083
1367 Ga0207693_10045814
1368 Ga0207663_10036366
1369 Ga0207663_10365554
1370 Ga0207660_10001933
1371 Ga0207660_10024344
1372 Ga0207660_10131916
1373 Ga0207660_10169745
1374 Ga0207662_10003138
1375 Ga0207662_10039816
1376 Ga0207662_10172241
1377 Ga0207662_10331532
1378 Ga0207657_10286473
1379 Ga0207649_10098602
1380 Ga0207649_10376931
1381 Ga0207649_10934033
1382 Ga0207652_10000613
1383 Ga0207652_10008803
1384 Ga0207652_10127330
1385 Ga0207652_10398702
1386 Ga0207681_10105768
1387 Ga0207681_10252197
1388 Ga0207694_10041971
1389 Ga0207694_10044756
1390 Ga0207694_10092589
1391 Ga0207694_10481610
1392 Ga0207694_10830833
1393 Ga0207694_10846327
1394 Ga0207650_10446284
1395 Ga0207650_10478583
1396 Ga0207659_10006597
1397 Ga0207659_10128580
1398 Ga0207659_10545303
1399 Ga0207659_10566304
1400 Ga0207700_10011337
1401 Ga0207700_10026505
1402 Ga0207664_10013517
1403 Ga0207664_10043030
1404 Ga0207664_10047267
1405 Ga0207644_10000660
1406 Ga0207644_10174134
1407 Ga0207706_10055844
1408 Ga0207706_10323827
1409 Ga0207686_10411020
1410 Ga0207670_10019610
1411 Ga0207670_10204666
1412 Ga0207669_10035440
1413 Ga0207669_10097759
1414 Ga0207669_10319320
1415 Ga0207704_10047013
1416 Ga0207704_10050165
1417 Ga0207704_10090212
1418 Ga0207704_10151418
1419 Ga0207704_10175278
1420 Ga0207665_10000587
1421 Ga0207665_10015240
1422 Ga0207665_10141497
1423 Ga0207691_10000808
1424 Ga0207691_10020237
1425 Ga0207691_10155413
1426 Ga0207691_10269659
1427 Ga0207711_10019836
1428 Ga0207711_10020918
1429 Ga0207711_10175845
1430 Ga0207689_10006816
1431 Ga0207689_10068790
1432 Ga0207689_10586526
1433 Ga0207661_10393241
1434 Ga0207661_10967791
1435 Ga0207679_10035222
1436 Ga0207679_10255264
1437 Ga0207679_11287257
1438 Ga0207667_10000798
1439 Ga0207667_10004634
1440 Ga0207667_10049362
1441 Ga0207667_10297061
1442 Ga0207667_10419651
1443 Ga0207651_10012726
1444 Ga0207651_10021532
1445 Ga0207651_10044659
1446 Ga0207651_10130569
1447 Ga0207651_10420972
1448 Ga0207712_10041797
1449 Ga0207712_10046720
1450 Ga0207668_10044717
1451 Ga0207668_10621621
1452 Ga0207658_10435869
1453 Ga0207658_10768776
1454 Ga0207658_11501410
1455 Ga0207677_10044619
1456 Ga0207677_10497306
1457 Ga0207703_10002919
1458 Ga0207703_10004149
1459 Ga0207703_10071608
1460 Ga0207703_10122843
1461 Ga0207703_10226563
1462 Ga0207703_10463879
1463 Ga0207639_10174985
1464 Ga0207639_10197304
1465 Ga0207678_10057667
1466 Ga0207678_10143351
1467 Ga0207708_10126206
1468 Ga0207708_10143037
1469 Ga0207708_10262327
1470 Ga0207702_10021375
1471 Ga0207702_10024278
1472 Ga0207702_10449937
1473 Ga0207702_11134358
1474 Ga0207641_10000266
1475 Ga0207641_10004267
1476 Ga0207641_10072695
1477 Ga0207641_10078506
1478 Ga0207648_10011589
1479 Ga0207648_10307452
1480 Ga0207648_10420128
1481 Ga0207648_10538471
1482 Ga0207648_10550578
1483 Ga0207676_10000965
1484 Ga0207674_10045038
1485 Ga0207674_10324191
1486 Ga0207675_100001909
1487 Ga0207675_100017235
1488 Ga0207675_100021368
1489 Ga0207675_100108282
1490 Ga0207675_100262014
1491 Ga0207683_10002455
1492 Ga0207683_10012739
1493 Ga0207683_10418636
1494 Ga0207683_10988293
1495 Ga0207428_10018642
1496 Ga0207428_10037638
1497 Ga0207428_10053868
1498 Ga0207428_10077052
1499 Ga0265356_1001033
1500 Ga0268266_10000159
1501 Ga0268266_10004018
1502 Ga0268266_10018604
1503 Ga0268266_10020525
1504 Ga0268266_10021131
1505 Ga0268266_10021707
1506 Ga0268266_10036776
1507 Ga0268266_10103250
1508 Ga0268266_10113600
1509 Ga0268266_10229263
1510 Ga0268266_10474874
1511 Ga0268265_10015831
1512 Ga0268265_10026933
1513 Ga0268265_10085663
1514 Ga0268265_10269110
1515 Ga0268265_10400670
1516 Ga0268265_10421531
1517 Ga0268265_10486922
1518 Ga0268265_10513957
1519 Ga0268264_10000047
1520 Ga0268264_10000140
1521 Ga0268264_10037266
1522 Ga0268264_10326291
1523 Ga0265334_10012381
1524 Ga0307517_10215405
1525 Ga0307515_10001652
1526 Ga0307515_10121290
1527 Ga0307515_10195041
1528 Ga0307515_10606956
1529 Ga0307511_10000268
1530 Ga0307511_10051996
1531 Ga0265770_1000007
1532 Ga0265760_10005135
1533 Ga0265760_10098769
1534 Ga0265340_10275247
1535 Ga0265339_10226767
1536 Ga0265331_10002039
1537 Ga0307513_10049297
1538 Ga0307513_10053175
1539 Ga0307513_10113314
1540 Ga0307513_10115262
1541 Ga0307513_10181146
1542 Ga0307509_10001396
1543 Ga0307509_10042256
1544 Ga0307509_10059381
1545 Ga0307509_10643087
1546 Ga0307408_100134284
1547 Ga0307508_10207321
1548 Ga0316576_10051790
1549 Ga0316576_10068868
1550 Ga0316576_10096611
1551 Ga0316576_10201666
1552 Ga0316578_10431437
1553 Ga0307516_10002208
1554 Ga0307405_10048178
1555 Ga0307405_10620416
1556 Ga0307413_10010738
1557 Ga0307413_10030393
1558 Ga0307413_10254987
1559 Ga0307413_10282177
1560 Ga0307410_10006032
1561 Ga0307410_10111930
1562 Ga0307406_10010319
1563 Ga0307406_10220386
1564 Ga0307406_10271691
1565 Ga0307406_10609286
1566 Ga0307406_10859982
1567 Ga0307407_10015668
1568 Ga0307407_10041476
1569 Ga0307412_10286848
1570 Ga0307412_10691078
1571 Ga0307412_11447345
1572 Ga0307409_100189418
1573 Ga0307409_100427238
1574 Ga0307409_100677127
1575 Ga0307416_100192517
1576 Ga0307416_100368594
1577 Ga0307416_100458569
1578 Ga0307416_101119484
1579 Ga0307416_102014556
1580 Ga0307414_10459409
1581 Ga0307414_11059891
1582 Ga0307411_10014764
1583 Ga0307411_10078816
1584 Ga0307411_10160080
1585 Ga0307411_10272327
1586 Ga0307411_10399134
1587 Ga0307411_10544499
1588 Ga0307411_10763428
1589 Ga0307411_11100196
1590 Ga0307411_11380182
1591 Ga0307415_100061002
1592 Ga0307415_100115502
1593 Ga0307415_100171048
1594 Ga0307415_100180680
1595 Ga0307415_100511231
1596 Ga0307415_100534046
1597 Ga0307415_100825375
1598 Ga0307507_10426193
1599 Ga0307510_10005539
1600 Ga0307510_10256592
1601 Ga0373923_0009894
1602 Ga0373923_0077208
1603 Ga0373936_0013613
1604 Ga0373945_0211837
1605 Ga0373956_0164325
1606 Ga0373957_0055727
1607 Ga0373957_0068871
1608 Ga0373957_0131475
1609 Ga0373960_0077475
1610 Ga0373943_0326457
1611 Ga0373946_0234066
1612 Ga0373955_0009251
1613 Ga0373955_0069928
1614 Ga0373961_0016704
1615 Ga0373962_0115306
1616 Ga0316574_0010344
1617 Ga0316574_0014494
1618 Ga0316574_0016384
1619 Ga0316574_0025283
1620 Ga0316574_0138730
1621 Ga0316574_0141004
1622 Ga0316574_0264702
1623 Ga0373931_0775174
1624 Ga0373927_0020690
1625 Ga0373927_0269784
1626 Ga0373933_0180346
1627 Ga0373937_0006608
1628 Ga0373937_0025980
1629 Ga0373937_0088213
1630 Ga0373937_0259964
1631 Ga0316584_0003331
1632 Ga0316584_0187258
1633 Ga0436364_1238211
1634 Ga0436365_1772567
1635 Ga0436365_1859648
1636 Ga0436360_0066373
1637 Ga0436360_0659686
1638 Ga0436360_0995015
1639 Ga0436361_0066890
1640 Ga0436361_0251740
1641 Ga0436363_0461713
1642 Ga0436363_0641697
1643 Ga0436363_1646651
1644 Ga0436362_0815706
1645 Ga0436362_1231019
1646 Ga0451789_0293465
1647 Ga0451791_0653772
1648 Ga0451793_0640635
1649 Ga0451793_0947639
1650 Ga0451797_0966810
1651 Ga0451800_0973983
1652 Ga0451800_1658630
1653 Ga0451802_1934902
1654 Ga0451802_1935343
1655 Ga0451807_0065623
1656 Ga0451807_2246987
1657 Ga0451807_2285000
1658 Ga0451833_1190085
1659 Ga0451849_1405876
1660 Ga0451851_1138035
1661 Ga0439442_023326
1662 Ga0439448_0113438
1663 Ga0439449_0052926
1664 Ga0450896_037636
1665 Ga0439444_0024418
1666 Ga0439459_0093011
1667 Ga0439464_0045734
1668 Ga0451577_0017859
1669 Ga0451577_0076774
1670 Ga0451577_0158358
1671 Ga0466969_0010650
1672 Ga0466969_0018694
1673 Ga0466972_0099651
1674 Ga0453683_0071396
1675 Ga0466965_0121950
1676 Ga0466965_0176878
1677 Ga0466966_0018782
1678 Ga0466966_0211198
1679 Ga0466966_0581404
1680 Ga0466961_0005738
1681 Ga0466964_0017568
1682 Ga0453684_0032214
1683 Ga0453684_0068289
1684 Ga0453684_0476960
1685 Ga0453684_0934179
1686 Ga0466971_0000216
1687 Ga0466970_0002740
1688 Ga0466957_0001530
1689 Ga0466960_0061910
1690 Ga0466959_0002645
1691 Ga0466959_0010436
1692 Ga0466959_0014163
1693 Ga0466959_0100728
1694 Ga0451576_0023536
1695 Ga0451576_0215678
1696 Ga0451576_1038706
1697 Ga0466958_0011057
1698 Ga0495592_0122645
1699 Ga0495590_0026392
1700 Ga0495591_019311
1701 Ga0495638_0029681
1702 Ga0495638_0042983
1703 Ga0495638_0467349
1704 Ga0495580_0002317
1705 Ga0495580_0011390
1706 Ga0495580_0038431
1707 Ga0495580_0250819
1708 Ga0495580_0745606
1709 Ga0495582_0171548
1710 Ga0495594_0225796
1711 Ga0495610_0299294
1712 Ga0495616_0003520
1713 Ga0495618_0070893
1714 Ga0495620_0181440
1715 Ga0495632_0030336
1716 Ga0495632_0030443
1717 Ga0495632_0319753
1718 Ga0495644_0019850
1719 Ga0495648_0058796
1720 Ga0495652_0258438
1721 Ga0495665_0044595
1722 Ga0495586_0055117
1723 Ga0495586_0484897
1724 Ga0495621_0024354
1725 Ga0495621_0048158
1726 Ga0495621_0088361
1727 Ga0495633_0156593
1728 Ga0495656_0054433
1729 Ga0495668_0489013
1730 Ga0495625_0004128
1731 Ga0495625_0056977
1732 Ga0495625_0084823
1733 Ga0495625_0150529
1734 Ga0495625_0277573
1735 Ga0495659_0160024
1736 Ga0495657_0072326
1737 Ga0495599_0099033
1738 Ga0495623_0061473
1739 Ga0495647_0022229
1740 Ga0495647_0028574
1741 Ga0495647_0141218
1742 Ga0495658_0010043
1743 Ga0495658_0510274
1744 Ga0495669_0357713
1745 Ga0495649_0070992
1746 Ga0495581_0149843
1747 Ga0495604_0031892
1748 Ga0495674_0449767
1749 Ga0495672_0063383
1750 Ga0495681_0037726
1751 Ga0495686_0068125
1752 Ga0495602_0035047
1753 Ga0495626_0223542
1754 Ga0496100_0014282
1755 Ga0496100_0924555
1756 Ga0496101_0002781
1757 Ga0496101_0058777
1758 Ga0496102_0004283
1759 Ga0496102_0015204
1760 Ga0496102_0025670
1761 Ga0496102_0239250
1762 Ga0496103_0054969
1763 Ga0496103_0157107
1764 Ga0496104_0166549
1765 Ga0496104_0183740
1766 Ga0496104_0205567
1767 Ga0496105_0038751
1768 Ga0496106_0023670
1769 Ga0496106_0092723
1770 Ga0496106_0131648
1771 Ga0496106_0232287
1772 Ga0496106_1019094
1773 Ga0496107_0014224
1774 Ga0496107_0704523
1775 Ga0496108_0012714
1776 Ga0496108_0578231
1777 Ga0496110_0000749
1778 Ga0496110_0352827
1779 Ga0496111_0007317
1780 Ga0496112_0005843
1781 Ga0496112_0149992
1782 Ga0496113_0024231
1783 Ga0496113_0034940
1784 Ga0496114_0001864
1785 Ga0496114_0031729
1786 Ga0496114_0139070
1787 Ga0496114_0546027
1788 Ga0496115_0019186
1789 Ga0496115_0255565
1790 Ga0496116_0009552
1791 Ga0496117_0000151
1792 Ga0496117_0365928
1793 Ga0496118_0000016
1794 Ga0496118_0053120
1795 Ga0496118_0061427
1796 Ga0496118_0071775
1797 Ga0496119_0007663
1798 Ga0496119_0026068
1799 Ga0496120_0002631
1800 Ga0496120_0079655
1801 Ga0496121_0003216
1802 Ga0496121_0062952
1803 Ga0496121_0088943
1804 Ga0496124_0036662
1805 Ga0496125_0000759
1806 Ga0496125_0015343
1807 Ga0496125_0042383
1808 Ga0496126_0001875
1809 Ga0496126_0059047
1810 Ga0501299_089863
1811 Ga0501031_0108948
1812 Ga0501031_0189438
1813 Ga0501032_0198951
1814 Ga0501033_0125845
1815 Ga0501033_0331458
1816 Ga0501034_1339501
1817 Ga0501036_0019918
1818 Ga0501036_0030927
1819 Ga0501036_0314169
1820 Ga0501037_0029609
1821 Ga0501037_0074819
1822 Ga0501038_0025407
1823 Ga0501038_0110786
1824 Ga0501039_0005021
1825 Ga0501039_0534782
1826 Ga0501040_0001902
1827 Ga0501040_0020637
1828 Ga0501041_0003543
1829 Ga0501041_0027415
1830 Ga0501042_0020076
1831 Ga0501042_0069390
1832 Ga0501043_0047241
1833 Ga0501046_0008614
1834 Ga0501046_0065359
1835 Ga0501046_0071635
1836 Ga0501046_0447081
1837 Ga0501048_0031048
1838 Ga0501048_0122126
1839 Ga0501068_0039428
1840 Ga0501068_0040215
1841 Ga0501069_0069086
1842 Ga0501070_0235381
1843 Ga0501071_0000689
1844 Ga0501071_0050039
1845 Ga0501072_0002540
1846 Ga0501072_0027868
1847 Ga0501072_0785763
1848 Ga0501075_0003894
1849 Ga0501076_0000782
1850 Ga0501076_0025012
1851 Ga0501077_0009125
1852 Ga0501077_0069821
1853 Ga0501209_026366
1854 Ga0501249_007490
1855 Ga0501257_089169
1856 Ga0501079_0001340
1857 Ga0501079_0017298
1858 Ga0501080_0005127
1859 Ga0501080_0185062
1860 Ga0501080_0839020
1861 Ga0501081_0010808
1862 Ga0501081_0051401
1863 Ga0501081_0544209
1864 Ga0501083_0259029
1865 Ga0501035_0038912
1866 Ga0501035_0052512
1867 Ga0501044_0121003
1868 Ga0501044_0648569
1869 Ga0501045_0000401
1870 Ga0501045_0020016
1871 Ga0501045_0116565
1872 nmdc:mga05p37_1003701_c1
1873 nmdc:mga09592_139542_c1
1874 nmdc:mga09592_79156_c1
1875 nmdc:mga0qj67_105459_c1
1876 nmdc:mga0qj67_119265_c1
1877 nmdc:mga0qj67_369301_c1
1878 nmdc:mga0qj67_441560_c1
1879 nmdc:mga06r32_12456_c1
1880 nmdc:mga06r32_140547_c1
1881 nmdc:mga06r32_24616_c1
1882 nmdc:mga06r32_259443_c1
1883 nmdc:mga06r32_87594_c1
1884 nmdc:mga08y16_1026529_c1
1885 nmdc:mga08y16_117632_c1
1886 nmdc:mga08y16_1181637_c1
1887 nmdc:mga08y16_2161_c1
1888 nmdc:mga08y16_24822_c1
1889 nmdc:mga08y16_508240_c1
1890 nmdc:mga08y16_66436_c1
1891 nmdc:mga08y16_920464_c1
1892 nmdc:mga0rr50_297944_c1
1893 nmdc:mga0rr50_430501_c1
1894 nmdc:mga0a205_692174_c1
1895 Ga0495612_0160887
1896 Ga0495612_0352621
1897 Ga0500646_0119074
1898 Ga0500583_0051673
1899 Ga0500583_0068826
1900 Ga0500651_0187399
1901 Ga0500641_0348540
1902 Ga0500660_127142
1903 Ga0500556_0085210
1904 Ga0500556_0095777
1905 Ga0500562_080488
1906 Ga0500569_010238
1907 Ga0500592_025572
1908 Ga0500595_095061
1909 Ga0500652_081380
1910 Ga0500652_139261
1911 Ga0500658_0008480
1912 Ga0500559_0039884
1913 Ga0500568_0037122
1914 Ga0500588_0002779
1915 Ga0500616_0000073
1916 Ga0500622_0002406
1917 Ga0500622_0005698
1918 Ga0500622_0014061
1919 Ga0500627_0073504
1920 Ga0500630_043962
1921 Ga0500633_0092643
1922 Ga0500633_0133288
1923 Ga0500636_0101843
1924 Ga0500637_0000126
1925 Ga0501084_0120250
1926 Ga0501084_0321710
1927 Ga0501082_0006995
1928 Ga0466962_0038104
1929 Ga0530510_0018068
1930 Ga0530510_0034834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

107

178

0.94

PF13560

HTH_31

Helix-turn-helix domain

4

63

0.9

PF01381

HTH_3

Helix-turn-helix

9

63

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.9565 4 65
3clc-assembly1.cif.gz_D crystal structure of the restriction-modification controller protein c.esp1396i tetramer in complex with its natural 35 base-pair operator 0.9513 4 65
2xcj-assembly1.cif.gz_B crystal structure of p2 c, the immunity repressor of temperate e. coli phage p2 0.9421 5 55
6rnz-assembly2.cif.gz_B crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.9418 5 64
4i6t-assembly1.cif.gz_A crystal structure of a t36a mutant of the restriction-modification controller protein c.esp1396i 0.9399 4 65
ID Description Score Start End Superfamily
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9624 4 65 1.10.260.40
2b5aA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9565 4 65 1.10.260.40
4x4bA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9534 4 65 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9524 4 65 1.10.260.40
3clcD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9513 4 65 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A3M3JZX3-F1-model_v4 deleted 0.9821 75 182
AF-A0A3M3JZX3-F1-model_v4 deleted 0.9644 75 182
AF-A0A7W2GSC8-F1-model_v4 Cupin domain-containing protein 0.964 75 182
AF-A0A3T1DYX9-F1-model_v4 deleted 0.9598 66 180
AF-A0A7Y2URT1-F1-model_v4 Cupin domain-containing protein 0.9569 80 182

Map