F486903

General Info

Members Datasets Scaffolds Average Seq Length
962 496 831 498

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221699|2644547923
Length 572
Sequence PXILSVVTFLPLVGAGLILLARLFNKGSADGAARWIALITTVAVLAVSAVLVMQFKPELATYQFVERYDWFAAAQYHMGVDGISILFVLLTAFLMPICIVASWXTIXXRVVDYMIAFLVLETLVIGVFTSLDLXXFYIFFEGTLVPMFIIIGVWGGANRIYASYKFFLYTLLGSVLMLLAMLWISVLMLLAMLWIEHFLVLETLVIGVFTSLDLFLFYIFFEGTLVPMFIIIGVWGGANRIYASYKFFLYTLLGSVLMLLAMLWMAAETGTTSIPALKDYAFSPTVQPLLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGILLKLGGYGFILFNLPMFPAASKMFAPLVFVLSAVAIVYTSLVAFRQTDMKKLIAYSSVAHMGFVTMGIFAGNALGVQGAVFQMLSHGLISGALFLCVGVVYDRMHTREIALYGGLTARMPWFAAIFLLFTMANVGLPGTSGFIGEILTMTGVYGVSTWTALFAATGVIFSAVYALTLYRNVMFGEITNPAMKAITDVDRRELLIFVPLIIGTLWLGVQPGLVLDYTAASVEALTSAFQLAIGG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
4 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
5 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
6 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
7 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
8 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
9 2547132512 Azospira oryzae 6a3 Isolate Unclassified
10 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
11 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
12 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
13 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
14 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
15 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
16 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
17 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
18 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
19 2643221583 Caulobacter sp. Root655 Isolate Unclassified
20 2643221584 Caulobacter sp. Root656 Isolate Unclassified
21 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
22 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
23 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
24 2643221640 Caulobacter sp. Root342 Isolate Unclassified
25 2643221642 Caulobacter sp. Root343 Isolate Unclassified
26 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
27 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
28 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
29 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
30 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
31 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
32 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
33 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
34 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
35 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
36 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
37 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
38 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
39 2818991435 Caulobacter henricii 536 Isolate Unclassified
40 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
41 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
42 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
43 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
44 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
45 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
46 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
47 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
48 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
49 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
50 2842694124 Methylopila sp. R-72369 Isolate Unclassified
51 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
52 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
53 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
54 2849560528 Caulobacter zeae 410 Isolate Unclassified
55 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
56 2851153111 Caulobacter radicis 736 Isolate Unclassified
57 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
58 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
59 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
60 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
61 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
62 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
63 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
64 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
65 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
66 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
67 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
68 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
69 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
70 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
71 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
72 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
73 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
74 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
75 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
76 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
77 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
78 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
79 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
80 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
81 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
82 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
83 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
84 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
85 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
86 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
87 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
88 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
89 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
90 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
91 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
92 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
93 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
94 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
95 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
96 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
97 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
98 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
99 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
100 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
101 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
102 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
103 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
104 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
105 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
106 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
107 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
108 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
109 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
110 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
111 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
112 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
113 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
114 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
115 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
116 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
117 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
118 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
119 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
120 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
121 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
122 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
123 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
124 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
125 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
126 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
127 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
128 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
129 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
130 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
131 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
132 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
133 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
134 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
135 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
136 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
137 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
138 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
139 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
140 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
141 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
142 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
143 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
144 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
145 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
146 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
147 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
148 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
149 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
150 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
151 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
152 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
153 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
154 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
155 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
156 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
157 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
158 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
159 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
160 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
161 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
162 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
163 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
164 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
165 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
166 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
167 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
168 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
169 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
170 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
171 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
172 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
173 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
174 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
175 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
176 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
177 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
178 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
179 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
180 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
181 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
182 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
183 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
184 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
185 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
186 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
187 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
188 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
189 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
190 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
191 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
192 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
193 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
194 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
195 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
196 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
197 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
198 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
199 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
200 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
201 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
202 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
204 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
205 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
206 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
207 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
208 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
209 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
210 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
211 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
212 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
213 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
214 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
215 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
216 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
217 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
218 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
219 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
220 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
221 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
222 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
223 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
224 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
228 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
231 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
275 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
276 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
277 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
278 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
279 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
283 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
284 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
285 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
286 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
287 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
288 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
289 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
290 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
291 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
292 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
293 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
294 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
295 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
296 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
297 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
298 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
299 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
300 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
301 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
302 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
303 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
304 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
305 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
306 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
307 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
308 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
309 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
310 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
311 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
312 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
313 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
314 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
316 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
317 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
318 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
319 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
320 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
324 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
325 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
326 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
333 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
334 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
335 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
336 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
337 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
338 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
339 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
340 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
341 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
342 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
343 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
344 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
345 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
346 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
347 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
348 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
349 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
350 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
351 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
352 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
353 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
354 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
355 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
356 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
357 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
358 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
362 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
363 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
364 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
365 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
366 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
367 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
368 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
369 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
370 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
371 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
372 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
373 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
374 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
375 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
376 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
377 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
378 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
379 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
380 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
381 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
382 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
383 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
384 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
385 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
386 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
396 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
397 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
398 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
399 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
400 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
401 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
402 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
403 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
404 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
405 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
406 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
407 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
423 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
424 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
425 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
426 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
427 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
428 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
429 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
430 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
431 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
432 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
433 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
434 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
435 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
436 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
437 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
440 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
441 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
442 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
443 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
444 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
445 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
446 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
447 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
448 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
449 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
450 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
451 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
452 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
453 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
454 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
455 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
456 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
457 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
458 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
459 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
460 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
461 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
462 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
463 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
464 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
465 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
466 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
467 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
468 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
469 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
470 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
471 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
472 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
473 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
474 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
475 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
476 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
477 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
478 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
479 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
480 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
481 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
482 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
483 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
484 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
485 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
486 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
487 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
488 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
489 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
490 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
491 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
492 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
493 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
494 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
495 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
496 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.28
Metatranscriptomes 0.1
Isolates 13.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.24
Nodule 5.82
Rhizoplane 4.05
Rhizosphere 65.18
Stem 0
Stem Tuber 0.1
Unclassified 10.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000469 3300001904 Bacteria 7572
2 JGI24740J21852_10002149 3300001979 Bacteria 9011
3 JGI24740J21852_10011083 3300001979 Bacteria 3444
4 JGI24735J21928_10001159 3300002067 Bacteria 9419
5 JGI24735J21928_10001163 3300002067 Bacteria 9410
6 JGI24738J21930_10003997 3300002075 Bacteria 3661
7 JGI25157J39369_1000707 3300002741 Bacteria 17999
8 Ga0055537_1005923 3300003773 Bacteria 3193
9 Ga0055536_1005242 3300003781 Bacteria 6390
10 Ga0055536_1005282 3300003781 Bacteria 6360
11 Ga0055536_1008966 3300003781 Bacteria 4214
12 Ga0055528_1005371 3300003790 Bacteria 5980
13 Ga0055530_10000647 3300003791 Bacteria 29932
14 Ga0055530_10001148 3300003791 Bacteria 20593
15 Ga0055530_10006282 3300003791 Bacteria 5346
16 Ga0055530_10011836 3300003791 Bacteria 3096
17 Ga0055531_10003600 3300003794 Bacteria 9796
18 Ga0055531_10008745 3300003794 Bacteria 5283
19 Ga0055531_10014013 3300003794 Bacteria 3647
20 Ga0065165_1000845 3300005262 Bacteria 40173
21 Ga0065165_1003786 3300005262 Bacteria 10124
22 Ga0065165_1005117 3300005262 Bacteria 7595
23 Ga0065704_10070237 3300005289 Bacteria 52535
24 Ga0065707_10000608 3300005295 Bacteria 19207
25 Ga0070658_10000125 3300005327 Bacteria 68211
26 Ga0070658_10013254 3300005327 Bacteria 6613
27 Ga0070658_10083602 3300005327 Bacteria 2624
28 Ga0070658_10093326 3300005327 Bacteria 2482
29 Ga0070658_10172058 3300005327 Bacteria 1820
30 Ga0070683_100019454 3300005329 Bacteria 6031
31 Ga0070670_100000037 3300005331 Bacteria 156070
32 Ga0070677_10000656 3300005333 Bacteria 11544
33 Ga0070680_100002884 3300005336 Bacteria 12785
34 Ga0070680_100003695 3300005336 Bacteria 11429
35 Ga0070680_100029645 3300005336 Bacteria 4394
36 Ga0070680_100030844 3300005336 Bacteria 4307
37 Ga0070680_100072505 3300005336 Bacteria 2830
38 Ga0070680_100102079 3300005336 Bacteria 2381
39 Ga0070682_100012466 3300005337 Bacteria 4877
40 Ga0068868_100000001 3300005338 Bacteria 282170
41 Ga0070660_100003034 3300005339 Bacteria 11561
42 Ga0070660_100005715 3300005339 Bacteria 8612
43 Ga0070660_100028150 3300005339 Bacteria 4202
44 Ga0070660_100114842 3300005339 Bacteria 2145
45 Ga0070689_100072270 3300005340 Bacteria 2696
46 Ga0070691_10002895 3300005341 Bacteria 7695
47 Ga0070691_10019229 3300005341 Bacteria 3150
48 Ga0070691_10026589 3300005341 Bacteria 2698
49 Ga0070661_100014744 3300005344 Bacteria 5512
50 Ga0070661_100026358 3300005344 Bacteria 4180
51 Ga0070668_100000018 3300005347 Bacteria 99142
52 Ga0070668_100002188 3300005347 Bacteria 14336
53 Ga0070668_100074951 3300005347 Bacteria 2641
54 Ga0070669_100000329 3300005353 Bacteria 36963
55 Ga0070669_100023151 3300005353 Bacteria 4446
56 Ga0070675_100127929 3300005354 Bacteria 2163
57 Ga0070671_100001250 3300005355 Bacteria 19045
58 Ga0070671_100024938 3300005355 Bacteria 4900
59 Ga0070671_100026330 3300005355 Bacteria 4779
60 Ga0070659_100000001 3300005366 Bacteria 576390
61 Ga0070659_100026185 3300005366 Bacteria 4486
62 Ga0070659_100067276 3300005366 Bacteria 2841
63 Ga0070659_100096585 3300005366 Bacteria 2374
64 Ga0070659_100104104 3300005366 Bacteria 2286
65 Ga0070667_100000083 3300005367 Bacteria 118261
66 Ga0070667_100010505 3300005367 Bacteria 7646
67 Ga0070714_100016732 3300005435 Bacteria 5929
68 Ga0070713_100001498 3300005436 Bacteria 14893
69 Ga0070705_100041450 3300005440 Bacteria 2625
70 Ga0070663_100000958 3300005455 Bacteria 15673
71 Ga0070663_100001663 3300005455 Bacteria 12303
72 Ga0070663_100008703 3300005455 Bacteria 6257
73 Ga0070663_100018515 3300005455 Bacteria 4569
74 Ga0070663_100032434 3300005455 Bacteria 3600
75 Ga0070681_10020073 3300005458 Bacteria 6696
76 Ga0070681_10032415 3300005458 Bacteria 5244
77 Ga0070681_10227695 3300005458 Bacteria 1779
78 Ga0070679_100005502 3300005530 Bacteria 11741
79 Ga0070679_100006911 3300005530 Bacteria 10585
80 Ga0070679_100022016 3300005530 Bacteria 6226
81 Ga0070679_100050766 3300005530 Bacteria 4131
82 Ga0070679_100063706 3300005530 Bacteria 3675
83 Ga0070684_100002726 3300005535 Bacteria 13054
84 Ga0068853_100005921 3300005539 Bacteria 9651
85 Ga0068853_100010858 3300005539 Bacteria 7379
86 Ga0068853_100015961 3300005539 Bacteria 6174
87 Ga0068853_100022761 3300005539 Bacteria 5237
88 Ga0068853_100025697 3300005539 Bacteria 4942
89 Ga0068853_100081486 3300005539 Bacteria 2834
90 Ga0068853_100127855 3300005539 Bacteria 2271
91 Ga0070686_100000597 3300005544 Bacteria 21352
92 Ga0070695_100032791 3300005545 Bacteria 3247
93 Ga0070665_100000116 3300005548 Bacteria 150141
94 Ga0070665_100000334 3300005548 Bacteria 72297
95 Ga0070665_100000883 3300005548 Bacteria 38439
96 Ga0070665_100005159 3300005548 Bacteria 13516
97 Ga0070704_100025527 3300005549 Bacteria 3892
98 Ga0068855_100031052 3300005563 Bacteria 6383
99 Ga0068855_100051832 3300005563 Bacteria 4833
100 Ga0068855_100059691 3300005563 Bacteria 4462
101 Ga0068855_100060289 3300005563 Bacteria 4438
102 Ga0068855_100066595 3300005563 Bacteria 4199
103 Ga0068855_100092635 3300005563 Bacteria 3485
104 Ga0068855_100160596 3300005563 Bacteria 2551
105 Ga0070664_100003103 3300005564 Bacteria 13439
106 Ga0070664_100065815 3300005564 Bacteria 3094
107 Ga0068857_100068835 3300005577 Bacteria 3151
108 Ga0068857_100108075 3300005577 Bacteria 2499
109 Ga0068857_100179160 3300005577 Bacteria 1928
110 Ga0068854_100010766 3300005578 Bacteria 5934
111 Ga0068854_100011856 3300005578 Bacteria 5693
112 Ga0068856_100012156 3300005614 Bacteria 8339
113 Ga0068852_100000387 3300005616 Bacteria 29490
114 Ga0068852_100006174 3300005616 Bacteria 8640
115 Ga0068852_100007731 3300005616 Bacteria 7862
116 Ga0068852_100134989 3300005616 Bacteria 2277
117 Ga0068852_100145389 3300005616 Bacteria 2199
118 Ga0068859_100021262 3300005617 Bacteria 6511
119 Ga0068859_100057359 3300005617 Bacteria 3922
120 Ga0068864_100000116 3300005618 Bacteria 79213
121 Ga0068864_100000363 3300005618 Bacteria 39706
122 Ga0068861_100097602 3300005719 Bacteria 2331
123 Ga0068861_100116950 3300005719 Bacteria 2145
124 Ga0068851_10011399 3300005834 Bacteria 4168
125 Ga0068851_10019055 3300005834 Bacteria 3315
126 Ga0068863_100000007 3300005841 Bacteria 257578
127 Ga0068863_100000122 3300005841 Bacteria 81534
128 Ga0068863_100003837 3300005841 Bacteria 14865
129 Ga0068863_100014998 3300005841 Bacteria 7444
130 Ga0068863_100039222 3300005841 Bacteria 4507
131 Ga0068863_100059984 3300005841 Bacteria 3599
132 Ga0068863_100060215 3300005841 Bacteria 3590
133 Ga0068863_100075817 3300005841 Bacteria 3182
134 Ga0068858_100000853 3300005842 Bacteria 31569
135 Ga0068858_100004079 3300005842 Bacteria 14391
136 Ga0068858_100012038 3300005842 Bacteria 8154
137 Ga0068858_100043412 3300005842 Bacteria 4168
138 Ga0068858_100144316 3300005842 Bacteria 2235
139 Ga0068860_100000348 3300005843 Bacteria 62147
140 Ga0068860_100001231 3300005843 Bacteria 27931
141 Ga0068860_100063874 3300005843 Bacteria 3497
142 Ga0068860_100066828 3300005843 Bacteria 3416
143 Ga0068862_100000067 3300005844 Bacteria 123668
144 Ga0068862_100000235 3300005844 Bacteria 61301
145 Ga0068862_100026581 3300005844 Bacteria 4865
146 Ga0081455_10001031 3300005937 Bacteria 35153
147 Ga0081455_10006263 3300005937 Bacteria 12803
148 Ga0081455_10014607 3300005937 Bacteria 7684
149 Ga0081540_1001263 3300005983 Bacteria 22058
150 Ga0081540_1001383 3300005983 Bacteria 21036
151 Ga0070717_10024295 3300006028 Bacteria 4810
152 Ga0075365_10000227 3300006038 Bacteria 19112
153 Ga0075365_10022854 3300006038 Bacteria 3924
154 Ga0075368_10000991 3300006042 Bacteria 8873
155 Ga0075368_10006977 3300006042 Bacteria 3973
156 Ga0075363_100000062 3300006048 Bacteria 21873
157 Ga0075363_100026434 3300006048 Bacteria 2969
158 Ga0075363_100038716 3300006048 Bacteria 2508
159 Ga0075364_10000935 3300006051 Bacteria 15418
160 Ga0075364_10001197 3300006051 Bacteria 13931
161 Ga0075364_10013747 3300006051 Bacteria 4985
162 Ga0075364_10078826 3300006051 Bacteria 2176
163 Ga0075432_10000094 3300006058 Bacteria 18657
164 Ga0075362_10002672 3300006177 Bacteria 6057
165 Ga0075362_10015878 3300006177 Bacteria 3072
166 Ga0075367_10000119 3300006178 Bacteria 22688
167 Ga0075367_10009476 3300006178 Bacteria 5091
168 Ga0075367_10094182 3300006178 Bacteria 1825
169 Ga0075369_10000060 3300006186 Bacteria 28160
170 Ga0075369_10014705 3300006186 Bacteria 3131
171 Ga0075427_10000023 3300006194 Bacteria 10265
172 Ga0075366_10000596 3300006195 Bacteria 16937
173 Ga0075366_10005099 3300006195 Bacteria 7103
174 Ga0075366_10051698 3300006195 Bacteria 2441
175 Ga0075370_10000043 3300006353 Bacteria 38612
176 Ga0075370_10000066 3300006353 Bacteria 31728
177 Ga0075370_10020413 3300006353 Bacteria 3621
178 Ga0075370_10023778 3300006353 Bacteria 3378
179 Ga0075370_10056584 3300006353 Bacteria 2229
180 Ga0075433_10026622 3300006852 Bacteria 4899
181 Ga0075434_100122090 3300006871 Bacteria 2621
182 Ga0075429_100006297 3300006880 Bacteria 10275
183 Ga0075436_100012782 3300006914 Bacteria 5756
184 Ga0097620_100021262 3300006931 Bacteria 6511
185 Ga0097620_100057357 3300006931 Bacteria 3922
186 Ga0075435_100016479 3300007076 Bacteria 5573
187 Ga0075435_100125914 3300007076 Bacteria 2141
188 Ga0105250_10002835 3300009092 Bacteria 8495
189 Ga0105250_10005265 3300009092 Bacteria 5816
190 Ga0105240_10000305 3300009093 Bacteria 94979
191 Ga0105240_10010558 3300009093 Bacteria 12971
192 Ga0105240_10019011 3300009093 Bacteria 9198
193 Ga0105240_10041126 3300009093 Bacteria 5903
194 Ga0105240_10133888 3300009093 Bacteria 2969
195 Ga0105245_10085797 3300009098 Bacteria 2886
196 Ga0105247_10003856 3300009101 Bacteria 9704
197 Ga0114129_10370390 3300009147 Bacteria 1893
198 Ga0105241_10060054 3300009174 Bacteria 2924
199 Ga0105248_10000059 3300009177 Bacteria 137176
200 Ga0105248_10000071 3300009177 Bacteria 118281
201 Ga0105248_10000438 3300009177 Bacteria 47263
202 Ga0105248_10045112 3300009177 Bacteria 4943
203 Ga0105248_10090660 3300009177 Bacteria 3442
204 Ga0105237_10003515 3300009545 Bacteria 18584
205 Ga0105237_10074969 3300009545 Bacteria 3375
206 Ga0105238_10011427 3300009551 Bacteria 8942
207 Ga0105238_10014487 3300009551 Bacteria 7973
208 Ga0105238_10027868 3300009551 Bacteria 5757
209 Ga0105238_10028949 3300009551 Bacteria 5642
210 Ga0105238_10029957 3300009551 Bacteria 5541
211 Ga0105238_10049267 3300009551 Bacteria 4243
212 Ga0105249_10000105 3300009553 Bacteria 117181
213 Ga0105249_10009441 3300009553 Bacteria 8541
214 Ga0105249_10011902 3300009553 Bacteria 7652
215 Ga0105249_10046170 3300009553 Bacteria 3964
216 Ga0105239_10000037 3300010375 Bacteria 206779
217 Ga0105239_10107230 3300010375 Bacteria 3095
218 Ga0105246_10017989 3300011119 Bacteria 4500
219 Ga0157373_10019439 3300013100 Bacteria 4943
220 Ga0157373_10030864 3300013100 Bacteria 3856
221 Ga0157373_10060215 3300013100 Bacteria 2690
222 Ga0157370_10018896 3300013104 Bacteria 6930
223 Ga0157370_10028965 3300013104 Bacteria 5441
224 Ga0157370_10037299 3300013104 Bacteria 4712
225 Ga0157370_10046511 3300013104 Bacteria 4161
226 Ga0157370_10064818 3300013104 Bacteria 3458
227 Ga0157370_10214112 3300013104 Bacteria 1785
228 Ga0157369_10066871 3300013105 Bacteria 3866
229 Ga0157369_10088770 3300013105 Bacteria 3300
230 Ga0157369_10149285 3300013105 Bacteria 2471
231 Ga0163162_10090862 3300013306 Bacteria 3135
232 Ga0157372_10013006 3300013307 Bacteria 8879
233 Ga0157372_10029019 3300013307 Bacteria 6036
234 Ga0157372_10202608 3300013307 Bacteria 2299
235 Ga0157375_10171314 3300013308 Bacteria 2319
236 Ga0183365_10002 3300015684 Bacteria 545891
237 Ga0163161_10060355 3300017792 Bacteria 2760
238 Ga0213873_10001565 3300021358 Bacteria 3823
239 Ga0213872_10001454 3300021361 Bacteria 15422
240 Ga0213872_10005154 3300021361 Bacteria 6770
241 Ga0213874_10025668 3300021377 Bacteria 1664
242 Ga0213876_10000544 3300021384 Bacteria 28326
243 Ga0213876_10000716 3300021384 Bacteria 23196
244 Ga0213876_10003346 3300021384 Bacteria 9180
245 Ga0213875_10016246 3300021388 Bacteria 3611
246 Ga0213871_10006931 3300021441 Bacteria 2424
247 Ga0209566_100542 3300025225 Bacteria 25524
248 Ga0209674_101649 3300025226 Bacteria 5579
249 Ga0209148_1000465 3300025254 Bacteria 43292
250 Ga0209759_1000057 3300025256 Bacteria 205181
251 Ga0209565_1000332 3300025263 Bacteria 42136
252 Ga0209676_1000327 3300025292 Bacteria 91596
253 Ga0209676_1000409 3300025292 Bacteria 77127
254 Ga0209758_1002592 3300025297 Bacteria 18133
255 Ga0209758_1005274 3300025297 Bacteria 10105
256 Ga0209050_1000101 3300025298 Bacteria 230076
257 Ga0209050_1000217 3300025298 Bacteria 128833
258 Ga0209050_1004277 3300025298 Bacteria 9792
259 Ga0209050_1005272 3300025298 Bacteria 8226
260 Ga0209050_1013083 3300025298 Bacteria 3731
261 Ga0209256_1002189 3300025299 Bacteria 16751
262 Ga0209256_1003655 3300025299 Bacteria 10519
263 Ga0209257_1000178 3300025304 Bacteria 160969
264 Ga0209257_1000220 3300025304 Bacteria 135116
265 Ga0209257_1000386 3300025304 Bacteria 88085
266 Ga0209257_1005253 3300025304 Bacteria 9242
267 Ga0209257_1005921 3300025304 Bacteria 8228
268 Ga0209257_1009127 3300025304 Bacteria 5409
269 Ga0207682_10000833 3300025893 Bacteria 14256
270 Ga0207710_10004304 3300025900 Bacteria 6232
271 Ga0207647_10001078 3300025904 Bacteria 21029
272 Ga0207647_10007591 3300025904 Bacteria 7815
273 Ga0207647_10027206 3300025904 Bacteria 3731
274 Ga0207645_10006878 3300025907 Bacteria 8111
275 Ga0207705_10000004 3300025909 Bacteria 705756
276 Ga0207705_10001414 3300025909 Bacteria 19120
277 Ga0207705_10005634 3300025909 Bacteria 9354
278 Ga0207705_10007304 3300025909 Bacteria 8125
279 Ga0207705_10019624 3300025909 Bacteria 4833
280 Ga0207705_10041040 3300025909 Bacteria 3319
281 Ga0207705_10067491 3300025909 Bacteria 2588
282 Ga0207707_10001296 3300025912 Bacteria 23280
283 Ga0207707_10034921 3300025912 Bacteria 4398
284 Ga0207707_10054709 3300025912 Bacteria 3474
285 Ga0207695_10000718 3300025913 Bacteria 64451
286 Ga0207695_10001017 3300025913 Bacteria 49429
287 Ga0207695_10001195 3300025913 Bacteria 44633
288 Ga0207695_10003313 3300025913 Bacteria 22832
289 Ga0207695_10007252 3300025913 Bacteria 14157
290 Ga0207695_10014240 3300025913 Bacteria 9433
291 Ga0207695_10040465 3300025913 Bacteria 4996
292 Ga0207671_10007045 3300025914 Bacteria 9848
293 Ga0207660_10003153 3300025917 Bacteria 10795
294 Ga0207660_10008412 3300025917 Bacteria 6676
295 Ga0207657_10001137 3300025919 Bacteria 28234
296 Ga0207657_10001303 3300025919 Bacteria 26487
297 Ga0207657_10001904 3300025919 Bacteria 22544
298 Ga0207657_10008828 3300025919 Bacteria 10195
299 Ga0207657_10024687 3300025919 Bacteria 5558
300 Ga0207657_10042588 3300025919 Bacteria 4004
301 Ga0207649_10021111 3300025920 Bacteria 3743
302 Ga0207652_10003865 3300025921 Bacteria 12269
303 Ga0207652_10020568 3300025921 Bacteria 5438
304 Ga0207652_10047102 3300025921 Bacteria 3682
305 Ga0207652_10052024 3300025921 Bacteria 3514
306 Ga0207681_10000448 3300025923 Bacteria 28899
307 Ga0207694_10008152 3300025924 Bacteria 7917
308 Ga0207694_10011507 3300025924 Bacteria 6678
309 Ga0207694_10022405 3300025924 Bacteria 4791
310 Ga0207694_10042460 3300025924 Bacteria 3508
311 Ga0207694_10056099 3300025924 Bacteria 3059
312 Ga0207694_10078125 3300025924 Bacteria 2594
313 Ga0207650_10000062 3300025925 Bacteria 149776
314 Ga0207659_10106133 3300025926 Bacteria 2126
315 Ga0207687_10027427 3300025927 Bacteria 3821
316 Ga0207644_10000003 3300025931 Bacteria 585905
317 Ga0207644_10000602 3300025931 Bacteria 22923
318 Ga0207644_10006348 3300025931 Bacteria 7698
319 Ga0207644_10021731 3300025931 Bacteria 4375
320 Ga0207644_10022690 3300025931 Bacteria 4290
321 Ga0207690_10000051 3300025932 Bacteria 107367
322 Ga0207690_10000053 3300025932 Bacteria 105125
323 Ga0207690_10003079 3300025932 Bacteria 10047
324 Ga0207690_10005435 3300025932 Bacteria 7507
325 Ga0207690_10008542 3300025932 Bacteria 6078
326 Ga0207706_10046633 3300025933 Bacteria 3837
327 Ga0207706_10123176 3300025933 Bacteria 2281
328 Ga0207670_10038590 3300025936 Bacteria 3121
329 Ga0207711_10001604 3300025941 Bacteria 20913
330 Ga0207711_10016191 3300025941 Bacteria 6190
331 Ga0207679_10005151 3300025945 Bacteria 8185
332 Ga0207667_10007334 3300025949 Bacteria 13274
333 Ga0207667_10008988 3300025949 Bacteria 11821
334 Ga0207667_10043233 3300025949 Bacteria 4782
335 Ga0207667_10092888 3300025949 Bacteria 3116
336 Ga0207667_10107443 3300025949 Bacteria 2879
337 Ga0207667_10151876 3300025949 Bacteria 2383
338 Ga0207667_10198713 3300025949 Bacteria 2057
339 Ga0207651_10017670 3300025960 Bacteria 4220
340 Ga0207712_10000015 3300025961 Bacteria 346689
341 Ga0207712_10003975 3300025961 Bacteria 9334
342 Ga0207712_10017866 3300025961 Bacteria 4614
343 Ga0207712_10018228 3300025961 Bacteria 4569
344 Ga0207712_10030942 3300025961 Bacteria 3602
345 Ga0207668_10000342 3300025972 Bacteria 30270
346 Ga0207668_10001123 3300025972 Bacteria 15955
347 Ga0207668_10003651 3300025972 Bacteria 9043
348 Ga0207668_10066068 3300025972 Bacteria 2562
349 Ga0207640_10000535 3300025981 Bacteria 22763
350 Ga0207640_10021214 3300025981 Bacteria 3868
351 Ga0207640_10043541 3300025981 Bacteria 2870
352 Ga0207658_10000218 3300025986 Bacteria 60270
353 Ga0207658_10001134 3300025986 Bacteria 21429
354 Ga0207658_10023073 3300025986 Bacteria 4338
355 Ga0207658_10033721 3300025986 Bacteria 3653
356 Ga0207677_10000013 3300026023 Bacteria 186519
357 Ga0207677_10004145 3300026023 Bacteria 7757
358 Ga0207677_10107112 3300026023 Bacteria 2072
359 Ga0207703_10000038 3300026035 Bacteria 175917
360 Ga0207703_10002707 3300026035 Bacteria 15178
361 Ga0207703_10005677 3300026035 Bacteria 10017
362 Ga0207639_10000260 3300026041 Bacteria 38302
363 Ga0207639_10031700 3300026041 Bacteria 3886
364 Ga0207639_10042224 3300026041 Bacteria 3416
365 Ga0207678_10000104 3300026067 Bacteria 69027
366 Ga0207678_10000716 3300026067 Bacteria 30304
367 Ga0207678_10051842 3300026067 Bacteria 3541
368 Ga0207702_10015322 3300026078 Bacteria 6355
369 Ga0207641_10000001 3300026088 Bacteria 1180841
370 Ga0207641_10000012 3300026088 Bacteria 375486
371 Ga0207641_10005823 3300026088 Bacteria 10457
372 Ga0207641_10021395 3300026088 Bacteria 5315
373 Ga0207641_10052619 3300026088 Bacteria 3449
374 Ga0207676_10000179 3300026095 Bacteria 55697
375 Ga0207676_10000437 3300026095 Bacteria 35190
376 Ga0207676_10045215 3300026095 Bacteria 3401
377 Ga0207674_10003125 3300026116 Bacteria 20421
378 Ga0207674_10024869 3300026116 Bacteria 6391
379 Ga0207675_100025874 3300026118 Bacteria 5459
380 Ga0207675_100079812 3300026118 Bacteria 3067
381 Ga0207675_100094527 3300026118 Bacteria 2812
382 Ga0207675_100137525 3300026118 Bacteria 2319
383 Ga0207683_10184130 3300026121 Bacteria 1894
384 Ga0207698_10000193 3300026142 Bacteria 38052
385 Ga0207698_10003399 3300026142 Bacteria 9579
386 Ga0207698_10003964 3300026142 Bacteria 8973
387 Ga0207698_10010338 3300026142 Bacteria 5987
388 Ga0207698_10046164 3300026142 Bacteria 3287
389 Ga0209389_1000117 3300027296 Bacteria 71506
390 Ga0209489_109135 3300027361 Bacteria 12644
391 Ga0209700_100021 3300027363 Bacteria 230859
392 Ga0209813_10000053 3300027866 Bacteria 47000
393 Ga0209813_10000873 3300027866 Bacteria 6787
394 Ga0209813_10002965 3300027866 Bacteria 3931
395 Ga0207428_10035873 3300027907 Bacteria 4050
396 Ga0268266_10000064 3300028379 Bacteria 249533
397 Ga0268266_10001119 3300028379 Bacteria 33470
398 Ga0268266_10003430 3300028379 Bacteria 15845
399 Ga0268266_10008959 3300028379 Bacteria 8858
400 Ga0268265_10000021 3300028380 Bacteria 272292
401 Ga0268265_10000600 3300028380 Bacteria 36213
402 Ga0268265_10045113 3300028380 Bacteria 3287
403 Ga0268264_10000046 3300028381 Bacteria 364597
404 Ga0268264_10000059 3300028381 Bacteria 306927
405 Ga0268264_10000330 3300028381 Bacteria 74311
406 Ga0268264_10032863 3300028381 Bacteria 4258
407 Ga0268264_10046476 3300028381 Bacteria 3605
408 Ga0268264_10098912 3300028381 Bacteria 2531
409 Ga0265337_1001337 3300028556 Bacteria 12227
410 Ga0265334_10001279 3300028573 Bacteria 12182
411 Ga0307517_10006007 3300028786 Bacteria 18094
412 Ga0307515_10101092 3300028794 Bacteria 3484
413 Ga0265338_10033178 3300028800 Bacteria 5016
414 Ga0265338_10038295 3300028800 Bacteria 4546
415 Ga0265338_10095129 3300028800 Bacteria 2448
416 Ga0307511_10053071 3300030521 Bacteria 3219
417 Ga0265330_10006479 3300031235 Bacteria 5788
418 Ga0265330_10046044 3300031235 Bacteria 1922
419 Ga0265330_10064138 3300031235 Bacteria 1596
420 Ga0265332_10000016 3300031238 Bacteria 229887
421 Ga0265329_10006065 3300031242 Bacteria 4827
422 Ga0265340_10031218 3300031247 Bacteria 2665
423 Ga0265339_10034446 3300031249 Bacteria 2845
424 Ga0265339_10069712 3300031249 Bacteria 1876
425 Ga0265331_10000695 3300031250 Bacteria 28793
426 Ga0265331_10008614 3300031250 Bacteria 5788
427 Ga0265331_10010985 3300031250 Bacteria 4972
428 Ga0265331_10011789 3300031250 Bacteria 4771
429 Ga0265327_10000588 3300031251 Bacteria 61029
430 Ga0265327_10000602 3300031251 Bacteria 59632
431 Ga0265327_10002222 3300031251 Bacteria 21132
432 Ga0265327_10004643 3300031251 Bacteria 12048
433 Ga0265327_10019344 3300031251 Bacteria 4190
434 Ga0265327_10041024 3300031251 Bacteria 2498
435 Ga0265327_10062793 3300031251 Bacteria 1889
436 Ga0265316_10000169 3300031344 Bacteria 73902
437 Ga0307513_10000261 3300031456 Bacteria 76045
438 Ga0307513_10004825 3300031456 Bacteria 17901
439 Ga0307513_10014216 3300031456 Bacteria 9734
440 Ga0307513_10021686 3300031456 Bacteria 7577
441 Ga0307408_100025242 3300031548 Bacteria 4069
442 Ga0316575_10000032 3300031665 Bacteria 33845
443 Ga0265342_10088293 3300031712 Bacteria 1781
444 Ga0316576_10016359 3300031727 Bacteria 5006
445 Ga0316578_10017916 3300031728 Bacteria 3867
446 Ga0307516_10000352 3300031730 Bacteria 59644
447 Ga0307405_10026182 3300031731 Bacteria 3362
448 Ga0307413_10019680 3300031824 Bacteria 3573
449 Ga0307413_10044707 3300031824 Bacteria 2620
450 Ga0307410_10000957 3300031852 Bacteria 12384
451 Ga0307406_10002549 3300031901 Bacteria 9931
452 Ga0307406_10031861 3300031901 Bacteria 3213
453 Ga0307412_10148330 3300031911 Bacteria 1727
454 Ga0307409_100030371 3300031995 Bacteria 3881
455 Ga0307409_100145419 3300031995 Bacteria 2049
456 Ga0307416_100034538 3300032002 Bacteria 3849
457 Ga0307414_10040568 3300032004 Bacteria 3146
458 Ga0307414_10061493 3300032004 Bacteria 2660
459 Ga0307411_10001513 3300032005 Bacteria 9568
460 Ga0307411_10007647 3300032005 Bacteria 5527
461 Ga0307415_100013094 3300032126 Bacteria 4826
462 Ga0316583_10028121 3300032133 Bacteria 2005
463 Ga0316593_10000364 3300032168 Bacteria 7995
464 Ga0373953_0009093 3300035117 Bacteria 3399
465 Ga0373946_0015362 3300035171 Bacteria 2902
466 Ga0373955_0001026 3300035172 Bacteria 11850
467 Ga0373961_0003522 3300035241 Bacteria 3865
468 Ga0316574_0000274 3300035398 Bacteria 19146
469 Ga0373931_0053499 3300035691 Bacteria 2154
470 Ga0373935_0046449 3300035692 Bacteria 2743
471 Ga0373927_0103826 3300035695 Bacteria 1850
472 Ga0373933_0024125 3300035724 Bacteria 3481
473 Ga0373937_0002849 3300036401 Bacteria 14447
474 Ga0316584_0029523 3300036712 Bacteria 4048
475 Ga0373925_0000061 3300037068 Bacteria 117783
476 Ga0395899_0000013 3300037312 Bacteria 510397
477 Ga0395899_0000151 3300037312 Bacteria 105368
478 Ga0395899_0000167 3300037312 Bacteria 100973
479 Ga0395899_0000804 3300037312 Bacteria 30745
480 Ga0395899_0000885 3300037312 Bacteria 28458
481 Ga0395899_0009300 3300037312 Bacteria 7546
482 Ga0395899_0012431 3300037312 Bacteria 6522
483 Ga0395899_0022192 3300037312 Bacteria 4813
484 Ga0395899_0086958 3300037312 Bacteria 2269
485 Ga0395900_0000009 3300037418 Bacteria 476249
486 Ga0395900_0000020 3300037418 Bacteria 353500
487 Ga0395900_0000031 3300037418 Bacteria 262393
488 Ga0395900_0001255 3300037418 Bacteria 31098
489 Ga0395900_0002764 3300037418 Bacteria 19179
490 Ga0395900_0029097 3300037418 Bacteria 5666
491 Ga0395900_0059667 3300037418 Bacteria 3927
492 Ga0395900_0121552 3300037418 Bacteria 2679
493 Ga0395900_0147150 3300037418 Bacteria 2408
494 Ga0395900_0191156 3300037418 Bacteria 2076
495 Ga0395898_0000104 3300037466 Bacteria 223462
496 Ga0395898_0006464 3300037466 Bacteria 12517
497 Ga0395898_0018445 3300037466 Bacteria 7115
498 Ga0395898_0027194 3300037466 Bacteria 5745
499 Ga0395898_0032773 3300037466 Bacteria 5188
500 Ga0395898_0049253 3300037466 Bacteria 4128
501 Ga0395905_0000019 3300037471 Bacteria 353500
502 Ga0395905_0000271 3300037471 Bacteria 77040
503 Ga0395905_0000458 3300037471 Bacteria 57029
504 Ga0395905_0001765 3300037471 Bacteria 25140
505 Ga0395905_0007899 3300037471 Bacteria 10523
506 Ga0395905_0073033 3300037471 Bacteria 3215
507 Ga0395905_0105913 3300037471 Bacteria 2640
508 Ga0395905_0184082 3300037471 Bacteria 1961
509 Ga0436364_0238815 3300037853 Bacteria 8510
510 Ga0436364_0414769 3300037853 Bacteria 4611
511 Ga0395901_0000014 3300038443 Bacteria 375100
512 Ga0395901_0000016 3300038443 Bacteria 354008
513 Ga0395901_0000035 3300038443 Bacteria 223888
514 Ga0395901_0001264 3300038443 Bacteria 26810
515 Ga0395901_0006984 3300038443 Bacteria 11409
516 Ga0395901_0008542 3300038443 Bacteria 10349
517 Ga0395901_0043872 3300038443 Bacteria 4638
518 Ga0395901_0147294 3300038443 Bacteria 2474
519 Ga0395901_0217321 3300038443 Bacteria 1998
520 Ga0395901_0220860 3300038443 Bacteria 1981
521 Ga0400485_03094 3300038735 Bacteria 3386
522 Ga0400483_135188 3300039062 Bacteria 2125
523 Ga0400483_198091 3300039062 Bacteria 2110
524 Ga0436365_0400394 3300039437 Bacteria 25450
525 Ga0436365_0835883 3300039437 Bacteria 3507
526 Ga0436365_0886091 3300039437 Bacteria 43353
527 Ga0436360_0197367 3300039438 Bacteria 2151
528 Ga0436361_0496775 3300039447 Bacteria 11116
529 Ga0436361_0917304 3300039447 Bacteria 39295
530 Ga0436363_0609059 3300039450 Bacteria 20913
531 Ga0436363_1027775 3300039450 Bacteria 2521
532 Ga0436363_1720929 3300039450 Bacteria 8555
533 Ga0436362_0516986 3300039453 Bacteria 11871
534 Ga0439446_0015224 3300042156 Bacteria 2132
535 Ga0439460_0012638 3300042461 Bacteria 2195
536 Ga0450901_002064 3300042533 Bacteria 2221
537 Ga0466969_0000193 3300044656 Bacteria 32883
538 Ga0466966_0000688 3300044684 Bacteria 21491
539 Ga0466966_0031712 3300044684 Bacteria 3427
540 Ga0466966_0076533 3300044684 Bacteria 2089
541 Ga0466961_0003224 3300044693 Bacteria 10143
542 Ga0466963_0001435 3300044694 Bacteria 12837
543 Ga0466963_0043037 3300044694 Bacteria 2967
544 Ga0466963_0100827 3300044694 Bacteria 1976
545 Ga0466963_0128588 3300044694 Bacteria 1748
546 Ga0466971_0002179 3300044719 Bacteria 8282
547 Ga0466970_0065108 3300044765 Bacteria 1955
548 Ga0466957_0002794 3300044842 Bacteria 9442
549 Ga0466959_0000118 3300045049 Bacteria 51145
550 Ga0451576_0000034 3300045051 Bacteria 390778
551 Ga0451576_0059690 3300045051 Bacteria 3981
552 Ga0466958_0000398 3300045836 Bacteria 17799
553 Ga0466958_0036198 3300045836 Bacteria 2953
554 Ga0495627_001043 3300046453 Bacteria 18449
555 Ga0495590_0019068 3300046457 Bacteria 2448
556 Ga0495650_0000017 3300046471 Bacteria 542552
557 Ga0495584_0015466 3300046491 Bacteria 3888
558 Ga0495585_0077303 3300046492 Bacteria 1807
559 Ga0495596_0000288 3300046500 Bacteria 33511
560 Ga0495583_0000020 3300046506 Bacteria 296185
561 Ga0495583_0000426 3300046506 Bacteria 63627
562 Ga0495606_0023713 3300046507 Bacteria 4438
563 Ga0495610_0000030 3300046512 Bacteria 265950
564 Ga0495610_0000908 3300046512 Bacteria 27545
565 Ga0495610_0007741 3300046512 Bacteria 7091
566 Ga0495616_0001591 3300046513 Bacteria 15584
567 Ga0495620_0017326 3300046515 Bacteria 3594
568 Ga0495632_0060259 3300046519 Bacteria 1844
569 Ga0495637_0002075 3300046520 Bacteria 11270
570 Ga0495648_0000948 3300046524 Bacteria 30025
571 Ga0495648_0003360 3300046524 Bacteria 14095
572 Ga0495654_0000216 3300046530 Bacteria 54273
573 Ga0495621_0014749 3300046539 Bacteria 2480
574 Ga0495597_0047282 3300046542 Bacteria 1905
575 Ga0495633_0002271 3300046558 Bacteria 13754
576 Ga0495668_0000092 3300046616 Bacteria 142835
577 Ga0495668_0006535 3300046616 Bacteria 7617
578 Ga0495668_0015161 3300046616 Bacteria 4506
579 Ga0495668_0016490 3300046616 Bacteria 4293
580 Ga0495669_0000003 3300046684 Bacteria 267741
581 Ga0495669_0000234 3300046684 Bacteria 32800
582 Ga0495649_0000345 3300046694 Bacteria 39827
583 Ga0495672_0001561 3300047320 Bacteria 22420
584 Ga0495677_0005616 3300047445 Bacteria 4754
585 Ga0495679_005032 3300047446 Bacteria 5945
586 Ga0495673_0000078 3300047469 Bacteria 203066
587 Ga0495673_0000401 3300047469 Bacteria 50743
588 Ga0495681_0000011 3300047470 Bacteria 201843
589 Ga0495686_0003214 3300047472 Bacteria 14390
590 Ga0495686_0011256 3300047472 Bacteria 6308
591 Ga0496101_0034152 3300048904 Bacteria 3591
592 Ga0496102_0062324 3300048905 Bacteria 3414
593 Ga0496103_0008642 3300048906 Bacteria 6050
594 Ga0496103_0103884 3300048906 Bacteria 1800
595 Ga0496104_0009696 3300048907 Bacteria 8580
596 Ga0496105_0006289 3300048908 Bacteria 9118
597 Ga0496106_0002158 3300048909 Bacteria 14703
598 Ga0496106_0002226 3300048909 Bacteria 14458
599 Ga0496106_0005334 3300048909 Bacteria 9514
600 Ga0496106_0179652 3300048909 Bacteria 1680
601 Ga0496107_0001868 3300048910 Bacteria 13316
602 Ga0496107_0060523 3300048910 Bacteria 2741
603 Ga0496107_0084790 3300048910 Bacteria 2312
604 Ga0496107_0131617 3300048910 Bacteria 1847
605 Ga0496108_0002227 3300048911 Bacteria 15527
606 Ga0496108_0034941 3300048911 Bacteria 4176
607 Ga0496109_0002047 3300048912 Bacteria 16717
608 Ga0496109_0023339 3300048912 Bacteria 5490
609 Ga0496109_0060051 3300048912 Bacteria 3474
610 Ga0496110_0026758 3300048913 Bacteria 4939
611 Ga0496110_0097858 3300048913 Bacteria 2629
612 Ga0496111_0008316 3300048914 Bacteria 6859
613 Ga0496111_0014620 3300048914 Bacteria 5369
614 Ga0496112_0003678 3300048915 Bacteria 12783
615 Ga0496112_0025671 3300048915 Bacteria 5660
616 Ga0496112_0036881 3300048915 Bacteria 4769
617 Ga0496112_0045422 3300048915 Bacteria 4306
618 Ga0496112_0068585 3300048915 Bacteria 3502
619 Ga0496113_0001823 3300048916 Bacteria 12118
620 Ga0496113_0001984 3300048916 Bacteria 11730
621 Ga0496113_0076057 3300048916 Bacteria 2564
622 Ga0496114_0007532 3300048917 Bacteria 8611
623 Ga0496114_0024978 3300048917 Bacteria 4880
624 Ga0496114_0094783 3300048917 Bacteria 2539
625 Ga0496115_0000571 3300048918 Bacteria 28486
626 Ga0496115_0000794 3300048918 Bacteria 23158
627 Ga0496115_0001409 3300048918 Bacteria 17195
628 Ga0496116_0000019 3300048919 Bacteria 533227
629 Ga0496116_0000039 3300048919 Bacteria 349134
630 Ga0496117_0054267 3300048920 Bacteria 2808
631 Ga0496118_0020178 3300048921 Bacteria 5920
632 Ga0496119_0003333 3300048922 Bacteria 16734
633 Ga0496119_0011136 3300048922 Bacteria 7491
634 Ga0496120_0036784 3300048923 Bacteria 2909
635 Ga0496121_0000001 3300048924 Bacteria 1830318
636 Ga0496121_0000009 3300048924 Bacteria 836971
637 Ga0496121_0000018 3300048924 Bacteria 542045
638 Ga0496121_0001392 3300048924 Bacteria 40941
639 Ga0496121_0004259 3300048924 Bacteria 19444
640 Ga0496121_0030838 3300048924 Bacteria 4916
641 Ga0496121_0035073 3300048924 Bacteria 4501
642 Ga0496122_0015650 3300048925 Bacteria 7236
643 Ga0496122_0066534 3300048925 Bacteria 2602
644 Ga0496123_0003680 3300048926 Bacteria 16906
645 Ga0496123_0005251 3300048926 Bacteria 13145
646 Ga0496124_0002764 3300048927 Bacteria 22312
647 Ga0496125_0000001 3300048928 Bacteria 1766138
648 Ga0496125_0000749 3300048928 Bacteria 53580
649 Ga0496125_0002786 3300048928 Bacteria 22105
650 Ga0496125_0007529 3300048928 Bacteria 11573
651 Ga0496125_0078257 3300048928 Bacteria 2543
652 Ga0496126_0000041 3300048929 Bacteria 340389
653 Ga0496126_0001877 3300048929 Bacteria 30562
654 Ga0496126_0071794 3300048929 Bacteria 3081
655 Ga0495678_001720 3300049459 Bacteria 16374
656 Ga0501031_0000019 3300049568 Bacteria 104793
657 Ga0501032_0000009 3300049569 Bacteria 228107
658 Ga0501032_0003255 3300049569 Bacteria 12491
659 Ga0501033_0000019 3300049570 Bacteria 204699
660 Ga0501033_0002053 3300049570 Bacteria 17511
661 Ga0501033_0041719 3300049570 Bacteria 3423
662 Ga0501033_0074012 3300049570 Bacteria 2501
663 Ga0501034_0000044 3300049571 Bacteria 227982
664 Ga0501034_0000176 3300049571 Bacteria 119228
665 Ga0501034_0014235 3300049571 Bacteria 8199
666 Ga0501034_0072566 3300049571 Bacteria 3451
667 Ga0501034_0090118 3300049571 Bacteria 3065
668 Ga0501034_0105144 3300049571 Bacteria 2816
669 Ga0501034_0198704 3300049571 Bacteria 1964
670 Ga0501036_0000008 3300049572 Bacteria 228106
671 Ga0501036_0025756 3300049572 Bacteria 4964
672 Ga0501036_0039031 3300049572 Bacteria 4021
673 Ga0501036_0089461 3300049572 Bacteria 2601
674 Ga0501037_0000055 3300049573 Bacteria 109790
675 Ga0501038_0000006 3300049574 Bacteria 228107
676 Ga0501038_0011223 3300049574 Bacteria 8179
677 Ga0501038_0160191 3300049574 Bacteria 1829
678 Ga0501038_0181333 3300049574 Bacteria 1699
679 Ga0501039_0000014 3300049575 Bacteria 228107
680 Ga0501039_0016254 3300049575 Bacteria 5700
681 Ga0501039_0085206 3300049575 Bacteria 2462
682 Ga0501040_0010441 3300049576 Bacteria 6073
683 Ga0501040_0057621 3300049576 Bacteria 2668
684 Ga0501041_0024027 3300049577 Bacteria 3657
685 Ga0501041_0053334 3300049577 Bacteria 2466
686 Ga0501042_0007634 3300049578 Bacteria 7095
687 Ga0501042_0025516 3300049578 Bacteria 4151
688 Ga0501043_0021029 3300049579 Bacteria 5116
689 Ga0501043_0071258 3300049579 Bacteria 2730
690 Ga0501046_0001115 3300049580 Bacteria 26209
691 Ga0501046_0003242 3300049580 Bacteria 14954
692 Ga0501047_0000290 3300049581 Bacteria 57649
693 Ga0501047_0008388 3300049581 Bacteria 9752
694 Ga0501047_0036257 3300049581 Bacteria 4766
695 Ga0501047_0085685 3300049581 Bacteria 3027
696 Ga0501047_0210013 3300049581 Bacteria 1805
697 Ga0501048_0021203 3300049582 Bacteria 4757
698 Ga0501048_0050050 3300049582 Bacteria 2976
699 Ga0501048_0059997 3300049582 Bacteria 2695
700 Ga0501067_0000905 3300049583 Bacteria 15942
701 Ga0501067_0001682 3300049583 Bacteria 12159
702 Ga0501070_0002529 3300049586 Bacteria 16034
703 Ga0501070_0063518 3300049586 Bacteria 3058
704 Ga0501070_0111973 3300049586 Bacteria 2256
705 Ga0501071_0005547 3300049587 Bacteria 8126
706 Ga0501071_0100061 3300049587 Bacteria 2136
707 Ga0501072_0004184 3300049588 Bacteria 10934
708 Ga0501073_0000018 3300049589 Bacteria 155244
709 Ga0501073_0003442 3300049589 Bacteria 11879
710 Ga0501074_0044326 3300049590 Bacteria 3220
711 Ga0501074_0081192 3300049590 Bacteria 2325
712 Ga0501075_0009175 3300049591 Bacteria 6914
713 Ga0501075_0105082 3300049591 Bacteria 2146
714 Ga0501076_0010765 3300049592 Bacteria 6799
715 Ga0501076_0049755 3300049592 Bacteria 3315
716 Ga0501077_0000026 3300049593 Bacteria 76023
717 Ga0501077_0027418 3300049593 Bacteria 3617
718 Ga0501257_000095 3300049686 Bacteria 21617
719 Ga0501079_0004232 3300049741 Bacteria 10642
720 Ga0501079_0017813 3300049741 Bacteria 5426
721 Ga0501079_0056185 3300049741 Bacteria 3037
722 Ga0501080_0000003 3300049742 Bacteria 214890
723 Ga0501080_0001057 3300049742 Bacteria 22628
724 Ga0501080_0005874 3300049742 Bacteria 10994
725 Ga0501080_0045353 3300049742 Bacteria 4092
726 Ga0501080_0050525 3300049742 Bacteria 3869
727 Ga0501080_0061944 3300049742 Bacteria 3482
728 Ga0501081_0008312 3300049743 Bacteria 6736
729 Ga0501081_0009224 3300049743 Bacteria 6426
730 Ga0501083_0021296 3300049744 Bacteria 4505
731 Ga0501280_002283 3300049776 Bacteria 3247
732 Ga0501035_0000096 3300049822 Bacteria 110635
733 Ga0501035_0000384 3300049822 Bacteria 50737
734 Ga0501035_0051742 3300049822 Bacteria 3676
735 Ga0501035_0054473 3300049822 Bacteria 3574
736 Ga0501035_0077431 3300049822 Bacteria 2939
737 Ga0501035_0208548 3300049822 Bacteria 1673
738 Ga0501044_0000017 3300049823 Bacteria 228107
739 Ga0501044_0000570 3300049823 Bacteria 44794
740 Ga0501044_0013529 3300049823 Bacteria 8821
741 Ga0501044_0030476 3300049823 Bacteria 5685
742 Ga0501044_0083632 3300049823 Bacteria 3227
743 Ga0501045_0049169 3300049824 Bacteria 3074
744 Ga0501045_0124006 3300049824 Bacteria 1918
745 nmdc:mga03683_625_c1 3300050489 Bacteria 10155
746 nmdc:mga03683_6_c1 3300050489 Bacteria 141493
747 nmdc:mga03n38_114044_c1 3300050490 Bacteria 1320
748 nmdc:mga03n38_61_c1 3300050490 Bacteria 22538
749 nmdc:mga00v17_146_c1 3300050491 Bacteria 40788
750 nmdc:mga00v17_322_c1 3300050491 Bacteria 27155
751 nmdc:mga00v17_505_c1 3300050491 Bacteria 21902
752 nmdc:mga00v17_934_c1 3300050491 Bacteria 15691
753 nmdc:mga00v17_99467_c1 3300050491 Bacteria 1835
754 nmdc:mga0yw44_57_c1 3300050492 Bacteria 40136
755 nmdc:mga0k408_6_c1 3300050493 Bacteria 200443
756 nmdc:mga06z11_105_c1 3300050494 Bacteria 34898
757 nmdc:mga06z11_12375_c1 3300050494 Bacteria 3710
758 nmdc:mga06z11_147_c1 3300050494 Bacteria 27767
759 nmdc:mga06z11_52078_c1 3300050494 Bacteria 2098
760 nmdc:mga04h51_24_c1 3300050495 Bacteria 59995
761 nmdc:mga04h51_2624_c1 3300050495 Bacteria 4279
762 nmdc:mga07m45_187_c2 3300050496 Bacteria 10171
763 nmdc:mga07m45_32659_c1 3300050496 Bacteria 2886
764 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
765 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
766 nmdc:mga07m45_66_c1 3300050496 Bacteria 40757
767 nmdc:mga09592_40497_c1 3300050508 Bacteria 3914
768 nmdc:mga08y16_134810_c1 3300050511 Bacteria 2566
769 nmdc:mga08y16_33263_c1 3300050511 Bacteria 5415
770 nmdc:mga0n895_207881_c1 3300050512 Bacteria 1988
771 nmdc:mga0rr50_39858_c1 3300050513 Bacteria 3410
772 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
773 nmdc:mga0sz30_118_c1 3300050516 Bacteria 29758
774 nmdc:mga0sz30_29578_c1 3300050516 Bacteria 2259
775 nmdc:mga0sz30_44_c1 3300050516 Bacteria 44851
776 Ga0500635_0000489 3300053080 Bacteria 11028
777 Ga0500635_0001292 3300053080 Bacteria 5983
778 Ga0500578_0000420 3300053086 Bacteria 51926
779 Ga0500643_008792 3300053087 Bacteria 3926
780 Ga0500643_009931 3300053087 Bacteria 3590
781 Ga0500643_011734 3300053087 Bacteria 3177
782 Ga0500643_022035 3300053087 Bacteria 2057
783 Ga0500644_0000274 3300053088 Bacteria 28730
784 Ga0500646_0007952 3300053090 Bacteria 2711
785 Ga0500641_0000486 3300053096 Bacteria 14448
786 Ga0500641_0010426 3300053096 Bacteria 3358
787 Ga0500641_0010581 3300053096 Bacteria 3336
788 Ga0500554_001836 3300053102 Bacteria 4100
789 Ga0500556_0000587 3300053104 Bacteria 23997
790 Ga0500556_0001909 3300053104 Bacteria 7444
791 Ga0500557_000050 3300053105 Bacteria 54589
792 Ga0500562_000021 3300053108 Bacteria 112425
793 Ga0500562_000519 3300053108 Bacteria 9336
794 Ga0500562_002122 3300053108 Bacteria 4955
795 Ga0500593_000050 3300053117 Bacteria 42339
796 Ga0500594_0003103 3300053118 Bacteria 3634
797 Ga0500595_002565 3300053119 Bacteria 8893
798 Ga0500595_007222 3300053119 Bacteria 4625
799 Ga0500608_000080 3300053122 Bacteria 40873
800 Ga0500608_000397 3300053122 Bacteria 16687
801 Ga0500608_002327 3300053122 Bacteria 6895
802 Ga0500618_000112 3300053125 Bacteria 65643
803 Ga0500642_0000065 3300053130 Bacteria 57974
804 Ga0500658_0001458 3300053134 Bacteria 9461
805 Ga0500559_0000077 3300053136 Bacteria 76287
806 Ga0500559_0000111 3300053136 Bacteria 64064
807 Ga0500564_000021 3300053138 Bacteria 47765
808 Ga0500568_0000001 3300053139 Bacteria 988705
809 Ga0500588_0005049 3300053146 Bacteria 2903
810 Ga0500590_021481 3300053148 Bacteria 3350
811 Ga0500604_0000078 3300053151 Bacteria 34635
812 Ga0500616_0018371 3300053153 Bacteria 3955
813 Ga0500622_0000526 3300053156 Bacteria 35500
814 Ga0500622_0007443 3300053156 Bacteria 6218
815 Ga0500624_000001 3300053157 Bacteria 284974
816 Ga0500624_000045 3300053157 Bacteria 89838
817 Ga0500627_0009954 3300053158 Bacteria 3447
818 Ga0500645_000353 3300053730 Bacteria 32638
819 Ga0500645_000461 3300053730 Bacteria 27834
820 Ga0500645_001891 3300053730 Bacteria 9997
821 Ga0500645_002164 3300053730 Bacteria 9004
822 Ga0500596_000572 3300053735 Bacteria 7020
823 Ga0501084_0018508 3300054114 Bacteria 5798
824 Ga0501084_0049834 3300054114 Bacteria 3505
825 Ga0501084_0098628 3300054114 Bacteria 2453
826 Ga0501082_0004153 3300060353 Bacteria 12655
827 Ga0501082_0054287 3300060353 Bacteria 3453
828 Ga0501082_0258071 3300060353 Bacteria 1516
829 Ga0466962_0000345 3300061719 Bacteria 19915
830 Ga0530510_0013704 3300061734 Bacteria 5706
831 Ga0530510_0017724 3300061734 Bacteria 5046

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0121552 Ga0395900_0121552_14_1291 408
2 3300035241 Ga0373961_0003522 Ga0373961_0003522_1583_3088 410
3 3300035172 Ga0373955_0001026 Ga0373955_0001026_12_1280 419
4 3300050490 nmdc:mga03n38_114044_c1 nmdc:mga03n38_114044_c1_29_1309 420
5 3300006042 Ga0075368_10006977 Ga0075368_100069772 434
6 3300006048 Ga0075363_100000062 Ga0075363_1000000622 434
7 3300006178 Ga0075367_10000119 Ga0075367_100001192 434
8 3300006186 Ga0075369_10000060 Ga0075369_100000605 434
9 3300006194 Ga0075427_10000023 Ga0075427_100000232 434
10 3300006353 Ga0075370_10000066 Ga0075370_1000006615 434
11 3300006880 Ga0075429_100006297 Ga0075429_1000062975 434
12 3300027866 Ga0209813_10000873 Ga0209813_100008735 434
13 3300050490 nmdc:mga03n38_61_c1 nmdc:mga03n38_61_c1_13684_15219 434
14 3300050491 nmdc:mga00v17_146_c1 nmdc:mga00v17_146_c1_20227_21762 434
15 3300050494 nmdc:mga06z11_105_c1 nmdc:mga06z11_105_c1_20404_21939 434
16 3300050495 nmdc:mga04h51_2624_c1 nmdc:mga04h51_2624_c1_1321_2856 434
17 3300050496 nmdc:mga07m45_66_c1 nmdc:mga07m45_66_c1_20205_21740 434
18 3300050508 nmdc:mga09592_40497_c1 nmdc:mga09592_40497_c1_2242_3777 434
19 3300050516 nmdc:mga0sz30_118_c1 nmdc:mga0sz30_118_c1_19101_20636 434
20 3300048910 Ga0496107_0131617 Ga0496107_0131617_354_1832 435
21 3300037312 Ga0395899_0000167 Ga0395899_0000167_54160_55644 448
22 3300037418 Ga0395900_0000009 Ga0395900_0000009_350734_352218 448
23 3300037466 Ga0395898_0006464 Ga0395898_0006464_9985_11469 448
24 3300038443 Ga0395901_0000014 Ga0395901_0000014_301940_303424 448
25 iso_pu_bacteria 8021120328 8021123174 449
26 3300048917 Ga0496114_0024978 Ga0496114_0024978_733_2223 455
27 3300021358 Ga0213873_10001565 Ga0213873_100015653 457
28 3300021441 Ga0213871_10006931 Ga0213871_100069312 457
29 3300039438 Ga0436360_0197367 Ga0436360_0197367_28_1554 457
30 3300050494 nmdc:mga06z11_52078_c1 nmdc:mga06z11_52078_c1_607_2079 459
31 3300006038 Ga0075365_10000227 Ga0075365_1000022717 461
32 3300006051 Ga0075364_10001197 Ga0075364_1000119714 461
33 3300050491 nmdc:mga00v17_505_c1 nmdc:mga00v17_505_c1_16985_18520 461
34 3300050492 nmdc:mga0yw44_57_c1 nmdc:mga0yw44_57_c1_17836_19371 461
35 3300050494 nmdc:mga06z11_12375_c1 nmdc:mga06z11_12375_c1_211_1746 461
36 3300005458 Ga0070681_10227695 Ga0070681_102276951 463
37 iso_pu_bacteria 2599185239 2599741020 464
38 3300005366 Ga0070659_100067276 Ga0070659_1000672762 465
39 3300028800 Ga0265338_10033178 Ga0265338_100331782 466
40 3300031251 Ga0265327_10041024 Ga0265327_100410241 466
41 3300049571 Ga0501034_0105144 Ga0501034_0105144_454_1989 466
42 3300002067 JGI24735J21928_10001159 JGI24735J21928_100011592 467
43 3300025225 Ga0209566_100542 Ga0209566_10054226 468
44 3300025226 Ga0209674_101649 Ga0209674_1016495 468
45 3300049571 Ga0501034_0072566 Ga0501034_0072566_1463_3007 468
46 3300049823 Ga0501044_0083632 Ga0501044_0083632_924_2468 468
47 3300053157 Ga0500624_000001 Ga0500624_000001_89007_90542 468
48 3300006852 Ga0075433_10026622 Ga0075433_100266224 469
49 3300006871 Ga0075434_100122090 Ga0075434_1001220902 469
50 3300037068 Ga0373925_0000061 Ga0373925_0000061_56129_57613 469
51 3300050512 nmdc:mga0n895_207881_c1 nmdc:mga0n895_207881_c1_432_1943 469
52 3300009551 Ga0105238_10049267 Ga0105238_100492673 470
53 3300025924 Ga0207694_10042460 Ga0207694_100424603 470
54 3300047320 Ga0495672_0001561 Ga0495672_0001561_18535_20064 470
55 3300053090 Ga0500646_0007952 Ga0500646_0007952_361_1848 470
56 3300048919 Ga0496116_0000019 Ga0496116_0000019_111057_112595 471
57 3300048920 Ga0496117_0054267 Ga0496117_0054267_580_2091 471
58 3300048923 Ga0496120_0036784 Ga0496120_0036784_175_1686 471
59 3300048924 Ga0496121_0000001 Ga0496121_0000001_1047460_1048971 471
60 3300048924 Ga0496121_0000018 Ga0496121_0000018_428648_430186 471
61 3300048928 Ga0496125_0000001 Ga0496125_0000001_1208018_1209529 471
62 3300049581 Ga0501047_0008388 Ga0501047_0008388_4381_5859 471
63 3300049742 Ga0501080_0001057 Ga0501080_0001057_11712_13190 471
64 3300050491 nmdc:mga00v17_99467_c1 nmdc:mga00v17_99467_c1_246_1757 471
65 3300005336 Ga0070680_100002884 Ga0070680_1000028847 472
66 3300005338 Ga0068868_100000001 Ga0068868_10000000117 472
67 3300005339 Ga0070660_100003034 Ga0070660_10000303411 472
68 3300005366 Ga0070659_100000001 Ga0070659_100000001341 472
69 3300005366 Ga0070659_100104104 Ga0070659_1001041041 472
70 3300005458 Ga0070681_10020073 Ga0070681_100200732 472
71 3300005530 Ga0070679_100006911 Ga0070679_1000069113 472
72 3300005539 Ga0068853_100005921 Ga0068853_1000059212 472
73 3300005563 Ga0068855_100051832 Ga0068855_1000518325 472
74 3300009098 Ga0105245_10085797 Ga0105245_100857972 472
75 3300021384 Ga0213876_10000544 Ga0213876_1000054418 472
76 3300025909 Ga0207705_10001414 Ga0207705_100014146 472
77 3300025917 Ga0207660_10003153 Ga0207660_100031535 472
78 3300025919 Ga0207657_10001137 Ga0207657_100011373 472
79 3300025921 Ga0207652_10003865 Ga0207652_100038656 472
80 3300025926 Ga0207659_10106133 Ga0207659_101061332 472
81 3300025927 Ga0207687_10027427 Ga0207687_100274273 472
82 3300025932 Ga0207690_10000051 Ga0207690_1000005145 472
83 3300025932 Ga0207690_10005435 Ga0207690_100054352 472
84 3300025949 Ga0207667_10007334 Ga0207667_100073348 472
85 3300026023 Ga0207677_10000013 Ga0207677_10000013182 472
86 3300031235 Ga0265330_10064138 Ga0265330_100641381 472
87 3300031247 Ga0265340_10031218 Ga0265340_100312182 472
88 3300031728 Ga0316578_10017916 Ga0316578_100179162 472
89 3300035398 Ga0316574_0000274 Ga0316574_0000274_4329_5843 472
90 3300049572 Ga0501036_0025756 Ga0501036_0025756_2586_4073 472
91 3300049579 Ga0501043_0021029 Ga0501043_0021029_2924_4411 472
92 3300049580 Ga0501046_0001115 Ga0501046_0001115_16308_17795 472
93 3300049581 Ga0501047_0000290 Ga0501047_0000290_20469_21956 472
94 3300049583 Ga0501067_0001682 Ga0501067_0001682_5535_7022 472
95 3300049586 Ga0501070_0002529 Ga0501070_0002529_1189_2676 472
96 3300049742 Ga0501080_0000003 Ga0501080_0000003_86447_87934 472
97 3300049822 Ga0501035_0000384 Ga0501035_0000384_29956_31443 472
98 3300049823 Ga0501044_0000570 Ga0501044_0000570_35852_37339 472
99 3300006051 Ga0075364_10013747 Ga0075364_100137472 473
100 3300037471 Ga0395905_0000271 Ga0395905_0000271_4876_6378 473
101 3300050491 nmdc:mga00v17_934_c1 nmdc:mga00v17_934_c1_12154_13707 473
102 3300050516 nmdc:mga0sz30_29578_c1 nmdc:mga0sz30_29578_c1_517_2070 473
103 3300060353 Ga0501082_0258071 Ga0501082_0258071_49_1503 473
104 3300005295 Ga0065707_10000608 Ga0065707_100006083 474
105 3300031235 Ga0265330_10046044 Ga0265330_100460442 474
106 3300031249 Ga0265339_10069712 Ga0265339_100697122 474
107 3300031250 Ga0265331_10011789 Ga0265331_100117892 474
108 3300046524 Ga0495648_0003360 Ga0495648_0003360_8584_10089 474
109 3300049570 Ga0501033_0002053 Ga0501033_0002053_15975_17471 474
110 3300049572 Ga0501036_0089461 Ga0501036_0089461_327_1844 474
111 3300049574 Ga0501038_0011223 Ga0501038_0011223_5898_7415 474
112 3300049575 Ga0501039_0016254 Ga0501039_0016254_3869_5386 474
113 3300049579 Ga0501043_0071258 Ga0501043_0071258_718_2235 474
114 3300049581 Ga0501047_0036257 Ga0501047_0036257_1302_2819 474
115 3300049589 Ga0501073_0003442 Ga0501073_0003442_8925_10442 474
116 3300049742 Ga0501080_0045353 Ga0501080_0045353_2011_3528 474
117 3300049823 Ga0501044_0013529 Ga0501044_0013529_6058_7575 474
118 3300050496 nmdc:mga07m45_32659_c1 nmdc:mga07m45_32659_c1_1356_2876 474
119 3300053096 Ga0500641_0010426 Ga0500641_0010426_985_2529 474
120 3300053096 Ga0500641_0010581 Ga0500641_0010581_1786_3270 474
121 3300005336 Ga0070680_100030844 Ga0070680_1000308442 475
122 3300005353 Ga0070669_100000329 Ga0070669_10000032927 475
123 3300005355 Ga0070671_100001250 Ga0070671_1000012505 475
124 3300005834 Ga0068851_10011399 Ga0068851_100113992 475
125 3300005841 Ga0068863_100059984 Ga0068863_1000599842 475
126 3300005842 Ga0068858_100043412 Ga0068858_1000434123 475
127 3300005843 Ga0068860_100066828 Ga0068860_1000668283 475
128 3300009177 Ga0105248_10090660 Ga0105248_100906603 475
129 3300025912 Ga0207707_10001296 Ga0207707_100012963 475
130 3300025923 Ga0207681_10000448 Ga0207681_1000044813 475
131 3300025931 Ga0207644_10000003 Ga0207644_10000003141 475
132 3300026095 Ga0207676_10045215 Ga0207676_100452152 475
133 3300048909 Ga0496106_0002158 Ga0496106_0002158_7837_9393 475
134 3300048913 Ga0496110_0026758 Ga0496110_0026758_3038_4594 475
135 3300005333 Ga0070677_10000656 Ga0070677_100006566 476
136 3300005539 Ga0068853_100025697 Ga0068853_1000256971 476
137 3300007076 Ga0075435_100125914 Ga0075435_1001259142 476
138 3300025893 Ga0207682_10000833 Ga0207682_100008339 476
139 3300025949 Ga0207667_10043233 Ga0207667_100432332 476
140 3300039437 Ga0436365_0835883 Ga0436365_0835883_105_1598 476
141 3300048916 Ga0496113_0001823 Ga0496113_0001823_10270_11826 476
142 iso_pu_bacteria 2547132512 2548846988 476
143 3300005440 Ga0070705_100041450 Ga0070705_1000414502 477
144 3300005545 Ga0070695_100032791 Ga0070695_1000327912 477
145 3300005548 Ga0070665_100000334 Ga0070665_10000033421 477
146 3300005842 Ga0068858_100012038 Ga0068858_1000120382 477
147 3300006914 Ga0075436_100012782 Ga0075436_1000127824 477
148 3300007076 Ga0075435_100016479 Ga0075435_1000164792 477
149 3300009177 Ga0105248_10045112 Ga0105248_100451124 477
150 3300028379 Ga0268266_10001119 Ga0268266_1000111933 477
151 3300032126 Ga0307415_100013094 Ga0307415_1000130942 477
152 3300050513 nmdc:mga0rr50_39858_c1 nmdc:mga0rr50_39858_c1_1184_2701 477
153 3300050514 nmdc:mga08x19_14_c1 nmdc:mga08x19_14_c1_218382_219899 477
154 3300048928 Ga0496125_0078257 Ga0496125_0078257_1038_2525 478
155 3300049571 Ga0501034_0198704 Ga0501034_0198704_167_1681 478
156 3300009147 Ga0114129_10370390 Ga0114129_103703901 479
157 3300037312 Ga0395899_0000151 Ga0395899_0000151_65228_66733 479
158 3300037418 Ga0395900_0000020 Ga0395900_0000020_168714_170219 479
159 3300037466 Ga0395898_0000104 Ga0395898_0000104_183282_184787 479
160 3300037471 Ga0395905_0000019 Ga0395905_0000019_183282_184787 479
161 3300038443 Ga0395901_0000016 Ga0395901_0000016_169222_170727 479
162 3300031238 Ga0265332_10000016 Ga0265332_10000016195 480
163 3300031251 Ga0265327_10000588 Ga0265327_1000058835 480
164 3300031251 Ga0265327_10002222 Ga0265327_1000222219 480
165 3300005354 Ga0070675_100127929 Ga0070675_1001279292 481
166 3300031665 Ga0316575_10000032 Ga0316575_1000003227 481
167 3300049581 Ga0501047_0085685 Ga0501047_0085685_633_2147 481
168 3300049586 Ga0501070_0063518 Ga0501070_0063518_1143_2657 481
169 3300049742 Ga0501080_0050525 Ga0501080_0050525_766_2280 481
170 iso_pu_bacteria 2510917020 2511125408 481
171 iso_pu_bacteria 2582581279 2585148510 481
172 iso_pu_bacteria 2582581280 2585153099 481
173 iso_pu_bacteria 2582581293 2585196661 481
174 iso_pu_bacteria 2585428106 2587916721 481
175 iso_pu_bacteria 2643221545 2643751417 481
176 iso_pu_bacteria 2643221552 2643778207 481
177 iso_pu_bacteria 2643221574 2643883259 481
178 iso_pu_bacteria 2643221583 2643923489 481
179 iso_pu_bacteria 2643221584 2643928414 481
180 iso_pu_bacteria 2643221598 2644000277 481
181 iso_pu_bacteria 2643221614 2644084959 481
182 iso_pu_bacteria 2643221640 2644225747 481
183 iso_pu_bacteria 2643221642 2644235236 481
184 iso_pu_bacteria 2643221661 2644342511 481
185 iso_pu_bacteria 2643221663 2644351902 481
186 iso_pu_bacteria 2643221666 2644365811 481
187 iso_pu_bacteria 2643221691 2644510530 481
188 iso_pu_bacteria 2643221699 2644547923 481
189 iso_pu_bacteria 2791355048 2792460622 481
190 iso_pu_bacteria 2818991435 2819536600 481
191 iso_pu_bacteria 2818991454 2819645761 481
192 iso_pu_bacteria 2843744320 2843747775 481
193 iso_pu_bacteria 2849560528 2849565354 481
194 iso_pu_bacteria 2849573788 2849578417 481
195 iso_pu_bacteria 2851153111 2851153806 481
196 iso_pu_bacteria 2857504554 2857506365 481
197 iso_pu_bacteria 2884960567 2884965114 481
198 iso_pu_bacteria 2898329390 2898329521 481
199 iso_pu_bacteria 2928531327 2928535387 481
200 iso_pu_bacteria 2928972540 2928975122 481
201 iso_pu_bacteria 2941485952 2941488429 481
202 iso_pu_bacteria 2977240413 2977241885 481
203 3300005337 Ga0070682_100012466 Ga0070682_1000124663 482
204 3300005366 Ga0070659_100096585 Ga0070659_1000965852 482
205 3300005530 Ga0070679_100005502 Ga0070679_10000550210 482
206 3300005539 Ga0068853_100015961 Ga0068853_1000159616 482
207 3300005549 Ga0070704_100025527 Ga0070704_1000255271 482
208 3300005577 Ga0068857_100068835 Ga0068857_1000688352 482
209 3300005983 Ga0081540_1001263 Ga0081540_100126320 482
210 3300009174 Ga0105241_10060054 Ga0105241_100600542 482
211 3300009553 Ga0105249_10009441 Ga0105249_100094412 482
212 3300013100 Ga0157373_10019439 Ga0157373_100194392 482
213 3300013104 Ga0157370_10018896 Ga0157370_100188963 482
214 3300025909 Ga0207705_10019624 Ga0207705_100196244 482
215 3300025912 Ga0207707_10054709 Ga0207707_100547092 482
216 3300025949 Ga0207667_10092888 Ga0207667_100928882 482
217 3300025961 Ga0207712_10017866 Ga0207712_100178664 482
218 3300031235 Ga0265330_10006479 Ga0265330_100064794 482
219 3300031250 Ga0265331_10010985 Ga0265331_100109852 482
220 3300045051 Ga0451576_0000034 Ga0451576_0000034_240786_242276 482
221 3300053105 Ga0500557_000050 Ga0500557_000050_1211_2719 482
222 3300053130 Ga0500642_0000065 Ga0500642_0000065_8424_9932 482
223 3300003781 Ga0055536_1008966 Ga0055536_10089663 483
224 3300003791 Ga0055530_10000647 Ga0055530_1000064721 483
225 3300003794 Ga0055531_10014013 Ga0055531_100140132 483
226 3300025297 Ga0209758_1002592 Ga0209758_10025928 483
227 3300025298 Ga0209050_1000101 Ga0209050_1000101162 483
228 3300025298 Ga0209050_1013083 Ga0209050_10130832 483
229 3300025304 Ga0209257_1000178 Ga0209257_100017864 483
230 3300025304 Ga0209257_1000220 Ga0209257_100022034 483
231 3300027866 Ga0209813_10002965 Ga0209813_100029652 483
232 3300031456 Ga0307513_10021686 Ga0307513_100216867 483
233 3300031901 Ga0307406_10002549 Ga0307406_100025492 483
234 3300005262 Ga0065165_1005117 Ga0065165_10051172 484
235 3300005327 Ga0070658_10093326 Ga0070658_100933262 484
236 3300005331 Ga0070670_100000037 Ga0070670_1000000379 484
237 3300005336 Ga0070680_100102079 Ga0070680_1001020792 484
238 3300005341 Ga0070691_10019229 Ga0070691_100192292 484
239 3300005347 Ga0070668_100002188 Ga0070668_1000021888 484
240 3300005353 Ga0070669_100023151 Ga0070669_1000231512 484
241 3300005355 Ga0070671_100026330 Ga0070671_1000263303 484
242 3300005367 Ga0070667_100000083 Ga0070667_1000000839 484
243 3300005367 Ga0070667_100010505 Ga0070667_1000105053 484
244 3300005539 Ga0068853_100127855 Ga0068853_1001278552 484
245 3300005548 Ga0070665_100000116 Ga0070665_100000116124 484
246 3300005548 Ga0070665_100000883 Ga0070665_1000008839 484
247 3300005548 Ga0070665_100005159 Ga0070665_1000051598 484
248 3300005563 Ga0068855_100160596 Ga0068855_1001605962 484
249 3300005618 Ga0068864_100000116 Ga0068864_10000011657 484
250 3300005618 Ga0068864_100000363 Ga0068864_10000036333 484
251 3300005841 Ga0068863_100000007 Ga0068863_100000007221 484
252 3300005841 Ga0068863_100003837 Ga0068863_1000038376 484
253 3300005842 Ga0068858_100000853 Ga0068858_10000085312 484
254 3300005842 Ga0068858_100004079 Ga0068858_1000040797 484
255 3300005843 Ga0068860_100000348 Ga0068860_10000034851 484
256 3300005844 Ga0068862_100000235 Ga0068862_10000023556 484
257 3300005844 Ga0068862_100026581 Ga0068862_1000265812 484
258 3300006051 Ga0075364_10000935 Ga0075364_1000093510 484
259 3300006178 Ga0075367_10094182 Ga0075367_100941821 484
260 3300006195 Ga0075366_10051698 Ga0075366_100516982 484
261 3300006353 Ga0075370_10020413 Ga0075370_100204132 484
262 3300009092 Ga0105250_10002835 Ga0105250_100028353 484
263 3300009093 Ga0105240_10010558 Ga0105240_100105582 484
264 3300009093 Ga0105240_10041126 Ga0105240_100411262 484
265 3300009093 Ga0105240_10133888 Ga0105240_101338882 484
266 3300009177 Ga0105248_10000438 Ga0105248_100004383 484
267 3300010375 Ga0105239_10107230 Ga0105239_101072302 484
268 3300013306 Ga0163162_10090862 Ga0163162_100908622 484
269 3300025304 Ga0209257_1005921 Ga0209257_10059217 484
270 3300025913 Ga0207695_10000718 Ga0207695_1000071860 484
271 3300025913 Ga0207695_10001195 Ga0207695_1000119514 484
272 3300025921 Ga0207652_10052024 Ga0207652_100520242 484
273 3300025925 Ga0207650_10000062 Ga0207650_1000006280 484
274 3300025931 Ga0207644_10021731 Ga0207644_100217313 484
275 3300025932 Ga0207690_10000053 Ga0207690_1000005388 484
276 3300025941 Ga0207711_10001604 Ga0207711_1000160414 484
277 3300025941 Ga0207711_10016191 Ga0207711_100161913 484
278 3300025961 Ga0207712_10003975 Ga0207712_100039757 484
279 3300025972 Ga0207668_10001123 Ga0207668_100011239 484
280 3300025972 Ga0207668_10003651 Ga0207668_100036515 484
281 3300025986 Ga0207658_10000218 Ga0207658_1000021825 484
282 3300025986 Ga0207658_10033721 Ga0207658_100337213 484
283 3300026035 Ga0207703_10000038 Ga0207703_1000003827 484
284 3300026035 Ga0207703_10005677 Ga0207703_100056779 484
285 3300026088 Ga0207641_10000012 Ga0207641_1000001288 484
286 3300026088 Ga0207641_10005823 Ga0207641_100058235 484
287 3300026095 Ga0207676_10000179 Ga0207676_100001799 484
288 3300026095 Ga0207676_10000437 Ga0207676_1000043710 484
289 3300026118 Ga0207675_100137525 Ga0207675_1001375252 484
290 3300027296 Ga0209389_1000117 Ga0209389_100011765 484
291 3300027361 Ga0209489_109135 Ga0209489_1091353 484
292 3300027363 Ga0209700_100021 Ga0209700_10002167 484
293 3300028379 Ga0268266_10000064 Ga0268266_10000064230 484
294 3300028379 Ga0268266_10003430 Ga0268266_1000343010 484
295 3300028379 Ga0268266_10008959 Ga0268266_100089598 484
296 3300028380 Ga0268265_10000600 Ga0268265_1000060032 484
297 3300028381 Ga0268264_10000059 Ga0268264_10000059299 484
298 3300028786 Ga0307517_10006007 Ga0307517_1000600713 484
299 3300030521 Ga0307511_10053071 Ga0307511_100530712 484
300 3300031456 Ga0307513_10004825 Ga0307513_1000482510 484
301 3300031456 Ga0307513_10014216 Ga0307513_100142164 484
302 3300031730 Ga0307516_10000352 Ga0307516_1000035249 484
303 3300038443 Ga0395901_0217321 Ga0395901_0217321_89_1573 484
304 3300042461 Ga0439460_0012638 Ga0439460_0012638_268_1764 484
305 3300046684 Ga0495669_0000003 Ga0495669_0000003_234390_235877 484
306 3300046684 Ga0495669_0000234 Ga0495669_0000234_26121_27608 484
307 3300047472 Ga0495686_0011256 Ga0495686_0011256_4310_5791 484
308 3300048918 Ga0496115_0000794 Ga0496115_0000794_2139_3623 484
309 3300048921 Ga0496118_0020178 Ga0496118_0020178_3888_5372 484
310 3300048922 Ga0496119_0011136 Ga0496119_0011136_4315_5799 484
311 3300048924 Ga0496121_0000009 Ga0496121_0000009_697038_698522 484
312 3300049569 Ga0501032_0003255 Ga0501032_0003255_6616_8124 484
313 3300049570 Ga0501033_0074012 Ga0501033_0074012_145_1629 484
314 3300049571 Ga0501034_0014235 Ga0501034_0014235_1323_2819 484
315 3300049589 Ga0501073_0000018 Ga0501073_0000018_92003_93511 484
316 3300049593 Ga0501077_0000026 Ga0501077_0000026_639_2147 484
317 3300049742 Ga0501080_0005874 Ga0501080_0005874_5614_7122 484
318 3300049823 Ga0501044_0030476 Ga0501044_0030476_1023_2531 484
319 3300053080 Ga0500635_0000489 Ga0500635_0000489_6137_7621 484
320 3300053087 Ga0500643_008792 Ga0500643_008792_1107_2597 484
321 3300053119 Ga0500595_002565 Ga0500595_002565_6761_8245 484
322 3300053122 Ga0500608_002327 Ga0500608_002327_3300_4784 484
323 3300053148 Ga0500590_021481 Ga0500590_021481_1465_2949 484
324 3300053730 Ga0500645_002164 Ga0500645_002164_6625_8106 484
325 3300053735 Ga0500596_000572 Ga0500596_000572_4851_6335 484
326 iso_pu_bacteria 2899259804 2899261570 484
327 3300003773 Ga0055537_1005923 Ga0055537_10059232 485
328 3300003781 Ga0055536_1005242 Ga0055536_10052422 485
329 3300003781 Ga0055536_1005282 Ga0055536_10052822 485
330 3300003790 Ga0055528_1005371 Ga0055528_10053712 485
331 3300003791 Ga0055530_10001148 Ga0055530_1000114817 485
332 3300003791 Ga0055530_10006282 Ga0055530_100062823 485
333 3300003794 Ga0055531_10003600 Ga0055531_100036003 485
334 3300003794 Ga0055531_10008745 Ga0055531_100087453 485
335 3300005262 Ga0065165_1000845 Ga0065165_100084520 485
336 3300005336 Ga0070680_100029645 Ga0070680_1000296452 485
337 3300005339 Ga0070660_100028150 Ga0070660_1000281502 485
338 3300005341 Ga0070691_10026589 Ga0070691_100265892 485
339 3300005347 Ga0070668_100074951 Ga0070668_1000749512 485
340 3300005455 Ga0070663_100008703 Ga0070663_1000087034 485
341 3300005539 Ga0068853_100081486 Ga0068853_1000814862 485
342 3300005617 Ga0068859_100057359 Ga0068859_1000573592 485
343 3300005841 Ga0068863_100039222 Ga0068863_1000392222 485
344 3300005843 Ga0068860_100001231 Ga0068860_1000012315 485
345 3300005843 Ga0068860_100063874 Ga0068860_1000638742 485
346 3300006931 Ga0097620_100057357 Ga0097620_1000573572 485
347 3300009551 Ga0105238_10011427 Ga0105238_100114272 485
348 3300009551 Ga0105238_10028949 Ga0105238_100289493 485
349 3300009553 Ga0105249_10046170 Ga0105249_100461702 485
350 3300011119 Ga0105246_10017989 Ga0105246_100179892 485
351 3300013100 Ga0157373_10030864 Ga0157373_100308641 485
352 3300013104 Ga0157370_10046511 Ga0157370_100465113 485
353 3300013104 Ga0157370_10214112 Ga0157370_102141121 485
354 3300013105 Ga0157369_10066871 Ga0157369_100668713 485
355 3300013307 Ga0157372_10029019 Ga0157372_100290192 485
356 3300013307 Ga0157372_10202608 Ga0157372_102026082 485
357 3300021361 Ga0213872_10005154 Ga0213872_100051547 485
358 3300025263 Ga0209565_1000332 Ga0209565_100033238 485
359 3300025292 Ga0209676_1000327 Ga0209676_100032727 485
360 3300025292 Ga0209676_1000409 Ga0209676_100040910 485
361 3300025297 Ga0209758_1005274 Ga0209758_10052749 485
362 3300025298 Ga0209050_1004277 Ga0209050_10042775 485
363 3300025298 Ga0209050_1005272 Ga0209050_10052725 485
364 3300025299 Ga0209256_1002189 Ga0209256_10021899 485
365 3300025299 Ga0209256_1003655 Ga0209256_10036559 485
366 3300025304 Ga0209257_1000386 Ga0209257_100038632 485
367 3300025304 Ga0209257_1005253 Ga0209257_10052537 485
368 3300025304 Ga0209257_1009127 Ga0209257_10091272 485
369 3300025913 Ga0207695_10003313 Ga0207695_1000331312 485
370 3300025919 Ga0207657_10042588 Ga0207657_100425882 485
371 3300025924 Ga0207694_10056099 Ga0207694_100560992 485
372 3300025961 Ga0207712_10018228 Ga0207712_100182282 485
373 3300025972 Ga0207668_10066068 Ga0207668_100660682 485
374 3300026041 Ga0207639_10042224 Ga0207639_100422242 485
375 3300026067 Ga0207678_10000104 Ga0207678_1000010415 485
376 3300026121 Ga0207683_10184130 Ga0207683_101841302 485
377 3300028380 Ga0268265_10045113 Ga0268265_100451132 485
378 3300028381 Ga0268264_10000046 Ga0268264_10000046188 485
379 3300028381 Ga0268264_10046476 Ga0268264_100464762 485
380 3300028794 Ga0307515_10101092 Ga0307515_101010922 485
381 3300028800 Ga0265338_10095129 Ga0265338_100951292 485
382 3300031251 Ga0265327_10000602 Ga0265327_100006026 485
383 3300031251 Ga0265327_10019344 Ga0265327_100193442 485
384 3300031456 Ga0307513_10000261 Ga0307513_1000026114 485
385 3300035692 Ga0373935_0046449 Ga0373935_0046449_1168_2655 485
386 3300037312 Ga0395899_0000013 Ga0395899_0000013_266948_268447 485
387 3300037466 Ga0395898_0018445 Ga0395898_0018445_1642_3129 485
388 3300037471 Ga0395905_0007899 Ga0395905_0007899_1673_3160 485
389 3300038443 Ga0395901_0043872 Ga0395901_0043872_1681_3171 485
390 3300039447 Ga0436361_0496775 Ga0436361_0496775_8960_10447 485
391 3300042156 Ga0439446_0015224 Ga0439446_0015224_396_1880 485
392 3300042533 Ga0450901_002064 Ga0450901_002064_613_2100 485
393 3300046457 Ga0495590_0019068 Ga0495590_0019068_352_1836 485
394 3300046471 Ga0495650_0000017 Ga0495650_0000017_140193_141677 485
395 3300046506 Ga0495583_0000020 Ga0495583_0000020_123736_125220 485
396 3300046507 Ga0495606_0023713 Ga0495606_0023713_352_1836 485
397 3300046512 Ga0495610_0000908 Ga0495610_0000908_6920_8404 485
398 3300046512 Ga0495610_0007741 Ga0495610_0007741_4703_6187 485
399 3300046513 Ga0495616_0001591 Ga0495616_0001591_1247_2731 485
400 3300046515 Ga0495620_0017326 Ga0495620_0017326_1675_3159 485
401 3300046519 Ga0495632_0060259 Ga0495632_0060259_320_1804 485
402 3300046520 Ga0495637_0002075 Ga0495637_0002075_1361_2845 485
403 3300046524 Ga0495648_0000948 Ga0495648_0000948_27205_28689 485
404 3300046530 Ga0495654_0000216 Ga0495654_0000216_12886_14370 485
405 3300046558 Ga0495633_0002271 Ga0495633_0002271_128_1612 485
406 3300046616 Ga0495668_0000092 Ga0495668_0000092_120143_121627 485
407 3300046616 Ga0495668_0006535 Ga0495668_0006535_2392_3876 485
408 3300046616 Ga0495668_0016490 Ga0495668_0016490_2720_4204 485
409 3300046694 Ga0495649_0000345 Ga0495649_0000345_3956_5440 485
410 3300047446 Ga0495679_005032 Ga0495679_005032_1263_2747 485
411 3300047469 Ga0495673_0000078 Ga0495673_0000078_198737_200221 485
412 3300047469 Ga0495673_0000401 Ga0495673_0000401_4843_6327 485
413 3300047472 Ga0495686_0003214 Ga0495686_0003214_1152_2636 485
414 3300048905 Ga0496102_0062324 Ga0496102_0062324_1396_2883 485
415 3300048906 Ga0496103_0103884 Ga0496103_0103884_56_1543 485
416 3300048909 Ga0496106_0002226 Ga0496106_0002226_11787_13274 485
417 3300048909 Ga0496106_0005334 Ga0496106_0005334_935_2419 485
418 3300048910 Ga0496107_0001868 Ga0496107_0001868_10575_12059 485
419 3300048924 Ga0496121_0001392 Ga0496121_0001392_4031_5515 485
420 3300048925 Ga0496122_0015650 Ga0496122_0015650_2384_3868 485
421 3300048926 Ga0496123_0005251 Ga0496123_0005251_2957_4441 485
422 3300048928 Ga0496125_0007529 Ga0496125_0007529_2080_3564 485
423 3300048929 Ga0496126_0001877 Ga0496126_0001877_20560_22044 485
424 3300049459 Ga0495678_001720 Ga0495678_001720_1144_2628 485
425 3300049571 Ga0501034_0090118 Ga0501034_0090118_453_1940 485
426 3300049580 Ga0501046_0003242 Ga0501046_0003242_12565_14052 485
427 3300049581 Ga0501047_0210013 Ga0501047_0210013_47_1534 485
428 3300049583 Ga0501067_0000905 Ga0501067_0000905_6214_7701 485
429 3300050491 nmdc:mga00v17_322_c1 nmdc:mga00v17_322_c1_5188_6681 485
430 3300050496 nmdc:mga07m45_187_c2 nmdc:mga07m45_187_c2_7588_9081 485
431 3300053086 Ga0500578_0000420 Ga0500578_0000420_13967_15451 485
432 3300053087 Ga0500643_022035 Ga0500643_022035_262_1746 485
433 3300053088 Ga0500644_0000274 Ga0500644_0000274_26384_27868 485
434 3300053102 Ga0500554_001836 Ga0500554_001836_257_1741 485
435 3300053104 Ga0500556_0000587 Ga0500556_0000587_4049_5533 485
436 3300053108 Ga0500562_002122 Ga0500562_002122_1261_2748 485
437 3300053118 Ga0500594_0003103 Ga0500594_0003103_1664_3148 485
438 3300053122 Ga0500608_000080 Ga0500608_000080_21250_22734 485
439 3300053125 Ga0500618_000112 Ga0500618_000112_29910_31394 485
440 3300053134 Ga0500658_0001458 Ga0500658_0001458_2259_3743 485
441 3300053136 Ga0500559_0000077 Ga0500559_0000077_21756_23246 485
442 3300053136 Ga0500559_0000111 Ga0500559_0000111_26153_27637 485
443 3300053138 Ga0500564_000021 Ga0500564_000021_44586_46070 485
444 3300053156 Ga0500622_0000526 Ga0500622_0000526_32350_33834 485
445 3300053156 Ga0500622_0007443 Ga0500622_0007443_1435_2940 485
446 3300053158 Ga0500627_0009954 Ga0500627_0009954_716_2200 485
447 iso_pu_bacteria 2739367756 2739791273 485
448 iso_pu_bacteria 2834578030 2834579933 485
449 iso_pu_bacteria 2919679072 2919680996 485
450 3300005544 Ga0070686_100000597 Ga0070686_10000059717 486
451 3300015684 Ga0183365_10002 Ga0183365_10002330 486
452 3300037471 Ga0395905_0184082 Ga0395905_0184082_302_1804 486
453 3300044656 Ga0466969_0000193 Ga0466969_0000193_8784_10286 486
454 3300044684 Ga0466966_0000688 Ga0466966_0000688_8955_10457 486
455 3300044693 Ga0466961_0003224 Ga0466961_0003224_4359_5861 486
456 3300044694 Ga0466963_0100827 Ga0466963_0100827_318_1820 486
457 3300044719 Ga0466971_0002179 Ga0466971_0002179_4253_5755 486
458 3300044765 Ga0466970_0065108 Ga0466970_0065108_34_1536 486
459 3300044842 Ga0466957_0002794 Ga0466957_0002794_2974_4476 486
460 3300045049 Ga0466959_0000118 Ga0466959_0000118_12003_13505 486
461 3300045836 Ga0466958_0000398 Ga0466958_0000398_7193_8695 486
462 3300046453 Ga0495627_001043 Ga0495627_001043_6384_7892 486
463 3300048928 Ga0496125_0000749 Ga0496125_0000749_7818_9323 486
464 3300049822 Ga0501035_0077431 Ga0501035_0077431_565_2079 486
465 3300049822 Ga0501035_0208548 Ga0501035_0208548_127_1608 486
466 3300053080 Ga0500635_0001292 Ga0500635_0001292_4231_5745 486
467 3300053087 Ga0500643_009931 Ga0500643_009931_1581_3071 486
468 3300053096 Ga0500641_0000486 Ga0500641_0000486_11486_12976 486
469 3300053104 Ga0500556_0001909 Ga0500556_0001909_2673_4163 486
470 3300053108 Ga0500562_000519 Ga0500562_000519_582_2072 486
471 3300053122 Ga0500608_000397 Ga0500608_000397_11365_12879 486
472 3300053146 Ga0500588_0005049 Ga0500588_0005049_961_2493 486
473 3300053730 Ga0500645_000353 Ga0500645_000353_29568_31058 486
474 3300053730 Ga0500645_000461 Ga0500645_000461_4196_5686 486
475 3300061719 Ga0466962_0000345 Ga0466962_0000345_16244_17746 486
476 iso_pu_bacteria 2840878972 2840883813 486
477 iso_pu_bacteria 2854681122 2854682736 486
478 iso_pu_bacteria 2855020534 2855022844 486
479 iso_pu_bacteria 2898795034 2898796198 486
480 iso_pu_bacteria 2899275550 2899275703 486
481 iso_pu_bacteria 3000405567 3000409113 486
482 iso_pu_bacteria 8057132660 8057133051 486
483 3300021377 Ga0213874_10025668 Ga0213874_100256681 487
484 3300039450 Ga0436363_1027775 Ga0436363_1027775_288_1826 487
485 3300048924 Ga0496121_0004259 Ga0496121_0004259_6485_7993 487
486 3300049570 Ga0501033_0041719 Ga0501033_0041719_605_2104 487
487 3300049572 Ga0501036_0039031 Ga0501036_0039031_2248_3747 487
488 3300049574 Ga0501038_0160191 Ga0501038_0160191_283_1782 487
489 3300049575 Ga0501039_0085206 Ga0501039_0085206_931_2430 487
490 3300049576 Ga0501040_0010441 Ga0501040_0010441_3760_5259 487
491 3300049577 Ga0501041_0024027 Ga0501041_0024027_456_1955 487
492 3300049582 Ga0501048_0050050 Ga0501048_0050050_1024_2523 487
493 3300049591 Ga0501075_0009175 Ga0501075_0009175_415_1914 487
494 3300049592 Ga0501076_0010765 Ga0501076_0010765_1645_3144 487
495 3300049741 Ga0501079_0004232 Ga0501079_0004232_7115_8614 487
496 3300049743 Ga0501081_0008312 Ga0501081_0008312_1575_3074 487
497 3300049824 Ga0501045_0124006 Ga0501045_0124006_56_1555 487
498 3300053139 Ga0500568_0000001 Ga0500568_0000001_411518_413038 487
499 3300054114 Ga0501084_0018508 Ga0501084_0018508_4245_5744 487
500 3300060353 Ga0501082_0004153 Ga0501082_0004153_4909_6408 487
501 iso_pu_bacteria 2513237305 2514420062 487
502 iso_pu_bacteria 2721755686 2723575579 487
503 iso_pu_bacteria 2841734538 2841739465 487
504 iso_pu_bacteria 2842333319 2842334877 487
505 iso_pu_bacteria 2847670302 2847675781 487
506 iso_pu_bacteria 2847686936 2847692427 487
507 iso_pu_bacteria 2856314179 2856319718 487
508 iso_pu_bacteria 2871495908 2871501218 487
509 iso_pu_bacteria 2874102143 2874107506 487
510 iso_pu_bacteria 2874123672 2874123865 487
511 iso_pu_bacteria 2876369609 2876375664 487
512 iso_pu_bacteria 2876392853 2876398626 487
513 iso_pu_bacteria 2878035449 2878040901 487
514 iso_pu_bacteria 2878760144 2878765198 487
515 iso_pu_bacteria 2878767105 2878772905 487
516 iso_pu_bacteria 2881147464 2881151701 487
517 iso_pu_bacteria 2881161766 2881167719 487
518 iso_pu_bacteria 2882632389 2882636462 487
519 iso_pu_bacteria 2885305155 2885309608 487
520 iso_pu_bacteria 2885326080 2885330632 487
521 iso_pu_bacteria 2885334103 2885338941 487
522 iso_pu_bacteria 2903540706 2903546029 487
523 iso_pu_bacteria 2904659560 2904665181 487
524 iso_pu_bacteria 2906328253 2906329840 487
525 iso_pu_bacteria 2906414383 2906420438 487
526 iso_pu_bacteria 2922158528 2922160460 487
527 iso_pu_bacteria 2924726620 2924732323 487
528 iso_pu_bacteria 2937822353 2937824663 487
529 iso_pu_bacteria 2937891427 2937893650 487
530 iso_pu_bacteria 2937994558 2937999887 487
531 iso_pu_bacteria 2958115193 2958118626 487
532 iso_pu_bacteria 2958165035 2958170350 487
533 iso_pu_bacteria 2961114664 2961120182 487
534 iso_pu_bacteria 2961163497 2961168805 487
535 iso_pu_bacteria 2965018300 2965024092 487
536 iso_pu_bacteria 2968091066 2968096441 487
537 iso_pu_bacteria 2968097103 2968101179 487
538 iso_pu_bacteria 2968110612 2968116539 487
539 iso_pu_bacteria 2968128360 2968132231 487
540 iso_pu_bacteria 2968171901 2968177199 487
541 iso_pu_bacteria 2970554993 2970560045 487
542 iso_pu_bacteria 2977858184 2977861097 487
543 iso_pu_bacteria 2977864932 2977866911 487
544 iso_pu_bacteria 2979779861 2979780168 487
545 iso_pu_bacteria 2987659509 2987664836 487
546 iso_pu_bacteria 3004188549 3004193893 487
547 iso_pu_bacteria 8004445564 8004447518 487
548 iso_pu_bacteria 8004703790 8004709528 487
549 3300021361 Ga0213872_10001454 Ga0213872_1000145411 488
550 3300031250 Ga0265331_10008614 Ga0265331_100086142 488
551 3300032168 Ga0316593_10000364 Ga0316593_100003642 488
552 3300039447 Ga0436361_0917304 Ga0436361_0917304_28750_30249 488
553 iso_pu_bacteria 2511231221 2512033972 488
554 iso_pu_bacteria 2713897090 2715499639 488
555 iso_pu_bacteria 2738541317 2738946388 488
556 iso_pu_bacteria 2894817345 2894818408 488
557 iso_pu_bacteria 2913308742 2913310801 488
558 iso_pu_bacteria 2924762789 2924767191 488
559 iso_pu_bacteria 2987666974 2987669045 488
560 iso_pu_bacteria 8002060224 8002063545 488
561 iso_pu_bacteria 8045864390 8045865199 488
562 3300038735 Ga0400485_03094 Ga0400485_03094_1749_3323 489
563 iso_pu_bacteria 2509276021 2509387515 489
564 iso_pu_bacteria 2510461069 2510840150 489
565 iso_pu_bacteria 2513237087 2513592719 489
566 iso_pu_bacteria 2515075009 2515111463 489
567 iso_pu_bacteria 2828305725 2828310123 489
568 iso_pu_bacteria 2841864319 2841865299 489
569 iso_pu_bacteria 2842341865 2842343423 489
570 iso_pu_bacteria 2842363717 2842365437 489
571 iso_pu_bacteria 2842694124 2842696911 489
572 iso_pu_bacteria 2899803654 2899807898 489
573 iso_pu_bacteria 2917554339 2917557042 489
574 iso_pu_bacteria 2929138655 2929139680 489
575 iso_pu_bacteria 8005460587 8005462109 489
576 iso_pu_bacteria 8046767195 8046769344 489
577 iso_pu_bacteria 8057575449 8057577135 489
578 3300026118 Ga0207675_100079812 Ga0207675_1000798123 490
579 3300031727 Ga0316576_10016359 Ga0316576_100163593 490
580 3300036712 Ga0316584_0029523 Ga0316584_0029523_1137_2678 490
581 3300039062 Ga0400483_135188 Ga0400483_135188_104_1654 490
582 3300039062 Ga0400483_198091 Ga0400483_198091_510_2051 490
583 3300045051 Ga0451576_0059690 Ga0451576_0059690_846_2393 490
584 3300046542 Ga0495597_0047282 Ga0495597_0047282_271_1776 490
585 3300049568 Ga0501031_0000019 Ga0501031_0000019_40143_41645 490
586 3300049569 Ga0501032_0000009 Ga0501032_0000009_86343_87845 490
587 3300049570 Ga0501033_0000019 Ga0501033_0000019_140263_141765 490
588 3300049571 Ga0501034_0000044 Ga0501034_0000044_86343_87845 490
589 3300049571 Ga0501034_0000176 Ga0501034_0000176_19182_20723 490
590 3300049572 Ga0501036_0000008 Ga0501036_0000008_86343_87845 490
591 3300049573 Ga0501037_0000055 Ga0501037_0000055_107249_108751 490
592 3300049574 Ga0501038_0000006 Ga0501038_0000006_86343_87845 490
593 3300049575 Ga0501039_0000014 Ga0501039_0000014_140263_141765 490
594 3300049822 Ga0501035_0000096 Ga0501035_0000096_1857_3359 490
595 3300049823 Ga0501044_0000017 Ga0501044_0000017_140263_141765 490
596 3300050511 nmdc:mga08y16_134810_c1 nmdc:mga08y16_134810_c1_812_2410 490
597 3300002741 JGI25157J39369_1000707 JGI25157J39369_10007077 491
598 3300005340 Ga0070689_100072270 Ga0070689_1000722702 491
599 3300005530 Ga0070679_100063706 Ga0070679_1000637063 491
600 3300005563 Ga0068855_100092635 Ga0068855_1000926352 491
601 3300005617 Ga0068859_100021262 Ga0068859_1000212626 491
602 3300005937 Ga0081455_10001031 Ga0081455_1000103121 491
603 3300005983 Ga0081540_1001383 Ga0081540_10013834 491
604 3300006931 Ga0097620_100021262 Ga0097620_1000212622 491
605 3300009545 Ga0105237_10074969 Ga0105237_100749692 491
606 3300013308 Ga0157375_10171314 Ga0157375_101713141 491
607 3300017792 Ga0163161_10060355 Ga0163161_100603552 491
608 3300021384 Ga0213876_10000716 Ga0213876_1000071618 491
609 3300021384 Ga0213876_10003346 Ga0213876_100033466 491
610 3300021388 Ga0213875_10016246 Ga0213875_100162462 491
611 3300025256 Ga0209759_1000057 Ga0209759_100005799 491
612 3300025921 Ga0207652_10047102 Ga0207652_100471023 491
613 3300025936 Ga0207670_10038590 Ga0207670_100385902 491
614 3300028381 Ga0268264_10098912 Ga0268264_100989122 491
615 3300028556 Ga0265337_1001337 Ga0265337_10013376 491
616 3300028573 Ga0265334_10001279 Ga0265334_100012796 491
617 3300028800 Ga0265338_10038295 Ga0265338_100382954 491
618 3300031249 Ga0265339_10034446 Ga0265339_100344462 491
619 3300035117 Ga0373953_0009093 Ga0373953_0009093_1594_3120 491
620 3300035695 Ga0373927_0103826 Ga0373927_0103826_121_1653 491
621 3300035724 Ga0373933_0024125 Ga0373933_0024125_1719_3245 491
622 3300036401 Ga0373937_0002849 Ga0373937_0002849_10546_12072 491
623 3300037853 Ga0436364_0238815 Ga0436364_0238815_4975_6480 491
624 3300039437 Ga0436365_0400394 Ga0436365_0400394_7361_8866 491
625 3300039437 Ga0436365_0886091 Ga0436365_0886091_29515_31020 491
626 3300039450 Ga0436363_0609059 Ga0436363_0609059_4771_6276 491
627 3300039450 Ga0436363_1720929 Ga0436363_1720929_5635_7140 491
628 3300039453 Ga0436362_0516986 Ga0436362_0516986_948_2453 491
629 3300048910 Ga0496107_0084790 Ga0496107_0084790_452_1960 491
630 3300048917 Ga0496114_0007532 Ga0496114_0007532_561_2069 491
631 3300050511 nmdc:mga08y16_33263_c1 nmdc:mga08y16_33263_c1_2504_4087 491
632 3300005719 Ga0068861_100116950 Ga0068861_1001169502 492
633 3300005841 Ga0068863_100014998 Ga0068863_1000149982 492
634 3300006048 Ga0075363_100038716 Ga0075363_1000387162 492
635 3300006058 Ga0075432_10000094 Ga0075432_1000009414 492
636 3300025986 Ga0207658_10023073 Ga0207658_100230734 492
637 3300026118 Ga0207675_100025874 Ga0207675_1000258742 492
638 3300027907 Ga0207428_10035873 Ga0207428_100358732 492
639 3300031242 Ga0265329_10006065 Ga0265329_100060652 492
640 3300031250 Ga0265331_10000695 Ga0265331_1000069510 492
641 3300031251 Ga0265327_10004643 Ga0265327_100046437 492
642 3300031344 Ga0265316_10000169 Ga0265316_1000016955 492
643 3300031712 Ga0265342_10088293 Ga0265342_100882932 492
644 3300032133 Ga0316583_10028121 Ga0316583_100281212 492
645 3300035691 Ga0373931_0053499 Ga0373931_0053499_594_2108 492
646 3300046491 Ga0495584_0015466 Ga0495584_0015466_1825_3339 492
647 3300046492 Ga0495585_0077303 Ga0495585_0077303_108_1622 492
648 3300048904 Ga0496101_0034152 Ga0496101_0034152_851_2365 492
649 3300048906 Ga0496103_0008642 Ga0496103_0008642_1878_3392 492
650 3300048912 Ga0496109_0023339 Ga0496109_0023339_156_1670 492
651 3300048912 Ga0496109_0060051 Ga0496109_0060051_398_1912 492
652 3300048913 Ga0496110_0097858 Ga0496110_0097858_790_2304 492
653 3300048915 Ga0496112_0045422 Ga0496112_0045422_1798_3312 492
654 3300049574 Ga0501038_0181333 Ga0501038_0181333_48_1562 492
655 3300049576 Ga0501040_0057621 Ga0501040_0057621_307_1821 492
656 3300049577 Ga0501041_0053334 Ga0501041_0053334_609_2123 492
657 3300049578 Ga0501042_0007634 Ga0501042_0007634_510_2024 492
658 3300049578 Ga0501042_0025516 Ga0501042_0025516_1458_2972 492
659 3300049582 Ga0501048_0021203 Ga0501048_0021203_1794_3308 492
660 3300049582 Ga0501048_0059997 Ga0501048_0059997_786_2300 492
661 3300049586 Ga0501070_0111973 Ga0501070_0111973_698_2218 492
662 3300049587 Ga0501071_0005547 Ga0501071_0005547_2601_4115 492
663 3300049587 Ga0501071_0100061 Ga0501071_0100061_553_2067 492
664 3300049588 Ga0501072_0004184 Ga0501072_0004184_8616_10130 492
665 3300049590 Ga0501074_0044326 Ga0501074_0044326_1590_3104 492
666 3300049590 Ga0501074_0081192 Ga0501074_0081192_754_2268 492
667 3300049591 Ga0501075_0105082 Ga0501075_0105082_545_2059 492
668 3300049592 Ga0501076_0049755 Ga0501076_0049755_766_2280 492
669 3300049593 Ga0501077_0027418 Ga0501077_0027418_2034_3548 492
670 3300049741 Ga0501079_0017813 Ga0501079_0017813_903_2417 492
671 3300049741 Ga0501079_0056185 Ga0501079_0056185_1076_2590 492
672 3300049742 Ga0501080_0061944 Ga0501080_0061944_151_1665 492
673 3300049743 Ga0501081_0009224 Ga0501081_0009224_3871_5385 492
674 3300049744 Ga0501083_0021296 Ga0501083_0021296_508_2022 492
675 3300049822 Ga0501035_0051742 Ga0501035_0051742_1586_3100 492
676 3300049822 Ga0501035_0054473 Ga0501035_0054473_1207_2721 492
677 3300049824 Ga0501045_0049169 Ga0501045_0049169_756_2270 492
678 3300054114 Ga0501084_0049834 Ga0501084_0049834_614_2128 492
679 3300054114 Ga0501084_0098628 Ga0501084_0098628_36_1550 492
680 3300060353 Ga0501082_0054287 Ga0501082_0054287_719_2233 492
681 3300061734 Ga0530510_0013704 Ga0530510_0013704_2360_3874 492
682 3300061734 Ga0530510_0017724 Ga0530510_0017724_2493_4007 492
683 3300005719 Ga0068861_100097602 Ga0068861_1000976022 493
684 3300005937 Ga0081455_10006263 Ga0081455_1000626310 493
685 3300005937 Ga0081455_10014607 Ga0081455_100146072 493
686 3300026118 Ga0207675_100094527 Ga0207675_1000945272 493
687 3300035171 Ga0373946_0015362 Ga0373946_0015362_410_1936 493
688 3300037853 Ga0436364_0414769 Ga0436364_0414769_515_2038 493
689 3300048907 Ga0496104_0009696 Ga0496104_0009696_1480_3003 493
690 3300048908 Ga0496105_0006289 Ga0496105_0006289_7037_8560 493
691 3300048909 Ga0496106_0179652 Ga0496106_0179652_29_1552 493
692 3300048911 Ga0496108_0002227 Ga0496108_0002227_4894_6417 493
693 3300048912 Ga0496109_0002047 Ga0496109_0002047_10422_11945 493
694 3300048914 Ga0496111_0008316 Ga0496111_0008316_176_1699 493
695 3300048915 Ga0496112_0003678 Ga0496112_0003678_6738_8261 493
696 3300048915 Ga0496112_0068585 Ga0496112_0068585_332_1843 493
697 3300048916 Ga0496113_0001984 Ga0496113_0001984_4775_6298 493
698 3300048916 Ga0496113_0076057 Ga0496113_0076057_373_1884 493
699 3300048917 Ga0496114_0094783 Ga0496114_0094783_1008_2519 493
700 3300048918 Ga0496115_0001409 Ga0496115_0001409_11130_12653 493
701 3300048922 Ga0496119_0003333 Ga0496119_0003333_5243_6754 493
702 3300053108 Ga0500562_000021 Ga0500562_000021_68951_70510 493
703 3300053117 Ga0500593_000050 Ga0500593_000050_29870_31390 493
704 3300037312 Ga0395899_0009300 Ga0395899_0009300_5083_6627 494
705 3300038443 Ga0395901_0001264 Ga0395901_0001264_22687_24213 494
706 3300009177 Ga0105248_10000071 Ga0105248_10000071106 496
707 3300009551 Ga0105238_10029957 Ga0105238_100299574 496
708 3300025924 Ga0207694_10008152 Ga0207694_100081523 496
709 3300025924 Ga0207694_10078125 Ga0207694_100781252 496
710 3300053119 Ga0500595_007222 Ga0500595_007222_1944_3476 496
711 3300005435 Ga0070714_100016732 Ga0070714_1000167322 497
712 3300006028 Ga0070717_10024295 Ga0070717_100242952 497
713 3300044684 Ga0466966_0031712 Ga0466966_0031712_500_2002 497
714 3300045836 Ga0466958_0036198 Ga0466958_0036198_823_2331 497
715 3300046500 Ga0495596_0000288 Ga0495596_0000288_31918_33456 498
716 iso_pu_bacteria 2510917021 2511127112 498
717 3300005347 Ga0070668_100000018 Ga0070668_100000018102 499
718 3300005841 Ga0068863_100000122 Ga0068863_10000012242 499
719 3300009553 Ga0105249_10011902 Ga0105249_100119025 499
720 3300025254 Ga0209148_1000465 Ga0209148_100046524 499
721 3300025931 Ga0207644_10000602 Ga0207644_1000060224 499
722 3300025961 Ga0207712_10030942 Ga0207712_100309422 499
723 3300025972 Ga0207668_10000342 Ga0207668_100003426 499
724 3300026088 Ga0207641_10000001 Ga0207641_1000000144 499
725 3300028381 Ga0268264_10032863 Ga0268264_100328632 499
726 3300032004 Ga0307414_10061493 Ga0307414_100614932 499
727 3300048910 Ga0496107_0060523 Ga0496107_0060523_603_2114 499
728 iso_pu_bacteria 2818991438 2819550569 499
729 iso_pu_bacteria 8054302542 8054307344 499
730 3300009093 Ga0105240_10000305 Ga0105240_1000030580 500
731 3300009545 Ga0105237_10003515 Ga0105237_100035155 500
732 3300010375 Ga0105239_10000037 Ga0105239_10000037165 500
733 3300025913 Ga0207695_10001017 Ga0207695_1000101733 500
734 3300025914 Ga0207671_10007045 Ga0207671_100070457 500
735 3300037312 Ga0395899_0086958 Ga0395899_0086958_454_1971 500
736 3300037418 Ga0395900_0147150 Ga0395900_0147150_593_2110 500
737 3300044694 Ga0466963_0128588 Ga0466963_0128588_153_1679 500
738 3300048924 Ga0496121_0035073 Ga0496121_0035073_1662_3218 500
739 3300053153 Ga0500616_0018371 Ga0500616_0018371_1061_2614 500
740 iso_pu_bacteria 2599185354 2600201021 500
741 iso_pu_bacteria 2751185897 2753765313 500
742 3300005355 Ga0070671_100024938 Ga0070671_1000249382 501
743 3300005530 Ga0070679_100050766 Ga0070679_1000507663 501
744 3300005563 Ga0068855_100059691 Ga0068855_1000596914 501
745 3300005614 Ga0068856_100012156 Ga0068856_1000121565 501
746 3300005616 Ga0068852_100006174 Ga0068852_1000061745 501
747 3300005616 Ga0068852_100007731 Ga0068852_1000077313 501
748 3300005841 Ga0068863_100060215 Ga0068863_1000602152 501
749 3300009092 Ga0105250_10005265 Ga0105250_100052655 501
750 3300009093 Ga0105240_10019011 Ga0105240_100190115 501
751 3300009551 Ga0105238_10014487 Ga0105238_100144875 501
752 3300009551 Ga0105238_10027868 Ga0105238_100278682 501
753 3300013100 Ga0157373_10060215 Ga0157373_100602152 501
754 3300013105 Ga0157369_10149285 Ga0157369_101492852 501
755 3300013307 Ga0157372_10013006 Ga0157372_100130067 501
756 3300025909 Ga0207705_10041040 Ga0207705_100410402 501
757 3300025931 Ga0207644_10006348 Ga0207644_100063484 501
758 3300025949 Ga0207667_10151876 Ga0207667_101518762 501
759 3300025960 Ga0207651_10017670 Ga0207651_100176702 501
760 3300026035 Ga0207703_10002707 Ga0207703_100027076 501
761 3300026088 Ga0207641_10052619 Ga0207641_100526192 501
762 3300026142 Ga0207698_10003399 Ga0207698_100033995 501
763 3300048915 Ga0496112_0025671 Ga0496112_0025671_2397_3917 501
764 3300048918 Ga0496115_0000571 Ga0496115_0000571_20650_22170 501
765 3300001979 JGI24740J21852_10002149 JGI24740J21852_100021492 502
766 3300005341 Ga0070691_10002895 Ga0070691_100028952 502
767 3300005344 Ga0070661_100026358 Ga0070661_1000263582 502
768 3300005436 Ga0070713_100001498 Ga0070713_1000014982 502
769 3300005455 Ga0070663_100032434 Ga0070663_1000324342 502
770 3300005535 Ga0070684_100002726 Ga0070684_1000027262 502
771 3300005539 Ga0068853_100010858 Ga0068853_1000108584 502
772 3300005564 Ga0070664_100065815 Ga0070664_1000658151 502
773 3300005577 Ga0068857_100179160 Ga0068857_1001791602 502
774 3300005578 Ga0068854_100010766 Ga0068854_1000107662 502
775 3300009177 Ga0105248_10000059 Ga0105248_1000005963 502
776 3300013104 Ga0157370_10028965 Ga0157370_100289655 502
777 3300013105 Ga0157369_10088770 Ga0157369_100887702 502
778 3300025904 Ga0207647_10001078 Ga0207647_100010784 502
779 3300025909 Ga0207705_10007304 Ga0207705_100073045 502
780 3300025913 Ga0207695_10014240 Ga0207695_100142405 502
781 3300025917 Ga0207660_10008412 Ga0207660_100084125 502
782 3300025919 Ga0207657_10008828 Ga0207657_100088286 502
783 3300025920 Ga0207649_10021111 Ga0207649_100211112 502
784 3300025924 Ga0207694_10022405 Ga0207694_100224052 502
785 3300025932 Ga0207690_10003079 Ga0207690_100030798 502
786 3300025949 Ga0207667_10008988 Ga0207667_100089888 502
787 3300025981 Ga0207640_10021214 Ga0207640_100212142 502
788 3300026023 Ga0207677_10107112 Ga0207677_101071122 502
789 3300026041 Ga0207639_10031700 Ga0207639_100317002 502
790 3300026078 Ga0207702_10015322 Ga0207702_100153222 502
791 3300026116 Ga0207674_10003125 Ga0207674_1000312513 502
792 3300026142 Ga0207698_10003964 Ga0207698_100039646 502
793 3300031824 Ga0307413_10044707 Ga0307413_100447072 502
794 3300037312 Ga0395899_0012431 Ga0395899_0012431_1567_3099 502
795 3300037418 Ga0395900_0002764 Ga0395900_0002764_16814_18358 502
796 3300044684 Ga0466966_0076533 Ga0466966_0076533_401_1933 502
797 3300046512 Ga0495610_0000030 Ga0495610_0000030_87095_88630 502
798 3300047445 Ga0495677_0005616 Ga0495677_0005616_2136_3659 502
799 3300047470 Ga0495681_0000011 Ga0495681_0000011_88597_90132 502
800 3300048911 Ga0496108_0034941 Ga0496108_0034941_2406_3929 502
801 3300048914 Ga0496111_0014620 Ga0496111_0014620_1580_3103 502
802 3300048915 Ga0496112_0036881 Ga0496112_0036881_948_2471 502
803 3300049686 Ga0501257_000095 Ga0501257_000095_18910_20463 502
804 3300049776 Ga0501280_002283 Ga0501280_002283_1021_2574 502
805 iso_pu_bacteria 2643221605 2644040207 502
806 3300001979 JGI24740J21852_10011083 JGI24740J21852_100110833 503
807 3300003791 Ga0055530_10011836 Ga0055530_100118362 503
808 3300005327 Ga0070658_10083602 Ga0070658_100836022 503
809 3300005329 Ga0070683_100019454 Ga0070683_1000194545 503
810 3300005336 Ga0070680_100003695 Ga0070680_1000036955 503
811 3300005344 Ga0070661_100014744 Ga0070661_1000147445 503
812 3300005455 Ga0070663_100018515 Ga0070663_1000185152 503
813 3300005458 Ga0070681_10032415 Ga0070681_100324154 503
814 3300005530 Ga0070679_100022016 Ga0070679_1000220165 503
815 3300005563 Ga0068855_100066595 Ga0068855_1000665952 503
816 3300005564 Ga0070664_100003103 Ga0070664_1000031037 503
817 3300005616 Ga0068852_100134989 Ga0068852_1001349892 503
818 3300005844 Ga0068862_100000067 Ga0068862_100000067107 503
819 3300006038 Ga0075365_10022854 Ga0075365_100228542 503
820 3300006042 Ga0075368_10000991 Ga0075368_100009911 503
821 3300006048 Ga0075363_100026434 Ga0075363_1000264342 503
822 3300006051 Ga0075364_10078826 Ga0075364_100788261 503
823 3300006177 Ga0075362_10002672 Ga0075362_100026724 503
824 3300006177 Ga0075362_10015878 Ga0075362_100158782 503
825 3300006178 Ga0075367_10009476 Ga0075367_100094762 503
826 3300006186 Ga0075369_10014705 Ga0075369_100147051 503
827 3300006195 Ga0075366_10000596 Ga0075366_100005963 503
828 3300006195 Ga0075366_10005099 Ga0075366_100050997 503
829 3300006353 Ga0075370_10000043 Ga0075370_100000437 503
830 3300006353 Ga0075370_10023778 Ga0075370_100237783 503
831 3300006353 Ga0075370_10056584 Ga0075370_100565842 503
832 3300013104 Ga0157370_10037299 Ga0157370_100372992 503
833 3300025298 Ga0209050_1000217 Ga0209050_100021734 503
834 3300025904 Ga0207647_10007591 Ga0207647_100075917 503
835 3300025907 Ga0207645_10006878 Ga0207645_100068787 503
836 3300025921 Ga0207652_10020568 Ga0207652_100205683 503
837 3300025931 Ga0207644_10022690 Ga0207644_100226903 503
838 3300025933 Ga0207706_10123176 Ga0207706_101231762 503
839 3300025945 Ga0207679_10005151 Ga0207679_100051513 503
840 3300026067 Ga0207678_10000716 Ga0207678_1000071624 503
841 3300026088 Ga0207641_10021395 Ga0207641_100213952 503
842 3300027866 Ga0209813_10000053 Ga0209813_1000005321 503
843 3300028380 Ga0268265_10000021 Ga0268265_10000021125 503
844 3300028381 Ga0268264_10000330 Ga0268264_1000033011 503
845 3300031251 Ga0265327_10062793 Ga0265327_100627932 503
846 3300031731 Ga0307405_10026182 Ga0307405_100261822 503
847 3300031901 Ga0307406_10031861 Ga0307406_100318613 503
848 3300032002 Ga0307416_100034538 Ga0307416_1000345382 503
849 3300037312 Ga0395899_0000804 Ga0395899_0000804_3365_4900 503
850 3300037418 Ga0395900_0001255 Ga0395900_0001255_26825_28360 503
851 3300037466 Ga0395898_0027194 Ga0395898_0027194_2566_4101 503
852 3300037471 Ga0395905_0001765 Ga0395905_0001765_21578_23113 503
853 3300038443 Ga0395901_0008542 Ga0395901_0008542_2596_4131 503
854 3300038443 Ga0395901_0220860 Ga0395901_0220860_262_1782 503
855 3300044694 Ga0466963_0001435 Ga0466963_0001435_1045_2574 503
856 3300046506 Ga0495583_0000426 Ga0495583_0000426_8012_9538 503
857 3300048919 Ga0496116_0000039 Ga0496116_0000039_208208_209743 503
858 3300048924 Ga0496121_0030838 Ga0496121_0030838_1141_2676 503
859 3300048925 Ga0496122_0066534 Ga0496122_0066534_370_1905 503
860 3300048926 Ga0496123_0003680 Ga0496123_0003680_1069_2604 503
861 3300048927 Ga0496124_0002764 Ga0496124_0002764_5852_7390 503
862 3300048928 Ga0496125_0002786 Ga0496125_0002786_1066_2604 503
863 3300048929 Ga0496126_0000041 Ga0496126_0000041_132157_133692 503
864 3300048929 Ga0496126_0071794 Ga0496126_0071794_562_2094 503
865 3300050489 nmdc:mga03683_625_c1 nmdc:mga03683_625_c1_2857_4392 503
866 3300050489 nmdc:mga03683_6_c1 nmdc:mga03683_6_c1_44374_45915 503
867 3300050493 nmdc:mga0k408_6_c1 nmdc:mga0k408_6_c1_154132_155673 503
868 3300050494 nmdc:mga06z11_147_c1 nmdc:mga06z11_147_c1_26102_27637 503
869 3300050495 nmdc:mga04h51_24_c1 nmdc:mga04h51_24_c1_18422_19957 503
870 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_245539_247080 503
871 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_209531_211066 503
872 3300050516 nmdc:mga0sz30_44_c1 nmdc:mga0sz30_44_c1_6718_8253 503
873 iso_pu_bacteria 2739367865 2740030137 503
874 3300005834 Ga0068851_10019055 Ga0068851_100190552 504
875 3300026142 Ga0207698_10010338 Ga0207698_100103382 504
876 3300037312 Ga0395899_0022192 Ga0395899_0022192_1712_3235 504
877 3300037418 Ga0395900_0191156 Ga0395900_0191156_196_1719 504
878 3300037466 Ga0395898_0049253 Ga0395898_0049253_742_2265 504
879 3300038443 Ga0395901_0147294 Ga0395901_0147294_891_2414 504
880 3300044694 Ga0466963_0043037 Ga0466963_0043037_270_1802 504
881 3300053087 Ga0500643_011734 Ga0500643_011734_905_2443 504
882 3300005327 Ga0070658_10000125 Ga0070658_1000012555 505
883 3300005327 Ga0070658_10013254 Ga0070658_100132543 505
884 3300005336 Ga0070680_100072505 Ga0070680_1000725052 505
885 3300005339 Ga0070660_100005715 Ga0070660_1000057157 505
886 3300005455 Ga0070663_100000958 Ga0070663_1000009587 505
887 3300005563 Ga0068855_100060289 Ga0068855_1000602894 505
888 3300005578 Ga0068854_100011856 Ga0068854_1000118564 505
889 3300005616 Ga0068852_100000387 Ga0068852_10000038725 505
890 3300005616 Ga0068852_100145389 Ga0068852_1001453892 505
891 3300005842 Ga0068858_100144316 Ga0068858_1001443162 505
892 3300013104 Ga0157370_10064818 Ga0157370_100648182 505
893 3300025909 Ga0207705_10000004 Ga0207705_10000004651 505
894 3300025909 Ga0207705_10005634 Ga0207705_100056342 505
895 3300025913 Ga0207695_10007252 Ga0207695_1000725211 505
896 3300025919 Ga0207657_10001303 Ga0207657_1000130324 505
897 3300025919 Ga0207657_10001904 Ga0207657_1000190415 505
898 3300025933 Ga0207706_10046633 Ga0207706_100466334 505
899 3300025949 Ga0207667_10107443 Ga0207667_101074432 505
900 3300025981 Ga0207640_10000535 Ga0207640_1000053518 505
901 3300026067 Ga0207678_10051842 Ga0207678_100518423 505
902 3300026142 Ga0207698_10000193 Ga0207698_1000019323 505
903 3300031824 Ga0307413_10019680 Ga0307413_100196802 505
904 3300031852 Ga0307410_10000957 Ga0307410_100009576 505
905 3300031911 Ga0307412_10148330 Ga0307412_101483302 505
906 3300031995 Ga0307409_100030371 Ga0307409_1000303712 505
907 3300031995 Ga0307409_100145419 Ga0307409_1001454192 505
908 3300032004 Ga0307414_10040568 Ga0307414_100405682 505
909 3300032005 Ga0307411_10001513 Ga0307411_100015136 505
910 3300032005 Ga0307411_10007647 Ga0307411_100076472 505
911 3300037312 Ga0395899_0000885 Ga0395899_0000885_13625_15154 505
912 3300037418 Ga0395900_0000031 Ga0395900_0000031_242417_243946 505
913 3300037418 Ga0395900_0029097 Ga0395900_0029097_3837_5363 505
914 3300037418 Ga0395900_0059667 Ga0395900_0059667_843_2372 505
915 3300037466 Ga0395898_0032773 Ga0395898_0032773_1996_3525 505
916 3300037471 Ga0395905_0000458 Ga0395905_0000458_33821_35347 505
917 3300037471 Ga0395905_0105913 Ga0395905_0105913_269_1798 505
918 3300038443 Ga0395901_0000035 Ga0395901_0000035_41966_43495 505
919 3300038443 Ga0395901_0006984 Ga0395901_0006984_722_2248 505
920 3300002067 JGI24735J21928_10001163 JGI24735J21928_100011637 506
921 3300002075 JGI24738J21930_10003997 JGI24738J21930_100039972 506
922 3300005327 Ga0070658_10172058 Ga0070658_101720581 506
923 3300005339 Ga0070660_100114842 Ga0070660_1001148422 506
924 3300005366 Ga0070659_100026185 Ga0070659_1000261854 506
925 3300005539 Ga0068853_100022761 Ga0068853_1000227613 506
926 3300005563 Ga0068855_100031052 Ga0068855_1000310525 506
927 3300005577 Ga0068857_100108075 Ga0068857_1001080752 506
928 3300025904 Ga0207647_10027206 Ga0207647_100272062 506
929 3300025909 Ga0207705_10067491 Ga0207705_100674911 506
930 3300025912 Ga0207707_10034921 Ga0207707_100349212 506
931 3300025913 Ga0207695_10040465 Ga0207695_100404654 506
932 3300025919 Ga0207657_10024687 Ga0207657_100246872 506
933 3300025924 Ga0207694_10011507 Ga0207694_100115077 506
934 3300025932 Ga0207690_10008542 Ga0207690_100085422 506
935 3300025949 Ga0207667_10198713 Ga0207667_101987132 506
936 3300025981 Ga0207640_10043541 Ga0207640_100435412 506
937 3300026041 Ga0207639_10000260 Ga0207639_1000026030 506
938 3300026116 Ga0207674_10024869 Ga0207674_100248692 506
939 3300026142 Ga0207698_10046164 Ga0207698_100461642 506
940 3300037471 Ga0395905_0073033 Ga0395905_0073033_663_2195 506
941 3300046539 Ga0495621_0014749 Ga0495621_0014749_323_1852 506
942 iso_pu_bacteria 2882806704 2882807681 506
943 3300005262 Ga0065165_1003786 Ga0065165_10037865 507
944 3300005289 Ga0065704_10070237 Ga0065704_1007023716 507
945 3300009101 Ga0105247_10003856 Ga0105247_100038567 507
946 3300009553 Ga0105249_10000105 Ga0105249_10000105113 507
947 3300025900 Ga0207710_10004304 Ga0207710_100043043 507
948 3300025961 Ga0207712_10000015 Ga0207712_10000015113 507
949 3300053151 Ga0500604_0000078 Ga0500604_0000078_24315_25889 507
950 iso_pu_bacteria 2896429255 2896430526 507
951 3300026023 Ga0207677_10004145 Ga0207677_100041452 508
952 iso_pu_bacteria 2895880812 2895886317 508
953 3300005841 Ga0068863_100075817 Ga0068863_1000758172 509
954 3300025986 Ga0207658_10001134 Ga0207658_1000113410 509
955 3300031548 Ga0307408_100025242 Ga0307408_1000252422 513
956 iso_pu_bacteria 2775507255 2778123689 514
957 iso_pu_bacteria 2919709256 2919710013 514
958 3300005455 Ga0070663_100001663 Ga0070663_1000016632 516
959 3300046616 Ga0495668_0015161 Ga0495668_0015161_1219_2781 516
960 3300053730 Ga0500645_001891 Ga0500645_001891_7291_8868 517
961 3300001904 JGI24736J21556_1000469 JGI24736J21556_10004696 518
962 3300053157 Ga0500624_000045 Ga0500624_000045_80297_81868 518

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

211

499

0.97

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

130

199

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8beh-assembly1.cif.gz_M cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane tip) 0.986 262 480
8e73-assembly1.cif.gz_4M vigna radiata supercomplex i+iii2 (full bridge) 0.9774 7 482
7ar7-assembly1.cif.gz_M cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.9722 7 482
7zmh-assembly1.cif.gz_4 cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.9673 6 479
8e9g-assembly1.cif.gz_M mycobacterial respiratory complex i with both quinone positions modelled 0.9643 4 484
ID Description Score Start End Superfamily
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9237 6 126 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9062 1 126 1.20.1070.10
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8867 2 128 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8733 1 126 1.20.1070.10
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8433 6 126 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A3B9EFA4-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9947 111 486 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A7Y2PBL1-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9917 270 485 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-K1YWP4-F1-model_v4 Proton-translocating NADH-quinone oxidoreductase, chain M 0.9896 76 485 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A3M1XWU0-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.986 93 486 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A4Q5QT70-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9859 1 242 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039

Feature Viewer

pLDDT pTM Quality
91.99 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map