F486903
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 962 | 496 | 831 | 498 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221699|2644547923 |
| Length | 572 |
| Sequence | PXILSVVTFLPLVGAGLILLARLFNKGSADGAARWIALITTVAVLAVSAVLVMQFKPELATYQFVERYDWFAAAQYHMGVDGISILFVLLTAFLMPICIVASWXTIXXRVVDYMIAFLVLETLVIGVFTSLDLXXFYIFFEGTLVPMFIIIGVWGGANRIYASYKFFLYTLLGSVLMLLAMLWISVLMLLAMLWIEHFLVLETLVIGVFTSLDLFLFYIFFEGTLVPMFIIIGVWGGANRIYASYKFFLYTLLGSVLMLLAMLWMAAETGTTSIPALKDYAFSPTVQPLLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGILLKLGGYGFILFNLPMFPAASKMFAPLVFVLSAVAIVYTSLVAFRQTDMKKLIAYSSVAHMGFVTMGIFAGNALGVQGAVFQMLSHGLISGALFLCVGVVYDRMHTREIALYGGLTARMPWFAAIFLLFTMANVGLPGTSGFIGEILTMTGVYGVSTWTALFAATGVIFSAVYALTLYRNVMFGEITNPAMKAITDVDRRELLIFVPLIIGTLWLGVQPGLVLDYTAASVEALTSAFQLAIGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 2 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 3 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 4 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 5 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 6 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 7 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 8 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 9 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 10 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 11 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 12 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 13 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 14 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 15 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 16 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 17 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 18 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 19 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 20 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 21 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 22 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 23 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 24 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 25 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 26 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 27 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 28 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 29 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 30 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 31 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 32 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 33 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 34 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 35 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 36 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 37 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 38 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 39 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 40 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 41 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 42 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 43 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 44 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 45 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 46 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 47 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 48 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 49 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 50 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 51 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 52 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 53 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 54 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 55 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 56 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 57 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 58 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 59 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 60 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 61 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 62 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 63 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 64 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 65 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 66 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 67 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 68 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 69 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 70 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 71 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 72 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 73 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 74 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 75 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 76 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 77 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 78 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 79 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 80 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 81 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 82 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 83 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 84 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 85 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 86 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 87 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 88 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 89 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 90 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 91 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 92 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 93 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 94 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 95 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 96 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 97 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 98 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 99 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 100 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 101 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 102 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 103 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 104 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 105 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 106 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 107 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 108 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 109 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 110 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 111 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 112 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 113 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 114 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 115 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 116 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 117 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 118 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 119 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 120 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 121 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 122 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 123 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 124 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 125 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 126 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 127 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 128 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 129 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 130 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 131 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 132 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 133 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 134 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 135 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 137 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 140 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 141 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 142 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 144 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 145 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 154 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 157 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 158 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 159 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 160 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 161 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 165 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 167 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 168 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 169 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 170 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 171 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 172 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 173 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 174 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 175 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 176 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 177 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 178 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 179 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 180 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 182 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 183 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 184 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 185 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 186 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 187 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 188 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 189 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 190 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 191 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 192 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 193 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 194 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 195 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 196 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 198 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 217 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 219 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 220 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 221 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 222 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 223 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 224 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 228 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 233 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 275 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 276 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 277 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 279 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 283 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 284 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 285 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 286 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 287 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 288 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 289 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 290 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 291 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 292 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 293 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 294 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 295 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 296 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 297 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 298 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 299 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 300 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 301 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 302 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 303 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 304 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 305 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 306 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 307 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 308 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 309 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 310 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 311 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 312 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 313 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 314 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 316 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 318 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 320 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 321 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 323 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 324 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 325 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 326 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 328 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 329 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 330 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 331 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 332 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 333 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 334 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 335 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 336 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 337 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 338 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 339 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 340 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 341 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 342 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 343 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 344 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 345 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 346 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 347 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 348 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 349 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 350 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 351 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 352 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 353 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 382 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 383 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 384 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 385 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 386 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 387 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 390 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 391 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 392 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 393 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 394 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 395 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 396 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 397 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 398 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 399 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 400 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 401 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 402 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 403 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 404 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 405 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 406 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 432 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 437 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 441 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 442 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 443 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 444 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 445 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 446 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 447 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 448 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 454 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 455 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 456 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 457 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 459 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 460 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 461 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 462 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 463 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 464 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 465 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 466 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 467 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 468 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 470 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 472 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 474 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 475 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 476 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 478 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 479 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 480 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 483 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 486 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 487 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 488 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 489 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 490 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 491 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 492 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 493 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 494 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 495 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
| 496 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.28 |
| Metatranscriptomes | 0.1 |
| Isolates | 13.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.24 |
| Nodule | 5.82 |
| Rhizoplane | 4.05 |
| Rhizosphere | 65.18 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 10.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000469 | 3300001904 | Bacteria | 7572 |
| 2 | JGI24740J21852_10002149 | 3300001979 | Bacteria | 9011 |
| 3 | JGI24740J21852_10011083 | 3300001979 | Bacteria | 3444 |
| 4 | JGI24735J21928_10001159 | 3300002067 | Bacteria | 9419 |
| 5 | JGI24735J21928_10001163 | 3300002067 | Bacteria | 9410 |
| 6 | JGI24738J21930_10003997 | 3300002075 | Bacteria | 3661 |
| 7 | JGI25157J39369_1000707 | 3300002741 | Bacteria | 17999 |
| 8 | Ga0055537_1005923 | 3300003773 | Bacteria | 3193 |
| 9 | Ga0055536_1005242 | 3300003781 | Bacteria | 6390 |
| 10 | Ga0055536_1005282 | 3300003781 | Bacteria | 6360 |
| 11 | Ga0055536_1008966 | 3300003781 | Bacteria | 4214 |
| 12 | Ga0055528_1005371 | 3300003790 | Bacteria | 5980 |
| 13 | Ga0055530_10000647 | 3300003791 | Bacteria | 29932 |
| 14 | Ga0055530_10001148 | 3300003791 | Bacteria | 20593 |
| 15 | Ga0055530_10006282 | 3300003791 | Bacteria | 5346 |
| 16 | Ga0055530_10011836 | 3300003791 | Bacteria | 3096 |
| 17 | Ga0055531_10003600 | 3300003794 | Bacteria | 9796 |
| 18 | Ga0055531_10008745 | 3300003794 | Bacteria | 5283 |
| 19 | Ga0055531_10014013 | 3300003794 | Bacteria | 3647 |
| 20 | Ga0065165_1000845 | 3300005262 | Bacteria | 40173 |
| 21 | Ga0065165_1003786 | 3300005262 | Bacteria | 10124 |
| 22 | Ga0065165_1005117 | 3300005262 | Bacteria | 7595 |
| 23 | Ga0065704_10070237 | 3300005289 | Bacteria | 52535 |
| 24 | Ga0065707_10000608 | 3300005295 | Bacteria | 19207 |
| 25 | Ga0070658_10000125 | 3300005327 | Bacteria | 68211 |
| 26 | Ga0070658_10013254 | 3300005327 | Bacteria | 6613 |
| 27 | Ga0070658_10083602 | 3300005327 | Bacteria | 2624 |
| 28 | Ga0070658_10093326 | 3300005327 | Bacteria | 2482 |
| 29 | Ga0070658_10172058 | 3300005327 | Bacteria | 1820 |
| 30 | Ga0070683_100019454 | 3300005329 | Bacteria | 6031 |
| 31 | Ga0070670_100000037 | 3300005331 | Bacteria | 156070 |
| 32 | Ga0070677_10000656 | 3300005333 | Bacteria | 11544 |
| 33 | Ga0070680_100002884 | 3300005336 | Bacteria | 12785 |
| 34 | Ga0070680_100003695 | 3300005336 | Bacteria | 11429 |
| 35 | Ga0070680_100029645 | 3300005336 | Bacteria | 4394 |
| 36 | Ga0070680_100030844 | 3300005336 | Bacteria | 4307 |
| 37 | Ga0070680_100072505 | 3300005336 | Bacteria | 2830 |
| 38 | Ga0070680_100102079 | 3300005336 | Bacteria | 2381 |
| 39 | Ga0070682_100012466 | 3300005337 | Bacteria | 4877 |
| 40 | Ga0068868_100000001 | 3300005338 | Bacteria | 282170 |
| 41 | Ga0070660_100003034 | 3300005339 | Bacteria | 11561 |
| 42 | Ga0070660_100005715 | 3300005339 | Bacteria | 8612 |
| 43 | Ga0070660_100028150 | 3300005339 | Bacteria | 4202 |
| 44 | Ga0070660_100114842 | 3300005339 | Bacteria | 2145 |
| 45 | Ga0070689_100072270 | 3300005340 | Bacteria | 2696 |
| 46 | Ga0070691_10002895 | 3300005341 | Bacteria | 7695 |
| 47 | Ga0070691_10019229 | 3300005341 | Bacteria | 3150 |
| 48 | Ga0070691_10026589 | 3300005341 | Bacteria | 2698 |
| 49 | Ga0070661_100014744 | 3300005344 | Bacteria | 5512 |
| 50 | Ga0070661_100026358 | 3300005344 | Bacteria | 4180 |
| 51 | Ga0070668_100000018 | 3300005347 | Bacteria | 99142 |
| 52 | Ga0070668_100002188 | 3300005347 | Bacteria | 14336 |
| 53 | Ga0070668_100074951 | 3300005347 | Bacteria | 2641 |
| 54 | Ga0070669_100000329 | 3300005353 | Bacteria | 36963 |
| 55 | Ga0070669_100023151 | 3300005353 | Bacteria | 4446 |
| 56 | Ga0070675_100127929 | 3300005354 | Bacteria | 2163 |
| 57 | Ga0070671_100001250 | 3300005355 | Bacteria | 19045 |
| 58 | Ga0070671_100024938 | 3300005355 | Bacteria | 4900 |
| 59 | Ga0070671_100026330 | 3300005355 | Bacteria | 4779 |
| 60 | Ga0070659_100000001 | 3300005366 | Bacteria | 576390 |
| 61 | Ga0070659_100026185 | 3300005366 | Bacteria | 4486 |
| 62 | Ga0070659_100067276 | 3300005366 | Bacteria | 2841 |
| 63 | Ga0070659_100096585 | 3300005366 | Bacteria | 2374 |
| 64 | Ga0070659_100104104 | 3300005366 | Bacteria | 2286 |
| 65 | Ga0070667_100000083 | 3300005367 | Bacteria | 118261 |
| 66 | Ga0070667_100010505 | 3300005367 | Bacteria | 7646 |
| 67 | Ga0070714_100016732 | 3300005435 | Bacteria | 5929 |
| 68 | Ga0070713_100001498 | 3300005436 | Bacteria | 14893 |
| 69 | Ga0070705_100041450 | 3300005440 | Bacteria | 2625 |
| 70 | Ga0070663_100000958 | 3300005455 | Bacteria | 15673 |
| 71 | Ga0070663_100001663 | 3300005455 | Bacteria | 12303 |
| 72 | Ga0070663_100008703 | 3300005455 | Bacteria | 6257 |
| 73 | Ga0070663_100018515 | 3300005455 | Bacteria | 4569 |
| 74 | Ga0070663_100032434 | 3300005455 | Bacteria | 3600 |
| 75 | Ga0070681_10020073 | 3300005458 | Bacteria | 6696 |
| 76 | Ga0070681_10032415 | 3300005458 | Bacteria | 5244 |
| 77 | Ga0070681_10227695 | 3300005458 | Bacteria | 1779 |
| 78 | Ga0070679_100005502 | 3300005530 | Bacteria | 11741 |
| 79 | Ga0070679_100006911 | 3300005530 | Bacteria | 10585 |
| 80 | Ga0070679_100022016 | 3300005530 | Bacteria | 6226 |
| 81 | Ga0070679_100050766 | 3300005530 | Bacteria | 4131 |
| 82 | Ga0070679_100063706 | 3300005530 | Bacteria | 3675 |
| 83 | Ga0070684_100002726 | 3300005535 | Bacteria | 13054 |
| 84 | Ga0068853_100005921 | 3300005539 | Bacteria | 9651 |
| 85 | Ga0068853_100010858 | 3300005539 | Bacteria | 7379 |
| 86 | Ga0068853_100015961 | 3300005539 | Bacteria | 6174 |
| 87 | Ga0068853_100022761 | 3300005539 | Bacteria | 5237 |
| 88 | Ga0068853_100025697 | 3300005539 | Bacteria | 4942 |
| 89 | Ga0068853_100081486 | 3300005539 | Bacteria | 2834 |
| 90 | Ga0068853_100127855 | 3300005539 | Bacteria | 2271 |
| 91 | Ga0070686_100000597 | 3300005544 | Bacteria | 21352 |
| 92 | Ga0070695_100032791 | 3300005545 | Bacteria | 3247 |
| 93 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 94 | Ga0070665_100000334 | 3300005548 | Bacteria | 72297 |
| 95 | Ga0070665_100000883 | 3300005548 | Bacteria | 38439 |
| 96 | Ga0070665_100005159 | 3300005548 | Bacteria | 13516 |
| 97 | Ga0070704_100025527 | 3300005549 | Bacteria | 3892 |
| 98 | Ga0068855_100031052 | 3300005563 | Bacteria | 6383 |
| 99 | Ga0068855_100051832 | 3300005563 | Bacteria | 4833 |
| 100 | Ga0068855_100059691 | 3300005563 | Bacteria | 4462 |
| 101 | Ga0068855_100060289 | 3300005563 | Bacteria | 4438 |
| 102 | Ga0068855_100066595 | 3300005563 | Bacteria | 4199 |
| 103 | Ga0068855_100092635 | 3300005563 | Bacteria | 3485 |
| 104 | Ga0068855_100160596 | 3300005563 | Bacteria | 2551 |
| 105 | Ga0070664_100003103 | 3300005564 | Bacteria | 13439 |
| 106 | Ga0070664_100065815 | 3300005564 | Bacteria | 3094 |
| 107 | Ga0068857_100068835 | 3300005577 | Bacteria | 3151 |
| 108 | Ga0068857_100108075 | 3300005577 | Bacteria | 2499 |
| 109 | Ga0068857_100179160 | 3300005577 | Bacteria | 1928 |
| 110 | Ga0068854_100010766 | 3300005578 | Bacteria | 5934 |
| 111 | Ga0068854_100011856 | 3300005578 | Bacteria | 5693 |
| 112 | Ga0068856_100012156 | 3300005614 | Bacteria | 8339 |
| 113 | Ga0068852_100000387 | 3300005616 | Bacteria | 29490 |
| 114 | Ga0068852_100006174 | 3300005616 | Bacteria | 8640 |
| 115 | Ga0068852_100007731 | 3300005616 | Bacteria | 7862 |
| 116 | Ga0068852_100134989 | 3300005616 | Bacteria | 2277 |
| 117 | Ga0068852_100145389 | 3300005616 | Bacteria | 2199 |
| 118 | Ga0068859_100021262 | 3300005617 | Bacteria | 6511 |
| 119 | Ga0068859_100057359 | 3300005617 | Bacteria | 3922 |
| 120 | Ga0068864_100000116 | 3300005618 | Bacteria | 79213 |
| 121 | Ga0068864_100000363 | 3300005618 | Bacteria | 39706 |
| 122 | Ga0068861_100097602 | 3300005719 | Bacteria | 2331 |
| 123 | Ga0068861_100116950 | 3300005719 | Bacteria | 2145 |
| 124 | Ga0068851_10011399 | 3300005834 | Bacteria | 4168 |
| 125 | Ga0068851_10019055 | 3300005834 | Bacteria | 3315 |
| 126 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 127 | Ga0068863_100000122 | 3300005841 | Bacteria | 81534 |
| 128 | Ga0068863_100003837 | 3300005841 | Bacteria | 14865 |
| 129 | Ga0068863_100014998 | 3300005841 | Bacteria | 7444 |
| 130 | Ga0068863_100039222 | 3300005841 | Bacteria | 4507 |
| 131 | Ga0068863_100059984 | 3300005841 | Bacteria | 3599 |
| 132 | Ga0068863_100060215 | 3300005841 | Bacteria | 3590 |
| 133 | Ga0068863_100075817 | 3300005841 | Bacteria | 3182 |
| 134 | Ga0068858_100000853 | 3300005842 | Bacteria | 31569 |
| 135 | Ga0068858_100004079 | 3300005842 | Bacteria | 14391 |
| 136 | Ga0068858_100012038 | 3300005842 | Bacteria | 8154 |
| 137 | Ga0068858_100043412 | 3300005842 | Bacteria | 4168 |
| 138 | Ga0068858_100144316 | 3300005842 | Bacteria | 2235 |
| 139 | Ga0068860_100000348 | 3300005843 | Bacteria | 62147 |
| 140 | Ga0068860_100001231 | 3300005843 | Bacteria | 27931 |
| 141 | Ga0068860_100063874 | 3300005843 | Bacteria | 3497 |
| 142 | Ga0068860_100066828 | 3300005843 | Bacteria | 3416 |
| 143 | Ga0068862_100000067 | 3300005844 | Bacteria | 123668 |
| 144 | Ga0068862_100000235 | 3300005844 | Bacteria | 61301 |
| 145 | Ga0068862_100026581 | 3300005844 | Bacteria | 4865 |
| 146 | Ga0081455_10001031 | 3300005937 | Bacteria | 35153 |
| 147 | Ga0081455_10006263 | 3300005937 | Bacteria | 12803 |
| 148 | Ga0081455_10014607 | 3300005937 | Bacteria | 7684 |
| 149 | Ga0081540_1001263 | 3300005983 | Bacteria | 22058 |
| 150 | Ga0081540_1001383 | 3300005983 | Bacteria | 21036 |
| 151 | Ga0070717_10024295 | 3300006028 | Bacteria | 4810 |
| 152 | Ga0075365_10000227 | 3300006038 | Bacteria | 19112 |
| 153 | Ga0075365_10022854 | 3300006038 | Bacteria | 3924 |
| 154 | Ga0075368_10000991 | 3300006042 | Bacteria | 8873 |
| 155 | Ga0075368_10006977 | 3300006042 | Bacteria | 3973 |
| 156 | Ga0075363_100000062 | 3300006048 | Bacteria | 21873 |
| 157 | Ga0075363_100026434 | 3300006048 | Bacteria | 2969 |
| 158 | Ga0075363_100038716 | 3300006048 | Bacteria | 2508 |
| 159 | Ga0075364_10000935 | 3300006051 | Bacteria | 15418 |
| 160 | Ga0075364_10001197 | 3300006051 | Bacteria | 13931 |
| 161 | Ga0075364_10013747 | 3300006051 | Bacteria | 4985 |
| 162 | Ga0075364_10078826 | 3300006051 | Bacteria | 2176 |
| 163 | Ga0075432_10000094 | 3300006058 | Bacteria | 18657 |
| 164 | Ga0075362_10002672 | 3300006177 | Bacteria | 6057 |
| 165 | Ga0075362_10015878 | 3300006177 | Bacteria | 3072 |
| 166 | Ga0075367_10000119 | 3300006178 | Bacteria | 22688 |
| 167 | Ga0075367_10009476 | 3300006178 | Bacteria | 5091 |
| 168 | Ga0075367_10094182 | 3300006178 | Bacteria | 1825 |
| 169 | Ga0075369_10000060 | 3300006186 | Bacteria | 28160 |
| 170 | Ga0075369_10014705 | 3300006186 | Bacteria | 3131 |
| 171 | Ga0075427_10000023 | 3300006194 | Bacteria | 10265 |
| 172 | Ga0075366_10000596 | 3300006195 | Bacteria | 16937 |
| 173 | Ga0075366_10005099 | 3300006195 | Bacteria | 7103 |
| 174 | Ga0075366_10051698 | 3300006195 | Bacteria | 2441 |
| 175 | Ga0075370_10000043 | 3300006353 | Bacteria | 38612 |
| 176 | Ga0075370_10000066 | 3300006353 | Bacteria | 31728 |
| 177 | Ga0075370_10020413 | 3300006353 | Bacteria | 3621 |
| 178 | Ga0075370_10023778 | 3300006353 | Bacteria | 3378 |
| 179 | Ga0075370_10056584 | 3300006353 | Bacteria | 2229 |
| 180 | Ga0075433_10026622 | 3300006852 | Bacteria | 4899 |
| 181 | Ga0075434_100122090 | 3300006871 | Bacteria | 2621 |
| 182 | Ga0075429_100006297 | 3300006880 | Bacteria | 10275 |
| 183 | Ga0075436_100012782 | 3300006914 | Bacteria | 5756 |
| 184 | Ga0097620_100021262 | 3300006931 | Bacteria | 6511 |
| 185 | Ga0097620_100057357 | 3300006931 | Bacteria | 3922 |
| 186 | Ga0075435_100016479 | 3300007076 | Bacteria | 5573 |
| 187 | Ga0075435_100125914 | 3300007076 | Bacteria | 2141 |
| 188 | Ga0105250_10002835 | 3300009092 | Bacteria | 8495 |
| 189 | Ga0105250_10005265 | 3300009092 | Bacteria | 5816 |
| 190 | Ga0105240_10000305 | 3300009093 | Bacteria | 94979 |
| 191 | Ga0105240_10010558 | 3300009093 | Bacteria | 12971 |
| 192 | Ga0105240_10019011 | 3300009093 | Bacteria | 9198 |
| 193 | Ga0105240_10041126 | 3300009093 | Bacteria | 5903 |
| 194 | Ga0105240_10133888 | 3300009093 | Bacteria | 2969 |
| 195 | Ga0105245_10085797 | 3300009098 | Bacteria | 2886 |
| 196 | Ga0105247_10003856 | 3300009101 | Bacteria | 9704 |
| 197 | Ga0114129_10370390 | 3300009147 | Bacteria | 1893 |
| 198 | Ga0105241_10060054 | 3300009174 | Bacteria | 2924 |
| 199 | Ga0105248_10000059 | 3300009177 | Bacteria | 137176 |
| 200 | Ga0105248_10000071 | 3300009177 | Bacteria | 118281 |
| 201 | Ga0105248_10000438 | 3300009177 | Bacteria | 47263 |
| 202 | Ga0105248_10045112 | 3300009177 | Bacteria | 4943 |
| 203 | Ga0105248_10090660 | 3300009177 | Bacteria | 3442 |
| 204 | Ga0105237_10003515 | 3300009545 | Bacteria | 18584 |
| 205 | Ga0105237_10074969 | 3300009545 | Bacteria | 3375 |
| 206 | Ga0105238_10011427 | 3300009551 | Bacteria | 8942 |
| 207 | Ga0105238_10014487 | 3300009551 | Bacteria | 7973 |
| 208 | Ga0105238_10027868 | 3300009551 | Bacteria | 5757 |
| 209 | Ga0105238_10028949 | 3300009551 | Bacteria | 5642 |
| 210 | Ga0105238_10029957 | 3300009551 | Bacteria | 5541 |
| 211 | Ga0105238_10049267 | 3300009551 | Bacteria | 4243 |
| 212 | Ga0105249_10000105 | 3300009553 | Bacteria | 117181 |
| 213 | Ga0105249_10009441 | 3300009553 | Bacteria | 8541 |
| 214 | Ga0105249_10011902 | 3300009553 | Bacteria | 7652 |
| 215 | Ga0105249_10046170 | 3300009553 | Bacteria | 3964 |
| 216 | Ga0105239_10000037 | 3300010375 | Bacteria | 206779 |
| 217 | Ga0105239_10107230 | 3300010375 | Bacteria | 3095 |
| 218 | Ga0105246_10017989 | 3300011119 | Bacteria | 4500 |
| 219 | Ga0157373_10019439 | 3300013100 | Bacteria | 4943 |
| 220 | Ga0157373_10030864 | 3300013100 | Bacteria | 3856 |
| 221 | Ga0157373_10060215 | 3300013100 | Bacteria | 2690 |
| 222 | Ga0157370_10018896 | 3300013104 | Bacteria | 6930 |
| 223 | Ga0157370_10028965 | 3300013104 | Bacteria | 5441 |
| 224 | Ga0157370_10037299 | 3300013104 | Bacteria | 4712 |
| 225 | Ga0157370_10046511 | 3300013104 | Bacteria | 4161 |
| 226 | Ga0157370_10064818 | 3300013104 | Bacteria | 3458 |
| 227 | Ga0157370_10214112 | 3300013104 | Bacteria | 1785 |
| 228 | Ga0157369_10066871 | 3300013105 | Bacteria | 3866 |
| 229 | Ga0157369_10088770 | 3300013105 | Bacteria | 3300 |
| 230 | Ga0157369_10149285 | 3300013105 | Bacteria | 2471 |
| 231 | Ga0163162_10090862 | 3300013306 | Bacteria | 3135 |
| 232 | Ga0157372_10013006 | 3300013307 | Bacteria | 8879 |
| 233 | Ga0157372_10029019 | 3300013307 | Bacteria | 6036 |
| 234 | Ga0157372_10202608 | 3300013307 | Bacteria | 2299 |
| 235 | Ga0157375_10171314 | 3300013308 | Bacteria | 2319 |
| 236 | Ga0183365_10002 | 3300015684 | Bacteria | 545891 |
| 237 | Ga0163161_10060355 | 3300017792 | Bacteria | 2760 |
| 238 | Ga0213873_10001565 | 3300021358 | Bacteria | 3823 |
| 239 | Ga0213872_10001454 | 3300021361 | Bacteria | 15422 |
| 240 | Ga0213872_10005154 | 3300021361 | Bacteria | 6770 |
| 241 | Ga0213874_10025668 | 3300021377 | Bacteria | 1664 |
| 242 | Ga0213876_10000544 | 3300021384 | Bacteria | 28326 |
| 243 | Ga0213876_10000716 | 3300021384 | Bacteria | 23196 |
| 244 | Ga0213876_10003346 | 3300021384 | Bacteria | 9180 |
| 245 | Ga0213875_10016246 | 3300021388 | Bacteria | 3611 |
| 246 | Ga0213871_10006931 | 3300021441 | Bacteria | 2424 |
| 247 | Ga0209566_100542 | 3300025225 | Bacteria | 25524 |
| 248 | Ga0209674_101649 | 3300025226 | Bacteria | 5579 |
| 249 | Ga0209148_1000465 | 3300025254 | Bacteria | 43292 |
| 250 | Ga0209759_1000057 | 3300025256 | Bacteria | 205181 |
| 251 | Ga0209565_1000332 | 3300025263 | Bacteria | 42136 |
| 252 | Ga0209676_1000327 | 3300025292 | Bacteria | 91596 |
| 253 | Ga0209676_1000409 | 3300025292 | Bacteria | 77127 |
| 254 | Ga0209758_1002592 | 3300025297 | Bacteria | 18133 |
| 255 | Ga0209758_1005274 | 3300025297 | Bacteria | 10105 |
| 256 | Ga0209050_1000101 | 3300025298 | Bacteria | 230076 |
| 257 | Ga0209050_1000217 | 3300025298 | Bacteria | 128833 |
| 258 | Ga0209050_1004277 | 3300025298 | Bacteria | 9792 |
| 259 | Ga0209050_1005272 | 3300025298 | Bacteria | 8226 |
| 260 | Ga0209050_1013083 | 3300025298 | Bacteria | 3731 |
| 261 | Ga0209256_1002189 | 3300025299 | Bacteria | 16751 |
| 262 | Ga0209256_1003655 | 3300025299 | Bacteria | 10519 |
| 263 | Ga0209257_1000178 | 3300025304 | Bacteria | 160969 |
| 264 | Ga0209257_1000220 | 3300025304 | Bacteria | 135116 |
| 265 | Ga0209257_1000386 | 3300025304 | Bacteria | 88085 |
| 266 | Ga0209257_1005253 | 3300025304 | Bacteria | 9242 |
| 267 | Ga0209257_1005921 | 3300025304 | Bacteria | 8228 |
| 268 | Ga0209257_1009127 | 3300025304 | Bacteria | 5409 |
| 269 | Ga0207682_10000833 | 3300025893 | Bacteria | 14256 |
| 270 | Ga0207710_10004304 | 3300025900 | Bacteria | 6232 |
| 271 | Ga0207647_10001078 | 3300025904 | Bacteria | 21029 |
| 272 | Ga0207647_10007591 | 3300025904 | Bacteria | 7815 |
| 273 | Ga0207647_10027206 | 3300025904 | Bacteria | 3731 |
| 274 | Ga0207645_10006878 | 3300025907 | Bacteria | 8111 |
| 275 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 276 | Ga0207705_10001414 | 3300025909 | Bacteria | 19120 |
| 277 | Ga0207705_10005634 | 3300025909 | Bacteria | 9354 |
| 278 | Ga0207705_10007304 | 3300025909 | Bacteria | 8125 |
| 279 | Ga0207705_10019624 | 3300025909 | Bacteria | 4833 |
| 280 | Ga0207705_10041040 | 3300025909 | Bacteria | 3319 |
| 281 | Ga0207705_10067491 | 3300025909 | Bacteria | 2588 |
| 282 | Ga0207707_10001296 | 3300025912 | Bacteria | 23280 |
| 283 | Ga0207707_10034921 | 3300025912 | Bacteria | 4398 |
| 284 | Ga0207707_10054709 | 3300025912 | Bacteria | 3474 |
| 285 | Ga0207695_10000718 | 3300025913 | Bacteria | 64451 |
| 286 | Ga0207695_10001017 | 3300025913 | Bacteria | 49429 |
| 287 | Ga0207695_10001195 | 3300025913 | Bacteria | 44633 |
| 288 | Ga0207695_10003313 | 3300025913 | Bacteria | 22832 |
| 289 | Ga0207695_10007252 | 3300025913 | Bacteria | 14157 |
| 290 | Ga0207695_10014240 | 3300025913 | Bacteria | 9433 |
| 291 | Ga0207695_10040465 | 3300025913 | Bacteria | 4996 |
| 292 | Ga0207671_10007045 | 3300025914 | Bacteria | 9848 |
| 293 | Ga0207660_10003153 | 3300025917 | Bacteria | 10795 |
| 294 | Ga0207660_10008412 | 3300025917 | Bacteria | 6676 |
| 295 | Ga0207657_10001137 | 3300025919 | Bacteria | 28234 |
| 296 | Ga0207657_10001303 | 3300025919 | Bacteria | 26487 |
| 297 | Ga0207657_10001904 | 3300025919 | Bacteria | 22544 |
| 298 | Ga0207657_10008828 | 3300025919 | Bacteria | 10195 |
| 299 | Ga0207657_10024687 | 3300025919 | Bacteria | 5558 |
| 300 | Ga0207657_10042588 | 3300025919 | Bacteria | 4004 |
| 301 | Ga0207649_10021111 | 3300025920 | Bacteria | 3743 |
| 302 | Ga0207652_10003865 | 3300025921 | Bacteria | 12269 |
| 303 | Ga0207652_10020568 | 3300025921 | Bacteria | 5438 |
| 304 | Ga0207652_10047102 | 3300025921 | Bacteria | 3682 |
| 305 | Ga0207652_10052024 | 3300025921 | Bacteria | 3514 |
| 306 | Ga0207681_10000448 | 3300025923 | Bacteria | 28899 |
| 307 | Ga0207694_10008152 | 3300025924 | Bacteria | 7917 |
| 308 | Ga0207694_10011507 | 3300025924 | Bacteria | 6678 |
| 309 | Ga0207694_10022405 | 3300025924 | Bacteria | 4791 |
| 310 | Ga0207694_10042460 | 3300025924 | Bacteria | 3508 |
| 311 | Ga0207694_10056099 | 3300025924 | Bacteria | 3059 |
| 312 | Ga0207694_10078125 | 3300025924 | Bacteria | 2594 |
| 313 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 314 | Ga0207659_10106133 | 3300025926 | Bacteria | 2126 |
| 315 | Ga0207687_10027427 | 3300025927 | Bacteria | 3821 |
| 316 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 317 | Ga0207644_10000602 | 3300025931 | Bacteria | 22923 |
| 318 | Ga0207644_10006348 | 3300025931 | Bacteria | 7698 |
| 319 | Ga0207644_10021731 | 3300025931 | Bacteria | 4375 |
| 320 | Ga0207644_10022690 | 3300025931 | Bacteria | 4290 |
| 321 | Ga0207690_10000051 | 3300025932 | Bacteria | 107367 |
| 322 | Ga0207690_10000053 | 3300025932 | Bacteria | 105125 |
| 323 | Ga0207690_10003079 | 3300025932 | Bacteria | 10047 |
| 324 | Ga0207690_10005435 | 3300025932 | Bacteria | 7507 |
| 325 | Ga0207690_10008542 | 3300025932 | Bacteria | 6078 |
| 326 | Ga0207706_10046633 | 3300025933 | Bacteria | 3837 |
| 327 | Ga0207706_10123176 | 3300025933 | Bacteria | 2281 |
| 328 | Ga0207670_10038590 | 3300025936 | Bacteria | 3121 |
| 329 | Ga0207711_10001604 | 3300025941 | Bacteria | 20913 |
| 330 | Ga0207711_10016191 | 3300025941 | Bacteria | 6190 |
| 331 | Ga0207679_10005151 | 3300025945 | Bacteria | 8185 |
| 332 | Ga0207667_10007334 | 3300025949 | Bacteria | 13274 |
| 333 | Ga0207667_10008988 | 3300025949 | Bacteria | 11821 |
| 334 | Ga0207667_10043233 | 3300025949 | Bacteria | 4782 |
| 335 | Ga0207667_10092888 | 3300025949 | Bacteria | 3116 |
| 336 | Ga0207667_10107443 | 3300025949 | Bacteria | 2879 |
| 337 | Ga0207667_10151876 | 3300025949 | Bacteria | 2383 |
| 338 | Ga0207667_10198713 | 3300025949 | Bacteria | 2057 |
| 339 | Ga0207651_10017670 | 3300025960 | Bacteria | 4220 |
| 340 | Ga0207712_10000015 | 3300025961 | Bacteria | 346689 |
| 341 | Ga0207712_10003975 | 3300025961 | Bacteria | 9334 |
| 342 | Ga0207712_10017866 | 3300025961 | Bacteria | 4614 |
| 343 | Ga0207712_10018228 | 3300025961 | Bacteria | 4569 |
| 344 | Ga0207712_10030942 | 3300025961 | Bacteria | 3602 |
| 345 | Ga0207668_10000342 | 3300025972 | Bacteria | 30270 |
| 346 | Ga0207668_10001123 | 3300025972 | Bacteria | 15955 |
| 347 | Ga0207668_10003651 | 3300025972 | Bacteria | 9043 |
| 348 | Ga0207668_10066068 | 3300025972 | Bacteria | 2562 |
| 349 | Ga0207640_10000535 | 3300025981 | Bacteria | 22763 |
| 350 | Ga0207640_10021214 | 3300025981 | Bacteria | 3868 |
| 351 | Ga0207640_10043541 | 3300025981 | Bacteria | 2870 |
| 352 | Ga0207658_10000218 | 3300025986 | Bacteria | 60270 |
| 353 | Ga0207658_10001134 | 3300025986 | Bacteria | 21429 |
| 354 | Ga0207658_10023073 | 3300025986 | Bacteria | 4338 |
| 355 | Ga0207658_10033721 | 3300025986 | Bacteria | 3653 |
| 356 | Ga0207677_10000013 | 3300026023 | Bacteria | 186519 |
| 357 | Ga0207677_10004145 | 3300026023 | Bacteria | 7757 |
| 358 | Ga0207677_10107112 | 3300026023 | Bacteria | 2072 |
| 359 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 360 | Ga0207703_10002707 | 3300026035 | Bacteria | 15178 |
| 361 | Ga0207703_10005677 | 3300026035 | Bacteria | 10017 |
| 362 | Ga0207639_10000260 | 3300026041 | Bacteria | 38302 |
| 363 | Ga0207639_10031700 | 3300026041 | Bacteria | 3886 |
| 364 | Ga0207639_10042224 | 3300026041 | Bacteria | 3416 |
| 365 | Ga0207678_10000104 | 3300026067 | Bacteria | 69027 |
| 366 | Ga0207678_10000716 | 3300026067 | Bacteria | 30304 |
| 367 | Ga0207678_10051842 | 3300026067 | Bacteria | 3541 |
| 368 | Ga0207702_10015322 | 3300026078 | Bacteria | 6355 |
| 369 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 370 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 371 | Ga0207641_10005823 | 3300026088 | Bacteria | 10457 |
| 372 | Ga0207641_10021395 | 3300026088 | Bacteria | 5315 |
| 373 | Ga0207641_10052619 | 3300026088 | Bacteria | 3449 |
| 374 | Ga0207676_10000179 | 3300026095 | Bacteria | 55697 |
| 375 | Ga0207676_10000437 | 3300026095 | Bacteria | 35190 |
| 376 | Ga0207676_10045215 | 3300026095 | Bacteria | 3401 |
| 377 | Ga0207674_10003125 | 3300026116 | Bacteria | 20421 |
| 378 | Ga0207674_10024869 | 3300026116 | Bacteria | 6391 |
| 379 | Ga0207675_100025874 | 3300026118 | Bacteria | 5459 |
| 380 | Ga0207675_100079812 | 3300026118 | Bacteria | 3067 |
| 381 | Ga0207675_100094527 | 3300026118 | Bacteria | 2812 |
| 382 | Ga0207675_100137525 | 3300026118 | Bacteria | 2319 |
| 383 | Ga0207683_10184130 | 3300026121 | Bacteria | 1894 |
| 384 | Ga0207698_10000193 | 3300026142 | Bacteria | 38052 |
| 385 | Ga0207698_10003399 | 3300026142 | Bacteria | 9579 |
| 386 | Ga0207698_10003964 | 3300026142 | Bacteria | 8973 |
| 387 | Ga0207698_10010338 | 3300026142 | Bacteria | 5987 |
| 388 | Ga0207698_10046164 | 3300026142 | Bacteria | 3287 |
| 389 | Ga0209389_1000117 | 3300027296 | Bacteria | 71506 |
| 390 | Ga0209489_109135 | 3300027361 | Bacteria | 12644 |
| 391 | Ga0209700_100021 | 3300027363 | Bacteria | 230859 |
| 392 | Ga0209813_10000053 | 3300027866 | Bacteria | 47000 |
| 393 | Ga0209813_10000873 | 3300027866 | Bacteria | 6787 |
| 394 | Ga0209813_10002965 | 3300027866 | Bacteria | 3931 |
| 395 | Ga0207428_10035873 | 3300027907 | Bacteria | 4050 |
| 396 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 397 | Ga0268266_10001119 | 3300028379 | Bacteria | 33470 |
| 398 | Ga0268266_10003430 | 3300028379 | Bacteria | 15845 |
| 399 | Ga0268266_10008959 | 3300028379 | Bacteria | 8858 |
| 400 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 401 | Ga0268265_10000600 | 3300028380 | Bacteria | 36213 |
| 402 | Ga0268265_10045113 | 3300028380 | Bacteria | 3287 |
| 403 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 404 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 405 | Ga0268264_10000330 | 3300028381 | Bacteria | 74311 |
| 406 | Ga0268264_10032863 | 3300028381 | Bacteria | 4258 |
| 407 | Ga0268264_10046476 | 3300028381 | Bacteria | 3605 |
| 408 | Ga0268264_10098912 | 3300028381 | Bacteria | 2531 |
| 409 | Ga0265337_1001337 | 3300028556 | Bacteria | 12227 |
| 410 | Ga0265334_10001279 | 3300028573 | Bacteria | 12182 |
| 411 | Ga0307517_10006007 | 3300028786 | Bacteria | 18094 |
| 412 | Ga0307515_10101092 | 3300028794 | Bacteria | 3484 |
| 413 | Ga0265338_10033178 | 3300028800 | Bacteria | 5016 |
| 414 | Ga0265338_10038295 | 3300028800 | Bacteria | 4546 |
| 415 | Ga0265338_10095129 | 3300028800 | Bacteria | 2448 |
| 416 | Ga0307511_10053071 | 3300030521 | Bacteria | 3219 |
| 417 | Ga0265330_10006479 | 3300031235 | Bacteria | 5788 |
| 418 | Ga0265330_10046044 | 3300031235 | Bacteria | 1922 |
| 419 | Ga0265330_10064138 | 3300031235 | Bacteria | 1596 |
| 420 | Ga0265332_10000016 | 3300031238 | Bacteria | 229887 |
| 421 | Ga0265329_10006065 | 3300031242 | Bacteria | 4827 |
| 422 | Ga0265340_10031218 | 3300031247 | Bacteria | 2665 |
| 423 | Ga0265339_10034446 | 3300031249 | Bacteria | 2845 |
| 424 | Ga0265339_10069712 | 3300031249 | Bacteria | 1876 |
| 425 | Ga0265331_10000695 | 3300031250 | Bacteria | 28793 |
| 426 | Ga0265331_10008614 | 3300031250 | Bacteria | 5788 |
| 427 | Ga0265331_10010985 | 3300031250 | Bacteria | 4972 |
| 428 | Ga0265331_10011789 | 3300031250 | Bacteria | 4771 |
| 429 | Ga0265327_10000588 | 3300031251 | Bacteria | 61029 |
| 430 | Ga0265327_10000602 | 3300031251 | Bacteria | 59632 |
| 431 | Ga0265327_10002222 | 3300031251 | Bacteria | 21132 |
| 432 | Ga0265327_10004643 | 3300031251 | Bacteria | 12048 |
| 433 | Ga0265327_10019344 | 3300031251 | Bacteria | 4190 |
| 434 | Ga0265327_10041024 | 3300031251 | Bacteria | 2498 |
| 435 | Ga0265327_10062793 | 3300031251 | Bacteria | 1889 |
| 436 | Ga0265316_10000169 | 3300031344 | Bacteria | 73902 |
| 437 | Ga0307513_10000261 | 3300031456 | Bacteria | 76045 |
| 438 | Ga0307513_10004825 | 3300031456 | Bacteria | 17901 |
| 439 | Ga0307513_10014216 | 3300031456 | Bacteria | 9734 |
| 440 | Ga0307513_10021686 | 3300031456 | Bacteria | 7577 |
| 441 | Ga0307408_100025242 | 3300031548 | Bacteria | 4069 |
| 442 | Ga0316575_10000032 | 3300031665 | Bacteria | 33845 |
| 443 | Ga0265342_10088293 | 3300031712 | Bacteria | 1781 |
| 444 | Ga0316576_10016359 | 3300031727 | Bacteria | 5006 |
| 445 | Ga0316578_10017916 | 3300031728 | Bacteria | 3867 |
| 446 | Ga0307516_10000352 | 3300031730 | Bacteria | 59644 |
| 447 | Ga0307405_10026182 | 3300031731 | Bacteria | 3362 |
| 448 | Ga0307413_10019680 | 3300031824 | Bacteria | 3573 |
| 449 | Ga0307413_10044707 | 3300031824 | Bacteria | 2620 |
| 450 | Ga0307410_10000957 | 3300031852 | Bacteria | 12384 |
| 451 | Ga0307406_10002549 | 3300031901 | Bacteria | 9931 |
| 452 | Ga0307406_10031861 | 3300031901 | Bacteria | 3213 |
| 453 | Ga0307412_10148330 | 3300031911 | Bacteria | 1727 |
| 454 | Ga0307409_100030371 | 3300031995 | Bacteria | 3881 |
| 455 | Ga0307409_100145419 | 3300031995 | Bacteria | 2049 |
| 456 | Ga0307416_100034538 | 3300032002 | Bacteria | 3849 |
| 457 | Ga0307414_10040568 | 3300032004 | Bacteria | 3146 |
| 458 | Ga0307414_10061493 | 3300032004 | Bacteria | 2660 |
| 459 | Ga0307411_10001513 | 3300032005 | Bacteria | 9568 |
| 460 | Ga0307411_10007647 | 3300032005 | Bacteria | 5527 |
| 461 | Ga0307415_100013094 | 3300032126 | Bacteria | 4826 |
| 462 | Ga0316583_10028121 | 3300032133 | Bacteria | 2005 |
| 463 | Ga0316593_10000364 | 3300032168 | Bacteria | 7995 |
| 464 | Ga0373953_0009093 | 3300035117 | Bacteria | 3399 |
| 465 | Ga0373946_0015362 | 3300035171 | Bacteria | 2902 |
| 466 | Ga0373955_0001026 | 3300035172 | Bacteria | 11850 |
| 467 | Ga0373961_0003522 | 3300035241 | Bacteria | 3865 |
| 468 | Ga0316574_0000274 | 3300035398 | Bacteria | 19146 |
| 469 | Ga0373931_0053499 | 3300035691 | Bacteria | 2154 |
| 470 | Ga0373935_0046449 | 3300035692 | Bacteria | 2743 |
| 471 | Ga0373927_0103826 | 3300035695 | Bacteria | 1850 |
| 472 | Ga0373933_0024125 | 3300035724 | Bacteria | 3481 |
| 473 | Ga0373937_0002849 | 3300036401 | Bacteria | 14447 |
| 474 | Ga0316584_0029523 | 3300036712 | Bacteria | 4048 |
| 475 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 476 | Ga0395899_0000013 | 3300037312 | Bacteria | 510397 |
| 477 | Ga0395899_0000151 | 3300037312 | Bacteria | 105368 |
| 478 | Ga0395899_0000167 | 3300037312 | Bacteria | 100973 |
| 479 | Ga0395899_0000804 | 3300037312 | Bacteria | 30745 |
| 480 | Ga0395899_0000885 | 3300037312 | Bacteria | 28458 |
| 481 | Ga0395899_0009300 | 3300037312 | Bacteria | 7546 |
| 482 | Ga0395899_0012431 | 3300037312 | Bacteria | 6522 |
| 483 | Ga0395899_0022192 | 3300037312 | Bacteria | 4813 |
| 484 | Ga0395899_0086958 | 3300037312 | Bacteria | 2269 |
| 485 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 486 | Ga0395900_0000020 | 3300037418 | Bacteria | 353500 |
| 487 | Ga0395900_0000031 | 3300037418 | Bacteria | 262393 |
| 488 | Ga0395900_0001255 | 3300037418 | Bacteria | 31098 |
| 489 | Ga0395900_0002764 | 3300037418 | Bacteria | 19179 |
| 490 | Ga0395900_0029097 | 3300037418 | Bacteria | 5666 |
| 491 | Ga0395900_0059667 | 3300037418 | Bacteria | 3927 |
| 492 | Ga0395900_0121552 | 3300037418 | Bacteria | 2679 |
| 493 | Ga0395900_0147150 | 3300037418 | Bacteria | 2408 |
| 494 | Ga0395900_0191156 | 3300037418 | Bacteria | 2076 |
| 495 | Ga0395898_0000104 | 3300037466 | Bacteria | 223462 |
| 496 | Ga0395898_0006464 | 3300037466 | Bacteria | 12517 |
| 497 | Ga0395898_0018445 | 3300037466 | Bacteria | 7115 |
| 498 | Ga0395898_0027194 | 3300037466 | Bacteria | 5745 |
| 499 | Ga0395898_0032773 | 3300037466 | Bacteria | 5188 |
| 500 | Ga0395898_0049253 | 3300037466 | Bacteria | 4128 |
| 501 | Ga0395905_0000019 | 3300037471 | Bacteria | 353500 |
| 502 | Ga0395905_0000271 | 3300037471 | Bacteria | 77040 |
| 503 | Ga0395905_0000458 | 3300037471 | Bacteria | 57029 |
| 504 | Ga0395905_0001765 | 3300037471 | Bacteria | 25140 |
| 505 | Ga0395905_0007899 | 3300037471 | Bacteria | 10523 |
| 506 | Ga0395905_0073033 | 3300037471 | Bacteria | 3215 |
| 507 | Ga0395905_0105913 | 3300037471 | Bacteria | 2640 |
| 508 | Ga0395905_0184082 | 3300037471 | Bacteria | 1961 |
| 509 | Ga0436364_0238815 | 3300037853 | Bacteria | 8510 |
| 510 | Ga0436364_0414769 | 3300037853 | Bacteria | 4611 |
| 511 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 512 | Ga0395901_0000016 | 3300038443 | Bacteria | 354008 |
| 513 | Ga0395901_0000035 | 3300038443 | Bacteria | 223888 |
| 514 | Ga0395901_0001264 | 3300038443 | Bacteria | 26810 |
| 515 | Ga0395901_0006984 | 3300038443 | Bacteria | 11409 |
| 516 | Ga0395901_0008542 | 3300038443 | Bacteria | 10349 |
| 517 | Ga0395901_0043872 | 3300038443 | Bacteria | 4638 |
| 518 | Ga0395901_0147294 | 3300038443 | Bacteria | 2474 |
| 519 | Ga0395901_0217321 | 3300038443 | Bacteria | 1998 |
| 520 | Ga0395901_0220860 | 3300038443 | Bacteria | 1981 |
| 521 | Ga0400485_03094 | 3300038735 | Bacteria | 3386 |
| 522 | Ga0400483_135188 | 3300039062 | Bacteria | 2125 |
| 523 | Ga0400483_198091 | 3300039062 | Bacteria | 2110 |
| 524 | Ga0436365_0400394 | 3300039437 | Bacteria | 25450 |
| 525 | Ga0436365_0835883 | 3300039437 | Bacteria | 3507 |
| 526 | Ga0436365_0886091 | 3300039437 | Bacteria | 43353 |
| 527 | Ga0436360_0197367 | 3300039438 | Bacteria | 2151 |
| 528 | Ga0436361_0496775 | 3300039447 | Bacteria | 11116 |
| 529 | Ga0436361_0917304 | 3300039447 | Bacteria | 39295 |
| 530 | Ga0436363_0609059 | 3300039450 | Bacteria | 20913 |
| 531 | Ga0436363_1027775 | 3300039450 | Bacteria | 2521 |
| 532 | Ga0436363_1720929 | 3300039450 | Bacteria | 8555 |
| 533 | Ga0436362_0516986 | 3300039453 | Bacteria | 11871 |
| 534 | Ga0439446_0015224 | 3300042156 | Bacteria | 2132 |
| 535 | Ga0439460_0012638 | 3300042461 | Bacteria | 2195 |
| 536 | Ga0450901_002064 | 3300042533 | Bacteria | 2221 |
| 537 | Ga0466969_0000193 | 3300044656 | Bacteria | 32883 |
| 538 | Ga0466966_0000688 | 3300044684 | Bacteria | 21491 |
| 539 | Ga0466966_0031712 | 3300044684 | Bacteria | 3427 |
| 540 | Ga0466966_0076533 | 3300044684 | Bacteria | 2089 |
| 541 | Ga0466961_0003224 | 3300044693 | Bacteria | 10143 |
| 542 | Ga0466963_0001435 | 3300044694 | Bacteria | 12837 |
| 543 | Ga0466963_0043037 | 3300044694 | Bacteria | 2967 |
| 544 | Ga0466963_0100827 | 3300044694 | Bacteria | 1976 |
| 545 | Ga0466963_0128588 | 3300044694 | Bacteria | 1748 |
| 546 | Ga0466971_0002179 | 3300044719 | Bacteria | 8282 |
| 547 | Ga0466970_0065108 | 3300044765 | Bacteria | 1955 |
| 548 | Ga0466957_0002794 | 3300044842 | Bacteria | 9442 |
| 549 | Ga0466959_0000118 | 3300045049 | Bacteria | 51145 |
| 550 | Ga0451576_0000034 | 3300045051 | Bacteria | 390778 |
| 551 | Ga0451576_0059690 | 3300045051 | Bacteria | 3981 |
| 552 | Ga0466958_0000398 | 3300045836 | Bacteria | 17799 |
| 553 | Ga0466958_0036198 | 3300045836 | Bacteria | 2953 |
| 554 | Ga0495627_001043 | 3300046453 | Bacteria | 18449 |
| 555 | Ga0495590_0019068 | 3300046457 | Bacteria | 2448 |
| 556 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 557 | Ga0495584_0015466 | 3300046491 | Bacteria | 3888 |
| 558 | Ga0495585_0077303 | 3300046492 | Bacteria | 1807 |
| 559 | Ga0495596_0000288 | 3300046500 | Bacteria | 33511 |
| 560 | Ga0495583_0000020 | 3300046506 | Bacteria | 296185 |
| 561 | Ga0495583_0000426 | 3300046506 | Bacteria | 63627 |
| 562 | Ga0495606_0023713 | 3300046507 | Bacteria | 4438 |
| 563 | Ga0495610_0000030 | 3300046512 | Bacteria | 265950 |
| 564 | Ga0495610_0000908 | 3300046512 | Bacteria | 27545 |
| 565 | Ga0495610_0007741 | 3300046512 | Bacteria | 7091 |
| 566 | Ga0495616_0001591 | 3300046513 | Bacteria | 15584 |
| 567 | Ga0495620_0017326 | 3300046515 | Bacteria | 3594 |
| 568 | Ga0495632_0060259 | 3300046519 | Bacteria | 1844 |
| 569 | Ga0495637_0002075 | 3300046520 | Bacteria | 11270 |
| 570 | Ga0495648_0000948 | 3300046524 | Bacteria | 30025 |
| 571 | Ga0495648_0003360 | 3300046524 | Bacteria | 14095 |
| 572 | Ga0495654_0000216 | 3300046530 | Bacteria | 54273 |
| 573 | Ga0495621_0014749 | 3300046539 | Bacteria | 2480 |
| 574 | Ga0495597_0047282 | 3300046542 | Bacteria | 1905 |
| 575 | Ga0495633_0002271 | 3300046558 | Bacteria | 13754 |
| 576 | Ga0495668_0000092 | 3300046616 | Bacteria | 142835 |
| 577 | Ga0495668_0006535 | 3300046616 | Bacteria | 7617 |
| 578 | Ga0495668_0015161 | 3300046616 | Bacteria | 4506 |
| 579 | Ga0495668_0016490 | 3300046616 | Bacteria | 4293 |
| 580 | Ga0495669_0000003 | 3300046684 | Bacteria | 267741 |
| 581 | Ga0495669_0000234 | 3300046684 | Bacteria | 32800 |
| 582 | Ga0495649_0000345 | 3300046694 | Bacteria | 39827 |
| 583 | Ga0495672_0001561 | 3300047320 | Bacteria | 22420 |
| 584 | Ga0495677_0005616 | 3300047445 | Bacteria | 4754 |
| 585 | Ga0495679_005032 | 3300047446 | Bacteria | 5945 |
| 586 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 587 | Ga0495673_0000401 | 3300047469 | Bacteria | 50743 |
| 588 | Ga0495681_0000011 | 3300047470 | Bacteria | 201843 |
| 589 | Ga0495686_0003214 | 3300047472 | Bacteria | 14390 |
| 590 | Ga0495686_0011256 | 3300047472 | Bacteria | 6308 |
| 591 | Ga0496101_0034152 | 3300048904 | Bacteria | 3591 |
| 592 | Ga0496102_0062324 | 3300048905 | Bacteria | 3414 |
| 593 | Ga0496103_0008642 | 3300048906 | Bacteria | 6050 |
| 594 | Ga0496103_0103884 | 3300048906 | Bacteria | 1800 |
| 595 | Ga0496104_0009696 | 3300048907 | Bacteria | 8580 |
| 596 | Ga0496105_0006289 | 3300048908 | Bacteria | 9118 |
| 597 | Ga0496106_0002158 | 3300048909 | Bacteria | 14703 |
| 598 | Ga0496106_0002226 | 3300048909 | Bacteria | 14458 |
| 599 | Ga0496106_0005334 | 3300048909 | Bacteria | 9514 |
| 600 | Ga0496106_0179652 | 3300048909 | Bacteria | 1680 |
| 601 | Ga0496107_0001868 | 3300048910 | Bacteria | 13316 |
| 602 | Ga0496107_0060523 | 3300048910 | Bacteria | 2741 |
| 603 | Ga0496107_0084790 | 3300048910 | Bacteria | 2312 |
| 604 | Ga0496107_0131617 | 3300048910 | Bacteria | 1847 |
| 605 | Ga0496108_0002227 | 3300048911 | Bacteria | 15527 |
| 606 | Ga0496108_0034941 | 3300048911 | Bacteria | 4176 |
| 607 | Ga0496109_0002047 | 3300048912 | Bacteria | 16717 |
| 608 | Ga0496109_0023339 | 3300048912 | Bacteria | 5490 |
| 609 | Ga0496109_0060051 | 3300048912 | Bacteria | 3474 |
| 610 | Ga0496110_0026758 | 3300048913 | Bacteria | 4939 |
| 611 | Ga0496110_0097858 | 3300048913 | Bacteria | 2629 |
| 612 | Ga0496111_0008316 | 3300048914 | Bacteria | 6859 |
| 613 | Ga0496111_0014620 | 3300048914 | Bacteria | 5369 |
| 614 | Ga0496112_0003678 | 3300048915 | Bacteria | 12783 |
| 615 | Ga0496112_0025671 | 3300048915 | Bacteria | 5660 |
| 616 | Ga0496112_0036881 | 3300048915 | Bacteria | 4769 |
| 617 | Ga0496112_0045422 | 3300048915 | Bacteria | 4306 |
| 618 | Ga0496112_0068585 | 3300048915 | Bacteria | 3502 |
| 619 | Ga0496113_0001823 | 3300048916 | Bacteria | 12118 |
| 620 | Ga0496113_0001984 | 3300048916 | Bacteria | 11730 |
| 621 | Ga0496113_0076057 | 3300048916 | Bacteria | 2564 |
| 622 | Ga0496114_0007532 | 3300048917 | Bacteria | 8611 |
| 623 | Ga0496114_0024978 | 3300048917 | Bacteria | 4880 |
| 624 | Ga0496114_0094783 | 3300048917 | Bacteria | 2539 |
| 625 | Ga0496115_0000571 | 3300048918 | Bacteria | 28486 |
| 626 | Ga0496115_0000794 | 3300048918 | Bacteria | 23158 |
| 627 | Ga0496115_0001409 | 3300048918 | Bacteria | 17195 |
| 628 | Ga0496116_0000019 | 3300048919 | Bacteria | 533227 |
| 629 | Ga0496116_0000039 | 3300048919 | Bacteria | 349134 |
| 630 | Ga0496117_0054267 | 3300048920 | Bacteria | 2808 |
| 631 | Ga0496118_0020178 | 3300048921 | Bacteria | 5920 |
| 632 | Ga0496119_0003333 | 3300048922 | Bacteria | 16734 |
| 633 | Ga0496119_0011136 | 3300048922 | Bacteria | 7491 |
| 634 | Ga0496120_0036784 | 3300048923 | Bacteria | 2909 |
| 635 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 636 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 637 | Ga0496121_0000018 | 3300048924 | Bacteria | 542045 |
| 638 | Ga0496121_0001392 | 3300048924 | Bacteria | 40941 |
| 639 | Ga0496121_0004259 | 3300048924 | Bacteria | 19444 |
| 640 | Ga0496121_0030838 | 3300048924 | Bacteria | 4916 |
| 641 | Ga0496121_0035073 | 3300048924 | Bacteria | 4501 |
| 642 | Ga0496122_0015650 | 3300048925 | Bacteria | 7236 |
| 643 | Ga0496122_0066534 | 3300048925 | Bacteria | 2602 |
| 644 | Ga0496123_0003680 | 3300048926 | Bacteria | 16906 |
| 645 | Ga0496123_0005251 | 3300048926 | Bacteria | 13145 |
| 646 | Ga0496124_0002764 | 3300048927 | Bacteria | 22312 |
| 647 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 648 | Ga0496125_0000749 | 3300048928 | Bacteria | 53580 |
| 649 | Ga0496125_0002786 | 3300048928 | Bacteria | 22105 |
| 650 | Ga0496125_0007529 | 3300048928 | Bacteria | 11573 |
| 651 | Ga0496125_0078257 | 3300048928 | Bacteria | 2543 |
| 652 | Ga0496126_0000041 | 3300048929 | Bacteria | 340389 |
| 653 | Ga0496126_0001877 | 3300048929 | Bacteria | 30562 |
| 654 | Ga0496126_0071794 | 3300048929 | Bacteria | 3081 |
| 655 | Ga0495678_001720 | 3300049459 | Bacteria | 16374 |
| 656 | Ga0501031_0000019 | 3300049568 | Bacteria | 104793 |
| 657 | Ga0501032_0000009 | 3300049569 | Bacteria | 228107 |
| 658 | Ga0501032_0003255 | 3300049569 | Bacteria | 12491 |
| 659 | Ga0501033_0000019 | 3300049570 | Bacteria | 204699 |
| 660 | Ga0501033_0002053 | 3300049570 | Bacteria | 17511 |
| 661 | Ga0501033_0041719 | 3300049570 | Bacteria | 3423 |
| 662 | Ga0501033_0074012 | 3300049570 | Bacteria | 2501 |
| 663 | Ga0501034_0000044 | 3300049571 | Bacteria | 227982 |
| 664 | Ga0501034_0000176 | 3300049571 | Bacteria | 119228 |
| 665 | Ga0501034_0014235 | 3300049571 | Bacteria | 8199 |
| 666 | Ga0501034_0072566 | 3300049571 | Bacteria | 3451 |
| 667 | Ga0501034_0090118 | 3300049571 | Bacteria | 3065 |
| 668 | Ga0501034_0105144 | 3300049571 | Bacteria | 2816 |
| 669 | Ga0501034_0198704 | 3300049571 | Bacteria | 1964 |
| 670 | Ga0501036_0000008 | 3300049572 | Bacteria | 228106 |
| 671 | Ga0501036_0025756 | 3300049572 | Bacteria | 4964 |
| 672 | Ga0501036_0039031 | 3300049572 | Bacteria | 4021 |
| 673 | Ga0501036_0089461 | 3300049572 | Bacteria | 2601 |
| 674 | Ga0501037_0000055 | 3300049573 | Bacteria | 109790 |
| 675 | Ga0501038_0000006 | 3300049574 | Bacteria | 228107 |
| 676 | Ga0501038_0011223 | 3300049574 | Bacteria | 8179 |
| 677 | Ga0501038_0160191 | 3300049574 | Bacteria | 1829 |
| 678 | Ga0501038_0181333 | 3300049574 | Bacteria | 1699 |
| 679 | Ga0501039_0000014 | 3300049575 | Bacteria | 228107 |
| 680 | Ga0501039_0016254 | 3300049575 | Bacteria | 5700 |
| 681 | Ga0501039_0085206 | 3300049575 | Bacteria | 2462 |
| 682 | Ga0501040_0010441 | 3300049576 | Bacteria | 6073 |
| 683 | Ga0501040_0057621 | 3300049576 | Bacteria | 2668 |
| 684 | Ga0501041_0024027 | 3300049577 | Bacteria | 3657 |
| 685 | Ga0501041_0053334 | 3300049577 | Bacteria | 2466 |
| 686 | Ga0501042_0007634 | 3300049578 | Bacteria | 7095 |
| 687 | Ga0501042_0025516 | 3300049578 | Bacteria | 4151 |
| 688 | Ga0501043_0021029 | 3300049579 | Bacteria | 5116 |
| 689 | Ga0501043_0071258 | 3300049579 | Bacteria | 2730 |
| 690 | Ga0501046_0001115 | 3300049580 | Bacteria | 26209 |
| 691 | Ga0501046_0003242 | 3300049580 | Bacteria | 14954 |
| 692 | Ga0501047_0000290 | 3300049581 | Bacteria | 57649 |
| 693 | Ga0501047_0008388 | 3300049581 | Bacteria | 9752 |
| 694 | Ga0501047_0036257 | 3300049581 | Bacteria | 4766 |
| 695 | Ga0501047_0085685 | 3300049581 | Bacteria | 3027 |
| 696 | Ga0501047_0210013 | 3300049581 | Bacteria | 1805 |
| 697 | Ga0501048_0021203 | 3300049582 | Bacteria | 4757 |
| 698 | Ga0501048_0050050 | 3300049582 | Bacteria | 2976 |
| 699 | Ga0501048_0059997 | 3300049582 | Bacteria | 2695 |
| 700 | Ga0501067_0000905 | 3300049583 | Bacteria | 15942 |
| 701 | Ga0501067_0001682 | 3300049583 | Bacteria | 12159 |
| 702 | Ga0501070_0002529 | 3300049586 | Bacteria | 16034 |
| 703 | Ga0501070_0063518 | 3300049586 | Bacteria | 3058 |
| 704 | Ga0501070_0111973 | 3300049586 | Bacteria | 2256 |
| 705 | Ga0501071_0005547 | 3300049587 | Bacteria | 8126 |
| 706 | Ga0501071_0100061 | 3300049587 | Bacteria | 2136 |
| 707 | Ga0501072_0004184 | 3300049588 | Bacteria | 10934 |
| 708 | Ga0501073_0000018 | 3300049589 | Bacteria | 155244 |
| 709 | Ga0501073_0003442 | 3300049589 | Bacteria | 11879 |
| 710 | Ga0501074_0044326 | 3300049590 | Bacteria | 3220 |
| 711 | Ga0501074_0081192 | 3300049590 | Bacteria | 2325 |
| 712 | Ga0501075_0009175 | 3300049591 | Bacteria | 6914 |
| 713 | Ga0501075_0105082 | 3300049591 | Bacteria | 2146 |
| 714 | Ga0501076_0010765 | 3300049592 | Bacteria | 6799 |
| 715 | Ga0501076_0049755 | 3300049592 | Bacteria | 3315 |
| 716 | Ga0501077_0000026 | 3300049593 | Bacteria | 76023 |
| 717 | Ga0501077_0027418 | 3300049593 | Bacteria | 3617 |
| 718 | Ga0501257_000095 | 3300049686 | Bacteria | 21617 |
| 719 | Ga0501079_0004232 | 3300049741 | Bacteria | 10642 |
| 720 | Ga0501079_0017813 | 3300049741 | Bacteria | 5426 |
| 721 | Ga0501079_0056185 | 3300049741 | Bacteria | 3037 |
| 722 | Ga0501080_0000003 | 3300049742 | Bacteria | 214890 |
| 723 | Ga0501080_0001057 | 3300049742 | Bacteria | 22628 |
| 724 | Ga0501080_0005874 | 3300049742 | Bacteria | 10994 |
| 725 | Ga0501080_0045353 | 3300049742 | Bacteria | 4092 |
| 726 | Ga0501080_0050525 | 3300049742 | Bacteria | 3869 |
| 727 | Ga0501080_0061944 | 3300049742 | Bacteria | 3482 |
| 728 | Ga0501081_0008312 | 3300049743 | Bacteria | 6736 |
| 729 | Ga0501081_0009224 | 3300049743 | Bacteria | 6426 |
| 730 | Ga0501083_0021296 | 3300049744 | Bacteria | 4505 |
| 731 | Ga0501280_002283 | 3300049776 | Bacteria | 3247 |
| 732 | Ga0501035_0000096 | 3300049822 | Bacteria | 110635 |
| 733 | Ga0501035_0000384 | 3300049822 | Bacteria | 50737 |
| 734 | Ga0501035_0051742 | 3300049822 | Bacteria | 3676 |
| 735 | Ga0501035_0054473 | 3300049822 | Bacteria | 3574 |
| 736 | Ga0501035_0077431 | 3300049822 | Bacteria | 2939 |
| 737 | Ga0501035_0208548 | 3300049822 | Bacteria | 1673 |
| 738 | Ga0501044_0000017 | 3300049823 | Bacteria | 228107 |
| 739 | Ga0501044_0000570 | 3300049823 | Bacteria | 44794 |
| 740 | Ga0501044_0013529 | 3300049823 | Bacteria | 8821 |
| 741 | Ga0501044_0030476 | 3300049823 | Bacteria | 5685 |
| 742 | Ga0501044_0083632 | 3300049823 | Bacteria | 3227 |
| 743 | Ga0501045_0049169 | 3300049824 | Bacteria | 3074 |
| 744 | Ga0501045_0124006 | 3300049824 | Bacteria | 1918 |
| 745 | nmdc:mga03683_625_c1 | 3300050489 | Bacteria | 10155 |
| 746 | nmdc:mga03683_6_c1 | 3300050489 | Bacteria | 141493 |
| 747 | nmdc:mga03n38_114044_c1 | 3300050490 | Bacteria | 1320 |
| 748 | nmdc:mga03n38_61_c1 | 3300050490 | Bacteria | 22538 |
| 749 | nmdc:mga00v17_146_c1 | 3300050491 | Bacteria | 40788 |
| 750 | nmdc:mga00v17_322_c1 | 3300050491 | Bacteria | 27155 |
| 751 | nmdc:mga00v17_505_c1 | 3300050491 | Bacteria | 21902 |
| 752 | nmdc:mga00v17_934_c1 | 3300050491 | Bacteria | 15691 |
| 753 | nmdc:mga00v17_99467_c1 | 3300050491 | Bacteria | 1835 |
| 754 | nmdc:mga0yw44_57_c1 | 3300050492 | Bacteria | 40136 |
| 755 | nmdc:mga0k408_6_c1 | 3300050493 | Bacteria | 200443 |
| 756 | nmdc:mga06z11_105_c1 | 3300050494 | Bacteria | 34898 |
| 757 | nmdc:mga06z11_12375_c1 | 3300050494 | Bacteria | 3710 |
| 758 | nmdc:mga06z11_147_c1 | 3300050494 | Bacteria | 27767 |
| 759 | nmdc:mga06z11_52078_c1 | 3300050494 | Bacteria | 2098 |
| 760 | nmdc:mga04h51_24_c1 | 3300050495 | Bacteria | 59995 |
| 761 | nmdc:mga04h51_2624_c1 | 3300050495 | Bacteria | 4279 |
| 762 | nmdc:mga07m45_187_c2 | 3300050496 | Bacteria | 10171 |
| 763 | nmdc:mga07m45_32659_c1 | 3300050496 | Bacteria | 2886 |
| 764 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 765 | nmdc:mga07m45_4_c1 | 3300050496 | Bacteria | 409607 |
| 766 | nmdc:mga07m45_66_c1 | 3300050496 | Bacteria | 40757 |
| 767 | nmdc:mga09592_40497_c1 | 3300050508 | Bacteria | 3914 |
| 768 | nmdc:mga08y16_134810_c1 | 3300050511 | Bacteria | 2566 |
| 769 | nmdc:mga08y16_33263_c1 | 3300050511 | Bacteria | 5415 |
| 770 | nmdc:mga0n895_207881_c1 | 3300050512 | Bacteria | 1988 |
| 771 | nmdc:mga0rr50_39858_c1 | 3300050513 | Bacteria | 3410 |
| 772 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 773 | nmdc:mga0sz30_118_c1 | 3300050516 | Bacteria | 29758 |
| 774 | nmdc:mga0sz30_29578_c1 | 3300050516 | Bacteria | 2259 |
| 775 | nmdc:mga0sz30_44_c1 | 3300050516 | Bacteria | 44851 |
| 776 | Ga0500635_0000489 | 3300053080 | Bacteria | 11028 |
| 777 | Ga0500635_0001292 | 3300053080 | Bacteria | 5983 |
| 778 | Ga0500578_0000420 | 3300053086 | Bacteria | 51926 |
| 779 | Ga0500643_008792 | 3300053087 | Bacteria | 3926 |
| 780 | Ga0500643_009931 | 3300053087 | Bacteria | 3590 |
| 781 | Ga0500643_011734 | 3300053087 | Bacteria | 3177 |
| 782 | Ga0500643_022035 | 3300053087 | Bacteria | 2057 |
| 783 | Ga0500644_0000274 | 3300053088 | Bacteria | 28730 |
| 784 | Ga0500646_0007952 | 3300053090 | Bacteria | 2711 |
| 785 | Ga0500641_0000486 | 3300053096 | Bacteria | 14448 |
| 786 | Ga0500641_0010426 | 3300053096 | Bacteria | 3358 |
| 787 | Ga0500641_0010581 | 3300053096 | Bacteria | 3336 |
| 788 | Ga0500554_001836 | 3300053102 | Bacteria | 4100 |
| 789 | Ga0500556_0000587 | 3300053104 | Bacteria | 23997 |
| 790 | Ga0500556_0001909 | 3300053104 | Bacteria | 7444 |
| 791 | Ga0500557_000050 | 3300053105 | Bacteria | 54589 |
| 792 | Ga0500562_000021 | 3300053108 | Bacteria | 112425 |
| 793 | Ga0500562_000519 | 3300053108 | Bacteria | 9336 |
| 794 | Ga0500562_002122 | 3300053108 | Bacteria | 4955 |
| 795 | Ga0500593_000050 | 3300053117 | Bacteria | 42339 |
| 796 | Ga0500594_0003103 | 3300053118 | Bacteria | 3634 |
| 797 | Ga0500595_002565 | 3300053119 | Bacteria | 8893 |
| 798 | Ga0500595_007222 | 3300053119 | Bacteria | 4625 |
| 799 | Ga0500608_000080 | 3300053122 | Bacteria | 40873 |
| 800 | Ga0500608_000397 | 3300053122 | Bacteria | 16687 |
| 801 | Ga0500608_002327 | 3300053122 | Bacteria | 6895 |
| 802 | Ga0500618_000112 | 3300053125 | Bacteria | 65643 |
| 803 | Ga0500642_0000065 | 3300053130 | Bacteria | 57974 |
| 804 | Ga0500658_0001458 | 3300053134 | Bacteria | 9461 |
| 805 | Ga0500559_0000077 | 3300053136 | Bacteria | 76287 |
| 806 | Ga0500559_0000111 | 3300053136 | Bacteria | 64064 |
| 807 | Ga0500564_000021 | 3300053138 | Bacteria | 47765 |
| 808 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 809 | Ga0500588_0005049 | 3300053146 | Bacteria | 2903 |
| 810 | Ga0500590_021481 | 3300053148 | Bacteria | 3350 |
| 811 | Ga0500604_0000078 | 3300053151 | Bacteria | 34635 |
| 812 | Ga0500616_0018371 | 3300053153 | Bacteria | 3955 |
| 813 | Ga0500622_0000526 | 3300053156 | Bacteria | 35500 |
| 814 | Ga0500622_0007443 | 3300053156 | Bacteria | 6218 |
| 815 | Ga0500624_000001 | 3300053157 | Bacteria | 284974 |
| 816 | Ga0500624_000045 | 3300053157 | Bacteria | 89838 |
| 817 | Ga0500627_0009954 | 3300053158 | Bacteria | 3447 |
| 818 | Ga0500645_000353 | 3300053730 | Bacteria | 32638 |
| 819 | Ga0500645_000461 | 3300053730 | Bacteria | 27834 |
| 820 | Ga0500645_001891 | 3300053730 | Bacteria | 9997 |
| 821 | Ga0500645_002164 | 3300053730 | Bacteria | 9004 |
| 822 | Ga0500596_000572 | 3300053735 | Bacteria | 7020 |
| 823 | Ga0501084_0018508 | 3300054114 | Bacteria | 5798 |
| 824 | Ga0501084_0049834 | 3300054114 | Bacteria | 3505 |
| 825 | Ga0501084_0098628 | 3300054114 | Bacteria | 2453 |
| 826 | Ga0501082_0004153 | 3300060353 | Bacteria | 12655 |
| 827 | Ga0501082_0054287 | 3300060353 | Bacteria | 3453 |
| 828 | Ga0501082_0258071 | 3300060353 | Bacteria | 1516 |
| 829 | Ga0466962_0000345 | 3300061719 | Bacteria | 19915 |
| 830 | Ga0530510_0013704 | 3300061734 | Bacteria | 5706 |
| 831 | Ga0530510_0017724 | 3300061734 | Bacteria | 5046 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0121552 | Ga0395900_0121552_14_1291 | 408 |
| 2 | 3300035241 | Ga0373961_0003522 | Ga0373961_0003522_1583_3088 | 410 |
| 3 | 3300035172 | Ga0373955_0001026 | Ga0373955_0001026_12_1280 | 419 |
| 4 | 3300050490 | nmdc:mga03n38_114044_c1 | nmdc:mga03n38_114044_c1_29_1309 | 420 |
| 5 | 3300006042 | Ga0075368_10006977 | Ga0075368_100069772 | 434 |
| 6 | 3300006048 | Ga0075363_100000062 | Ga0075363_1000000622 | 434 |
| 7 | 3300006178 | Ga0075367_10000119 | Ga0075367_100001192 | 434 |
| 8 | 3300006186 | Ga0075369_10000060 | Ga0075369_100000605 | 434 |
| 9 | 3300006194 | Ga0075427_10000023 | Ga0075427_100000232 | 434 |
| 10 | 3300006353 | Ga0075370_10000066 | Ga0075370_1000006615 | 434 |
| 11 | 3300006880 | Ga0075429_100006297 | Ga0075429_1000062975 | 434 |
| 12 | 3300027866 | Ga0209813_10000873 | Ga0209813_100008735 | 434 |
| 13 | 3300050490 | nmdc:mga03n38_61_c1 | nmdc:mga03n38_61_c1_13684_15219 | 434 |
| 14 | 3300050491 | nmdc:mga00v17_146_c1 | nmdc:mga00v17_146_c1_20227_21762 | 434 |
| 15 | 3300050494 | nmdc:mga06z11_105_c1 | nmdc:mga06z11_105_c1_20404_21939 | 434 |
| 16 | 3300050495 | nmdc:mga04h51_2624_c1 | nmdc:mga04h51_2624_c1_1321_2856 | 434 |
| 17 | 3300050496 | nmdc:mga07m45_66_c1 | nmdc:mga07m45_66_c1_20205_21740 | 434 |
| 18 | 3300050508 | nmdc:mga09592_40497_c1 | nmdc:mga09592_40497_c1_2242_3777 | 434 |
| 19 | 3300050516 | nmdc:mga0sz30_118_c1 | nmdc:mga0sz30_118_c1_19101_20636 | 434 |
| 20 | 3300048910 | Ga0496107_0131617 | Ga0496107_0131617_354_1832 | 435 |
| 21 | 3300037312 | Ga0395899_0000167 | Ga0395899_0000167_54160_55644 | 448 |
| 22 | 3300037418 | Ga0395900_0000009 | Ga0395900_0000009_350734_352218 | 448 |
| 23 | 3300037466 | Ga0395898_0006464 | Ga0395898_0006464_9985_11469 | 448 |
| 24 | 3300038443 | Ga0395901_0000014 | Ga0395901_0000014_301940_303424 | 448 |
| 25 | iso_pu_bacteria | 8021120328 | 8021123174 | 449 |
| 26 | 3300048917 | Ga0496114_0024978 | Ga0496114_0024978_733_2223 | 455 |
| 27 | 3300021358 | Ga0213873_10001565 | Ga0213873_100015653 | 457 |
| 28 | 3300021441 | Ga0213871_10006931 | Ga0213871_100069312 | 457 |
| 29 | 3300039438 | Ga0436360_0197367 | Ga0436360_0197367_28_1554 | 457 |
| 30 | 3300050494 | nmdc:mga06z11_52078_c1 | nmdc:mga06z11_52078_c1_607_2079 | 459 |
| 31 | 3300006038 | Ga0075365_10000227 | Ga0075365_1000022717 | 461 |
| 32 | 3300006051 | Ga0075364_10001197 | Ga0075364_1000119714 | 461 |
| 33 | 3300050491 | nmdc:mga00v17_505_c1 | nmdc:mga00v17_505_c1_16985_18520 | 461 |
| 34 | 3300050492 | nmdc:mga0yw44_57_c1 | nmdc:mga0yw44_57_c1_17836_19371 | 461 |
| 35 | 3300050494 | nmdc:mga06z11_12375_c1 | nmdc:mga06z11_12375_c1_211_1746 | 461 |
| 36 | 3300005458 | Ga0070681_10227695 | Ga0070681_102276951 | 463 |
| 37 | iso_pu_bacteria | 2599185239 | 2599741020 | 464 |
| 38 | 3300005366 | Ga0070659_100067276 | Ga0070659_1000672762 | 465 |
| 39 | 3300028800 | Ga0265338_10033178 | Ga0265338_100331782 | 466 |
| 40 | 3300031251 | Ga0265327_10041024 | Ga0265327_100410241 | 466 |
| 41 | 3300049571 | Ga0501034_0105144 | Ga0501034_0105144_454_1989 | 466 |
| 42 | 3300002067 | JGI24735J21928_10001159 | JGI24735J21928_100011592 | 467 |
| 43 | 3300025225 | Ga0209566_100542 | Ga0209566_10054226 | 468 |
| 44 | 3300025226 | Ga0209674_101649 | Ga0209674_1016495 | 468 |
| 45 | 3300049571 | Ga0501034_0072566 | Ga0501034_0072566_1463_3007 | 468 |
| 46 | 3300049823 | Ga0501044_0083632 | Ga0501044_0083632_924_2468 | 468 |
| 47 | 3300053157 | Ga0500624_000001 | Ga0500624_000001_89007_90542 | 468 |
| 48 | 3300006852 | Ga0075433_10026622 | Ga0075433_100266224 | 469 |
| 49 | 3300006871 | Ga0075434_100122090 | Ga0075434_1001220902 | 469 |
| 50 | 3300037068 | Ga0373925_0000061 | Ga0373925_0000061_56129_57613 | 469 |
| 51 | 3300050512 | nmdc:mga0n895_207881_c1 | nmdc:mga0n895_207881_c1_432_1943 | 469 |
| 52 | 3300009551 | Ga0105238_10049267 | Ga0105238_100492673 | 470 |
| 53 | 3300025924 | Ga0207694_10042460 | Ga0207694_100424603 | 470 |
| 54 | 3300047320 | Ga0495672_0001561 | Ga0495672_0001561_18535_20064 | 470 |
| 55 | 3300053090 | Ga0500646_0007952 | Ga0500646_0007952_361_1848 | 470 |
| 56 | 3300048919 | Ga0496116_0000019 | Ga0496116_0000019_111057_112595 | 471 |
| 57 | 3300048920 | Ga0496117_0054267 | Ga0496117_0054267_580_2091 | 471 |
| 58 | 3300048923 | Ga0496120_0036784 | Ga0496120_0036784_175_1686 | 471 |
| 59 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_1047460_1048971 | 471 |
| 60 | 3300048924 | Ga0496121_0000018 | Ga0496121_0000018_428648_430186 | 471 |
| 61 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1208018_1209529 | 471 |
| 62 | 3300049581 | Ga0501047_0008388 | Ga0501047_0008388_4381_5859 | 471 |
| 63 | 3300049742 | Ga0501080_0001057 | Ga0501080_0001057_11712_13190 | 471 |
| 64 | 3300050491 | nmdc:mga00v17_99467_c1 | nmdc:mga00v17_99467_c1_246_1757 | 471 |
| 65 | 3300005336 | Ga0070680_100002884 | Ga0070680_1000028847 | 472 |
| 66 | 3300005338 | Ga0068868_100000001 | Ga0068868_10000000117 | 472 |
| 67 | 3300005339 | Ga0070660_100003034 | Ga0070660_10000303411 | 472 |
| 68 | 3300005366 | Ga0070659_100000001 | Ga0070659_100000001341 | 472 |
| 69 | 3300005366 | Ga0070659_100104104 | Ga0070659_1001041041 | 472 |
| 70 | 3300005458 | Ga0070681_10020073 | Ga0070681_100200732 | 472 |
| 71 | 3300005530 | Ga0070679_100006911 | Ga0070679_1000069113 | 472 |
| 72 | 3300005539 | Ga0068853_100005921 | Ga0068853_1000059212 | 472 |
| 73 | 3300005563 | Ga0068855_100051832 | Ga0068855_1000518325 | 472 |
| 74 | 3300009098 | Ga0105245_10085797 | Ga0105245_100857972 | 472 |
| 75 | 3300021384 | Ga0213876_10000544 | Ga0213876_1000054418 | 472 |
| 76 | 3300025909 | Ga0207705_10001414 | Ga0207705_100014146 | 472 |
| 77 | 3300025917 | Ga0207660_10003153 | Ga0207660_100031535 | 472 |
| 78 | 3300025919 | Ga0207657_10001137 | Ga0207657_100011373 | 472 |
| 79 | 3300025921 | Ga0207652_10003865 | Ga0207652_100038656 | 472 |
| 80 | 3300025926 | Ga0207659_10106133 | Ga0207659_101061332 | 472 |
| 81 | 3300025927 | Ga0207687_10027427 | Ga0207687_100274273 | 472 |
| 82 | 3300025932 | Ga0207690_10000051 | Ga0207690_1000005145 | 472 |
| 83 | 3300025932 | Ga0207690_10005435 | Ga0207690_100054352 | 472 |
| 84 | 3300025949 | Ga0207667_10007334 | Ga0207667_100073348 | 472 |
| 85 | 3300026023 | Ga0207677_10000013 | Ga0207677_10000013182 | 472 |
| 86 | 3300031235 | Ga0265330_10064138 | Ga0265330_100641381 | 472 |
| 87 | 3300031247 | Ga0265340_10031218 | Ga0265340_100312182 | 472 |
| 88 | 3300031728 | Ga0316578_10017916 | Ga0316578_100179162 | 472 |
| 89 | 3300035398 | Ga0316574_0000274 | Ga0316574_0000274_4329_5843 | 472 |
| 90 | 3300049572 | Ga0501036_0025756 | Ga0501036_0025756_2586_4073 | 472 |
| 91 | 3300049579 | Ga0501043_0021029 | Ga0501043_0021029_2924_4411 | 472 |
| 92 | 3300049580 | Ga0501046_0001115 | Ga0501046_0001115_16308_17795 | 472 |
| 93 | 3300049581 | Ga0501047_0000290 | Ga0501047_0000290_20469_21956 | 472 |
| 94 | 3300049583 | Ga0501067_0001682 | Ga0501067_0001682_5535_7022 | 472 |
| 95 | 3300049586 | Ga0501070_0002529 | Ga0501070_0002529_1189_2676 | 472 |
| 96 | 3300049742 | Ga0501080_0000003 | Ga0501080_0000003_86447_87934 | 472 |
| 97 | 3300049822 | Ga0501035_0000384 | Ga0501035_0000384_29956_31443 | 472 |
| 98 | 3300049823 | Ga0501044_0000570 | Ga0501044_0000570_35852_37339 | 472 |
| 99 | 3300006051 | Ga0075364_10013747 | Ga0075364_100137472 | 473 |
| 100 | 3300037471 | Ga0395905_0000271 | Ga0395905_0000271_4876_6378 | 473 |
| 101 | 3300050491 | nmdc:mga00v17_934_c1 | nmdc:mga00v17_934_c1_12154_13707 | 473 |
| 102 | 3300050516 | nmdc:mga0sz30_29578_c1 | nmdc:mga0sz30_29578_c1_517_2070 | 473 |
| 103 | 3300060353 | Ga0501082_0258071 | Ga0501082_0258071_49_1503 | 473 |
| 104 | 3300005295 | Ga0065707_10000608 | Ga0065707_100006083 | 474 |
| 105 | 3300031235 | Ga0265330_10046044 | Ga0265330_100460442 | 474 |
| 106 | 3300031249 | Ga0265339_10069712 | Ga0265339_100697122 | 474 |
| 107 | 3300031250 | Ga0265331_10011789 | Ga0265331_100117892 | 474 |
| 108 | 3300046524 | Ga0495648_0003360 | Ga0495648_0003360_8584_10089 | 474 |
| 109 | 3300049570 | Ga0501033_0002053 | Ga0501033_0002053_15975_17471 | 474 |
| 110 | 3300049572 | Ga0501036_0089461 | Ga0501036_0089461_327_1844 | 474 |
| 111 | 3300049574 | Ga0501038_0011223 | Ga0501038_0011223_5898_7415 | 474 |
| 112 | 3300049575 | Ga0501039_0016254 | Ga0501039_0016254_3869_5386 | 474 |
| 113 | 3300049579 | Ga0501043_0071258 | Ga0501043_0071258_718_2235 | 474 |
| 114 | 3300049581 | Ga0501047_0036257 | Ga0501047_0036257_1302_2819 | 474 |
| 115 | 3300049589 | Ga0501073_0003442 | Ga0501073_0003442_8925_10442 | 474 |
| 116 | 3300049742 | Ga0501080_0045353 | Ga0501080_0045353_2011_3528 | 474 |
| 117 | 3300049823 | Ga0501044_0013529 | Ga0501044_0013529_6058_7575 | 474 |
| 118 | 3300050496 | nmdc:mga07m45_32659_c1 | nmdc:mga07m45_32659_c1_1356_2876 | 474 |
| 119 | 3300053096 | Ga0500641_0010426 | Ga0500641_0010426_985_2529 | 474 |
| 120 | 3300053096 | Ga0500641_0010581 | Ga0500641_0010581_1786_3270 | 474 |
| 121 | 3300005336 | Ga0070680_100030844 | Ga0070680_1000308442 | 475 |
| 122 | 3300005353 | Ga0070669_100000329 | Ga0070669_10000032927 | 475 |
| 123 | 3300005355 | Ga0070671_100001250 | Ga0070671_1000012505 | 475 |
| 124 | 3300005834 | Ga0068851_10011399 | Ga0068851_100113992 | 475 |
| 125 | 3300005841 | Ga0068863_100059984 | Ga0068863_1000599842 | 475 |
| 126 | 3300005842 | Ga0068858_100043412 | Ga0068858_1000434123 | 475 |
| 127 | 3300005843 | Ga0068860_100066828 | Ga0068860_1000668283 | 475 |
| 128 | 3300009177 | Ga0105248_10090660 | Ga0105248_100906603 | 475 |
| 129 | 3300025912 | Ga0207707_10001296 | Ga0207707_100012963 | 475 |
| 130 | 3300025923 | Ga0207681_10000448 | Ga0207681_1000044813 | 475 |
| 131 | 3300025931 | Ga0207644_10000003 | Ga0207644_10000003141 | 475 |
| 132 | 3300026095 | Ga0207676_10045215 | Ga0207676_100452152 | 475 |
| 133 | 3300048909 | Ga0496106_0002158 | Ga0496106_0002158_7837_9393 | 475 |
| 134 | 3300048913 | Ga0496110_0026758 | Ga0496110_0026758_3038_4594 | 475 |
| 135 | 3300005333 | Ga0070677_10000656 | Ga0070677_100006566 | 476 |
| 136 | 3300005539 | Ga0068853_100025697 | Ga0068853_1000256971 | 476 |
| 137 | 3300007076 | Ga0075435_100125914 | Ga0075435_1001259142 | 476 |
| 138 | 3300025893 | Ga0207682_10000833 | Ga0207682_100008339 | 476 |
| 139 | 3300025949 | Ga0207667_10043233 | Ga0207667_100432332 | 476 |
| 140 | 3300039437 | Ga0436365_0835883 | Ga0436365_0835883_105_1598 | 476 |
| 141 | 3300048916 | Ga0496113_0001823 | Ga0496113_0001823_10270_11826 | 476 |
| 142 | iso_pu_bacteria | 2547132512 | 2548846988 | 476 |
| 143 | 3300005440 | Ga0070705_100041450 | Ga0070705_1000414502 | 477 |
| 144 | 3300005545 | Ga0070695_100032791 | Ga0070695_1000327912 | 477 |
| 145 | 3300005548 | Ga0070665_100000334 | Ga0070665_10000033421 | 477 |
| 146 | 3300005842 | Ga0068858_100012038 | Ga0068858_1000120382 | 477 |
| 147 | 3300006914 | Ga0075436_100012782 | Ga0075436_1000127824 | 477 |
| 148 | 3300007076 | Ga0075435_100016479 | Ga0075435_1000164792 | 477 |
| 149 | 3300009177 | Ga0105248_10045112 | Ga0105248_100451124 | 477 |
| 150 | 3300028379 | Ga0268266_10001119 | Ga0268266_1000111933 | 477 |
| 151 | 3300032126 | Ga0307415_100013094 | Ga0307415_1000130942 | 477 |
| 152 | 3300050513 | nmdc:mga0rr50_39858_c1 | nmdc:mga0rr50_39858_c1_1184_2701 | 477 |
| 153 | 3300050514 | nmdc:mga08x19_14_c1 | nmdc:mga08x19_14_c1_218382_219899 | 477 |
| 154 | 3300048928 | Ga0496125_0078257 | Ga0496125_0078257_1038_2525 | 478 |
| 155 | 3300049571 | Ga0501034_0198704 | Ga0501034_0198704_167_1681 | 478 |
| 156 | 3300009147 | Ga0114129_10370390 | Ga0114129_103703901 | 479 |
| 157 | 3300037312 | Ga0395899_0000151 | Ga0395899_0000151_65228_66733 | 479 |
| 158 | 3300037418 | Ga0395900_0000020 | Ga0395900_0000020_168714_170219 | 479 |
| 159 | 3300037466 | Ga0395898_0000104 | Ga0395898_0000104_183282_184787 | 479 |
| 160 | 3300037471 | Ga0395905_0000019 | Ga0395905_0000019_183282_184787 | 479 |
| 161 | 3300038443 | Ga0395901_0000016 | Ga0395901_0000016_169222_170727 | 479 |
| 162 | 3300031238 | Ga0265332_10000016 | Ga0265332_10000016195 | 480 |
| 163 | 3300031251 | Ga0265327_10000588 | Ga0265327_1000058835 | 480 |
| 164 | 3300031251 | Ga0265327_10002222 | Ga0265327_1000222219 | 480 |
| 165 | 3300005354 | Ga0070675_100127929 | Ga0070675_1001279292 | 481 |
| 166 | 3300031665 | Ga0316575_10000032 | Ga0316575_1000003227 | 481 |
| 167 | 3300049581 | Ga0501047_0085685 | Ga0501047_0085685_633_2147 | 481 |
| 168 | 3300049586 | Ga0501070_0063518 | Ga0501070_0063518_1143_2657 | 481 |
| 169 | 3300049742 | Ga0501080_0050525 | Ga0501080_0050525_766_2280 | 481 |
| 170 | iso_pu_bacteria | 2510917020 | 2511125408 | 481 |
| 171 | iso_pu_bacteria | 2582581279 | 2585148510 | 481 |
| 172 | iso_pu_bacteria | 2582581280 | 2585153099 | 481 |
| 173 | iso_pu_bacteria | 2582581293 | 2585196661 | 481 |
| 174 | iso_pu_bacteria | 2585428106 | 2587916721 | 481 |
| 175 | iso_pu_bacteria | 2643221545 | 2643751417 | 481 |
| 176 | iso_pu_bacteria | 2643221552 | 2643778207 | 481 |
| 177 | iso_pu_bacteria | 2643221574 | 2643883259 | 481 |
| 178 | iso_pu_bacteria | 2643221583 | 2643923489 | 481 |
| 179 | iso_pu_bacteria | 2643221584 | 2643928414 | 481 |
| 180 | iso_pu_bacteria | 2643221598 | 2644000277 | 481 |
| 181 | iso_pu_bacteria | 2643221614 | 2644084959 | 481 |
| 182 | iso_pu_bacteria | 2643221640 | 2644225747 | 481 |
| 183 | iso_pu_bacteria | 2643221642 | 2644235236 | 481 |
| 184 | iso_pu_bacteria | 2643221661 | 2644342511 | 481 |
| 185 | iso_pu_bacteria | 2643221663 | 2644351902 | 481 |
| 186 | iso_pu_bacteria | 2643221666 | 2644365811 | 481 |
| 187 | iso_pu_bacteria | 2643221691 | 2644510530 | 481 |
| 188 | iso_pu_bacteria | 2643221699 | 2644547923 | 481 |
| 189 | iso_pu_bacteria | 2791355048 | 2792460622 | 481 |
| 190 | iso_pu_bacteria | 2818991435 | 2819536600 | 481 |
| 191 | iso_pu_bacteria | 2818991454 | 2819645761 | 481 |
| 192 | iso_pu_bacteria | 2843744320 | 2843747775 | 481 |
| 193 | iso_pu_bacteria | 2849560528 | 2849565354 | 481 |
| 194 | iso_pu_bacteria | 2849573788 | 2849578417 | 481 |
| 195 | iso_pu_bacteria | 2851153111 | 2851153806 | 481 |
| 196 | iso_pu_bacteria | 2857504554 | 2857506365 | 481 |
| 197 | iso_pu_bacteria | 2884960567 | 2884965114 | 481 |
| 198 | iso_pu_bacteria | 2898329390 | 2898329521 | 481 |
| 199 | iso_pu_bacteria | 2928531327 | 2928535387 | 481 |
| 200 | iso_pu_bacteria | 2928972540 | 2928975122 | 481 |
| 201 | iso_pu_bacteria | 2941485952 | 2941488429 | 481 |
| 202 | iso_pu_bacteria | 2977240413 | 2977241885 | 481 |
| 203 | 3300005337 | Ga0070682_100012466 | Ga0070682_1000124663 | 482 |
| 204 | 3300005366 | Ga0070659_100096585 | Ga0070659_1000965852 | 482 |
| 205 | 3300005530 | Ga0070679_100005502 | Ga0070679_10000550210 | 482 |
| 206 | 3300005539 | Ga0068853_100015961 | Ga0068853_1000159616 | 482 |
| 207 | 3300005549 | Ga0070704_100025527 | Ga0070704_1000255271 | 482 |
| 208 | 3300005577 | Ga0068857_100068835 | Ga0068857_1000688352 | 482 |
| 209 | 3300005983 | Ga0081540_1001263 | Ga0081540_100126320 | 482 |
| 210 | 3300009174 | Ga0105241_10060054 | Ga0105241_100600542 | 482 |
| 211 | 3300009553 | Ga0105249_10009441 | Ga0105249_100094412 | 482 |
| 212 | 3300013100 | Ga0157373_10019439 | Ga0157373_100194392 | 482 |
| 213 | 3300013104 | Ga0157370_10018896 | Ga0157370_100188963 | 482 |
| 214 | 3300025909 | Ga0207705_10019624 | Ga0207705_100196244 | 482 |
| 215 | 3300025912 | Ga0207707_10054709 | Ga0207707_100547092 | 482 |
| 216 | 3300025949 | Ga0207667_10092888 | Ga0207667_100928882 | 482 |
| 217 | 3300025961 | Ga0207712_10017866 | Ga0207712_100178664 | 482 |
| 218 | 3300031235 | Ga0265330_10006479 | Ga0265330_100064794 | 482 |
| 219 | 3300031250 | Ga0265331_10010985 | Ga0265331_100109852 | 482 |
| 220 | 3300045051 | Ga0451576_0000034 | Ga0451576_0000034_240786_242276 | 482 |
| 221 | 3300053105 | Ga0500557_000050 | Ga0500557_000050_1211_2719 | 482 |
| 222 | 3300053130 | Ga0500642_0000065 | Ga0500642_0000065_8424_9932 | 482 |
| 223 | 3300003781 | Ga0055536_1008966 | Ga0055536_10089663 | 483 |
| 224 | 3300003791 | Ga0055530_10000647 | Ga0055530_1000064721 | 483 |
| 225 | 3300003794 | Ga0055531_10014013 | Ga0055531_100140132 | 483 |
| 226 | 3300025297 | Ga0209758_1002592 | Ga0209758_10025928 | 483 |
| 227 | 3300025298 | Ga0209050_1000101 | Ga0209050_1000101162 | 483 |
| 228 | 3300025298 | Ga0209050_1013083 | Ga0209050_10130832 | 483 |
| 229 | 3300025304 | Ga0209257_1000178 | Ga0209257_100017864 | 483 |
| 230 | 3300025304 | Ga0209257_1000220 | Ga0209257_100022034 | 483 |
| 231 | 3300027866 | Ga0209813_10002965 | Ga0209813_100029652 | 483 |
| 232 | 3300031456 | Ga0307513_10021686 | Ga0307513_100216867 | 483 |
| 233 | 3300031901 | Ga0307406_10002549 | Ga0307406_100025492 | 483 |
| 234 | 3300005262 | Ga0065165_1005117 | Ga0065165_10051172 | 484 |
| 235 | 3300005327 | Ga0070658_10093326 | Ga0070658_100933262 | 484 |
| 236 | 3300005331 | Ga0070670_100000037 | Ga0070670_1000000379 | 484 |
| 237 | 3300005336 | Ga0070680_100102079 | Ga0070680_1001020792 | 484 |
| 238 | 3300005341 | Ga0070691_10019229 | Ga0070691_100192292 | 484 |
| 239 | 3300005347 | Ga0070668_100002188 | Ga0070668_1000021888 | 484 |
| 240 | 3300005353 | Ga0070669_100023151 | Ga0070669_1000231512 | 484 |
| 241 | 3300005355 | Ga0070671_100026330 | Ga0070671_1000263303 | 484 |
| 242 | 3300005367 | Ga0070667_100000083 | Ga0070667_1000000839 | 484 |
| 243 | 3300005367 | Ga0070667_100010505 | Ga0070667_1000105053 | 484 |
| 244 | 3300005539 | Ga0068853_100127855 | Ga0068853_1001278552 | 484 |
| 245 | 3300005548 | Ga0070665_100000116 | Ga0070665_100000116124 | 484 |
| 246 | 3300005548 | Ga0070665_100000883 | Ga0070665_1000008839 | 484 |
| 247 | 3300005548 | Ga0070665_100005159 | Ga0070665_1000051598 | 484 |
| 248 | 3300005563 | Ga0068855_100160596 | Ga0068855_1001605962 | 484 |
| 249 | 3300005618 | Ga0068864_100000116 | Ga0068864_10000011657 | 484 |
| 250 | 3300005618 | Ga0068864_100000363 | Ga0068864_10000036333 | 484 |
| 251 | 3300005841 | Ga0068863_100000007 | Ga0068863_100000007221 | 484 |
| 252 | 3300005841 | Ga0068863_100003837 | Ga0068863_1000038376 | 484 |
| 253 | 3300005842 | Ga0068858_100000853 | Ga0068858_10000085312 | 484 |
| 254 | 3300005842 | Ga0068858_100004079 | Ga0068858_1000040797 | 484 |
| 255 | 3300005843 | Ga0068860_100000348 | Ga0068860_10000034851 | 484 |
| 256 | 3300005844 | Ga0068862_100000235 | Ga0068862_10000023556 | 484 |
| 257 | 3300005844 | Ga0068862_100026581 | Ga0068862_1000265812 | 484 |
| 258 | 3300006051 | Ga0075364_10000935 | Ga0075364_1000093510 | 484 |
| 259 | 3300006178 | Ga0075367_10094182 | Ga0075367_100941821 | 484 |
| 260 | 3300006195 | Ga0075366_10051698 | Ga0075366_100516982 | 484 |
| 261 | 3300006353 | Ga0075370_10020413 | Ga0075370_100204132 | 484 |
| 262 | 3300009092 | Ga0105250_10002835 | Ga0105250_100028353 | 484 |
| 263 | 3300009093 | Ga0105240_10010558 | Ga0105240_100105582 | 484 |
| 264 | 3300009093 | Ga0105240_10041126 | Ga0105240_100411262 | 484 |
| 265 | 3300009093 | Ga0105240_10133888 | Ga0105240_101338882 | 484 |
| 266 | 3300009177 | Ga0105248_10000438 | Ga0105248_100004383 | 484 |
| 267 | 3300010375 | Ga0105239_10107230 | Ga0105239_101072302 | 484 |
| 268 | 3300013306 | Ga0163162_10090862 | Ga0163162_100908622 | 484 |
| 269 | 3300025304 | Ga0209257_1005921 | Ga0209257_10059217 | 484 |
| 270 | 3300025913 | Ga0207695_10000718 | Ga0207695_1000071860 | 484 |
| 271 | 3300025913 | Ga0207695_10001195 | Ga0207695_1000119514 | 484 |
| 272 | 3300025921 | Ga0207652_10052024 | Ga0207652_100520242 | 484 |
| 273 | 3300025925 | Ga0207650_10000062 | Ga0207650_1000006280 | 484 |
| 274 | 3300025931 | Ga0207644_10021731 | Ga0207644_100217313 | 484 |
| 275 | 3300025932 | Ga0207690_10000053 | Ga0207690_1000005388 | 484 |
| 276 | 3300025941 | Ga0207711_10001604 | Ga0207711_1000160414 | 484 |
| 277 | 3300025941 | Ga0207711_10016191 | Ga0207711_100161913 | 484 |
| 278 | 3300025961 | Ga0207712_10003975 | Ga0207712_100039757 | 484 |
| 279 | 3300025972 | Ga0207668_10001123 | Ga0207668_100011239 | 484 |
| 280 | 3300025972 | Ga0207668_10003651 | Ga0207668_100036515 | 484 |
| 281 | 3300025986 | Ga0207658_10000218 | Ga0207658_1000021825 | 484 |
| 282 | 3300025986 | Ga0207658_10033721 | Ga0207658_100337213 | 484 |
| 283 | 3300026035 | Ga0207703_10000038 | Ga0207703_1000003827 | 484 |
| 284 | 3300026035 | Ga0207703_10005677 | Ga0207703_100056779 | 484 |
| 285 | 3300026088 | Ga0207641_10000012 | Ga0207641_1000001288 | 484 |
| 286 | 3300026088 | Ga0207641_10005823 | Ga0207641_100058235 | 484 |
| 287 | 3300026095 | Ga0207676_10000179 | Ga0207676_100001799 | 484 |
| 288 | 3300026095 | Ga0207676_10000437 | Ga0207676_1000043710 | 484 |
| 289 | 3300026118 | Ga0207675_100137525 | Ga0207675_1001375252 | 484 |
| 290 | 3300027296 | Ga0209389_1000117 | Ga0209389_100011765 | 484 |
| 291 | 3300027361 | Ga0209489_109135 | Ga0209489_1091353 | 484 |
| 292 | 3300027363 | Ga0209700_100021 | Ga0209700_10002167 | 484 |
| 293 | 3300028379 | Ga0268266_10000064 | Ga0268266_10000064230 | 484 |
| 294 | 3300028379 | Ga0268266_10003430 | Ga0268266_1000343010 | 484 |
| 295 | 3300028379 | Ga0268266_10008959 | Ga0268266_100089598 | 484 |
| 296 | 3300028380 | Ga0268265_10000600 | Ga0268265_1000060032 | 484 |
| 297 | 3300028381 | Ga0268264_10000059 | Ga0268264_10000059299 | 484 |
| 298 | 3300028786 | Ga0307517_10006007 | Ga0307517_1000600713 | 484 |
| 299 | 3300030521 | Ga0307511_10053071 | Ga0307511_100530712 | 484 |
| 300 | 3300031456 | Ga0307513_10004825 | Ga0307513_1000482510 | 484 |
| 301 | 3300031456 | Ga0307513_10014216 | Ga0307513_100142164 | 484 |
| 302 | 3300031730 | Ga0307516_10000352 | Ga0307516_1000035249 | 484 |
| 303 | 3300038443 | Ga0395901_0217321 | Ga0395901_0217321_89_1573 | 484 |
| 304 | 3300042461 | Ga0439460_0012638 | Ga0439460_0012638_268_1764 | 484 |
| 305 | 3300046684 | Ga0495669_0000003 | Ga0495669_0000003_234390_235877 | 484 |
| 306 | 3300046684 | Ga0495669_0000234 | Ga0495669_0000234_26121_27608 | 484 |
| 307 | 3300047472 | Ga0495686_0011256 | Ga0495686_0011256_4310_5791 | 484 |
| 308 | 3300048918 | Ga0496115_0000794 | Ga0496115_0000794_2139_3623 | 484 |
| 309 | 3300048921 | Ga0496118_0020178 | Ga0496118_0020178_3888_5372 | 484 |
| 310 | 3300048922 | Ga0496119_0011136 | Ga0496119_0011136_4315_5799 | 484 |
| 311 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_697038_698522 | 484 |
| 312 | 3300049569 | Ga0501032_0003255 | Ga0501032_0003255_6616_8124 | 484 |
| 313 | 3300049570 | Ga0501033_0074012 | Ga0501033_0074012_145_1629 | 484 |
| 314 | 3300049571 | Ga0501034_0014235 | Ga0501034_0014235_1323_2819 | 484 |
| 315 | 3300049589 | Ga0501073_0000018 | Ga0501073_0000018_92003_93511 | 484 |
| 316 | 3300049593 | Ga0501077_0000026 | Ga0501077_0000026_639_2147 | 484 |
| 317 | 3300049742 | Ga0501080_0005874 | Ga0501080_0005874_5614_7122 | 484 |
| 318 | 3300049823 | Ga0501044_0030476 | Ga0501044_0030476_1023_2531 | 484 |
| 319 | 3300053080 | Ga0500635_0000489 | Ga0500635_0000489_6137_7621 | 484 |
| 320 | 3300053087 | Ga0500643_008792 | Ga0500643_008792_1107_2597 | 484 |
| 321 | 3300053119 | Ga0500595_002565 | Ga0500595_002565_6761_8245 | 484 |
| 322 | 3300053122 | Ga0500608_002327 | Ga0500608_002327_3300_4784 | 484 |
| 323 | 3300053148 | Ga0500590_021481 | Ga0500590_021481_1465_2949 | 484 |
| 324 | 3300053730 | Ga0500645_002164 | Ga0500645_002164_6625_8106 | 484 |
| 325 | 3300053735 | Ga0500596_000572 | Ga0500596_000572_4851_6335 | 484 |
| 326 | iso_pu_bacteria | 2899259804 | 2899261570 | 484 |
| 327 | 3300003773 | Ga0055537_1005923 | Ga0055537_10059232 | 485 |
| 328 | 3300003781 | Ga0055536_1005242 | Ga0055536_10052422 | 485 |
| 329 | 3300003781 | Ga0055536_1005282 | Ga0055536_10052822 | 485 |
| 330 | 3300003790 | Ga0055528_1005371 | Ga0055528_10053712 | 485 |
| 331 | 3300003791 | Ga0055530_10001148 | Ga0055530_1000114817 | 485 |
| 332 | 3300003791 | Ga0055530_10006282 | Ga0055530_100062823 | 485 |
| 333 | 3300003794 | Ga0055531_10003600 | Ga0055531_100036003 | 485 |
| 334 | 3300003794 | Ga0055531_10008745 | Ga0055531_100087453 | 485 |
| 335 | 3300005262 | Ga0065165_1000845 | Ga0065165_100084520 | 485 |
| 336 | 3300005336 | Ga0070680_100029645 | Ga0070680_1000296452 | 485 |
| 337 | 3300005339 | Ga0070660_100028150 | Ga0070660_1000281502 | 485 |
| 338 | 3300005341 | Ga0070691_10026589 | Ga0070691_100265892 | 485 |
| 339 | 3300005347 | Ga0070668_100074951 | Ga0070668_1000749512 | 485 |
| 340 | 3300005455 | Ga0070663_100008703 | Ga0070663_1000087034 | 485 |
| 341 | 3300005539 | Ga0068853_100081486 | Ga0068853_1000814862 | 485 |
| 342 | 3300005617 | Ga0068859_100057359 | Ga0068859_1000573592 | 485 |
| 343 | 3300005841 | Ga0068863_100039222 | Ga0068863_1000392222 | 485 |
| 344 | 3300005843 | Ga0068860_100001231 | Ga0068860_1000012315 | 485 |
| 345 | 3300005843 | Ga0068860_100063874 | Ga0068860_1000638742 | 485 |
| 346 | 3300006931 | Ga0097620_100057357 | Ga0097620_1000573572 | 485 |
| 347 | 3300009551 | Ga0105238_10011427 | Ga0105238_100114272 | 485 |
| 348 | 3300009551 | Ga0105238_10028949 | Ga0105238_100289493 | 485 |
| 349 | 3300009553 | Ga0105249_10046170 | Ga0105249_100461702 | 485 |
| 350 | 3300011119 | Ga0105246_10017989 | Ga0105246_100179892 | 485 |
| 351 | 3300013100 | Ga0157373_10030864 | Ga0157373_100308641 | 485 |
| 352 | 3300013104 | Ga0157370_10046511 | Ga0157370_100465113 | 485 |
| 353 | 3300013104 | Ga0157370_10214112 | Ga0157370_102141121 | 485 |
| 354 | 3300013105 | Ga0157369_10066871 | Ga0157369_100668713 | 485 |
| 355 | 3300013307 | Ga0157372_10029019 | Ga0157372_100290192 | 485 |
| 356 | 3300013307 | Ga0157372_10202608 | Ga0157372_102026082 | 485 |
| 357 | 3300021361 | Ga0213872_10005154 | Ga0213872_100051547 | 485 |
| 358 | 3300025263 | Ga0209565_1000332 | Ga0209565_100033238 | 485 |
| 359 | 3300025292 | Ga0209676_1000327 | Ga0209676_100032727 | 485 |
| 360 | 3300025292 | Ga0209676_1000409 | Ga0209676_100040910 | 485 |
| 361 | 3300025297 | Ga0209758_1005274 | Ga0209758_10052749 | 485 |
| 362 | 3300025298 | Ga0209050_1004277 | Ga0209050_10042775 | 485 |
| 363 | 3300025298 | Ga0209050_1005272 | Ga0209050_10052725 | 485 |
| 364 | 3300025299 | Ga0209256_1002189 | Ga0209256_10021899 | 485 |
| 365 | 3300025299 | Ga0209256_1003655 | Ga0209256_10036559 | 485 |
| 366 | 3300025304 | Ga0209257_1000386 | Ga0209257_100038632 | 485 |
| 367 | 3300025304 | Ga0209257_1005253 | Ga0209257_10052537 | 485 |
| 368 | 3300025304 | Ga0209257_1009127 | Ga0209257_10091272 | 485 |
| 369 | 3300025913 | Ga0207695_10003313 | Ga0207695_1000331312 | 485 |
| 370 | 3300025919 | Ga0207657_10042588 | Ga0207657_100425882 | 485 |
| 371 | 3300025924 | Ga0207694_10056099 | Ga0207694_100560992 | 485 |
| 372 | 3300025961 | Ga0207712_10018228 | Ga0207712_100182282 | 485 |
| 373 | 3300025972 | Ga0207668_10066068 | Ga0207668_100660682 | 485 |
| 374 | 3300026041 | Ga0207639_10042224 | Ga0207639_100422242 | 485 |
| 375 | 3300026067 | Ga0207678_10000104 | Ga0207678_1000010415 | 485 |
| 376 | 3300026121 | Ga0207683_10184130 | Ga0207683_101841302 | 485 |
| 377 | 3300028380 | Ga0268265_10045113 | Ga0268265_100451132 | 485 |
| 378 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046188 | 485 |
| 379 | 3300028381 | Ga0268264_10046476 | Ga0268264_100464762 | 485 |
| 380 | 3300028794 | Ga0307515_10101092 | Ga0307515_101010922 | 485 |
| 381 | 3300028800 | Ga0265338_10095129 | Ga0265338_100951292 | 485 |
| 382 | 3300031251 | Ga0265327_10000602 | Ga0265327_100006026 | 485 |
| 383 | 3300031251 | Ga0265327_10019344 | Ga0265327_100193442 | 485 |
| 384 | 3300031456 | Ga0307513_10000261 | Ga0307513_1000026114 | 485 |
| 385 | 3300035692 | Ga0373935_0046449 | Ga0373935_0046449_1168_2655 | 485 |
| 386 | 3300037312 | Ga0395899_0000013 | Ga0395899_0000013_266948_268447 | 485 |
| 387 | 3300037466 | Ga0395898_0018445 | Ga0395898_0018445_1642_3129 | 485 |
| 388 | 3300037471 | Ga0395905_0007899 | Ga0395905_0007899_1673_3160 | 485 |
| 389 | 3300038443 | Ga0395901_0043872 | Ga0395901_0043872_1681_3171 | 485 |
| 390 | 3300039447 | Ga0436361_0496775 | Ga0436361_0496775_8960_10447 | 485 |
| 391 | 3300042156 | Ga0439446_0015224 | Ga0439446_0015224_396_1880 | 485 |
| 392 | 3300042533 | Ga0450901_002064 | Ga0450901_002064_613_2100 | 485 |
| 393 | 3300046457 | Ga0495590_0019068 | Ga0495590_0019068_352_1836 | 485 |
| 394 | 3300046471 | Ga0495650_0000017 | Ga0495650_0000017_140193_141677 | 485 |
| 395 | 3300046506 | Ga0495583_0000020 | Ga0495583_0000020_123736_125220 | 485 |
| 396 | 3300046507 | Ga0495606_0023713 | Ga0495606_0023713_352_1836 | 485 |
| 397 | 3300046512 | Ga0495610_0000908 | Ga0495610_0000908_6920_8404 | 485 |
| 398 | 3300046512 | Ga0495610_0007741 | Ga0495610_0007741_4703_6187 | 485 |
| 399 | 3300046513 | Ga0495616_0001591 | Ga0495616_0001591_1247_2731 | 485 |
| 400 | 3300046515 | Ga0495620_0017326 | Ga0495620_0017326_1675_3159 | 485 |
| 401 | 3300046519 | Ga0495632_0060259 | Ga0495632_0060259_320_1804 | 485 |
| 402 | 3300046520 | Ga0495637_0002075 | Ga0495637_0002075_1361_2845 | 485 |
| 403 | 3300046524 | Ga0495648_0000948 | Ga0495648_0000948_27205_28689 | 485 |
| 404 | 3300046530 | Ga0495654_0000216 | Ga0495654_0000216_12886_14370 | 485 |
| 405 | 3300046558 | Ga0495633_0002271 | Ga0495633_0002271_128_1612 | 485 |
| 406 | 3300046616 | Ga0495668_0000092 | Ga0495668_0000092_120143_121627 | 485 |
| 407 | 3300046616 | Ga0495668_0006535 | Ga0495668_0006535_2392_3876 | 485 |
| 408 | 3300046616 | Ga0495668_0016490 | Ga0495668_0016490_2720_4204 | 485 |
| 409 | 3300046694 | Ga0495649_0000345 | Ga0495649_0000345_3956_5440 | 485 |
| 410 | 3300047446 | Ga0495679_005032 | Ga0495679_005032_1263_2747 | 485 |
| 411 | 3300047469 | Ga0495673_0000078 | Ga0495673_0000078_198737_200221 | 485 |
| 412 | 3300047469 | Ga0495673_0000401 | Ga0495673_0000401_4843_6327 | 485 |
| 413 | 3300047472 | Ga0495686_0003214 | Ga0495686_0003214_1152_2636 | 485 |
| 414 | 3300048905 | Ga0496102_0062324 | Ga0496102_0062324_1396_2883 | 485 |
| 415 | 3300048906 | Ga0496103_0103884 | Ga0496103_0103884_56_1543 | 485 |
| 416 | 3300048909 | Ga0496106_0002226 | Ga0496106_0002226_11787_13274 | 485 |
| 417 | 3300048909 | Ga0496106_0005334 | Ga0496106_0005334_935_2419 | 485 |
| 418 | 3300048910 | Ga0496107_0001868 | Ga0496107_0001868_10575_12059 | 485 |
| 419 | 3300048924 | Ga0496121_0001392 | Ga0496121_0001392_4031_5515 | 485 |
| 420 | 3300048925 | Ga0496122_0015650 | Ga0496122_0015650_2384_3868 | 485 |
| 421 | 3300048926 | Ga0496123_0005251 | Ga0496123_0005251_2957_4441 | 485 |
| 422 | 3300048928 | Ga0496125_0007529 | Ga0496125_0007529_2080_3564 | 485 |
| 423 | 3300048929 | Ga0496126_0001877 | Ga0496126_0001877_20560_22044 | 485 |
| 424 | 3300049459 | Ga0495678_001720 | Ga0495678_001720_1144_2628 | 485 |
| 425 | 3300049571 | Ga0501034_0090118 | Ga0501034_0090118_453_1940 | 485 |
| 426 | 3300049580 | Ga0501046_0003242 | Ga0501046_0003242_12565_14052 | 485 |
| 427 | 3300049581 | Ga0501047_0210013 | Ga0501047_0210013_47_1534 | 485 |
| 428 | 3300049583 | Ga0501067_0000905 | Ga0501067_0000905_6214_7701 | 485 |
| 429 | 3300050491 | nmdc:mga00v17_322_c1 | nmdc:mga00v17_322_c1_5188_6681 | 485 |
| 430 | 3300050496 | nmdc:mga07m45_187_c2 | nmdc:mga07m45_187_c2_7588_9081 | 485 |
| 431 | 3300053086 | Ga0500578_0000420 | Ga0500578_0000420_13967_15451 | 485 |
| 432 | 3300053087 | Ga0500643_022035 | Ga0500643_022035_262_1746 | 485 |
| 433 | 3300053088 | Ga0500644_0000274 | Ga0500644_0000274_26384_27868 | 485 |
| 434 | 3300053102 | Ga0500554_001836 | Ga0500554_001836_257_1741 | 485 |
| 435 | 3300053104 | Ga0500556_0000587 | Ga0500556_0000587_4049_5533 | 485 |
| 436 | 3300053108 | Ga0500562_002122 | Ga0500562_002122_1261_2748 | 485 |
| 437 | 3300053118 | Ga0500594_0003103 | Ga0500594_0003103_1664_3148 | 485 |
| 438 | 3300053122 | Ga0500608_000080 | Ga0500608_000080_21250_22734 | 485 |
| 439 | 3300053125 | Ga0500618_000112 | Ga0500618_000112_29910_31394 | 485 |
| 440 | 3300053134 | Ga0500658_0001458 | Ga0500658_0001458_2259_3743 | 485 |
| 441 | 3300053136 | Ga0500559_0000077 | Ga0500559_0000077_21756_23246 | 485 |
| 442 | 3300053136 | Ga0500559_0000111 | Ga0500559_0000111_26153_27637 | 485 |
| 443 | 3300053138 | Ga0500564_000021 | Ga0500564_000021_44586_46070 | 485 |
| 444 | 3300053156 | Ga0500622_0000526 | Ga0500622_0000526_32350_33834 | 485 |
| 445 | 3300053156 | Ga0500622_0007443 | Ga0500622_0007443_1435_2940 | 485 |
| 446 | 3300053158 | Ga0500627_0009954 | Ga0500627_0009954_716_2200 | 485 |
| 447 | iso_pu_bacteria | 2739367756 | 2739791273 | 485 |
| 448 | iso_pu_bacteria | 2834578030 | 2834579933 | 485 |
| 449 | iso_pu_bacteria | 2919679072 | 2919680996 | 485 |
| 450 | 3300005544 | Ga0070686_100000597 | Ga0070686_10000059717 | 486 |
| 451 | 3300015684 | Ga0183365_10002 | Ga0183365_10002330 | 486 |
| 452 | 3300037471 | Ga0395905_0184082 | Ga0395905_0184082_302_1804 | 486 |
| 453 | 3300044656 | Ga0466969_0000193 | Ga0466969_0000193_8784_10286 | 486 |
| 454 | 3300044684 | Ga0466966_0000688 | Ga0466966_0000688_8955_10457 | 486 |
| 455 | 3300044693 | Ga0466961_0003224 | Ga0466961_0003224_4359_5861 | 486 |
| 456 | 3300044694 | Ga0466963_0100827 | Ga0466963_0100827_318_1820 | 486 |
| 457 | 3300044719 | Ga0466971_0002179 | Ga0466971_0002179_4253_5755 | 486 |
| 458 | 3300044765 | Ga0466970_0065108 | Ga0466970_0065108_34_1536 | 486 |
| 459 | 3300044842 | Ga0466957_0002794 | Ga0466957_0002794_2974_4476 | 486 |
| 460 | 3300045049 | Ga0466959_0000118 | Ga0466959_0000118_12003_13505 | 486 |
| 461 | 3300045836 | Ga0466958_0000398 | Ga0466958_0000398_7193_8695 | 486 |
| 462 | 3300046453 | Ga0495627_001043 | Ga0495627_001043_6384_7892 | 486 |
| 463 | 3300048928 | Ga0496125_0000749 | Ga0496125_0000749_7818_9323 | 486 |
| 464 | 3300049822 | Ga0501035_0077431 | Ga0501035_0077431_565_2079 | 486 |
| 465 | 3300049822 | Ga0501035_0208548 | Ga0501035_0208548_127_1608 | 486 |
| 466 | 3300053080 | Ga0500635_0001292 | Ga0500635_0001292_4231_5745 | 486 |
| 467 | 3300053087 | Ga0500643_009931 | Ga0500643_009931_1581_3071 | 486 |
| 468 | 3300053096 | Ga0500641_0000486 | Ga0500641_0000486_11486_12976 | 486 |
| 469 | 3300053104 | Ga0500556_0001909 | Ga0500556_0001909_2673_4163 | 486 |
| 470 | 3300053108 | Ga0500562_000519 | Ga0500562_000519_582_2072 | 486 |
| 471 | 3300053122 | Ga0500608_000397 | Ga0500608_000397_11365_12879 | 486 |
| 472 | 3300053146 | Ga0500588_0005049 | Ga0500588_0005049_961_2493 | 486 |
| 473 | 3300053730 | Ga0500645_000353 | Ga0500645_000353_29568_31058 | 486 |
| 474 | 3300053730 | Ga0500645_000461 | Ga0500645_000461_4196_5686 | 486 |
| 475 | 3300061719 | Ga0466962_0000345 | Ga0466962_0000345_16244_17746 | 486 |
| 476 | iso_pu_bacteria | 2840878972 | 2840883813 | 486 |
| 477 | iso_pu_bacteria | 2854681122 | 2854682736 | 486 |
| 478 | iso_pu_bacteria | 2855020534 | 2855022844 | 486 |
| 479 | iso_pu_bacteria | 2898795034 | 2898796198 | 486 |
| 480 | iso_pu_bacteria | 2899275550 | 2899275703 | 486 |
| 481 | iso_pu_bacteria | 3000405567 | 3000409113 | 486 |
| 482 | iso_pu_bacteria | 8057132660 | 8057133051 | 486 |
| 483 | 3300021377 | Ga0213874_10025668 | Ga0213874_100256681 | 487 |
| 484 | 3300039450 | Ga0436363_1027775 | Ga0436363_1027775_288_1826 | 487 |
| 485 | 3300048924 | Ga0496121_0004259 | Ga0496121_0004259_6485_7993 | 487 |
| 486 | 3300049570 | Ga0501033_0041719 | Ga0501033_0041719_605_2104 | 487 |
| 487 | 3300049572 | Ga0501036_0039031 | Ga0501036_0039031_2248_3747 | 487 |
| 488 | 3300049574 | Ga0501038_0160191 | Ga0501038_0160191_283_1782 | 487 |
| 489 | 3300049575 | Ga0501039_0085206 | Ga0501039_0085206_931_2430 | 487 |
| 490 | 3300049576 | Ga0501040_0010441 | Ga0501040_0010441_3760_5259 | 487 |
| 491 | 3300049577 | Ga0501041_0024027 | Ga0501041_0024027_456_1955 | 487 |
| 492 | 3300049582 | Ga0501048_0050050 | Ga0501048_0050050_1024_2523 | 487 |
| 493 | 3300049591 | Ga0501075_0009175 | Ga0501075_0009175_415_1914 | 487 |
| 494 | 3300049592 | Ga0501076_0010765 | Ga0501076_0010765_1645_3144 | 487 |
| 495 | 3300049741 | Ga0501079_0004232 | Ga0501079_0004232_7115_8614 | 487 |
| 496 | 3300049743 | Ga0501081_0008312 | Ga0501081_0008312_1575_3074 | 487 |
| 497 | 3300049824 | Ga0501045_0124006 | Ga0501045_0124006_56_1555 | 487 |
| 498 | 3300053139 | Ga0500568_0000001 | Ga0500568_0000001_411518_413038 | 487 |
| 499 | 3300054114 | Ga0501084_0018508 | Ga0501084_0018508_4245_5744 | 487 |
| 500 | 3300060353 | Ga0501082_0004153 | Ga0501082_0004153_4909_6408 | 487 |
| 501 | iso_pu_bacteria | 2513237305 | 2514420062 | 487 |
| 502 | iso_pu_bacteria | 2721755686 | 2723575579 | 487 |
| 503 | iso_pu_bacteria | 2841734538 | 2841739465 | 487 |
| 504 | iso_pu_bacteria | 2842333319 | 2842334877 | 487 |
| 505 | iso_pu_bacteria | 2847670302 | 2847675781 | 487 |
| 506 | iso_pu_bacteria | 2847686936 | 2847692427 | 487 |
| 507 | iso_pu_bacteria | 2856314179 | 2856319718 | 487 |
| 508 | iso_pu_bacteria | 2871495908 | 2871501218 | 487 |
| 509 | iso_pu_bacteria | 2874102143 | 2874107506 | 487 |
| 510 | iso_pu_bacteria | 2874123672 | 2874123865 | 487 |
| 511 | iso_pu_bacteria | 2876369609 | 2876375664 | 487 |
| 512 | iso_pu_bacteria | 2876392853 | 2876398626 | 487 |
| 513 | iso_pu_bacteria | 2878035449 | 2878040901 | 487 |
| 514 | iso_pu_bacteria | 2878760144 | 2878765198 | 487 |
| 515 | iso_pu_bacteria | 2878767105 | 2878772905 | 487 |
| 516 | iso_pu_bacteria | 2881147464 | 2881151701 | 487 |
| 517 | iso_pu_bacteria | 2881161766 | 2881167719 | 487 |
| 518 | iso_pu_bacteria | 2882632389 | 2882636462 | 487 |
| 519 | iso_pu_bacteria | 2885305155 | 2885309608 | 487 |
| 520 | iso_pu_bacteria | 2885326080 | 2885330632 | 487 |
| 521 | iso_pu_bacteria | 2885334103 | 2885338941 | 487 |
| 522 | iso_pu_bacteria | 2903540706 | 2903546029 | 487 |
| 523 | iso_pu_bacteria | 2904659560 | 2904665181 | 487 |
| 524 | iso_pu_bacteria | 2906328253 | 2906329840 | 487 |
| 525 | iso_pu_bacteria | 2906414383 | 2906420438 | 487 |
| 526 | iso_pu_bacteria | 2922158528 | 2922160460 | 487 |
| 527 | iso_pu_bacteria | 2924726620 | 2924732323 | 487 |
| 528 | iso_pu_bacteria | 2937822353 | 2937824663 | 487 |
| 529 | iso_pu_bacteria | 2937891427 | 2937893650 | 487 |
| 530 | iso_pu_bacteria | 2937994558 | 2937999887 | 487 |
| 531 | iso_pu_bacteria | 2958115193 | 2958118626 | 487 |
| 532 | iso_pu_bacteria | 2958165035 | 2958170350 | 487 |
| 533 | iso_pu_bacteria | 2961114664 | 2961120182 | 487 |
| 534 | iso_pu_bacteria | 2961163497 | 2961168805 | 487 |
| 535 | iso_pu_bacteria | 2965018300 | 2965024092 | 487 |
| 536 | iso_pu_bacteria | 2968091066 | 2968096441 | 487 |
| 537 | iso_pu_bacteria | 2968097103 | 2968101179 | 487 |
| 538 | iso_pu_bacteria | 2968110612 | 2968116539 | 487 |
| 539 | iso_pu_bacteria | 2968128360 | 2968132231 | 487 |
| 540 | iso_pu_bacteria | 2968171901 | 2968177199 | 487 |
| 541 | iso_pu_bacteria | 2970554993 | 2970560045 | 487 |
| 542 | iso_pu_bacteria | 2977858184 | 2977861097 | 487 |
| 543 | iso_pu_bacteria | 2977864932 | 2977866911 | 487 |
| 544 | iso_pu_bacteria | 2979779861 | 2979780168 | 487 |
| 545 | iso_pu_bacteria | 2987659509 | 2987664836 | 487 |
| 546 | iso_pu_bacteria | 3004188549 | 3004193893 | 487 |
| 547 | iso_pu_bacteria | 8004445564 | 8004447518 | 487 |
| 548 | iso_pu_bacteria | 8004703790 | 8004709528 | 487 |
| 549 | 3300021361 | Ga0213872_10001454 | Ga0213872_1000145411 | 488 |
| 550 | 3300031250 | Ga0265331_10008614 | Ga0265331_100086142 | 488 |
| 551 | 3300032168 | Ga0316593_10000364 | Ga0316593_100003642 | 488 |
| 552 | 3300039447 | Ga0436361_0917304 | Ga0436361_0917304_28750_30249 | 488 |
| 553 | iso_pu_bacteria | 2511231221 | 2512033972 | 488 |
| 554 | iso_pu_bacteria | 2713897090 | 2715499639 | 488 |
| 555 | iso_pu_bacteria | 2738541317 | 2738946388 | 488 |
| 556 | iso_pu_bacteria | 2894817345 | 2894818408 | 488 |
| 557 | iso_pu_bacteria | 2913308742 | 2913310801 | 488 |
| 558 | iso_pu_bacteria | 2924762789 | 2924767191 | 488 |
| 559 | iso_pu_bacteria | 2987666974 | 2987669045 | 488 |
| 560 | iso_pu_bacteria | 8002060224 | 8002063545 | 488 |
| 561 | iso_pu_bacteria | 8045864390 | 8045865199 | 488 |
| 562 | 3300038735 | Ga0400485_03094 | Ga0400485_03094_1749_3323 | 489 |
| 563 | iso_pu_bacteria | 2509276021 | 2509387515 | 489 |
| 564 | iso_pu_bacteria | 2510461069 | 2510840150 | 489 |
| 565 | iso_pu_bacteria | 2513237087 | 2513592719 | 489 |
| 566 | iso_pu_bacteria | 2515075009 | 2515111463 | 489 |
| 567 | iso_pu_bacteria | 2828305725 | 2828310123 | 489 |
| 568 | iso_pu_bacteria | 2841864319 | 2841865299 | 489 |
| 569 | iso_pu_bacteria | 2842341865 | 2842343423 | 489 |
| 570 | iso_pu_bacteria | 2842363717 | 2842365437 | 489 |
| 571 | iso_pu_bacteria | 2842694124 | 2842696911 | 489 |
| 572 | iso_pu_bacteria | 2899803654 | 2899807898 | 489 |
| 573 | iso_pu_bacteria | 2917554339 | 2917557042 | 489 |
| 574 | iso_pu_bacteria | 2929138655 | 2929139680 | 489 |
| 575 | iso_pu_bacteria | 8005460587 | 8005462109 | 489 |
| 576 | iso_pu_bacteria | 8046767195 | 8046769344 | 489 |
| 577 | iso_pu_bacteria | 8057575449 | 8057577135 | 489 |
| 578 | 3300026118 | Ga0207675_100079812 | Ga0207675_1000798123 | 490 |
| 579 | 3300031727 | Ga0316576_10016359 | Ga0316576_100163593 | 490 |
| 580 | 3300036712 | Ga0316584_0029523 | Ga0316584_0029523_1137_2678 | 490 |
| 581 | 3300039062 | Ga0400483_135188 | Ga0400483_135188_104_1654 | 490 |
| 582 | 3300039062 | Ga0400483_198091 | Ga0400483_198091_510_2051 | 490 |
| 583 | 3300045051 | Ga0451576_0059690 | Ga0451576_0059690_846_2393 | 490 |
| 584 | 3300046542 | Ga0495597_0047282 | Ga0495597_0047282_271_1776 | 490 |
| 585 | 3300049568 | Ga0501031_0000019 | Ga0501031_0000019_40143_41645 | 490 |
| 586 | 3300049569 | Ga0501032_0000009 | Ga0501032_0000009_86343_87845 | 490 |
| 587 | 3300049570 | Ga0501033_0000019 | Ga0501033_0000019_140263_141765 | 490 |
| 588 | 3300049571 | Ga0501034_0000044 | Ga0501034_0000044_86343_87845 | 490 |
| 589 | 3300049571 | Ga0501034_0000176 | Ga0501034_0000176_19182_20723 | 490 |
| 590 | 3300049572 | Ga0501036_0000008 | Ga0501036_0000008_86343_87845 | 490 |
| 591 | 3300049573 | Ga0501037_0000055 | Ga0501037_0000055_107249_108751 | 490 |
| 592 | 3300049574 | Ga0501038_0000006 | Ga0501038_0000006_86343_87845 | 490 |
| 593 | 3300049575 | Ga0501039_0000014 | Ga0501039_0000014_140263_141765 | 490 |
| 594 | 3300049822 | Ga0501035_0000096 | Ga0501035_0000096_1857_3359 | 490 |
| 595 | 3300049823 | Ga0501044_0000017 | Ga0501044_0000017_140263_141765 | 490 |
| 596 | 3300050511 | nmdc:mga08y16_134810_c1 | nmdc:mga08y16_134810_c1_812_2410 | 490 |
| 597 | 3300002741 | JGI25157J39369_1000707 | JGI25157J39369_10007077 | 491 |
| 598 | 3300005340 | Ga0070689_100072270 | Ga0070689_1000722702 | 491 |
| 599 | 3300005530 | Ga0070679_100063706 | Ga0070679_1000637063 | 491 |
| 600 | 3300005563 | Ga0068855_100092635 | Ga0068855_1000926352 | 491 |
| 601 | 3300005617 | Ga0068859_100021262 | Ga0068859_1000212626 | 491 |
| 602 | 3300005937 | Ga0081455_10001031 | Ga0081455_1000103121 | 491 |
| 603 | 3300005983 | Ga0081540_1001383 | Ga0081540_10013834 | 491 |
| 604 | 3300006931 | Ga0097620_100021262 | Ga0097620_1000212622 | 491 |
| 605 | 3300009545 | Ga0105237_10074969 | Ga0105237_100749692 | 491 |
| 606 | 3300013308 | Ga0157375_10171314 | Ga0157375_101713141 | 491 |
| 607 | 3300017792 | Ga0163161_10060355 | Ga0163161_100603552 | 491 |
| 608 | 3300021384 | Ga0213876_10000716 | Ga0213876_1000071618 | 491 |
| 609 | 3300021384 | Ga0213876_10003346 | Ga0213876_100033466 | 491 |
| 610 | 3300021388 | Ga0213875_10016246 | Ga0213875_100162462 | 491 |
| 611 | 3300025256 | Ga0209759_1000057 | Ga0209759_100005799 | 491 |
| 612 | 3300025921 | Ga0207652_10047102 | Ga0207652_100471023 | 491 |
| 613 | 3300025936 | Ga0207670_10038590 | Ga0207670_100385902 | 491 |
| 614 | 3300028381 | Ga0268264_10098912 | Ga0268264_100989122 | 491 |
| 615 | 3300028556 | Ga0265337_1001337 | Ga0265337_10013376 | 491 |
| 616 | 3300028573 | Ga0265334_10001279 | Ga0265334_100012796 | 491 |
| 617 | 3300028800 | Ga0265338_10038295 | Ga0265338_100382954 | 491 |
| 618 | 3300031249 | Ga0265339_10034446 | Ga0265339_100344462 | 491 |
| 619 | 3300035117 | Ga0373953_0009093 | Ga0373953_0009093_1594_3120 | 491 |
| 620 | 3300035695 | Ga0373927_0103826 | Ga0373927_0103826_121_1653 | 491 |
| 621 | 3300035724 | Ga0373933_0024125 | Ga0373933_0024125_1719_3245 | 491 |
| 622 | 3300036401 | Ga0373937_0002849 | Ga0373937_0002849_10546_12072 | 491 |
| 623 | 3300037853 | Ga0436364_0238815 | Ga0436364_0238815_4975_6480 | 491 |
| 624 | 3300039437 | Ga0436365_0400394 | Ga0436365_0400394_7361_8866 | 491 |
| 625 | 3300039437 | Ga0436365_0886091 | Ga0436365_0886091_29515_31020 | 491 |
| 626 | 3300039450 | Ga0436363_0609059 | Ga0436363_0609059_4771_6276 | 491 |
| 627 | 3300039450 | Ga0436363_1720929 | Ga0436363_1720929_5635_7140 | 491 |
| 628 | 3300039453 | Ga0436362_0516986 | Ga0436362_0516986_948_2453 | 491 |
| 629 | 3300048910 | Ga0496107_0084790 | Ga0496107_0084790_452_1960 | 491 |
| 630 | 3300048917 | Ga0496114_0007532 | Ga0496114_0007532_561_2069 | 491 |
| 631 | 3300050511 | nmdc:mga08y16_33263_c1 | nmdc:mga08y16_33263_c1_2504_4087 | 491 |
| 632 | 3300005719 | Ga0068861_100116950 | Ga0068861_1001169502 | 492 |
| 633 | 3300005841 | Ga0068863_100014998 | Ga0068863_1000149982 | 492 |
| 634 | 3300006048 | Ga0075363_100038716 | Ga0075363_1000387162 | 492 |
| 635 | 3300006058 | Ga0075432_10000094 | Ga0075432_1000009414 | 492 |
| 636 | 3300025986 | Ga0207658_10023073 | Ga0207658_100230734 | 492 |
| 637 | 3300026118 | Ga0207675_100025874 | Ga0207675_1000258742 | 492 |
| 638 | 3300027907 | Ga0207428_10035873 | Ga0207428_100358732 | 492 |
| 639 | 3300031242 | Ga0265329_10006065 | Ga0265329_100060652 | 492 |
| 640 | 3300031250 | Ga0265331_10000695 | Ga0265331_1000069510 | 492 |
| 641 | 3300031251 | Ga0265327_10004643 | Ga0265327_100046437 | 492 |
| 642 | 3300031344 | Ga0265316_10000169 | Ga0265316_1000016955 | 492 |
| 643 | 3300031712 | Ga0265342_10088293 | Ga0265342_100882932 | 492 |
| 644 | 3300032133 | Ga0316583_10028121 | Ga0316583_100281212 | 492 |
| 645 | 3300035691 | Ga0373931_0053499 | Ga0373931_0053499_594_2108 | 492 |
| 646 | 3300046491 | Ga0495584_0015466 | Ga0495584_0015466_1825_3339 | 492 |
| 647 | 3300046492 | Ga0495585_0077303 | Ga0495585_0077303_108_1622 | 492 |
| 648 | 3300048904 | Ga0496101_0034152 | Ga0496101_0034152_851_2365 | 492 |
| 649 | 3300048906 | Ga0496103_0008642 | Ga0496103_0008642_1878_3392 | 492 |
| 650 | 3300048912 | Ga0496109_0023339 | Ga0496109_0023339_156_1670 | 492 |
| 651 | 3300048912 | Ga0496109_0060051 | Ga0496109_0060051_398_1912 | 492 |
| 652 | 3300048913 | Ga0496110_0097858 | Ga0496110_0097858_790_2304 | 492 |
| 653 | 3300048915 | Ga0496112_0045422 | Ga0496112_0045422_1798_3312 | 492 |
| 654 | 3300049574 | Ga0501038_0181333 | Ga0501038_0181333_48_1562 | 492 |
| 655 | 3300049576 | Ga0501040_0057621 | Ga0501040_0057621_307_1821 | 492 |
| 656 | 3300049577 | Ga0501041_0053334 | Ga0501041_0053334_609_2123 | 492 |
| 657 | 3300049578 | Ga0501042_0007634 | Ga0501042_0007634_510_2024 | 492 |
| 658 | 3300049578 | Ga0501042_0025516 | Ga0501042_0025516_1458_2972 | 492 |
| 659 | 3300049582 | Ga0501048_0021203 | Ga0501048_0021203_1794_3308 | 492 |
| 660 | 3300049582 | Ga0501048_0059997 | Ga0501048_0059997_786_2300 | 492 |
| 661 | 3300049586 | Ga0501070_0111973 | Ga0501070_0111973_698_2218 | 492 |
| 662 | 3300049587 | Ga0501071_0005547 | Ga0501071_0005547_2601_4115 | 492 |
| 663 | 3300049587 | Ga0501071_0100061 | Ga0501071_0100061_553_2067 | 492 |
| 664 | 3300049588 | Ga0501072_0004184 | Ga0501072_0004184_8616_10130 | 492 |
| 665 | 3300049590 | Ga0501074_0044326 | Ga0501074_0044326_1590_3104 | 492 |
| 666 | 3300049590 | Ga0501074_0081192 | Ga0501074_0081192_754_2268 | 492 |
| 667 | 3300049591 | Ga0501075_0105082 | Ga0501075_0105082_545_2059 | 492 |
| 668 | 3300049592 | Ga0501076_0049755 | Ga0501076_0049755_766_2280 | 492 |
| 669 | 3300049593 | Ga0501077_0027418 | Ga0501077_0027418_2034_3548 | 492 |
| 670 | 3300049741 | Ga0501079_0017813 | Ga0501079_0017813_903_2417 | 492 |
| 671 | 3300049741 | Ga0501079_0056185 | Ga0501079_0056185_1076_2590 | 492 |
| 672 | 3300049742 | Ga0501080_0061944 | Ga0501080_0061944_151_1665 | 492 |
| 673 | 3300049743 | Ga0501081_0009224 | Ga0501081_0009224_3871_5385 | 492 |
| 674 | 3300049744 | Ga0501083_0021296 | Ga0501083_0021296_508_2022 | 492 |
| 675 | 3300049822 | Ga0501035_0051742 | Ga0501035_0051742_1586_3100 | 492 |
| 676 | 3300049822 | Ga0501035_0054473 | Ga0501035_0054473_1207_2721 | 492 |
| 677 | 3300049824 | Ga0501045_0049169 | Ga0501045_0049169_756_2270 | 492 |
| 678 | 3300054114 | Ga0501084_0049834 | Ga0501084_0049834_614_2128 | 492 |
| 679 | 3300054114 | Ga0501084_0098628 | Ga0501084_0098628_36_1550 | 492 |
| 680 | 3300060353 | Ga0501082_0054287 | Ga0501082_0054287_719_2233 | 492 |
| 681 | 3300061734 | Ga0530510_0013704 | Ga0530510_0013704_2360_3874 | 492 |
| 682 | 3300061734 | Ga0530510_0017724 | Ga0530510_0017724_2493_4007 | 492 |
| 683 | 3300005719 | Ga0068861_100097602 | Ga0068861_1000976022 | 493 |
| 684 | 3300005937 | Ga0081455_10006263 | Ga0081455_1000626310 | 493 |
| 685 | 3300005937 | Ga0081455_10014607 | Ga0081455_100146072 | 493 |
| 686 | 3300026118 | Ga0207675_100094527 | Ga0207675_1000945272 | 493 |
| 687 | 3300035171 | Ga0373946_0015362 | Ga0373946_0015362_410_1936 | 493 |
| 688 | 3300037853 | Ga0436364_0414769 | Ga0436364_0414769_515_2038 | 493 |
| 689 | 3300048907 | Ga0496104_0009696 | Ga0496104_0009696_1480_3003 | 493 |
| 690 | 3300048908 | Ga0496105_0006289 | Ga0496105_0006289_7037_8560 | 493 |
| 691 | 3300048909 | Ga0496106_0179652 | Ga0496106_0179652_29_1552 | 493 |
| 692 | 3300048911 | Ga0496108_0002227 | Ga0496108_0002227_4894_6417 | 493 |
| 693 | 3300048912 | Ga0496109_0002047 | Ga0496109_0002047_10422_11945 | 493 |
| 694 | 3300048914 | Ga0496111_0008316 | Ga0496111_0008316_176_1699 | 493 |
| 695 | 3300048915 | Ga0496112_0003678 | Ga0496112_0003678_6738_8261 | 493 |
| 696 | 3300048915 | Ga0496112_0068585 | Ga0496112_0068585_332_1843 | 493 |
| 697 | 3300048916 | Ga0496113_0001984 | Ga0496113_0001984_4775_6298 | 493 |
| 698 | 3300048916 | Ga0496113_0076057 | Ga0496113_0076057_373_1884 | 493 |
| 699 | 3300048917 | Ga0496114_0094783 | Ga0496114_0094783_1008_2519 | 493 |
| 700 | 3300048918 | Ga0496115_0001409 | Ga0496115_0001409_11130_12653 | 493 |
| 701 | 3300048922 | Ga0496119_0003333 | Ga0496119_0003333_5243_6754 | 493 |
| 702 | 3300053108 | Ga0500562_000021 | Ga0500562_000021_68951_70510 | 493 |
| 703 | 3300053117 | Ga0500593_000050 | Ga0500593_000050_29870_31390 | 493 |
| 704 | 3300037312 | Ga0395899_0009300 | Ga0395899_0009300_5083_6627 | 494 |
| 705 | 3300038443 | Ga0395901_0001264 | Ga0395901_0001264_22687_24213 | 494 |
| 706 | 3300009177 | Ga0105248_10000071 | Ga0105248_10000071106 | 496 |
| 707 | 3300009551 | Ga0105238_10029957 | Ga0105238_100299574 | 496 |
| 708 | 3300025924 | Ga0207694_10008152 | Ga0207694_100081523 | 496 |
| 709 | 3300025924 | Ga0207694_10078125 | Ga0207694_100781252 | 496 |
| 710 | 3300053119 | Ga0500595_007222 | Ga0500595_007222_1944_3476 | 496 |
| 711 | 3300005435 | Ga0070714_100016732 | Ga0070714_1000167322 | 497 |
| 712 | 3300006028 | Ga0070717_10024295 | Ga0070717_100242952 | 497 |
| 713 | 3300044684 | Ga0466966_0031712 | Ga0466966_0031712_500_2002 | 497 |
| 714 | 3300045836 | Ga0466958_0036198 | Ga0466958_0036198_823_2331 | 497 |
| 715 | 3300046500 | Ga0495596_0000288 | Ga0495596_0000288_31918_33456 | 498 |
| 716 | iso_pu_bacteria | 2510917021 | 2511127112 | 498 |
| 717 | 3300005347 | Ga0070668_100000018 | Ga0070668_100000018102 | 499 |
| 718 | 3300005841 | Ga0068863_100000122 | Ga0068863_10000012242 | 499 |
| 719 | 3300009553 | Ga0105249_10011902 | Ga0105249_100119025 | 499 |
| 720 | 3300025254 | Ga0209148_1000465 | Ga0209148_100046524 | 499 |
| 721 | 3300025931 | Ga0207644_10000602 | Ga0207644_1000060224 | 499 |
| 722 | 3300025961 | Ga0207712_10030942 | Ga0207712_100309422 | 499 |
| 723 | 3300025972 | Ga0207668_10000342 | Ga0207668_100003426 | 499 |
| 724 | 3300026088 | Ga0207641_10000001 | Ga0207641_1000000144 | 499 |
| 725 | 3300028381 | Ga0268264_10032863 | Ga0268264_100328632 | 499 |
| 726 | 3300032004 | Ga0307414_10061493 | Ga0307414_100614932 | 499 |
| 727 | 3300048910 | Ga0496107_0060523 | Ga0496107_0060523_603_2114 | 499 |
| 728 | iso_pu_bacteria | 2818991438 | 2819550569 | 499 |
| 729 | iso_pu_bacteria | 8054302542 | 8054307344 | 499 |
| 730 | 3300009093 | Ga0105240_10000305 | Ga0105240_1000030580 | 500 |
| 731 | 3300009545 | Ga0105237_10003515 | Ga0105237_100035155 | 500 |
| 732 | 3300010375 | Ga0105239_10000037 | Ga0105239_10000037165 | 500 |
| 733 | 3300025913 | Ga0207695_10001017 | Ga0207695_1000101733 | 500 |
| 734 | 3300025914 | Ga0207671_10007045 | Ga0207671_100070457 | 500 |
| 735 | 3300037312 | Ga0395899_0086958 | Ga0395899_0086958_454_1971 | 500 |
| 736 | 3300037418 | Ga0395900_0147150 | Ga0395900_0147150_593_2110 | 500 |
| 737 | 3300044694 | Ga0466963_0128588 | Ga0466963_0128588_153_1679 | 500 |
| 738 | 3300048924 | Ga0496121_0035073 | Ga0496121_0035073_1662_3218 | 500 |
| 739 | 3300053153 | Ga0500616_0018371 | Ga0500616_0018371_1061_2614 | 500 |
| 740 | iso_pu_bacteria | 2599185354 | 2600201021 | 500 |
| 741 | iso_pu_bacteria | 2751185897 | 2753765313 | 500 |
| 742 | 3300005355 | Ga0070671_100024938 | Ga0070671_1000249382 | 501 |
| 743 | 3300005530 | Ga0070679_100050766 | Ga0070679_1000507663 | 501 |
| 744 | 3300005563 | Ga0068855_100059691 | Ga0068855_1000596914 | 501 |
| 745 | 3300005614 | Ga0068856_100012156 | Ga0068856_1000121565 | 501 |
| 746 | 3300005616 | Ga0068852_100006174 | Ga0068852_1000061745 | 501 |
| 747 | 3300005616 | Ga0068852_100007731 | Ga0068852_1000077313 | 501 |
| 748 | 3300005841 | Ga0068863_100060215 | Ga0068863_1000602152 | 501 |
| 749 | 3300009092 | Ga0105250_10005265 | Ga0105250_100052655 | 501 |
| 750 | 3300009093 | Ga0105240_10019011 | Ga0105240_100190115 | 501 |
| 751 | 3300009551 | Ga0105238_10014487 | Ga0105238_100144875 | 501 |
| 752 | 3300009551 | Ga0105238_10027868 | Ga0105238_100278682 | 501 |
| 753 | 3300013100 | Ga0157373_10060215 | Ga0157373_100602152 | 501 |
| 754 | 3300013105 | Ga0157369_10149285 | Ga0157369_101492852 | 501 |
| 755 | 3300013307 | Ga0157372_10013006 | Ga0157372_100130067 | 501 |
| 756 | 3300025909 | Ga0207705_10041040 | Ga0207705_100410402 | 501 |
| 757 | 3300025931 | Ga0207644_10006348 | Ga0207644_100063484 | 501 |
| 758 | 3300025949 | Ga0207667_10151876 | Ga0207667_101518762 | 501 |
| 759 | 3300025960 | Ga0207651_10017670 | Ga0207651_100176702 | 501 |
| 760 | 3300026035 | Ga0207703_10002707 | Ga0207703_100027076 | 501 |
| 761 | 3300026088 | Ga0207641_10052619 | Ga0207641_100526192 | 501 |
| 762 | 3300026142 | Ga0207698_10003399 | Ga0207698_100033995 | 501 |
| 763 | 3300048915 | Ga0496112_0025671 | Ga0496112_0025671_2397_3917 | 501 |
| 764 | 3300048918 | Ga0496115_0000571 | Ga0496115_0000571_20650_22170 | 501 |
| 765 | 3300001979 | JGI24740J21852_10002149 | JGI24740J21852_100021492 | 502 |
| 766 | 3300005341 | Ga0070691_10002895 | Ga0070691_100028952 | 502 |
| 767 | 3300005344 | Ga0070661_100026358 | Ga0070661_1000263582 | 502 |
| 768 | 3300005436 | Ga0070713_100001498 | Ga0070713_1000014982 | 502 |
| 769 | 3300005455 | Ga0070663_100032434 | Ga0070663_1000324342 | 502 |
| 770 | 3300005535 | Ga0070684_100002726 | Ga0070684_1000027262 | 502 |
| 771 | 3300005539 | Ga0068853_100010858 | Ga0068853_1000108584 | 502 |
| 772 | 3300005564 | Ga0070664_100065815 | Ga0070664_1000658151 | 502 |
| 773 | 3300005577 | Ga0068857_100179160 | Ga0068857_1001791602 | 502 |
| 774 | 3300005578 | Ga0068854_100010766 | Ga0068854_1000107662 | 502 |
| 775 | 3300009177 | Ga0105248_10000059 | Ga0105248_1000005963 | 502 |
| 776 | 3300013104 | Ga0157370_10028965 | Ga0157370_100289655 | 502 |
| 777 | 3300013105 | Ga0157369_10088770 | Ga0157369_100887702 | 502 |
| 778 | 3300025904 | Ga0207647_10001078 | Ga0207647_100010784 | 502 |
| 779 | 3300025909 | Ga0207705_10007304 | Ga0207705_100073045 | 502 |
| 780 | 3300025913 | Ga0207695_10014240 | Ga0207695_100142405 | 502 |
| 781 | 3300025917 | Ga0207660_10008412 | Ga0207660_100084125 | 502 |
| 782 | 3300025919 | Ga0207657_10008828 | Ga0207657_100088286 | 502 |
| 783 | 3300025920 | Ga0207649_10021111 | Ga0207649_100211112 | 502 |
| 784 | 3300025924 | Ga0207694_10022405 | Ga0207694_100224052 | 502 |
| 785 | 3300025932 | Ga0207690_10003079 | Ga0207690_100030798 | 502 |
| 786 | 3300025949 | Ga0207667_10008988 | Ga0207667_100089888 | 502 |
| 787 | 3300025981 | Ga0207640_10021214 | Ga0207640_100212142 | 502 |
| 788 | 3300026023 | Ga0207677_10107112 | Ga0207677_101071122 | 502 |
| 789 | 3300026041 | Ga0207639_10031700 | Ga0207639_100317002 | 502 |
| 790 | 3300026078 | Ga0207702_10015322 | Ga0207702_100153222 | 502 |
| 791 | 3300026116 | Ga0207674_10003125 | Ga0207674_1000312513 | 502 |
| 792 | 3300026142 | Ga0207698_10003964 | Ga0207698_100039646 | 502 |
| 793 | 3300031824 | Ga0307413_10044707 | Ga0307413_100447072 | 502 |
| 794 | 3300037312 | Ga0395899_0012431 | Ga0395899_0012431_1567_3099 | 502 |
| 795 | 3300037418 | Ga0395900_0002764 | Ga0395900_0002764_16814_18358 | 502 |
| 796 | 3300044684 | Ga0466966_0076533 | Ga0466966_0076533_401_1933 | 502 |
| 797 | 3300046512 | Ga0495610_0000030 | Ga0495610_0000030_87095_88630 | 502 |
| 798 | 3300047445 | Ga0495677_0005616 | Ga0495677_0005616_2136_3659 | 502 |
| 799 | 3300047470 | Ga0495681_0000011 | Ga0495681_0000011_88597_90132 | 502 |
| 800 | 3300048911 | Ga0496108_0034941 | Ga0496108_0034941_2406_3929 | 502 |
| 801 | 3300048914 | Ga0496111_0014620 | Ga0496111_0014620_1580_3103 | 502 |
| 802 | 3300048915 | Ga0496112_0036881 | Ga0496112_0036881_948_2471 | 502 |
| 803 | 3300049686 | Ga0501257_000095 | Ga0501257_000095_18910_20463 | 502 |
| 804 | 3300049776 | Ga0501280_002283 | Ga0501280_002283_1021_2574 | 502 |
| 805 | iso_pu_bacteria | 2643221605 | 2644040207 | 502 |
| 806 | 3300001979 | JGI24740J21852_10011083 | JGI24740J21852_100110833 | 503 |
| 807 | 3300003791 | Ga0055530_10011836 | Ga0055530_100118362 | 503 |
| 808 | 3300005327 | Ga0070658_10083602 | Ga0070658_100836022 | 503 |
| 809 | 3300005329 | Ga0070683_100019454 | Ga0070683_1000194545 | 503 |
| 810 | 3300005336 | Ga0070680_100003695 | Ga0070680_1000036955 | 503 |
| 811 | 3300005344 | Ga0070661_100014744 | Ga0070661_1000147445 | 503 |
| 812 | 3300005455 | Ga0070663_100018515 | Ga0070663_1000185152 | 503 |
| 813 | 3300005458 | Ga0070681_10032415 | Ga0070681_100324154 | 503 |
| 814 | 3300005530 | Ga0070679_100022016 | Ga0070679_1000220165 | 503 |
| 815 | 3300005563 | Ga0068855_100066595 | Ga0068855_1000665952 | 503 |
| 816 | 3300005564 | Ga0070664_100003103 | Ga0070664_1000031037 | 503 |
| 817 | 3300005616 | Ga0068852_100134989 | Ga0068852_1001349892 | 503 |
| 818 | 3300005844 | Ga0068862_100000067 | Ga0068862_100000067107 | 503 |
| 819 | 3300006038 | Ga0075365_10022854 | Ga0075365_100228542 | 503 |
| 820 | 3300006042 | Ga0075368_10000991 | Ga0075368_100009911 | 503 |
| 821 | 3300006048 | Ga0075363_100026434 | Ga0075363_1000264342 | 503 |
| 822 | 3300006051 | Ga0075364_10078826 | Ga0075364_100788261 | 503 |
| 823 | 3300006177 | Ga0075362_10002672 | Ga0075362_100026724 | 503 |
| 824 | 3300006177 | Ga0075362_10015878 | Ga0075362_100158782 | 503 |
| 825 | 3300006178 | Ga0075367_10009476 | Ga0075367_100094762 | 503 |
| 826 | 3300006186 | Ga0075369_10014705 | Ga0075369_100147051 | 503 |
| 827 | 3300006195 | Ga0075366_10000596 | Ga0075366_100005963 | 503 |
| 828 | 3300006195 | Ga0075366_10005099 | Ga0075366_100050997 | 503 |
| 829 | 3300006353 | Ga0075370_10000043 | Ga0075370_100000437 | 503 |
| 830 | 3300006353 | Ga0075370_10023778 | Ga0075370_100237783 | 503 |
| 831 | 3300006353 | Ga0075370_10056584 | Ga0075370_100565842 | 503 |
| 832 | 3300013104 | Ga0157370_10037299 | Ga0157370_100372992 | 503 |
| 833 | 3300025298 | Ga0209050_1000217 | Ga0209050_100021734 | 503 |
| 834 | 3300025904 | Ga0207647_10007591 | Ga0207647_100075917 | 503 |
| 835 | 3300025907 | Ga0207645_10006878 | Ga0207645_100068787 | 503 |
| 836 | 3300025921 | Ga0207652_10020568 | Ga0207652_100205683 | 503 |
| 837 | 3300025931 | Ga0207644_10022690 | Ga0207644_100226903 | 503 |
| 838 | 3300025933 | Ga0207706_10123176 | Ga0207706_101231762 | 503 |
| 839 | 3300025945 | Ga0207679_10005151 | Ga0207679_100051513 | 503 |
| 840 | 3300026067 | Ga0207678_10000716 | Ga0207678_1000071624 | 503 |
| 841 | 3300026088 | Ga0207641_10021395 | Ga0207641_100213952 | 503 |
| 842 | 3300027866 | Ga0209813_10000053 | Ga0209813_1000005321 | 503 |
| 843 | 3300028380 | Ga0268265_10000021 | Ga0268265_10000021125 | 503 |
| 844 | 3300028381 | Ga0268264_10000330 | Ga0268264_1000033011 | 503 |
| 845 | 3300031251 | Ga0265327_10062793 | Ga0265327_100627932 | 503 |
| 846 | 3300031731 | Ga0307405_10026182 | Ga0307405_100261822 | 503 |
| 847 | 3300031901 | Ga0307406_10031861 | Ga0307406_100318613 | 503 |
| 848 | 3300032002 | Ga0307416_100034538 | Ga0307416_1000345382 | 503 |
| 849 | 3300037312 | Ga0395899_0000804 | Ga0395899_0000804_3365_4900 | 503 |
| 850 | 3300037418 | Ga0395900_0001255 | Ga0395900_0001255_26825_28360 | 503 |
| 851 | 3300037466 | Ga0395898_0027194 | Ga0395898_0027194_2566_4101 | 503 |
| 852 | 3300037471 | Ga0395905_0001765 | Ga0395905_0001765_21578_23113 | 503 |
| 853 | 3300038443 | Ga0395901_0008542 | Ga0395901_0008542_2596_4131 | 503 |
| 854 | 3300038443 | Ga0395901_0220860 | Ga0395901_0220860_262_1782 | 503 |
| 855 | 3300044694 | Ga0466963_0001435 | Ga0466963_0001435_1045_2574 | 503 |
| 856 | 3300046506 | Ga0495583_0000426 | Ga0495583_0000426_8012_9538 | 503 |
| 857 | 3300048919 | Ga0496116_0000039 | Ga0496116_0000039_208208_209743 | 503 |
| 858 | 3300048924 | Ga0496121_0030838 | Ga0496121_0030838_1141_2676 | 503 |
| 859 | 3300048925 | Ga0496122_0066534 | Ga0496122_0066534_370_1905 | 503 |
| 860 | 3300048926 | Ga0496123_0003680 | Ga0496123_0003680_1069_2604 | 503 |
| 861 | 3300048927 | Ga0496124_0002764 | Ga0496124_0002764_5852_7390 | 503 |
| 862 | 3300048928 | Ga0496125_0002786 | Ga0496125_0002786_1066_2604 | 503 |
| 863 | 3300048929 | Ga0496126_0000041 | Ga0496126_0000041_132157_133692 | 503 |
| 864 | 3300048929 | Ga0496126_0071794 | Ga0496126_0071794_562_2094 | 503 |
| 865 | 3300050489 | nmdc:mga03683_625_c1 | nmdc:mga03683_625_c1_2857_4392 | 503 |
| 866 | 3300050489 | nmdc:mga03683_6_c1 | nmdc:mga03683_6_c1_44374_45915 | 503 |
| 867 | 3300050493 | nmdc:mga0k408_6_c1 | nmdc:mga0k408_6_c1_154132_155673 | 503 |
| 868 | 3300050494 | nmdc:mga06z11_147_c1 | nmdc:mga06z11_147_c1_26102_27637 | 503 |
| 869 | 3300050495 | nmdc:mga04h51_24_c1 | nmdc:mga04h51_24_c1_18422_19957 | 503 |
| 870 | 3300050496 | nmdc:mga07m45_3_c1 | nmdc:mga07m45_3_c1_245539_247080 | 503 |
| 871 | 3300050496 | nmdc:mga07m45_4_c1 | nmdc:mga07m45_4_c1_209531_211066 | 503 |
| 872 | 3300050516 | nmdc:mga0sz30_44_c1 | nmdc:mga0sz30_44_c1_6718_8253 | 503 |
| 873 | iso_pu_bacteria | 2739367865 | 2740030137 | 503 |
| 874 | 3300005834 | Ga0068851_10019055 | Ga0068851_100190552 | 504 |
| 875 | 3300026142 | Ga0207698_10010338 | Ga0207698_100103382 | 504 |
| 876 | 3300037312 | Ga0395899_0022192 | Ga0395899_0022192_1712_3235 | 504 |
| 877 | 3300037418 | Ga0395900_0191156 | Ga0395900_0191156_196_1719 | 504 |
| 878 | 3300037466 | Ga0395898_0049253 | Ga0395898_0049253_742_2265 | 504 |
| 879 | 3300038443 | Ga0395901_0147294 | Ga0395901_0147294_891_2414 | 504 |
| 880 | 3300044694 | Ga0466963_0043037 | Ga0466963_0043037_270_1802 | 504 |
| 881 | 3300053087 | Ga0500643_011734 | Ga0500643_011734_905_2443 | 504 |
| 882 | 3300005327 | Ga0070658_10000125 | Ga0070658_1000012555 | 505 |
| 883 | 3300005327 | Ga0070658_10013254 | Ga0070658_100132543 | 505 |
| 884 | 3300005336 | Ga0070680_100072505 | Ga0070680_1000725052 | 505 |
| 885 | 3300005339 | Ga0070660_100005715 | Ga0070660_1000057157 | 505 |
| 886 | 3300005455 | Ga0070663_100000958 | Ga0070663_1000009587 | 505 |
| 887 | 3300005563 | Ga0068855_100060289 | Ga0068855_1000602894 | 505 |
| 888 | 3300005578 | Ga0068854_100011856 | Ga0068854_1000118564 | 505 |
| 889 | 3300005616 | Ga0068852_100000387 | Ga0068852_10000038725 | 505 |
| 890 | 3300005616 | Ga0068852_100145389 | Ga0068852_1001453892 | 505 |
| 891 | 3300005842 | Ga0068858_100144316 | Ga0068858_1001443162 | 505 |
| 892 | 3300013104 | Ga0157370_10064818 | Ga0157370_100648182 | 505 |
| 893 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004651 | 505 |
| 894 | 3300025909 | Ga0207705_10005634 | Ga0207705_100056342 | 505 |
| 895 | 3300025913 | Ga0207695_10007252 | Ga0207695_1000725211 | 505 |
| 896 | 3300025919 | Ga0207657_10001303 | Ga0207657_1000130324 | 505 |
| 897 | 3300025919 | Ga0207657_10001904 | Ga0207657_1000190415 | 505 |
| 898 | 3300025933 | Ga0207706_10046633 | Ga0207706_100466334 | 505 |
| 899 | 3300025949 | Ga0207667_10107443 | Ga0207667_101074432 | 505 |
| 900 | 3300025981 | Ga0207640_10000535 | Ga0207640_1000053518 | 505 |
| 901 | 3300026067 | Ga0207678_10051842 | Ga0207678_100518423 | 505 |
| 902 | 3300026142 | Ga0207698_10000193 | Ga0207698_1000019323 | 505 |
| 903 | 3300031824 | Ga0307413_10019680 | Ga0307413_100196802 | 505 |
| 904 | 3300031852 | Ga0307410_10000957 | Ga0307410_100009576 | 505 |
| 905 | 3300031911 | Ga0307412_10148330 | Ga0307412_101483302 | 505 |
| 906 | 3300031995 | Ga0307409_100030371 | Ga0307409_1000303712 | 505 |
| 907 | 3300031995 | Ga0307409_100145419 | Ga0307409_1001454192 | 505 |
| 908 | 3300032004 | Ga0307414_10040568 | Ga0307414_100405682 | 505 |
| 909 | 3300032005 | Ga0307411_10001513 | Ga0307411_100015136 | 505 |
| 910 | 3300032005 | Ga0307411_10007647 | Ga0307411_100076472 | 505 |
| 911 | 3300037312 | Ga0395899_0000885 | Ga0395899_0000885_13625_15154 | 505 |
| 912 | 3300037418 | Ga0395900_0000031 | Ga0395900_0000031_242417_243946 | 505 |
| 913 | 3300037418 | Ga0395900_0029097 | Ga0395900_0029097_3837_5363 | 505 |
| 914 | 3300037418 | Ga0395900_0059667 | Ga0395900_0059667_843_2372 | 505 |
| 915 | 3300037466 | Ga0395898_0032773 | Ga0395898_0032773_1996_3525 | 505 |
| 916 | 3300037471 | Ga0395905_0000458 | Ga0395905_0000458_33821_35347 | 505 |
| 917 | 3300037471 | Ga0395905_0105913 | Ga0395905_0105913_269_1798 | 505 |
| 918 | 3300038443 | Ga0395901_0000035 | Ga0395901_0000035_41966_43495 | 505 |
| 919 | 3300038443 | Ga0395901_0006984 | Ga0395901_0006984_722_2248 | 505 |
| 920 | 3300002067 | JGI24735J21928_10001163 | JGI24735J21928_100011637 | 506 |
| 921 | 3300002075 | JGI24738J21930_10003997 | JGI24738J21930_100039972 | 506 |
| 922 | 3300005327 | Ga0070658_10172058 | Ga0070658_101720581 | 506 |
| 923 | 3300005339 | Ga0070660_100114842 | Ga0070660_1001148422 | 506 |
| 924 | 3300005366 | Ga0070659_100026185 | Ga0070659_1000261854 | 506 |
| 925 | 3300005539 | Ga0068853_100022761 | Ga0068853_1000227613 | 506 |
| 926 | 3300005563 | Ga0068855_100031052 | Ga0068855_1000310525 | 506 |
| 927 | 3300005577 | Ga0068857_100108075 | Ga0068857_1001080752 | 506 |
| 928 | 3300025904 | Ga0207647_10027206 | Ga0207647_100272062 | 506 |
| 929 | 3300025909 | Ga0207705_10067491 | Ga0207705_100674911 | 506 |
| 930 | 3300025912 | Ga0207707_10034921 | Ga0207707_100349212 | 506 |
| 931 | 3300025913 | Ga0207695_10040465 | Ga0207695_100404654 | 506 |
| 932 | 3300025919 | Ga0207657_10024687 | Ga0207657_100246872 | 506 |
| 933 | 3300025924 | Ga0207694_10011507 | Ga0207694_100115077 | 506 |
| 934 | 3300025932 | Ga0207690_10008542 | Ga0207690_100085422 | 506 |
| 935 | 3300025949 | Ga0207667_10198713 | Ga0207667_101987132 | 506 |
| 936 | 3300025981 | Ga0207640_10043541 | Ga0207640_100435412 | 506 |
| 937 | 3300026041 | Ga0207639_10000260 | Ga0207639_1000026030 | 506 |
| 938 | 3300026116 | Ga0207674_10024869 | Ga0207674_100248692 | 506 |
| 939 | 3300026142 | Ga0207698_10046164 | Ga0207698_100461642 | 506 |
| 940 | 3300037471 | Ga0395905_0073033 | Ga0395905_0073033_663_2195 | 506 |
| 941 | 3300046539 | Ga0495621_0014749 | Ga0495621_0014749_323_1852 | 506 |
| 942 | iso_pu_bacteria | 2882806704 | 2882807681 | 506 |
| 943 | 3300005262 | Ga0065165_1003786 | Ga0065165_10037865 | 507 |
| 944 | 3300005289 | Ga0065704_10070237 | Ga0065704_1007023716 | 507 |
| 945 | 3300009101 | Ga0105247_10003856 | Ga0105247_100038567 | 507 |
| 946 | 3300009553 | Ga0105249_10000105 | Ga0105249_10000105113 | 507 |
| 947 | 3300025900 | Ga0207710_10004304 | Ga0207710_100043043 | 507 |
| 948 | 3300025961 | Ga0207712_10000015 | Ga0207712_10000015113 | 507 |
| 949 | 3300053151 | Ga0500604_0000078 | Ga0500604_0000078_24315_25889 | 507 |
| 950 | iso_pu_bacteria | 2896429255 | 2896430526 | 507 |
| 951 | 3300026023 | Ga0207677_10004145 | Ga0207677_100041452 | 508 |
| 952 | iso_pu_bacteria | 2895880812 | 2895886317 | 508 |
| 953 | 3300005841 | Ga0068863_100075817 | Ga0068863_1000758172 | 509 |
| 954 | 3300025986 | Ga0207658_10001134 | Ga0207658_1000113410 | 509 |
| 955 | 3300031548 | Ga0307408_100025242 | Ga0307408_1000252422 | 513 |
| 956 | iso_pu_bacteria | 2775507255 | 2778123689 | 514 |
| 957 | iso_pu_bacteria | 2919709256 | 2919710013 | 514 |
| 958 | 3300005455 | Ga0070663_100001663 | Ga0070663_1000016632 | 516 |
| 959 | 3300046616 | Ga0495668_0015161 | Ga0495668_0015161_1219_2781 | 516 |
| 960 | 3300053730 | Ga0500645_001891 | Ga0500645_001891_7291_8868 | 517 |
| 961 | 3300001904 | JGI24736J21556_1000469 | JGI24736J21556_10004696 | 518 |
| 962 | 3300053157 | Ga0500624_000045 | Ga0500624_000045_80297_81868 | 518 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8beh-assembly1.cif.gz_M | cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane tip) | 0.986 | 262 | 480 |
| 8e73-assembly1.cif.gz_4M | vigna radiata supercomplex i+iii2 (full bridge) | 0.9774 | 7 | 482 |
| 7ar7-assembly1.cif.gz_M | cryo-em structure of arabidopsis thaliana complex-i (open conformation) | 0.9722 | 7 | 482 |
| 7zmh-assembly1.cif.gz_4 | cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm | 0.9673 | 6 | 479 |
| 8e9g-assembly1.cif.gz_M | mycobacterial respiratory complex i with both quinone positions modelled | 0.9643 | 4 | 484 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFE8_1_132_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.9237 | 6 | 126 | 1.20.1070.10 |
| af_P26288_1_130_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.9062 | 1 | 126 | 1.20.1070.10 |
| af_M1FQK6_1_136_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8867 | 2 | 128 | 1.20.1070.10 |
| af_P26288_1_130_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8733 | 1 | 126 | 1.20.1070.10 |
| af_P0AFE8_1_132_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8433 | 6 | 126 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9EFA4-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.9947 | 111 | 486 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A7Y2PBL1-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.9917 | 270 | 485 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-K1YWP4-F1-model_v4 | Proton-translocating NADH-quinone oxidoreductase, chain M | 0.9896 | 76 | 485 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A3M1XWU0-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.986 | 93 | 486 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A4Q5QT70-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.9859 | 1 | 242 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar