F486741

General Info

Members Datasets Scaffolds Average Seq Length
956 402 933 180

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10000113|Ga0105248_1000011336
Length 216
Sequence MVGRQSTTVKNVALSDFLPEGLSGITGSSRMRDAGIVKKLTLLRHAKSGWDDPVARDFDRPLNAKGKRAAHRVGEYLRDHHLDFDHVVASPAVRVVETIENLVAGSGETMTPAWDKRVYLASAVSLLDVVHEADDRYDSLLLVGHNPGLEDLVLMMVPDRAGDEARDQIEEKFPTASIAEISFPVEHWEDVQPNSGTLSLFIRPRDLDPALGPDRD

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
7 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
13 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
14 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
15 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
16 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
17 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
18 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
19 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
20 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
21 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
22 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
23 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
24 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
25 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
26 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
27 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
28 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
33 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
36 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
37 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
38 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
39 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
40 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
41 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
46 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
47 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
48 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
57 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
70 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
71 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
72 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
128 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
242 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
243 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
246 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
247 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
248 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
249 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
250 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
251 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
252 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
253 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
254 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
258 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
276 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
321 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
322 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
323 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
324 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
325 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
326 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
340 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
341 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
342 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
343 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
344 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
345 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
346 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
347 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
348 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
349 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
350 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
351 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
352 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
353 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
354 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
355 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
356 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
357 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
358 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
359 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
360 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
361 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
368 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
369 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
370 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
375 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
376 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
377 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
378 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
379 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
380 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
381 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
382 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
383 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
384 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
385 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
386 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
387 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
390 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
391 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
394 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
395 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
396 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
397 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
398 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
401 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
402 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 0
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 16
Nodule 0
Rhizoplane 3.24
Rhizosphere 71.76
Stem 0
Stem Tuber 0
Unclassified 8.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2766702 2162886006 Bacteria 3709
2 ARcpr5yngRDRAFT_c000749 3300000043 Bacteria 3985
3 JGI24736J21556_1000083 3300001904 Bacteria 15464
4 JGI24741J21665_1004664 3300001915 Bacteria 2993
5 JGI24741J21665_1016602 3300001915 Bacteria 1200
6 JGI24752J21851_1000379 3300001976 Bacteria 6152
7 JGI24752J21851_1002368 3300001976 Bacteria 2507
8 JGI24740J21852_10005913 3300001979 Bacteria 5128
9 JGI24740J21852_10016144 3300001979 Bacteria 2705
10 JGI24740J21852_10017375 3300001979 Bacteria 2575
11 JGI24739J22299_10006876 3300001989 Bacteria 4284
12 JGI24739J22299_10008728 3300001989 Bacteria 3780
13 JGI24739J22299_10020919 3300001989 Bacteria 2334
14 JGI24737J22298_10022130 3300001990 Bacteria 2020
15 JGI24737J22298_10076137 3300001990 Bacteria 1000
16 JGI24737J22298_10082606 3300001990 Bacteria 955
17 JGI24735J21928_10001347 3300002067 Bacteria 8689
18 JGI24750J21931_1001923 3300002070 Bacteria 2536
19 JGI24750J21931_1027918 3300002070 Unclassified 818
20 JGI24748J21848_1000124 3300002074 Bacteria 14795
21 JGI24738J21930_10000970 3300002075 Bacteria 8229
22 JGI24738J21930_10020685 3300002075 Bacteria 1368
23 JGI24749J21850_1000179 3300002076 Bacteria 10133
24 JGI24749J21850_1000879 3300002076 Bacteria 4324
25 JGI24749J21850_1030677 3300002076 Unclassified 771
26 JGI24744J21845_10057570 3300002077 Bacteria 712
27 JGI24034J26672_10000048 3300002239 Bacteria 56597
28 JGI24034J26672_10013219 3300002239 Bacteria 1251
29 JGI24742J22300_10004390 3300002244 Bacteria 2308
30 JGI24751J29686_10000022 3300002459 Bacteria 104477
31 JGI24751J29686_10008525 3300002459 Bacteria 2097
32 JGI24751J29686_10009785 3300002459 Bacteria 1975
33 JGI25150J39212_1000336 3300002774 Bacteria 23118
34 JGI25165J46597_1000010 3300003214 Bacteria 442113
35 JGI25153J46596_10000045 3300003215 Bacteria 149347
36 JGI25153J46596_10000055 3300003215 Bacteria 135518
37 JGI25153J46596_10003282 3300003215 Bacteria 9084
38 rootH2_10053686 3300003320 Bacteria 1105
39 rootH1_10009798 3300003323 Bacteria 2252
40 rootH1_10239172 3300003323 Bacteria 1068
41 Ga0055539_1017913 3300003752 Bacteria 855
42 Ga0055525_1000080 3300003759 Bacteria 164642
43 Ga0055542_1000012 3300003762 Bacteria 391808
44 Ga0055529_1000002 3300003763 Bacteria 537914
45 Ga0055529_1000004 3300003763 Bacteria 433331
46 Ga0055526_1005851 3300003771 Bacteria 6905
47 Ga0055537_1003306 3300003773 Bacteria 4996
48 Ga0055524_1000405 3300003775 Bacteria 36783
49 Ga0055536_1002944 3300003781 Bacteria 9347
50 Ga0055536_1010300 3300003781 Bacteria 3731
51 Ga0055536_1019463 3300003781 Bacteria 2133
52 Ga0055534_1014749 3300003784 Bacteria 1454
53 Ga0055530_10000203 3300003791 Bacteria 53592
54 Ga0055530_10000915 3300003791 Bacteria 24243
55 Ga0055530_10006827 3300003791 Bacteria 4961
56 Ga0055530_10009074 3300003791 Bacteria 3873
57 Ga0055540_1004237 3300003792 Bacteria 6581
58 Ga0055531_10001375 3300003794 Bacteria 18071
59 Ga0055531_10005683 3300003794 Bacteria 7237
60 Ga0055531_10005973 3300003794 Bacteria 6995
61 Ga0055531_10006693 3300003794 Bacteria 6458
62 Ga0055531_10078366 3300003794 Bacteria 736
63 Ga0055543_1034130 3300004625 Bacteria 877
64 Ga0065165_1004742 3300005262 Bacteria 8148
65 Ga0065165_1018884 3300005262 Bacteria 2480
66 Ga0065707_10082321 3300005295 Bacteria 16892
67 Ga0065707_10250722 3300005295 Bacteria 1126
68 Ga0065707_10309846 3300005295 Unclassified 987
69 Ga0065707_10316426 3300005295 Bacteria 975
70 Ga0070658_10000003 3300005327 Bacteria 465963
71 Ga0070658_10002437 3300005327 Bacteria 15566
72 Ga0070658_10100600 3300005327 Bacteria 2390
73 Ga0070658_10359976 3300005327 Bacteria 1246
74 Ga0070676_10020378 3300005328 Bacteria 3701
75 Ga0070683_100104667 3300005329 Bacteria 2667
76 Ga0070683_100108350 3300005329 Bacteria 2620
77 Ga0070683_100577103 3300005329 Bacteria 1076
78 Ga0070690_100000016 3300005330 Bacteria 85515
79 Ga0070670_100000006 3300005331 Bacteria 319420
80 Ga0070670_100000292 3300005331 Bacteria 43960
81 Ga0070670_100002143 3300005331 Bacteria 16199
82 Ga0070670_100002325 3300005331 Bacteria 15657
83 Ga0070670_100061762 3300005331 Bacteria 3216
84 Ga0068869_100725405 3300005334 Bacteria 849
85 Ga0068869_100897459 3300005334 Bacteria 767
86 Ga0070666_10000011 3300005335 Bacteria 261736
87 Ga0070666_10000829 3300005335 Bacteria 18742
88 Ga0070682_100509515 3300005337 Bacteria 934
89 Ga0070660_100002821 3300005339 Bacteria 11956
90 Ga0070660_100047738 3300005339 Bacteria 3286
91 Ga0070660_100309086 3300005339 Bacteria 1297
92 Ga0070660_100811019 3300005339 Bacteria 787
93 Ga0070689_100045939 3300005340 Bacteria 3364
94 Ga0070687_100040703 3300005343 Bacteria 2343
95 Ga0070661_100000261 3300005344 Bacteria 43151
96 Ga0070661_100027201 3300005344 Bacteria 4117
97 Ga0070661_100085227 3300005344 Bacteria 2334
98 Ga0070661_100374564 3300005344 Bacteria 1121
99 Ga0070692_10005410 3300005345 Bacteria 5443
100 Ga0070668_100002152 3300005347 Bacteria 14427
101 Ga0070668_100004339 3300005347 Bacteria 10518
102 Ga0070668_100007957 3300005347 Bacteria 7872
103 Ga0070669_100000004 3300005353 Bacteria 314707
104 Ga0070669_100000009 3300005353 Bacteria 224683
105 Ga0070669_100000036 3300005353 Bacteria 137564
106 Ga0070669_100049847 3300005353 Bacteria 3057
107 Ga0070675_100985551 3300005354 Bacteria 774
108 Ga0070671_100000004 3300005355 Bacteria 262155
109 Ga0070671_100000273 3300005355 Bacteria 34866
110 Ga0070671_100039735 3300005355 Bacteria 3906
111 Ga0070671_100094914 3300005355 Bacteria 2500
112 Ga0070671_100549088 3300005355 Bacteria 996
113 Ga0070674_100001683 3300005356 Bacteria 11963
114 Ga0070674_100030244 3300005356 Bacteria 3576
115 Ga0070673_100248365 3300005364 Bacteria 1550
116 Ga0070673_100617176 3300005364 Bacteria 990
117 Ga0070688_100001707 3300005365 Bacteria 10964
118 Ga0070688_101066772 3300005365 Bacteria 644
119 Ga0070659_100001775 3300005366 Bacteria 15502
120 Ga0070659_100264976 3300005366 Bacteria 1426
121 Ga0070659_100727003 3300005366 Bacteria 860
122 Ga0070667_100000298 3300005367 Bacteria 55786
123 Ga0070667_100000398 3300005367 Bacteria 46959
124 Ga0070667_100000415 3300005367 Bacteria 45632
125 Ga0070667_100002347 3300005367 Bacteria 16582
126 Ga0070667_100179436 3300005367 Bacteria 1872
127 Ga0070667_100256711 3300005367 Bacteria 1564
128 Ga0070705_100005751 3300005440 Bacteria 6058
129 Ga0070663_100046814 3300005455 Bacteria 3062
130 Ga0070663_100329966 3300005455 Bacteria 1229
131 Ga0070678_100000679 3300005456 Bacteria 16764
132 Ga0070678_100124729 3300005456 Bacteria 2036
133 Ga0070662_100043140 3300005457 Bacteria 3225
134 Ga0070662_100160195 3300005457 Bacteria 1760
135 Ga0070681_11001110 3300005458 Bacteria 755
136 Ga0068867_100169110 3300005459 Bacteria 1730
137 Ga0068867_101393210 3300005459 Bacteria 650
138 Ga0070685_10000186 3300005466 Bacteria 41567
139 Ga0070679_100199935 3300005530 Bacteria 1965
140 Ga0070679_100671658 3300005530 Bacteria 979
141 Ga0070684_100093789 3300005535 Bacteria 2672
142 Ga0068853_100004467 3300005539 Bacteria 10846
143 Ga0068853_100016381 3300005539 Bacteria 6100
144 Ga0068853_100081684 3300005539 Bacteria 2830
145 Ga0068853_100467353 3300005539 Bacteria 1188
146 Ga0068853_100894298 3300005539 Unclassified 853
147 Ga0070686_100000001 3300005544 Bacteria 515830
148 Ga0070665_100000004 3300005548 Bacteria 785500
149 Ga0070665_100000088 3300005548 Bacteria 177729
150 Ga0070665_100332902 3300005548 Bacteria 1523
151 Ga0070665_100471593 3300005548 Bacteria 1266
152 Ga0070665_100511047 3300005548 Bacteria 1213
153 Ga0070665_100667779 3300005548 Unclassified 1052
154 Ga0068855_100000667 3300005563 Bacteria 41874
155 Ga0068855_100099751 3300005563 Bacteria 3344
156 Ga0068855_100250360 3300005563 Bacteria 1976
157 Ga0068855_100346840 3300005563 Bacteria 1636
158 Ga0068855_101055868 3300005563 Bacteria 851
159 Ga0068857_100017231 3300005577 Bacteria 6330
160 Ga0068857_100043041 3300005577 Bacteria 4006
161 Ga0068857_100204800 3300005577 Bacteria 1799
162 Ga0068857_100380072 3300005577 Bacteria 1311
163 Ga0068857_100555250 3300005577 Bacteria 1082
164 Ga0068854_100008336 3300005578 Bacteria 6659
165 Ga0068854_100074397 3300005578 Bacteria 2492
166 Ga0068854_100083318 3300005578 Bacteria 2364
167 Ga0068854_100908063 3300005578 Bacteria 774
168 Ga0068856_100100701 3300005614 Bacteria 2882
169 Ga0068856_100123778 3300005614 Bacteria 2588
170 Ga0068852_100086066 3300005616 Bacteria 2801
171 Ga0068852_100090931 3300005616 Bacteria 2730
172 Ga0068852_100117605 3300005616 Bacteria 2427
173 Ga0068852_100160386 3300005616 Bacteria 2099
174 Ga0068859_100001079 3300005617 Bacteria 27844
175 Ga0068859_100003565 3300005617 Bacteria 15857
176 Ga0068859_100006631 3300005617 Bacteria 11757
177 Ga0068859_100007071 3300005617 Bacteria 11392
178 Ga0068859_100028197 3300005617 Bacteria 5629
179 Ga0068859_100948772 3300005617 Unclassified 944
180 Ga0068864_100000014 3300005618 Bacteria 308927
181 Ga0068864_100000300 3300005618 Bacteria 43960
182 Ga0068864_100000544 3300005618 Bacteria 32111
183 Ga0068864_100001484 3300005618 Bacteria 19321
184 Ga0068864_100009598 3300005618 Bacteria 7980
185 Ga0068864_100014481 3300005618 Bacteria 6551
186 Ga0068861_100000203 3300005719 Bacteria 31717
187 Ga0068861_100003016 3300005719 Bacteria 11116
188 Ga0068861_100031375 3300005719 Bacteria 3903
189 Ga0068861_100434862 3300005719 Bacteria 1172
190 Ga0068851_10019572 3300005834 Bacteria 3271
191 Ga0068851_10077021 3300005834 Bacteria 1735
192 Ga0068851_10295787 3300005834 Bacteria 929
193 Ga0068863_100000010 3300005841 Bacteria 237758
194 Ga0068863_100000073 3300005841 Bacteria 110576
195 Ga0068863_100015329 3300005841 Bacteria 7366
196 Ga0068863_100025444 3300005841 Bacteria 5644
197 Ga0068863_100053484 3300005841 Bacteria 3827
198 Ga0068858_100000360 3300005842 Bacteria 48023
199 Ga0068858_100000487 3300005842 Bacteria 41394
200 Ga0068858_100000782 3300005842 Bacteria 33248
201 Ga0068858_100000957 3300005842 Bacteria 29868
202 Ga0068858_100001582 3300005842 Bacteria 23264
203 Ga0068858_100072688 3300005842 Bacteria 3191
204 Ga0068860_100000030 3300005843 Bacteria 256364
205 Ga0068860_100000143 3300005843 Bacteria 116787
206 Ga0068860_100000412 3300005843 Bacteria 55786
207 Ga0068860_100001278 3300005843 Bacteria 27382
208 Ga0068860_100007681 3300005843 Bacteria 10779
209 Ga0068862_100000007 3300005844 Bacteria 313933
210 Ga0068862_100000014 3300005844 Bacteria 251552
211 Ga0068862_100000431 3300005844 Bacteria 45517
212 Ga0068862_100000462 3300005844 Bacteria 43948
213 Ga0068862_100000716 3300005844 Bacteria 33750
214 Ga0068862_100000810 3300005844 Bacteria 31040
215 Ga0068862_100012378 3300005844 Bacteria 7054
216 Ga0068862_100096973 3300005844 Bacteria 2574
217 Ga0068862_100292157 3300005844 Bacteria 1497
218 Ga0081455_10000405 3300005937 Bacteria 56782
219 Ga0075364_10061051 3300006051 Bacteria 2472
220 Ga0075366_10104846 3300006195 Bacteria 1699
221 Ga0075366_10445365 3300006195 Bacteria 799
222 Ga0097621_100193783 3300006237 Bacteria 1761
223 Ga0097621_100385789 3300006237 Bacteria 1252
224 Ga0075370_10026022 3300006353 Bacteria 3239
225 Ga0075370_10174138 3300006353 Bacteria 1265
226 Ga0068871_100315503 3300006358 Bacteria 1375
227 Ga0068871_100784643 3300006358 Bacteria 877
228 Ga0075429_100216459 3300006880 Bacteria 1678
229 Ga0097620_100001079 3300006931 Bacteria 27844
230 Ga0097620_100003566 3300006931 Bacteria 15857
231 Ga0097620_100006631 3300006931 Bacteria 11757
232 Ga0097620_100007071 3300006931 Bacteria 11392
233 Ga0097620_100028198 3300006931 Bacteria 5629
234 Ga0097620_100948790 3300006931 Unclassified 944
235 Ga0105251_10000296 3300009011 Bacteria 49888
236 Ga0105251_10176357 3300009011 Unclassified 963
237 Ga0105240_10110084 3300009093 Bacteria 3334
238 Ga0105240_10114767 3300009093 Bacteria 3253
239 Ga0105240_10445502 3300009093 Bacteria 1450
240 Ga0105240_10502904 3300009093 Bacteria 1347
241 Ga0105245_10005729 3300009098 Bacteria 10905
242 Ga0105247_10000874 3300009101 Bacteria 22814
243 Ga0105247_10024765 3300009101 Bacteria 3617
244 Ga0105247_10108150 3300009101 Bacteria 1786
245 Ga0105243_10001945 3300009148 Bacteria 17580
246 Ga0105241_10012572 3300009174 Bacteria 6210
247 Ga0105241_10077684 3300009174 Bacteria 2592
248 Ga0105241_10640398 3300009174 Bacteria 964
249 Ga0105248_10000029 3300009177 Bacteria 223366
250 Ga0105248_10000113 3300009177 Bacteria 91128
251 Ga0105248_10056147 3300009177 Bacteria 4417
252 Ga0105248_10123446 3300009177 Bacteria 2921
253 Ga0105248_10144662 3300009177 Bacteria 2682
254 Ga0105248_10222120 3300009177 Bacteria 2127
255 Ga0105248_10805215 3300009177 Bacteria 1060
256 Ga0105237_10009797 3300009545 Bacteria 10244
257 Ga0105237_10035288 3300009545 Bacteria 5060
258 Ga0105237_10951022 3300009545 Bacteria 866
259 Ga0105238_10116166 3300009551 Bacteria 2655
260 Ga0105238_10226626 3300009551 Bacteria 1846
261 Ga0105238_11111161 3300009551 Bacteria 813
262 Ga0105249_10000002 3300009553 Bacteria 376207
263 Ga0105249_10000016 3300009553 Bacteria 278643
264 Ga0105249_10000024 3300009553 Bacteria 232947
265 Ga0105249_10014933 3300009553 Bacteria 6869
266 Ga0105249_10687866 3300009553 Bacteria 1082
267 Ga0105239_10145283 3300010375 Bacteria 2645
268 Ga0105239_10332665 3300010375 Bacteria 1714
269 Ga0105239_11184609 3300010375 Bacteria 880
270 Ga0105239_11299434 3300010375 Bacteria 839
271 Ga0105239_11597561 3300010375 Bacteria 754
272 Ga0105246_10118019 3300011119 Bacteria 1961
273 Ga0157317_1006477 3300012475 Bacteria 818
274 Ga0157326_1003753 3300012513 Bacteria 1594
275 Ga0157373_10015634 3300013100 Bacteria 5543
276 Ga0157373_10066327 3300013100 Bacteria 2554
277 Ga0157371_10000290 3300013102 Bacteria 67914
278 Ga0157371_10100385 3300013102 Bacteria 2053
279 Ga0157370_10013637 3300013104 Bacteria 8362
280 Ga0157370_10260172 3300013104 Bacteria 1604
281 Ga0157370_10919005 3300013104 Bacteria 794
282 Ga0157369_10006147 3300013105 Bacteria 13934
283 Ga0157369_10027424 3300013105 Bacteria 6314
284 Ga0157369_10493554 3300013105 Bacteria 1267
285 Ga0157369_11043934 3300013105 Bacteria 836
286 Ga0157369_11240354 3300013105 Bacteria 761
287 Ga0157369_11510405 3300013105 Bacteria 683
288 Ga0157374_10033722 3300013296 Bacteria 4672
289 Ga0157378_10014680 3300013297 Bacteria 6862
290 Ga0157378_10131445 3300013297 Bacteria 2317
291 Ga0157378_10247544 3300013297 Bacteria 1705
292 Ga0163162_10001555 3300013306 Bacteria 21458
293 Ga0163162_10068722 3300013306 Bacteria 3594
294 Ga0163162_10609628 3300013306 Bacteria 1217
295 Ga0157372_10029722 3300013307 Bacteria 5970
296 Ga0157372_10195146 3300013307 Bacteria 2345
297 Ga0157372_10828150 3300013307 Bacteria 1075
298 Ga0157375_10840863 3300013308 Bacteria 1065
299 Ga0163163_10010448 3300014325 Bacteria 8353
300 Ga0163163_10015142 3300014325 Bacteria 7120
301 Ga0163163_10165587 3300014325 Bacteria 2257
302 Ga0157380_10000042 3300014326 Bacteria 75921
303 Ga0157380_10009001 3300014326 Bacteria 7135
304 Ga0157380_10072337 3300014326 Bacteria 2792
305 Ga0157380_10098586 3300014326 Bacteria 2428
306 Ga0157379_10010222 3300014968 Bacteria 8174
307 Ga0157379_10017701 3300014968 Bacteria 6277
308 Ga0183363_1003 3300015690 Bacteria 421263
309 Ga0163161_10000044 3300017792 Bacteria 132739
310 Ga0163161_10047151 3300017792 Bacteria 3112
311 Ga0163161_10138163 3300017792 Bacteria 1843
312 Ga0163161_10614660 3300017792 Bacteria 897
313 Ga0213876_10001336 3300021384 Bacteria 15468
314 Ga0213875_10000820 3300021388 Bacteria 23114
315 Ga0207672_1001095 3300025223 Bacteria 2447
316 Ga0209563_100058 3300025230 Bacteria 302571
317 Ga0207425_1000005 3300025245 Bacteria 900502
318 Ga0207425_1003780 3300025245 Bacteria 4727
319 Ga0209646_1016590 3300025246 Bacteria 1091
320 Ga0209026_1023261 3300025250 Bacteria 945
321 Ga0209677_105890 3300025253 Bacteria 3067
322 Ga0209148_1000008 3300025254 Bacteria 1504371
323 Ga0209129_1001045 3300025258 Bacteria 16360
324 Ga0209233_1000044 3300025261 Bacteria 489783
325 Ga0209565_1000029 3300025263 Bacteria 340335
326 Ga0209565_1000272 3300025263 Bacteria 52468
327 Ga0209455_1000002 3300025272 Bacteria 1505459
328 Ga0209455_1008948 3300025272 Bacteria 2669
329 Ga0209673_1001949 3300025273 Bacteria 16202
330 Ga0209673_1002970 3300025273 Bacteria 10595
331 Ga0209675_1000399 3300025291 Bacteria 36040
332 Ga0209675_1008112 3300025291 Bacteria 3914
333 Ga0209676_1000358 3300025292 Bacteria 86541
334 Ga0209676_1000829 3300025292 Bacteria 40137
335 Ga0209676_1001005 3300025292 Bacteria 33061
336 Ga0209025_1001074 3300025294 Bacteria 39612
337 Ga0209025_1017474 3300025294 Bacteria 4136
338 Ga0209564_1000949 3300025295 Bacteria 37130
339 Ga0209564_1038417 3300025295 Bacteria 1332
340 Ga0209758_1000002 3300025297 Bacteria 1400310
341 Ga0209758_1000007 3300025297 Bacteria 1270410
342 Ga0209758_1012238 3300025297 Bacteria 4826
343 Ga0209050_1000001 3300025298 Bacteria 3563507
344 Ga0209050_1000167 3300025298 Bacteria 151608
345 Ga0209050_1000437 3300025298 Bacteria 76322
346 Ga0209050_1004286 3300025298 Bacteria 9767
347 Ga0209050_1020129 3300025298 Bacteria 2496
348 Ga0209050_1040150 3300025298 Bacteria 1308
349 Ga0209050_1040886 3300025298 Bacteria 1285
350 Ga0209256_1000008 3300025299 Bacteria 975723
351 Ga0207426_1025383 3300025302 Bacteria 1996
352 Ga0209051_1000364 3300025303 Bacteria 66340
353 Ga0209257_1000028 3300025304 Bacteria 699493
354 Ga0209257_1000328 3300025304 Bacteria 99542
355 Ga0209257_1004831 3300025304 Bacteria 9988
356 Ga0209257_1007735 3300025304 Bacteria 6402
357 Ga0209257_1008403 3300025304 Bacteria 5880
358 Ga0209257_1012636 3300025304 Bacteria 3873
359 Ga0209257_1017646 3300025304 Bacteria 2798
360 Ga0209257_1046897 3300025304 Bacteria 1246
361 Ga0207697_10003772 3300025315 Bacteria 7401
362 Ga0207656_10004100 3300025321 Bacteria 5057
363 Ga0207656_10008193 3300025321 Bacteria 3835
364 Ga0207656_10252561 3300025321 Bacteria 864
365 Ga0207713_1002770 3300025735 Bacteria 12405
366 Ga0207710_10002774 3300025900 Bacteria 8005
367 Ga0207710_10018608 3300025900 Bacteria 2956
368 Ga0207710_10059562 3300025900 Bacteria 1729
369 Ga0207680_10000008 3300025903 Bacteria 518177
370 Ga0207680_10000253 3300025903 Bacteria 25735
371 Ga0207647_10001877 3300025904 Bacteria 16094
372 Ga0207647_10116105 3300025904 Bacteria 1580
373 Ga0207647_10132150 3300025904 Bacteria 1466
374 Ga0207705_10000005 3300025909 Bacteria 673478
375 Ga0207705_10000103 3300025909 Bacteria 97511
376 Ga0207705_10013836 3300025909 Bacteria 5819
377 Ga0207654_10000150 3300025911 Bacteria 44134
378 Ga0207654_10001270 3300025911 Bacteria 13439
379 Ga0207695_10008046 3300025913 Bacteria 13275
380 Ga0207695_10039997 3300025913 Bacteria 5034
381 Ga0207695_10052087 3300025913 Bacteria 4291
382 Ga0207695_10091029 3300025913 Bacteria 3065
383 Ga0207671_10001574 3300025914 Bacteria 26006
384 Ga0207671_10003457 3300025914 Bacteria 15723
385 Ga0207671_10174640 3300025914 Bacteria 1670
386 Ga0207671_10358640 3300025914 Unclassified 1157
387 Ga0207662_10080808 3300025918 Bacteria 1984
388 Ga0207657_10002670 3300025919 Bacteria 19230
389 Ga0207657_10146650 3300025919 Bacteria 1924
390 Ga0207657_10262423 3300025919 Bacteria 1374
391 Ga0207657_10420358 3300025919 Bacteria 1051
392 Ga0207649_10000016 3300025920 Bacteria 243843
393 Ga0207649_10000660 3300025920 Bacteria 22994
394 Ga0207649_10352116 3300025920 Bacteria 1090
395 Ga0207681_10000001 3300025923 Bacteria 1105841
396 Ga0207681_10000010 3300025923 Bacteria 403379
397 Ga0207681_10000020 3300025923 Bacteria 240498
398 Ga0207681_10004630 3300025923 Bacteria 8460
399 Ga0207681_10625461 3300025923 Bacteria 891
400 Ga0207694_10003254 3300025924 Bacteria 12936
401 Ga0207694_10046069 3300025924 Bacteria 3370
402 Ga0207694_10048382 3300025924 Bacteria 3290
403 Ga0207694_10104889 3300025924 Bacteria 2244
404 Ga0207694_10156022 3300025924 Bacteria 1841
405 Ga0207694_10774217 3300025924 Bacteria 810
406 Ga0207650_10000023 3300025925 Bacteria 308148
407 Ga0207650_10000354 3300025925 Bacteria 44199
408 Ga0207650_10002062 3300025925 Bacteria 14048
409 Ga0207650_10093199 3300025925 Bacteria 2305
410 Ga0207687_10001020 3300025927 Bacteria 18993
411 Ga0207644_10000007 3300025931 Bacteria 381778
412 Ga0207644_10000283 3300025931 Bacteria 33445
413 Ga0207644_10008404 3300025931 Bacteria 6756
414 Ga0207690_10012099 3300025932 Bacteria 5161
415 Ga0207690_10033348 3300025932 Bacteria 3311
416 Ga0207690_10285539 3300025932 Bacteria 1286
417 Ga0207706_10010038 3300025933 Bacteria 8677
418 Ga0207706_10051291 3300025933 Bacteria 3643
419 Ga0207706_10263123 3300025933 Bacteria 1505
420 Ga0207709_10000005 3300025935 Bacteria 806813
421 Ga0207670_10032086 3300025936 Bacteria 3374
422 Ga0207669_10000322 3300025937 Bacteria 21900
423 Ga0207669_10001286 3300025937 Bacteria 10655
424 Ga0207691_10183964 3300025940 Bacteria 1825
425 Ga0207711_10000004 3300025941 Bacteria 870636
426 Ga0207711_10003287 3300025941 Bacteria 14053
427 Ga0207711_10011919 3300025941 Bacteria 7225
428 Ga0207711_10076009 3300025941 Bacteria 2924
429 Ga0207711_10116915 3300025941 Bacteria 2378
430 Ga0207711_10142200 3300025941 Bacteria 2159
431 Ga0207689_10737011 3300025942 Bacteria 831
432 Ga0207661_10553420 3300025944 Bacteria 1054
433 Ga0207679_10802779 3300025945 Bacteria 858
434 Ga0207679_10911472 3300025945 Bacteria 804
435 Ga0207667_10000001 3300025949 Bacteria 1178522
436 Ga0207667_10000603 3300025949 Bacteria 46518
437 Ga0207667_10024985 3300025949 Bacteria 6549
438 Ga0207667_10357351 3300025949 Bacteria 1490
439 Ga0207667_10823067 3300025949 Bacteria 924
440 Ga0207667_10853012 3300025949 Bacteria 905
441 Ga0207712_10000002 3300025961 Bacteria 706628
442 Ga0207712_10000009 3300025961 Bacteria 518177
443 Ga0207712_10000510 3300025961 Bacteria 32303
444 Ga0207712_10018856 3300025961 Bacteria 4499
445 Ga0207712_10458833 3300025961 Bacteria 1082
446 Ga0207668_10001363 3300025972 Bacteria 14427
447 Ga0207668_10002028 3300025972 Bacteria 11816
448 Ga0207668_10006578 3300025972 Bacteria 6869
449 Ga0207668_10039903 3300025972 Bacteria 3164
450 Ga0207640_10005130 3300025981 Bacteria 7124
451 Ga0207640_10006365 3300025981 Bacteria 6476
452 Ga0207640_10020510 3300025981 Bacteria 3925
453 Ga0207640_10367889 3300025981 Bacteria 1161
454 Ga0207640_10384262 3300025981 Bacteria 1138
455 Ga0207640_10599555 3300025981 Bacteria 932
456 Ga0207640_10798783 3300025981 Bacteria 817
457 Ga0207640_11174619 3300025981 Bacteria 681
458 Ga0207658_10000026 3300025986 Bacteria 178292
459 Ga0207658_10000254 3300025986 Bacteria 55800
460 Ga0207658_10001005 3300025986 Bacteria 23144
461 Ga0207658_10001129 3300025986 Bacteria 21497
462 Ga0207658_10001394 3300025986 Bacteria 18834
463 Ga0207658_10001522 3300025986 Bacteria 18013
464 Ga0207658_10302095 3300025986 Bacteria 1379
465 Ga0207703_10000108 3300026035 Bacteria 97908
466 Ga0207703_10000845 3300026035 Bacteria 30089
467 Ga0207703_10001794 3300026035 Bacteria 19143
468 Ga0207703_10002095 3300026035 Bacteria 17541
469 Ga0207703_10007252 3300026035 Bacteria 8815
470 Ga0207639_10001679 3300026041 Bacteria 14938
471 Ga0207639_10003338 3300026041 Bacteria 10793
472 Ga0207639_10021197 3300026041 Bacteria 4664
473 Ga0207639_10035037 3300026041 Bacteria 3714
474 Ga0207639_10137934 3300026041 Bacteria 2028
475 Ga0207639_10430236 3300026041 Bacteria 1195
476 Ga0207678_10048806 3300026067 Bacteria 3658
477 Ga0207678_10111417 3300026067 Bacteria 2335
478 Ga0207678_10303638 3300026067 Bacteria 1372
479 Ga0207702_10000723 3300026078 Bacteria 35400
480 Ga0207702_10026646 3300026078 Bacteria 4799
481 Ga0207702_10065672 3300026078 Bacteria 3108
482 Ga0207702_10093967 3300026078 Bacteria 2631
483 Ga0207641_10000018 3300026088 Bacteria 298209
484 Ga0207641_10000346 3300026088 Bacteria 55535
485 Ga0207641_10000386 3300026088 Bacteria 52430
486 Ga0207641_10013111 3300026088 Bacteria 6797
487 Ga0207641_10017585 3300026088 Bacteria 5853
488 Ga0207641_10056278 3300026088 Bacteria 3341
489 Ga0207648_10647762 3300026089 Bacteria 976
490 Ga0207676_10000017 3300026095 Bacteria 308709
491 Ga0207676_10000137 3300026095 Bacteria 63867
492 Ga0207676_10000276 3300026095 Bacteria 44706
493 Ga0207676_10001455 3300026095 Bacteria 17617
494 Ga0207676_10003438 3300026095 Bacteria 11204
495 Ga0207676_10022019 3300026095 Bacteria 4683
496 Ga0207674_10010611 3300026116 Bacteria 10420
497 Ga0207674_10025744 3300026116 Bacteria 6265
498 Ga0207674_10066737 3300026116 Bacteria 3623
499 Ga0207674_10074826 3300026116 Bacteria 3397
500 Ga0207674_10578482 3300026116 Bacteria 1085
501 Ga0207674_10659422 3300026116 Bacteria 1010
502 Ga0207675_100000110 3300026118 Bacteria 66177
503 Ga0207675_100000280 3300026118 Bacteria 48895
504 Ga0207675_100000329 3300026118 Bacteria 45296
505 Ga0207675_100689672 3300026118 Bacteria 1030
506 Ga0207683_10001013 3300026121 Bacteria 25627
507 Ga0207683_10196466 3300026121 Bacteria 1833
508 Ga0207698_10005044 3300026142 Bacteria 8100
509 Ga0207698_10006839 3300026142 Bacteria 7136
510 Ga0207698_10057071 3300026142 Bacteria 3018
511 Ga0207698_10116692 3300026142 Bacteria 2250
512 Ga0207698_10384683 3300026142 Bacteria 1336
513 Ga0268266_10000009 3300028379 Bacteria 1097737
514 Ga0268266_10000074 3300028379 Bacteria 230993
515 Ga0268266_10241808 3300028379 Bacteria 1666
516 Ga0268266_10399215 3300028379 Unclassified 1300
517 Ga0268266_10497953 3300028379 Unclassified 1163
518 Ga0268265_10000002 3300028380 Bacteria 1035381
519 Ga0268265_10000058 3300028380 Bacteria 154702
520 Ga0268265_10000097 3300028380 Bacteria 110755
521 Ga0268265_10000149 3300028380 Bacteria 86376
522 Ga0268265_10000607 3300028380 Bacteria 35893
523 Ga0268265_10001059 3300028380 Bacteria 24670
524 Ga0268265_10121344 3300028380 Bacteria 2154
525 Ga0268265_10192792 3300028380 Bacteria 1761
526 Ga0268264_10000003 3300028381 Bacteria 1141976
527 Ga0268264_10000076 3300028381 Bacteria 255518
528 Ga0268264_10000083 3300028381 Bacteria 245366
529 Ga0268264_10000106 3300028381 Bacteria 210031
530 Ga0268264_10000634 3300028381 Bacteria 41826
531 Ga0307517_10013945 3300028786 Bacteria 10858
532 Ga0307517_10044893 3300028786 Bacteria 4660
533 Ga0307517_10231038 3300028786 Bacteria 1110
534 Ga0307513_10049071 3300031456 Bacteria 4575
535 Ga0307513_10052452 3300031456 Bacteria 4392
536 Ga0307509_10042055 3300031507 Bacteria 4954
537 Ga0307408_100008545 3300031548 Bacteria 6762
538 Ga0307408_100008592 3300031548 Bacteria 6745
539 Ga0307408_100366558 3300031548 Bacteria 1227
540 Ga0307408_100409157 3300031548 Bacteria 1167
541 Ga0307408_100633645 3300031548 Bacteria 954
542 Ga0307408_100676087 3300031548 Bacteria 925
543 Ga0307508_10005032 3300031616 Bacteria 12703
544 Ga0307405_10041988 3300031731 Bacteria 2781
545 Ga0307405_10137760 3300031731 Bacteria 1697
546 Ga0307405_10285238 3300031731 Bacteria 1245
547 Ga0307405_10355492 3300031731 Bacteria 1131
548 Ga0307405_10491549 3300031731 Bacteria 982
549 Ga0307405_10574013 3300031731 Bacteria 916
550 Ga0307413_10034190 3300031824 Bacteria 2903
551 Ga0307410_10376873 3300031852 Bacteria 1141
552 Ga0307406_10002345 3300031901 Bacteria 10289
553 Ga0307406_10138671 3300031901 Bacteria 1718
554 Ga0307406_10400810 3300031901 Bacteria 1087
555 Ga0307412_10000342 3300031911 Bacteria 29331
556 Ga0307412_10003855 3300031911 Bacteria 8336
557 Ga0307412_10014907 3300031911 Bacteria 4595
558 Ga0307412_10026822 3300031911 Bacteria 3586
559 Ga0307412_10052383 3300031911 Bacteria 2702
560 Ga0307412_10064718 3300031911 Bacteria 2471
561 Ga0307412_10065516 3300031911 Bacteria 2459
562 Ga0307412_10157651 3300031911 Bacteria 1682
563 Ga0307416_100110021 3300032002 Bacteria 2425
564 Ga0307416_100532938 3300032002 Bacteria 1245
565 Ga0307416_101011654 3300032002 Bacteria 934
566 Ga0307414_10000239 3300032004 Bacteria 34941
567 Ga0307414_10009181 3300032004 Bacteria 5665
568 Ga0307414_10018842 3300032004 Bacteria 4262
569 Ga0307414_10023279 3300032004 Bacteria 3926
570 Ga0307414_10356668 3300032004 Bacteria 1257
571 Ga0307414_10407337 3300032004 Bacteria 1183
572 Ga0307414_10419870 3300032004 Bacteria 1166
573 Ga0307414_10503440 3300032004 Bacteria 1072
574 Ga0307411_10049357 3300032005 Bacteria 2734
575 Ga0307411_10356223 3300032005 Bacteria 1195
576 Ga0307510_10005677 3300033180 Bacteria 14872
577 Ga0307510_10033362 3300033180 Bacteria 5782
578 Ga0373923_0185193 3300035111 Unclassified 958
579 Ga0373954_0032080 3300035118 Bacteria 2428
580 Ga0373927_0096292 3300035695 Bacteria 1924
581 Ga0373937_0432554 3300036401 Bacteria 1249
582 Ga0395900_1030673 3300037418 Bacteria 742
583 Ga0395905_0096269 3300037471 Bacteria 2779
584 Ga0395905_0447278 3300037471 Bacteria 1190
585 Ga0395905_1334915 3300037471 Unclassified 621
586 Ga0436364_0752226 3300037853 Bacteria 1979
587 Ga0436364_1409528 3300037853 Bacteria 22143
588 Ga0395901_0029420 3300038443 Bacteria 5657
589 Ga0395901_0040961 3300038443 Bacteria 4799
590 Ga0395901_1258397 3300038443 Bacteria 703
591 Ga0237819_03124 3300038705 Bacteria 3030
592 Ga0436365_0062931 3300039437 Bacteria 52276
593 Ga0436365_0340026 3300039437 Bacteria 1680
594 Ga0436363_0901981 3300039450 Bacteria 1091
595 Ga0439439_0064079 3300041406 Bacteria 979
596 Ga0439465_0000267 3300041413 Bacteria 14538
597 Ga0439465_0001572 3300041413 Bacteria 7418
598 Ga0451789_0057199 3300041443 Bacteria 828
599 Ga0451800_0410130 3300041459 Bacteria 728
600 Ga0451802_2041707 3300041460 Bacteria 809
601 Ga0451853_2935544 3300041512 Bacteria 701
602 Ga0439431_0000273 3300041997 Bacteria 10607
603 Ga0439431_0014648 3300041997 Bacteria 1819
604 Ga0439442_009040 3300042002 Bacteria 2014
605 Ga0439445_0000417 3300042004 Bacteria 8552
606 Ga0439445_0008347 3300042004 Bacteria 2421
607 Ga0439445_0024060 3300042004 Bacteria 1545
608 Ga0439432_002453 3300042006 Bacteria 6983
609 Ga0439449_0045533 3300042007 Bacteria 1626
610 Ga0439452_020562 3300042010 Bacteria 1730
611 Ga0439457_014047 3300042014 Bacteria 1795
612 Ga0439462_0004232 3300042015 Bacteria 3491
613 Ga0439446_0043431 3300042156 Bacteria 1328
614 Ga0439434_0000488 3300042435 Bacteria 11259
615 Ga0451577_1286555 3300042876 Bacteria 651
616 Ga0451576_0005491 3300045051 Bacteria 15866
617 Ga0495627_005422 3300046453 Bacteria 5143
618 Ga0495590_0280425 3300046457 Bacteria 624
619 Ga0495638_0000014 3300046460 Bacteria 417060
620 Ga0495638_0000732 3300046460 Bacteria 35317
621 Ga0495638_0004896 3300046460 Bacteria 10068
622 Ga0495638_0054875 3300046460 Bacteria 2476
623 Ga0495638_0238855 3300046460 Bacteria 1007
624 Ga0495650_0000196 3300046471 Bacteria 131306
625 Ga0495639_0354264 3300046475 Bacteria 737
626 Ga0495662_0508846 3300046476 Bacteria 590
627 Ga0495585_0000620 3300046492 Bacteria 33105
628 Ga0495585_0039871 3300046492 Bacteria 2639
629 Ga0495596_0028535 3300046500 Bacteria 2240
630 Ga0495607_0037621 3300046501 Bacteria 2905
631 Ga0495583_0000406 3300046506 Bacteria 65391
632 Ga0495583_0000557 3300046506 Bacteria 52013
633 Ga0495583_0001125 3300046506 Bacteria 29400
634 Ga0495583_0007101 3300046506 Bacteria 7155
635 Ga0495583_0015490 3300046506 Bacteria 4144
636 Ga0495583_0046112 3300046506 Bacteria 2011
637 Ga0495583_0087721 3300046506 Bacteria 1344
638 Ga0495606_0000259 3300046507 Bacteria 93403
639 Ga0495606_0000497 3300046507 Bacteria 64227
640 Ga0495606_0022207 3300046507 Bacteria 4629
641 Ga0495631_0085611 3300046518 Bacteria 1358
642 Ga0495632_0000446 3300046519 Bacteria 39306
643 Ga0495632_0188767 3300046519 Bacteria 942
644 Ga0495637_0010269 3300046520 Bacteria 4535
645 Ga0495637_0020660 3300046520 Bacteria 3027
646 Ga0495637_0078074 3300046520 Bacteria 1324
647 Ga0495643_0002033 3300046522 Bacteria 16829
648 Ga0495643_0004844 3300046522 Bacteria 9274
649 Ga0495643_0005462 3300046522 Bacteria 8595
650 Ga0495643_0044540 3300046522 Bacteria 2411
651 Ga0495643_0058007 3300046522 Bacteria 2061
652 Ga0495648_0000021 3300046524 Bacteria 246945
653 Ga0495648_0000114 3300046524 Bacteria 98677
654 Ga0495648_0020266 3300046524 Bacteria 4642
655 Ga0495648_0065607 3300046524 Bacteria 2133
656 Ga0495648_0098124 3300046524 Bacteria 1623
657 Ga0495663_0000369 3300046525 Bacteria 16622
658 Ga0495663_0070503 3300046525 Bacteria 1112
659 Ga0495642_0040137 3300046528 Bacteria 1900
660 Ga0495654_0001113 3300046530 Bacteria 19393
661 Ga0495654_0096529 3300046530 Bacteria 1366
662 Ga0495609_0294533 3300046538 Bacteria 662
663 Ga0495597_0013437 3300046542 Bacteria 3922
664 Ga0495597_0103983 3300046542 Bacteria 1195
665 Ga0495622_0021745 3300046557 Bacteria 2987
666 Ga0495622_0033946 3300046557 Bacteria 2381
667 Ga0495622_0067429 3300046557 Bacteria 1653
668 Ga0495633_0000207 3300046558 Bacteria 74645
669 Ga0495633_0010366 3300046558 Bacteria 5091
670 Ga0495668_0000022 3300046616 Bacteria 363999
671 Ga0495668_0000387 3300046616 Bacteria 58040
672 Ga0495668_0012858 3300046616 Bacteria 4955
673 Ga0495668_0017893 3300046616 Bacteria 4105
674 Ga0495668_0042229 3300046616 Bacteria 2539
675 Ga0495668_0069004 3300046616 Bacteria 1944
676 Ga0495611_0002606 3300046648 Bacteria 8162
677 Ga0495611_0052799 3300046648 Bacteria 1834
678 Ga0495611_0129649 3300046648 Bacteria 1176
679 Ga0495625_0000031 3300046660 Bacteria 238193
680 Ga0495625_0000588 3300046660 Bacteria 52820
681 Ga0495625_0002611 3300046660 Bacteria 19281
682 Ga0495625_0002676 3300046660 Bacteria 18953
683 Ga0495625_0011605 3300046660 Bacteria 7168
684 Ga0495625_0013677 3300046660 Bacteria 6508
685 Ga0495625_0270528 3300046660 Bacteria 1096
686 Ga0495625_0448300 3300046660 Bacteria 798
687 Ga0495661_0092822 3300046665 Bacteria 1714
688 Ga0495661_0102062 3300046665 Bacteria 1613
689 Ga0495669_0000047 3300046684 Bacteria 82672
690 Ga0495669_0041952 3300046684 Bacteria 2033
691 Ga0495670_0000016 3300046691 Bacteria 128045
692 Ga0495670_0002882 3300046691 Bacteria 8474
693 Ga0495670_0011648 3300046691 Bacteria 4327
694 Ga0495670_0014291 3300046691 Bacteria 3905
695 Ga0495671_0000028 3300046692 Bacteria 234938
696 Ga0495671_0007026 3300046692 Bacteria 6452
697 Ga0495671_0015741 3300046692 Bacteria 4046
698 Ga0495671_0043874 3300046692 Bacteria 2244
699 Ga0495671_0131335 3300046692 Bacteria 1221
700 Ga0495671_0361940 3300046692 Bacteria 695
701 Ga0495649_0228736 3300046694 Bacteria 960
702 Ga0495589_0076479 3300046794 Bacteria 1632
703 Ga0495600_0038150 3300046809 Bacteria 3125
704 Ga0495660_0044172 3300046810 Bacteria 2453
705 Ga0495660_0164844 3300046810 Bacteria 1084
706 Ga0495683_0013776 3300047323 Bacteria 4221
707 Ga0495687_000043 3300047443 Bacteria 216711
708 Ga0495687_002080 3300047443 Bacteria 16814
709 Ga0495677_0003536 3300047445 Bacteria 6063
710 Ga0495673_0000058 3300047469 Bacteria 235044
711 Ga0495673_0013172 3300047469 Bacteria 4353
712 Ga0495681_0005101 3300047470 Bacteria 8854
713 Ga0495686_0000139 3300047472 Bacteria 145796
714 Ga0495686_0000523 3300047472 Bacteria 55456
715 Ga0495686_0001582 3300047472 Bacteria 24064
716 Ga0495686_0010788 3300047472 Bacteria 6479
717 Ga0496100_0191427 3300048903 Bacteria 1485
718 Ga0496102_0000022 3300048905 Bacteria 246314
719 Ga0496102_0000034 3300048905 Bacteria 213826
720 Ga0496102_0025183 3300048905 Bacteria 5293
721 Ga0496102_0146484 3300048905 Bacteria 2216
722 Ga0496102_0225699 3300048905 Bacteria 1766
723 Ga0496102_0832373 3300048905 Bacteria 845
724 Ga0496103_0000026 3300048906 Bacteria 213826
725 Ga0496103_0000075 3300048906 Bacteria 114569
726 Ga0496103_0002036 3300048906 Bacteria 12973
727 Ga0496103_0014765 3300048906 Bacteria 4642
728 Ga0496103_0460315 3300048906 Unclassified 816
729 Ga0496104_0003920 3300048907 Bacteria 12878
730 Ga0496104_0125628 3300048907 Bacteria 2463
731 Ga0496105_0000847 3300048908 Bacteria 20846
732 Ga0496105_0066116 3300048908 Bacteria 2984
733 Ga0496107_0059004 3300048910 Bacteria 2776
734 Ga0496107_0060780 3300048910 Bacteria 2735
735 Ga0496108_0674775 3300048911 Bacteria 897
736 Ga0496109_0230113 3300048912 Bacteria 1744
737 Ga0496111_0018587 3300048914 Bacteria 4816
738 Ga0496113_0030152 3300048916 Bacteria 3924
739 Ga0496114_0006903 3300048917 Bacteria 8945
740 Ga0496115_0000029 3300048918 Bacteria 141359
741 Ga0496115_0000304 3300048918 Bacteria 41844
742 Ga0496115_0256703 3300048918 Bacteria 1438
743 Ga0496116_0001435 3300048919 Bacteria 26777
744 Ga0496116_0002308 3300048919 Bacteria 20225
745 Ga0496116_0020839 3300048919 Bacteria 4965
746 Ga0496116_0290060 3300048919 Bacteria 786
747 Ga0496117_0000072 3300048920 Bacteria 238366
748 Ga0496117_0000260 3300048920 Bacteria 99636
749 Ga0496117_0004000 3300048920 Bacteria 16644
750 Ga0496117_0005912 3300048920 Bacteria 12633
751 Ga0496117_0009616 3300048920 Bacteria 8952
752 Ga0496117_0061114 3300048920 Bacteria 2592
753 Ga0496117_0434779 3300048920 Bacteria 653
754 Ga0496118_0000030 3300048921 Bacteria 339946
755 Ga0496118_0000039 3300048921 Bacteria 305458
756 Ga0496118_0002183 3300048921 Bacteria 27245
757 Ga0496118_0002784 3300048921 Bacteria 22888
758 Ga0496118_0030499 3300048921 Bacteria 4498
759 Ga0496119_0011873 3300048922 Bacteria 7151
760 Ga0496119_0019906 3300048922 Bacteria 4917
761 Ga0496120_0011696 3300048923 Bacteria 6020
762 Ga0496121_0000269 3300048924 Bacteria 108869
763 Ga0496121_0255892 3300048924 Bacteria 1212
764 Ga0496122_0000359 3300048925 Bacteria 97927
765 Ga0496122_0072028 3300048925 Bacteria 2459
766 Ga0496122_0114676 3300048925 Bacteria 1757
767 Ga0496122_0173154 3300048925 Bacteria 1298
768 Ga0496123_0002200 3300048926 Bacteria 24799
769 Ga0496123_0010124 3300048926 Bacteria 8381
770 Ga0496123_0017074 3300048926 Bacteria 5860
771 Ga0496123_0071430 3300048926 Bacteria 2165
772 Ga0496123_0113147 3300048926 Bacteria 1546
773 Ga0496123_0134808 3300048926 Bacteria 1361
774 Ga0496124_0000061 3300048927 Bacteria 238225
775 Ga0496124_0000076 3300048927 Bacteria 215767
776 Ga0496124_0000972 3300048927 Bacteria 45648
777 Ga0496124_0009807 3300048927 Bacteria 9795
778 Ga0496124_0060812 3300048927 Bacteria 3168
779 Ga0496124_0210206 3300048927 Bacteria 1473
780 Ga0496124_0259721 3300048927 Bacteria 1279
781 Ga0496124_0366393 3300048927 Bacteria 1013
782 Ga0496124_0384241 3300048927 Bacteria 981
783 Ga0496125_0000505 3300048928 Bacteria 67726
784 Ga0496125_0048947 3300048928 Bacteria 3518
785 Ga0496125_0180549 3300048928 Bacteria 1407
786 Ga0496125_0342270 3300048928 Bacteria 897
787 Ga0496125_0392358 3300048928 Bacteria 814
788 Ga0496125_0423031 3300048928 Bacteria 771
789 Ga0496125_0424528 3300048928 Bacteria 769
790 Ga0496126_0000469 3300048929 Bacteria 80156
791 Ga0496126_0072263 3300048929 Bacteria 3069
792 Ga0496126_0142042 3300048929 Bacteria 2066
793 Ga0496126_0181775 3300048929 Bacteria 1786
794 Ga0495678_067352 3300049459 Bacteria 1323
795 Ga0495678_089306 3300049459 Bacteria 1089
796 Ga0495682_0005472 3300049460 Bacteria 5269
797 Ga0501290_010424 3300049513 Bacteria 1188
798 Ga0501292_000003 3300049515 Bacteria 161908
799 Ga0501293_014882 3300049516 Bacteria 711
800 Ga0501294_001507 3300049517 Bacteria 2331
801 Ga0501300_000435 3300049523 Bacteria 6338
802 Ga0501300_006309 3300049523 Bacteria 1747
803 Ga0501031_0063333 3300049568 Bacteria 2409
804 Ga0501032_0010092 3300049569 Bacteria 6817
805 Ga0501032_0116551 3300049569 Bacteria 1766
806 Ga0501033_0086928 3300049570 Bacteria 2288
807 Ga0501033_0108351 3300049570 Bacteria 2023
808 Ga0501034_0008195 3300049571 Bacteria 11079
809 Ga0501034_0027966 3300049571 Bacteria 5734
810 Ga0501034_0051809 3300049571 Bacteria 4138
811 Ga0501034_0169871 3300049571 Bacteria 2148
812 Ga0501036_0147928 3300049572 Bacteria 1981
813 Ga0501036_0515586 3300049572 Bacteria 994
814 Ga0501037_0635499 3300049573 Bacteria 714
815 Ga0501038_0022352 3300049574 Bacteria 5669
816 Ga0501039_0530071 3300049575 Bacteria 924
817 Ga0501043_0057451 3300049579 Bacteria 3055
818 Ga0501043_0135872 3300049579 Bacteria 1926
819 Ga0501046_0132703 3300049580 Bacteria 1888
820 Ga0501047_0001517 3300049581 Bacteria 22668
821 Ga0501047_0200828 3300049581 Bacteria 1855
822 Ga0501047_0372518 3300049581 Bacteria 1263
823 Ga0501048_0119258 3300049582 Bacteria 1864
824 Ga0501198_038966 3300049649 Bacteria 818
825 Ga0501202_003716 3300049652 Bacteria 2629
826 Ga0501206_004721 3300049653 Bacteria 1741
827 Ga0501207_014963 3300049654 Bacteria 1190
828 Ga0501222_000605 3300049662 Bacteria 5260
829 Ga0501223_000090 3300049663 Bacteria 26538
830 Ga0501223_002495 3300049663 Bacteria 4074
831 Ga0501224_000025 3300049664 Bacteria 56130
832 Ga0501224_001119 3300049664 Bacteria 3492
833 Ga0501227_002177 3300049665 Bacteria 4333
834 Ga0501233_000238 3300049668 Bacteria 8300
835 Ga0501235_043485 3300049669 Bacteria 1031
836 Ga0501242_023965 3300049674 Bacteria 798
837 Ga0501249_000067 3300049679 Bacteria 37308
838 Ga0501257_000019 3300049686 Bacteria 47149
839 Ga0501257_009301 3300049686 Bacteria 2217
840 Ga0501259_000022 3300049688 Bacteria 22627
841 Ga0501261_000007 3300049690 Bacteria 60773
842 Ga0501221_002092 3300049704 Bacteria 3321
843 Ga0501221_017434 3300049704 Bacteria 1371
844 Ga0501225_0000115 3300049705 Bacteria 24964
845 Ga0501234_000307 3300049707 Bacteria 7144
846 Ga0501245_017803 3300049708 Bacteria 1087
847 Ga0501279_000082 3300049775 Bacteria 15759
848 Ga0501280_000047 3300049776 Bacteria 35975
849 Ga0501280_000638 3300049776 Bacteria 7890
850 Ga0501281_00165 3300049777 Bacteria 7693
851 Ga0501282_000814 3300049778 Bacteria 3580
852 Ga0501035_0076990 3300049822 Bacteria 2948
853 Ga0501035_0217406 3300049822 Bacteria 1633
854 Ga0501035_0296075 3300049822 Bacteria 1364
855 Ga0501035_0531848 3300049822 Bacteria 965
856 Ga0501044_0153977 3300049823 Bacteria 2279
857 Ga0501044_0232027 3300049823 Bacteria 1792
858 Ga0501226_000020 3300049853 Bacteria 141193
859 nmdc:mga0k408_167288_c1 3300050493 Bacteria 1310
860 nmdc:mga07m45_62558_c1 3300050496 Bacteria 1663
861 Ga0500610_0000075 3300053079 Bacteria 30153
862 Ga0500643_000293 3300053087 Bacteria 42902
863 Ga0500643_000709 3300053087 Bacteria 22105
864 Ga0500643_000824 3300053087 Bacteria 20040
865 Ga0500643_000847 3300053087 Bacteria 19541
866 Ga0500643_017589 3300053087 Bacteria 2391
867 Ga0500647_0067941 3300053091 Bacteria 1714
868 Ga0500583_0330907 3300053092 Bacteria 741
869 Ga0500651_0071175 3300053093 Bacteria 2164
870 Ga0500566_0015005 3300053094 Bacteria 4549
871 Ga0500566_0050704 3300053094 Bacteria 2376
872 Ga0500641_0014638 3300053096 Bacteria 2897
873 Ga0500641_0062406 3300053096 Bacteria 1554
874 Ga0500555_000708 3300053103 Bacteria 12614
875 Ga0500556_0081715 3300053104 Bacteria 1222
876 Ga0500562_128708 3300053108 Bacteria 690
877 Ga0500592_000543 3300053116 Bacteria 6225
878 Ga0500592_000812 3300053116 Bacteria 5113
879 Ga0500592_004915 3300053116 Bacteria 2122
880 Ga0500592_015284 3300053116 Bacteria 1231
881 Ga0500592_023894 3300053116 Bacteria 985
882 Ga0500594_0008100 3300053118 Bacteria 2390
883 Ga0500594_0020557 3300053118 Bacteria 1648
884 Ga0500595_000789 3300053119 Bacteria 18477
885 Ga0500595_004048 3300053119 Bacteria 6670
886 Ga0500595_047484 3300053119 Bacteria 1345
887 Ga0500597_002858 3300053120 Bacteria 4935
888 Ga0500614_029717 3300053123 Bacteria 1328
889 Ga0500618_011159 3300053125 Bacteria 2392
890 Ga0500642_0002794 3300053130 Bacteria 5177
891 Ga0500652_173387 3300053131 Bacteria 887
892 Ga0500655_000411 3300053133 Bacteria 8997
893 Ga0500658_0010536 3300053134 Bacteria 3409
894 Ga0500658_0018148 3300053134 Bacteria 2634
895 Ga0500658_0027407 3300053134 Bacteria 2203
896 Ga0500658_0168690 3300053134 Bacteria 993
897 Ga0500658_0343353 3300053134 Bacteria 685
898 Ga0500559_0001245 3300053136 Bacteria 14977
899 Ga0500559_0019742 3300053136 Bacteria 2848
900 Ga0500559_0026803 3300053136 Bacteria 2457
901 Ga0500568_0003154 3300053139 Bacteria 9393
902 Ga0500568_0020227 3300053139 Bacteria 2882
903 Ga0500568_0025795 3300053139 Bacteria 2474
904 Ga0500568_0047498 3300053139 Bacteria 1700
905 Ga0500568_0075216 3300053139 Bacteria 1288
906 Ga0500573_0000041 3300053140 Bacteria 103805
907 Ga0500590_002280 3300053148 Bacteria 8425
908 Ga0500604_0030240 3300053151 Bacteria 1583
909 Ga0500604_0164895 3300053151 Bacteria 756
910 Ga0500616_0112681 3300053153 Bacteria 1311
911 Ga0500616_0145388 3300053153 Bacteria 1103
912 Ga0500624_000004 3300053157 Bacteria 196921
913 Ga0500624_000095 3300053157 Bacteria 43267
914 Ga0500624_016035 3300053157 Bacteria 1152
915 Ga0500627_0000056 3300053158 Bacteria 53879
916 Ga0500627_0000374 3300053158 Bacteria 12179
917 Ga0500627_0000418 3300053158 Bacteria 11489
918 Ga0500627_0036703 3300053158 Bacteria 2088
919 Ga0500627_0105744 3300053158 Bacteria 1265
920 Ga0500627_0155528 3300053158 Bacteria 1032
921 Ga0500627_0165050 3300053158 Bacteria 999
922 Ga0500636_0004155 3300053177 Bacteria 8192
923 Ga0500636_0019811 3300053177 Bacteria 3978
924 Ga0500636_0043398 3300053177 Bacteria 2655
925 Ga0500636_0135147 3300053177 Bacteria 1370
926 Ga0500637_0000454 3300053178 Bacteria 15762
927 Ga0500570_000528 3300053724 Bacteria 14985
928 Ga0500611_001307 3300053727 Bacteria 2703
929 Ga0500645_000038 3300053730 Bacteria 112786
930 Ga0500645_003201 3300053730 Bacteria 6792
931 Ga0500645_103965 3300053730 Bacteria 799
932 Ga0500596_000565 3300053735 Bacteria 7056
933 Ga0500601_012482 3300053737 Bacteria 960

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0000304 Ga0496115_0000304_13494_14027 165
2 iso_pu_bacteria 2599185359 2600227134 173
3 iso_pu_bacteria 2818991466 2819715414 173
4 iso_pu_bacteria 2879163058 2879163245 173
5 iso_pu_bacteria 2928526807 2928530843 173
6 iso_pu_bacteria 2928968154 2928971083 173
7 iso_pu_bacteria 2643221622 2644127386 174
8 iso_pu_bacteria 2990265787 2990268352 174
9 iso_pu_bacteria 2993693658 2993696616 174
10 iso_pu_bacteria 8057101203 8057105483 174
11 3300005327 Ga0070658_10000003 Ga0070658_10000003142 175
12 3300005339 Ga0070660_100002821 Ga0070660_1000028213 175
13 3300005344 Ga0070661_100000261 Ga0070661_10000026113 175
14 3300005345 Ga0070692_10005410 Ga0070692_100054104 175
15 3300005366 Ga0070659_100001775 Ga0070659_1000017752 175
16 3300013105 Ga0157369_10006147 Ga0157369_100061472 175
17 3300021384 Ga0213876_10001336 Ga0213876_100013365 175
18 3300025909 Ga0207705_10000005 Ga0207705_10000005145 175
19 3300025919 Ga0207657_10002670 Ga0207657_100026709 175
20 3300025920 Ga0207649_10000016 Ga0207649_10000016189 175
21 3300025932 Ga0207690_10012099 Ga0207690_100120992 175
22 3300039437 Ga0436365_0062931 Ga0436365_0062931_43263_43790 175
23 3300039437 Ga0436365_0340026 Ga0436365_0340026_625_1152 175
24 iso_pu_bacteria 2599185354 2600203137 175
25 iso_pu_bacteria 2751185897 2753766557 175
26 iso_pu_bacteria 2830075706 2830075873 175
27 iso_pu_bacteria 2946787523 2946790433 175
28 3300009551 Ga0105238_11111161 Ga0105238_111111611 176
29 3300037853 Ga0436364_0752226 Ga0436364_0752226_543_1073 176
30 iso_pu_bacteria 2582581305 2585263300 176
31 iso_pu_bacteria 2643221563 2643835339 176
32 iso_pu_bacteria 2643221608 2644056265 176
33 iso_pu_bacteria 2852653556 2852654927 176
34 iso_pu_bacteria 2852680915 2852681730 176
35 iso_pu_bacteria 2885429604 2885432402 176
36 3300002774 JGI25150J39212_1000336 JGI25150J39212_100033619 177
37 3300003215 JGI25153J46596_10000055 JGI25153J46596_1000005551 177
38 3300003320 rootH2_10053686 rootH2_100536862 177
39 3300003771 Ga0055526_1005851 Ga0055526_10058512 177
40 3300003773 Ga0055537_1003306 Ga0055537_10033064 177
41 3300003781 Ga0055536_1010300 Ga0055536_10103002 177
42 3300003791 Ga0055530_10009074 Ga0055530_100090741 177
43 3300003792 Ga0055540_1004237 Ga0055540_10042372 177
44 3300003794 Ga0055531_10078366 Ga0055531_100783662 177
45 3300005577 Ga0068857_100017231 Ga0068857_1000172314 177
46 3300005578 Ga0068854_100074397 Ga0068854_1000743972 177
47 3300006353 Ga0075370_10174138 Ga0075370_101741382 177
48 3300009093 Ga0105240_10445502 Ga0105240_104455022 177
49 3300009545 Ga0105237_10009797 Ga0105237_100097975 177
50 3300010375 Ga0105239_11299434 Ga0105239_112994342 177
51 3300025245 Ga0207425_1000005 Ga0207425_1000005645 177
52 3300025258 Ga0209129_1001045 Ga0209129_10010452 177
53 3300025263 Ga0209565_1000272 Ga0209565_100027215 177
54 3300025273 Ga0209673_1002970 Ga0209673_10029709 177
55 3300025294 Ga0209025_1001074 Ga0209025_100107422 177
56 3300025295 Ga0209564_1000949 Ga0209564_100094911 177
57 3300025295 Ga0209564_1038417 Ga0209564_10384172 177
58 3300025297 Ga0209758_1000002 Ga0209758_1000002699 177
59 3300025298 Ga0209050_1000001 Ga0209050_1000001678 177
60 3300025302 Ga0207426_1025383 Ga0207426_10253834 177
61 3300025303 Ga0209051_1000364 Ga0209051_100036465 177
62 3300025914 Ga0207671_10001574 Ga0207671_100015749 177
63 3300025981 Ga0207640_10005130 Ga0207640_100051305 177
64 3300026116 Ga0207674_10025744 Ga0207674_100257444 177
65 3300031911 Ga0307412_10000342 Ga0307412_1000034225 177
66 3300035118 Ga0373954_0032080 Ga0373954_0032080_1614_2147 177
67 3300042876 Ga0451577_1286555 Ga0451577_1286555_56_607 177
68 3300045051 Ga0451576_0005491 Ga0451576_0005491_7029_7577 177
69 3300046660 Ga0495625_0002676 Ga0495625_0002676_16560_17102 177
70 3300048903 Ga0496100_0191427 Ga0496100_0191427_402_935 177
71 3300048905 Ga0496102_0146484 Ga0496102_0146484_1133_1666 177
72 3300048920 Ga0496117_0434779 Ga0496117_0434779_67_600 177
73 3300048924 Ga0496121_0255892 Ga0496121_0255892_32_565 177
74 3300048925 Ga0496122_0072028 Ga0496122_0072028_1725_2258 177
75 3300048925 Ga0496122_0173154 Ga0496122_0173154_311_844 177
76 3300048926 Ga0496123_0017074 Ga0496123_0017074_2428_2961 177
77 3300048926 Ga0496123_0113147 Ga0496123_0113147_255_788 177
78 3300048927 Ga0496124_0000972 Ga0496124_0000972_12709_13242 177
79 3300048927 Ga0496124_0009807 Ga0496124_0009807_6429_6962 177
80 3300048927 Ga0496124_0259721 Ga0496124_0259721_521_1054 177
81 3300048927 Ga0496124_0366393 Ga0496124_0366393_335_868 177
82 3300048927 Ga0496124_0384241 Ga0496124_0384241_278_820 177
83 3300048928 Ga0496125_0048947 Ga0496125_0048947_436_969 177
84 3300048928 Ga0496125_0423031 Ga0496125_0423031_78_611 177
85 3300048929 Ga0496126_0181775 Ga0496126_0181775_1113_1646 177
86 3300049571 Ga0501034_0169871 Ga0501034_0169871_1157_1699 177
87 3300050496 nmdc:mga07m45_62558_c1 nmdc:mga07m45_62558_c1_713_1246 177
88 3300053096 Ga0500641_0014638 Ga0500641_0014638_1244_1777 177
89 3300053104 Ga0500556_0081715 Ga0500556_0081715_358_891 177
90 3300053119 Ga0500595_000789 Ga0500595_000789_9665_10198 177
91 3300053131 Ga0500652_173387 Ga0500652_173387_181_714 177
92 3300053139 Ga0500568_0003154 Ga0500568_0003154_1598_2140 177
93 3300053730 Ga0500645_003201 Ga0500645_003201_1293_1826 177
94 3300000043 ARcpr5yngRDRAFT_c000749 ARcpr5yngRDRAFT_0007497 178
95 3300001915 JGI24741J21665_1004664 JGI24741J21665_10046642 178
96 3300001915 JGI24741J21665_1016602 JGI24741J21665_10166022 178
97 3300001979 JGI24740J21852_10016144 JGI24740J21852_100161442 178
98 3300001979 JGI24740J21852_10017375 JGI24740J21852_100173753 178
99 3300001990 JGI24737J22298_10022130 JGI24737J22298_100221301 178
100 3300002077 JGI24744J21845_10057570 JGI24744J21845_100575702 178
101 3300003215 JGI25153J46596_10000045 JGI25153J46596_1000004576 178
102 3300003215 JGI25153J46596_10003282 JGI25153J46596_100032822 178
103 3300003323 rootH1_10009798 rootH1_100097982 178
104 3300003752 Ga0055539_1017913 Ga0055539_10179132 178
105 3300003759 Ga0055525_1000080 Ga0055525_1000080152 178
106 3300003762 Ga0055542_1000012 Ga0055542_1000012149 178
107 3300003763 Ga0055529_1000002 Ga0055529_100000265 178
108 3300003763 Ga0055529_1000004 Ga0055529_1000004292 178
109 3300003775 Ga0055524_1000405 Ga0055524_100040541 178
110 3300003791 Ga0055530_10000915 Ga0055530_1000091519 178
111 3300003791 Ga0055530_10006827 Ga0055530_100068272 178
112 3300003794 Ga0055531_10001375 Ga0055531_1000137510 178
113 3300003794 Ga0055531_10005973 Ga0055531_1000597310 178
114 3300004625 Ga0055543_1034130 Ga0055543_10341301 178
115 3300005262 Ga0065165_1004742 Ga0065165_10047426 178
116 3300005262 Ga0065165_1018884 Ga0065165_10188844 178
117 3300005327 Ga0070658_10002437 Ga0070658_1000243712 178
118 3300005328 Ga0070676_10020378 Ga0070676_100203782 178
119 3300005329 Ga0070683_100108350 Ga0070683_1001083501 178
120 3300005329 Ga0070683_100577103 Ga0070683_1005771031 178
121 3300005334 Ga0068869_100897459 Ga0068869_1008974591 178
122 3300005339 Ga0070660_100811019 Ga0070660_1008110191 178
123 3300005344 Ga0070661_100027201 Ga0070661_1000272012 178
124 3300005354 Ga0070675_100985551 Ga0070675_1009855512 178
125 3300005355 Ga0070671_100549088 Ga0070671_1005490882 178
126 3300005356 Ga0070674_100001683 Ga0070674_1000016838 178
127 3300005356 Ga0070674_100030244 Ga0070674_1000302442 178
128 3300005364 Ga0070673_100248365 Ga0070673_1002483652 178
129 3300005365 Ga0070688_101066772 Ga0070688_1010667721 178
130 3300005367 Ga0070667_100256711 Ga0070667_1002567112 178
131 3300005455 Ga0070663_100329966 Ga0070663_1003299662 178
132 3300005456 Ga0070678_100000679 Ga0070678_10000067912 178
133 3300005456 Ga0070678_100124729 Ga0070678_1001247292 178
134 3300005457 Ga0070662_100043140 Ga0070662_1000431404 178
135 3300005457 Ga0070662_100160195 Ga0070662_1001601952 178
136 3300005459 Ga0068867_101393210 Ga0068867_1013932101 178
137 3300005535 Ga0070684_100093789 Ga0070684_1000937892 178
138 3300005539 Ga0068853_100081684 Ga0068853_1000816841 178
139 3300005548 Ga0070665_100000088 Ga0070665_10000008872 178
140 3300005548 Ga0070665_100471593 Ga0070665_1004715932 178
141 3300005563 Ga0068855_100099751 Ga0068855_1000997512 178
142 3300005563 Ga0068855_100250360 Ga0068855_1002503602 178
143 3300005577 Ga0068857_100204800 Ga0068857_1002048002 178
144 3300005614 Ga0068856_100123778 Ga0068856_1001237782 178
145 3300005616 Ga0068852_100090931 Ga0068852_1000909312 178
146 3300005616 Ga0068852_100160386 Ga0068852_1001603862 178
147 3300005834 Ga0068851_10077021 Ga0068851_100770212 178
148 3300006195 Ga0075366_10445365 Ga0075366_104453652 178
149 3300009093 Ga0105240_10114767 Ga0105240_101147672 178
150 3300009148 Ga0105243_10001945 Ga0105243_100019456 178
151 3300009174 Ga0105241_10012572 Ga0105241_100125724 178
152 3300009545 Ga0105237_10951022 Ga0105237_109510222 178
153 3300010375 Ga0105239_11597561 Ga0105239_115975611 178
154 3300011119 Ga0105246_10118019 Ga0105246_101180193 178
155 3300012475 Ga0157317_1006477 Ga0157317_10064771 178
156 3300013100 Ga0157373_10066327 Ga0157373_100663272 178
157 3300013102 Ga0157371_10000290 Ga0157371_1000029041 178
158 3300013104 Ga0157370_10260172 Ga0157370_102601722 178
159 3300013104 Ga0157370_10919005 Ga0157370_109190052 178
160 3300013105 Ga0157369_11043934 Ga0157369_110439341 178
161 3300013105 Ga0157369_11240354 Ga0157369_112403541 178
162 3300013105 Ga0157369_11510405 Ga0157369_115104051 178
163 3300013307 Ga0157372_10195146 Ga0157372_101951463 178
164 3300013307 Ga0157372_10828150 Ga0157372_108281502 178
165 3300025230 Ga0209563_100058 Ga0209563_100058274 178
166 3300025245 Ga0207425_1003780 Ga0207425_10037802 178
167 3300025246 Ga0209646_1016590 Ga0209646_10165902 178
168 3300025250 Ga0209026_1023261 Ga0209026_10232612 178
169 3300025253 Ga0209677_105890 Ga0209677_1058901 178
170 3300025254 Ga0209148_1000008 Ga0209148_1000008784 178
171 3300025263 Ga0209565_1000029 Ga0209565_1000029166 178
172 3300025272 Ga0209455_1000002 Ga0209455_1000002641 178
173 3300025273 Ga0209673_1001949 Ga0209673_10019495 178
174 3300025291 Ga0209675_1008112 Ga0209675_10081123 178
175 3300025297 Ga0209758_1000007 Ga0209758_1000007929 178
176 3300025297 Ga0209758_1012238 Ga0209758_10122385 178
177 3300025298 Ga0209050_1000167 Ga0209050_100016766 178
178 3300025298 Ga0209050_1004286 Ga0209050_100428612 178
179 3300025299 Ga0209256_1000008 Ga0209256_1000008775 178
180 3300025304 Ga0209257_1000028 Ga0209257_1000028670 178
181 3300025304 Ga0209257_1008403 Ga0209257_10084032 178
182 3300025304 Ga0209257_1012636 Ga0209257_10126365 178
183 3300025321 Ga0207656_10008193 Ga0207656_100081935 178
184 3300025904 Ga0207647_10116105 Ga0207647_101161053 178
185 3300025909 Ga0207705_10000103 Ga0207705_1000010350 178
186 3300025911 Ga0207654_10000150 Ga0207654_100001503 178
187 3300025913 Ga0207695_10039997 Ga0207695_100399973 178
188 3300025913 Ga0207695_10052087 Ga0207695_100520875 178
189 3300025914 Ga0207671_10174640 Ga0207671_101746401 178
190 3300025914 Ga0207671_10358640 Ga0207671_103586401 178
191 3300025919 Ga0207657_10420358 Ga0207657_104203582 178
192 3300025920 Ga0207649_10000660 Ga0207649_100006608 178
193 3300025924 Ga0207694_10046069 Ga0207694_100460693 178
194 3300025932 Ga0207690_10033348 Ga0207690_100333482 178
195 3300025933 Ga0207706_10263123 Ga0207706_102631233 178
196 3300025935 Ga0207709_10000005 Ga0207709_10000005309 178
197 3300025937 Ga0207669_10000322 Ga0207669_100003227 178
198 3300025937 Ga0207669_10001286 Ga0207669_100012864 178
199 3300025940 Ga0207691_10183964 Ga0207691_101839642 178
200 3300025942 Ga0207689_10737011 Ga0207689_107370112 178
201 3300025944 Ga0207661_10553420 Ga0207661_105534201 178
202 3300025949 Ga0207667_10000001 Ga0207667_10000001997 178
203 3300025949 Ga0207667_10357351 Ga0207667_103573512 178
204 3300025981 Ga0207640_10006365 Ga0207640_100063656 178
205 3300025981 Ga0207640_11174619 Ga0207640_111746191 178
206 3300025986 Ga0207658_10302095 Ga0207658_103020952 178
207 3300026041 Ga0207639_10001679 Ga0207639_100016797 178
208 3300026041 Ga0207639_10430236 Ga0207639_104302362 178
209 3300026067 Ga0207678_10111417 Ga0207678_101114173 178
210 3300026067 Ga0207678_10303638 Ga0207678_103036382 178
211 3300026078 Ga0207702_10026646 Ga0207702_100266462 178
212 3300026078 Ga0207702_10065672 Ga0207702_100656722 178
213 3300026089 Ga0207648_10647762 Ga0207648_106477622 178
214 3300026116 Ga0207674_10578482 Ga0207674_105784822 178
215 3300026121 Ga0207683_10001013 Ga0207683_100010132 178
216 3300026142 Ga0207698_10005044 Ga0207698_100050442 178
217 3300026142 Ga0207698_10057071 Ga0207698_100570712 178
218 3300028379 Ga0268266_10000074 Ga0268266_1000007489 178
219 3300028379 Ga0268266_10497953 Ga0268266_104979531 178
220 3300028786 Ga0307517_10044893 Ga0307517_100448932 178
221 3300031456 Ga0307513_10052452 Ga0307513_100524522 178
222 3300032002 Ga0307416_100532938 Ga0307416_1005329382 178
223 3300032005 Ga0307411_10356223 Ga0307411_103562232 178
224 3300033180 Ga0307510_10005677 Ga0307510_100056776 178
225 3300033180 Ga0307510_10033362 Ga0307510_100333624 178
226 3300035111 Ga0373923_0185193 Ga0373923_0185193_285_821 178
227 3300036401 Ga0373937_0432554 Ga0373937_0432554_572_1108 178
228 3300037418 Ga0395900_1030673 Ga0395900_1030673_164_700 178
229 3300037471 Ga0395905_0096269 Ga0395905_0096269_788_1324 178
230 3300037471 Ga0395905_0447278 Ga0395905_0447278_58_594 178
231 3300037471 Ga0395905_1334915 Ga0395905_1334915_40_576 178
232 3300038443 Ga0395901_0029420 Ga0395901_0029420_84_620 178
233 3300038443 Ga0395901_0040961 Ga0395901_0040961_4232_4768 178
234 3300038443 Ga0395901_1258397 Ga0395901_1258397_41_577 178
235 3300041406 Ga0439439_0064079 Ga0439439_0064079_393_929 178
236 3300041413 Ga0439465_0000267 Ga0439465_0000267_11312_11848 178
237 3300041413 Ga0439465_0001572 Ga0439465_0001572_4441_4977 178
238 3300041512 Ga0451853_2935544 Ga0451853_2935544_27_563 178
239 3300041997 Ga0439431_0000273 Ga0439431_0000273_510_1046 178
240 3300041997 Ga0439431_0014648 Ga0439431_0014648_89_625 178
241 3300042002 Ga0439442_009040 Ga0439442_009040_693_1229 178
242 3300042004 Ga0439445_0000417 Ga0439445_0000417_2458_2994 178
243 3300042004 Ga0439445_0008347 Ga0439445_0008347_1463_1999 178
244 3300042004 Ga0439445_0024060 Ga0439445_0024060_501_1037 178
245 3300042006 Ga0439432_002453 Ga0439432_002453_5318_5854 178
246 3300042007 Ga0439449_0045533 Ga0439449_0045533_961_1497 178
247 3300042010 Ga0439452_020562 Ga0439452_020562_1160_1696 178
248 3300042014 Ga0439457_014047 Ga0439457_014047_273_809 178
249 3300042015 Ga0439462_0004232 Ga0439462_0004232_1485_2021 178
250 3300042156 Ga0439446_0043431 Ga0439446_0043431_223_759 178
251 3300042435 Ga0439434_0000488 Ga0439434_0000488_5668_6204 178
252 3300046453 Ga0495627_005422 Ga0495627_005422_1645_2181 178
253 3300046460 Ga0495638_0238855 Ga0495638_0238855_132_668 178
254 3300046471 Ga0495650_0000196 Ga0495650_0000196_4814_5350 178
255 3300046476 Ga0495662_0508846 Ga0495662_0508846_44_580 178
256 3300046492 Ga0495585_0000620 Ga0495585_0000620_28190_28726 178
257 3300046500 Ga0495596_0028535 Ga0495596_0028535_1413_1949 178
258 3300046506 Ga0495583_0000406 Ga0495583_0000406_937_1473 178
259 3300046506 Ga0495583_0007101 Ga0495583_0007101_940_1476 178
260 3300046506 Ga0495583_0046112 Ga0495583_0046112_1235_1771 178
261 3300046506 Ga0495583_0087721 Ga0495583_0087721_707_1243 178
262 3300046507 Ga0495606_0000497 Ga0495606_0000497_7497_8033 178
263 3300046507 Ga0495606_0022207 Ga0495606_0022207_2260_2796 178
264 3300046518 Ga0495631_0085611 Ga0495631_0085611_534_1070 178
265 3300046520 Ga0495637_0010269 Ga0495637_0010269_2756_3292 178
266 3300046522 Ga0495643_0002033 Ga0495643_0002033_4224_4760 178
267 3300046522 Ga0495643_0004844 Ga0495643_0004844_1832_2368 178
268 3300046522 Ga0495643_0005462 Ga0495643_0005462_4683_5219 178
269 3300046522 Ga0495643_0058007 Ga0495643_0058007_661_1197 178
270 3300046524 Ga0495648_0000114 Ga0495648_0000114_10762_11298 178
271 3300046524 Ga0495648_0098124 Ga0495648_0098124_843_1379 178
272 3300046525 Ga0495663_0000369 Ga0495663_0000369_12550_13086 178
273 3300046525 Ga0495663_0070503 Ga0495663_0070503_525_1061 178
274 3300046528 Ga0495642_0040137 Ga0495642_0040137_61_597 178
275 3300046542 Ga0495597_0103983 Ga0495597_0103983_118_654 178
276 3300046557 Ga0495622_0033946 Ga0495622_0033946_1510_2046 178
277 3300046558 Ga0495633_0000207 Ga0495633_0000207_20778_21314 178
278 3300046616 Ga0495668_0000022 Ga0495668_0000022_57637_58173 178
279 3300046648 Ga0495611_0002606 Ga0495611_0002606_4763_5299 178
280 3300046648 Ga0495611_0052799 Ga0495611_0052799_1033_1569 178
281 3300046648 Ga0495611_0129649 Ga0495611_0129649_537_1073 178
282 3300046660 Ga0495625_0000588 Ga0495625_0000588_2032_2568 178
283 3300046660 Ga0495625_0011605 Ga0495625_0011605_2090_2626 178
284 3300046660 Ga0495625_0270528 Ga0495625_0270528_400_936 178
285 3300046660 Ga0495625_0448300 Ga0495625_0448300_66_602 178
286 3300046665 Ga0495661_0102062 Ga0495661_0102062_226_762 178
287 3300046684 Ga0495669_0000047 Ga0495669_0000047_38113_38649 178
288 3300046691 Ga0495670_0000016 Ga0495670_0000016_113507_114043 178
289 3300046692 Ga0495671_0043874 Ga0495671_0043874_1249_1785 178
290 3300046809 Ga0495600_0038150 Ga0495600_0038150_2196_2732 178
291 3300046810 Ga0495660_0044172 Ga0495660_0044172_1405_1941 178
292 3300047323 Ga0495683_0013776 Ga0495683_0013776_2153_2689 178
293 3300047443 Ga0495687_000043 Ga0495687_000043_47074_47610 178
294 3300047443 Ga0495687_002080 Ga0495687_002080_9219_9755 178
295 3300047470 Ga0495681_0005101 Ga0495681_0005101_5406_5942 178
296 3300048905 Ga0496102_0000022 Ga0496102_0000022_104696_105232 178
297 3300048906 Ga0496103_0000075 Ga0496103_0000075_104935_105471 178
298 3300048907 Ga0496104_0003920 Ga0496104_0003920_739_1275 178
299 3300048908 Ga0496105_0000847 Ga0496105_0000847_10991_11527 178
300 3300048910 Ga0496107_0060780 Ga0496107_0060780_2165_2701 178
301 3300048911 Ga0496108_0674775 Ga0496108_0674775_293_829 178
302 3300048912 Ga0496109_0230113 Ga0496109_0230113_254_790 178
303 3300048914 Ga0496111_0018587 Ga0496111_0018587_2233_2769 178
304 3300048916 Ga0496113_0030152 Ga0496113_0030152_1367_1903 178
305 3300048917 Ga0496114_0006903 Ga0496114_0006903_5056_5592 178
306 3300048918 Ga0496115_0000029 Ga0496115_0000029_63028_63564 178
307 3300048919 Ga0496116_0001435 Ga0496116_0001435_7960_8496 178
308 3300048920 Ga0496117_0000260 Ga0496117_0000260_27414_27950 178
309 3300048921 Ga0496118_0000039 Ga0496118_0000039_195590_196126 178
310 3300048922 Ga0496119_0019906 Ga0496119_0019906_4275_4811 178
311 3300048923 Ga0496120_0011696 Ga0496120_0011696_2767_3303 178
312 3300048924 Ga0496121_0000269 Ga0496121_0000269_99481_100017 178
313 3300048925 Ga0496122_0114676 Ga0496122_0114676_94_630 178
314 3300048926 Ga0496123_0010124 Ga0496123_0010124_2730_3266 178
315 3300048927 Ga0496124_0000076 Ga0496124_0000076_110242_110778 178
316 3300048928 Ga0496125_0000505 Ga0496125_0000505_20885_21421 178
317 3300048928 Ga0496125_0392358 Ga0496125_0392358_52_588 178
318 3300048929 Ga0496126_0000469 Ga0496126_0000469_77705_78241 178
319 3300049459 Ga0495678_089306 Ga0495678_089306_81_707 178
320 3300049571 Ga0501034_0051809 Ga0501034_0051809_526_1068 178
321 3300049581 Ga0501047_0200828 Ga0501047_0200828_364_900 178
322 3300049581 Ga0501047_0372518 Ga0501047_0372518_274_810 178
323 3300049822 Ga0501035_0217406 Ga0501035_0217406_1013_1549 178
324 3300049822 Ga0501035_0531848 Ga0501035_0531848_207_743 178
325 3300050493 nmdc:mga0k408_167288_c1 nmdc:mga0k408_167288_c1_743_1279 178
326 3300053079 Ga0500610_0000075 Ga0500610_0000075_5115_5651 178
327 3300053119 Ga0500595_004048 Ga0500595_004048_510_1046 178
328 3300053130 Ga0500642_0002794 Ga0500642_0002794_2479_3105 178
329 3300053134 Ga0500658_0010536 Ga0500658_0010536_1062_1598 178
330 3300053134 Ga0500658_0343353 Ga0500658_0343353_22_558 178
331 3300053139 Ga0500568_0020227 Ga0500568_0020227_2146_2682 178
332 3300053139 Ga0500568_0075216 Ga0500568_0075216_63_599 178
333 3300053151 Ga0500604_0164895 Ga0500604_0164895_174_710 178
334 3300053177 Ga0500636_0019811 Ga0500636_0019811_1664_2200 178
335 3300053730 Ga0500645_000038 Ga0500645_000038_68713_69249 178
336 3300053735 Ga0500596_000565 Ga0500596_000565_4180_4716 178
337 3300001904 JGI24736J21556_1000083 JGI24736J21556_10000833 179
338 3300001976 JGI24752J21851_1000379 JGI24752J21851_10003794 179
339 3300001976 JGI24752J21851_1002368 JGI24752J21851_10023684 179
340 3300001979 JGI24740J21852_10005913 JGI24740J21852_100059132 179
341 3300001989 JGI24739J22299_10008728 JGI24739J22299_100087285 179
342 3300001989 JGI24739J22299_10020919 JGI24739J22299_100209192 179
343 3300001990 JGI24737J22298_10082606 JGI24737J22298_100826062 179
344 3300002067 JGI24735J21928_10001347 JGI24735J21928_100013471 179
345 3300002070 JGI24750J21931_1001923 JGI24750J21931_10019233 179
346 3300002070 JGI24750J21931_1027918 JGI24750J21931_10279181 179
347 3300002074 JGI24748J21848_1000124 JGI24748J21848_10001243 179
348 3300002075 JGI24738J21930_10000970 JGI24738J21930_100009709 179
349 3300002076 JGI24749J21850_1000879 JGI24749J21850_10008792 179
350 3300002076 JGI24749J21850_1030677 JGI24749J21850_10306771 179
351 3300002239 JGI24034J26672_10000048 JGI24034J26672_1000004848 179
352 3300002239 JGI24034J26672_10013219 JGI24034J26672_100132192 179
353 3300002244 JGI24742J22300_10004390 JGI24742J22300_100043904 179
354 3300002459 JGI24751J29686_10008525 JGI24751J29686_100085253 179
355 3300002459 JGI24751J29686_10009785 JGI24751J29686_100097852 179
356 3300003323 rootH1_10239172 rootH1_102391722 179
357 3300005295 Ga0065707_10309846 Ga0065707_103098461 179
358 3300005329 Ga0070683_100104667 Ga0070683_1001046672 179
359 3300005330 Ga0070690_100000016 Ga0070690_10000001614 179
360 3300005331 Ga0070670_100000292 Ga0070670_10000029213 179
361 3300005331 Ga0070670_100002143 Ga0070670_1000021436 179
362 3300005331 Ga0070670_100061762 Ga0070670_1000617622 179
363 3300005335 Ga0070666_10000011 Ga0070666_1000001159 179
364 3300005335 Ga0070666_10000829 Ga0070666_100008298 179
365 3300005339 Ga0070660_100047738 Ga0070660_1000477382 179
366 3300005340 Ga0070689_100045939 Ga0070689_1000459392 179
367 3300005343 Ga0070687_100040703 Ga0070687_1000407034 179
368 3300005344 Ga0070661_100085227 Ga0070661_1000852272 179
369 3300005347 Ga0070668_100004339 Ga0070668_1000043395 179
370 3300005347 Ga0070668_100007957 Ga0070668_1000079574 179
371 3300005353 Ga0070669_100000004 Ga0070669_100000004284 179
372 3300005353 Ga0070669_100000009 Ga0070669_10000000996 179
373 3300005355 Ga0070671_100000004 Ga0070671_100000004104 179
374 3300005355 Ga0070671_100039735 Ga0070671_1000397352 179
375 3300005355 Ga0070671_100094914 Ga0070671_1000949142 179
376 3300005365 Ga0070688_100001707 Ga0070688_10000170711 179
377 3300005366 Ga0070659_100264976 Ga0070659_1002649762 179
378 3300005367 Ga0070667_100000415 Ga0070667_10000041533 179
379 3300005367 Ga0070667_100179436 Ga0070667_1001794361 179
380 3300005440 Ga0070705_100005751 Ga0070705_1000057512 179
381 3300005455 Ga0070663_100046814 Ga0070663_1000468145 179
382 3300005466 Ga0070685_10000186 Ga0070685_1000018634 179
383 3300005539 Ga0068853_100004467 Ga0068853_1000044671 179
384 3300005544 Ga0070686_100000001 Ga0070686_100000001460 179
385 3300005548 Ga0070665_100000004 Ga0070665_100000004194 179
386 3300005548 Ga0070665_100667779 Ga0070665_1006677792 179
387 3300005563 Ga0068855_100346840 Ga0068855_1003468402 179
388 3300005577 Ga0068857_100043041 Ga0068857_1000430411 179
389 3300005616 Ga0068852_100117605 Ga0068852_1001176052 179
390 3300005617 Ga0068859_100001079 Ga0068859_10000107917 179
391 3300005617 Ga0068859_100003565 Ga0068859_10000356512 179
392 3300005617 Ga0068859_100006631 Ga0068859_1000066313 179
393 3300005617 Ga0068859_100948772 Ga0068859_1009487722 179
394 3300005618 Ga0068864_100000300 Ga0068864_10000030013 179
395 3300005618 Ga0068864_100000544 Ga0068864_10000054421 179
396 3300005618 Ga0068864_100014481 Ga0068864_1000144813 179
397 3300005719 Ga0068861_100000203 Ga0068861_10000020316 179
398 3300005719 Ga0068861_100003016 Ga0068861_1000030166 179
399 3300005719 Ga0068861_100434862 Ga0068861_1004348622 179
400 3300005834 Ga0068851_10019572 Ga0068851_100195722 179
401 3300005834 Ga0068851_10295787 Ga0068851_102957871 179
402 3300005841 Ga0068863_100000010 Ga0068863_100000010126 179
403 3300005841 Ga0068863_100000073 Ga0068863_10000007383 179
404 3300005841 Ga0068863_100053484 Ga0068863_1000534845 179
405 3300005842 Ga0068858_100000360 Ga0068858_10000036010 179
406 3300005842 Ga0068858_100000782 Ga0068858_10000078223 179
407 3300005842 Ga0068858_100072688 Ga0068858_1000726882 179
408 3300005843 Ga0068860_100000030 Ga0068860_100000030200 179
409 3300005843 Ga0068860_100007681 Ga0068860_1000076819 179
410 3300005844 Ga0068862_100000431 Ga0068862_10000043115 179
411 3300005844 Ga0068862_100000462 Ga0068862_10000046218 179
412 3300005844 Ga0068862_100000716 Ga0068862_10000071617 179
413 3300005844 Ga0068862_100012378 Ga0068862_1000123782 179
414 3300006880 Ga0075429_100216459 Ga0075429_1002164592 179
415 3300006931 Ga0097620_100001079 Ga0097620_10000107917 179
416 3300006931 Ga0097620_100003566 Ga0097620_1000035666 179
417 3300006931 Ga0097620_100006631 Ga0097620_1000066313 179
418 3300006931 Ga0097620_100948790 Ga0097620_1009487902 179
419 3300009011 Ga0105251_10000296 Ga0105251_1000029620 179
420 3300009011 Ga0105251_10176357 Ga0105251_101763572 179
421 3300009093 Ga0105240_10502904 Ga0105240_105029043 179
422 3300009101 Ga0105247_10000874 Ga0105247_1000087416 179
423 3300009101 Ga0105247_10024765 Ga0105247_100247652 179
424 3300009101 Ga0105247_10108150 Ga0105247_101081502 179
425 3300009174 Ga0105241_10077684 Ga0105241_100776841 179
426 3300009177 Ga0105248_10000029 Ga0105248_10000029209 179
427 3300009177 Ga0105248_10056147 Ga0105248_100561475 179
428 3300009177 Ga0105248_10123446 Ga0105248_101234462 179
429 3300009177 Ga0105248_10805215 Ga0105248_108052151 179
430 3300009545 Ga0105237_10035288 Ga0105237_100352882 179
431 3300009553 Ga0105249_10000016 Ga0105249_10000016201 179
432 3300009553 Ga0105249_10000024 Ga0105249_10000024205 179
433 3300009553 Ga0105249_10014933 Ga0105249_100149332 179
434 3300012513 Ga0157326_1003753 Ga0157326_10037532 179
435 3300013100 Ga0157373_10015634 Ga0157373_100156348 179
436 3300013102 Ga0157371_10100385 Ga0157371_101003852 179
437 3300013104 Ga0157370_10013637 Ga0157370_1001363712 179
438 3300013105 Ga0157369_10027424 Ga0157369_100274242 179
439 3300013105 Ga0157369_10493554 Ga0157369_104935542 179
440 3300013306 Ga0163162_10068722 Ga0163162_100687224 179
441 3300013307 Ga0157372_10029722 Ga0157372_100297229 179
442 3300014325 Ga0163163_10010448 Ga0163163_100104484 179
443 3300014325 Ga0163163_10015142 Ga0163163_100151422 179
444 3300014325 Ga0163163_10165587 Ga0163163_101655872 179
445 3300014326 Ga0157380_10072337 Ga0157380_100723374 179
446 3300014968 Ga0157379_10010222 Ga0157379_100102222 179
447 3300014968 Ga0157379_10017701 Ga0157379_1001770110 179
448 3300015690 Ga0183363_1003 Ga0183363_1003161 179
449 3300017792 Ga0163161_10000044 Ga0163161_1000004449 179
450 3300017792 Ga0163161_10047151 Ga0163161_100471514 179
451 3300025223 Ga0207672_1001095 Ga0207672_10010952 179
452 3300025298 Ga0209050_1040886 Ga0209050_10408862 179
453 3300025304 Ga0209257_1017646 Ga0209257_10176462 179
454 3300025315 Ga0207697_10003772 Ga0207697_1000377210 179
455 3300025321 Ga0207656_10004100 Ga0207656_100041002 179
456 3300025321 Ga0207656_10252561 Ga0207656_102525611 179
457 3300025735 Ga0207713_1002770 Ga0207713_100277011 179
458 3300025900 Ga0207710_10002774 Ga0207710_1000277412 179
459 3300025900 Ga0207710_10018608 Ga0207710_100186082 179
460 3300025900 Ga0207710_10059562 Ga0207710_100595622 179
461 3300025903 Ga0207680_10000008 Ga0207680_10000008453 179
462 3300025903 Ga0207680_10000253 Ga0207680_1000025323 179
463 3300025904 Ga0207647_10001877 Ga0207647_100018773 179
464 3300025909 Ga0207705_10013836 Ga0207705_100138367 179
465 3300025911 Ga0207654_10001270 Ga0207654_100012702 179
466 3300025913 Ga0207695_10008046 Ga0207695_100080462 179
467 3300025914 Ga0207671_10003457 Ga0207671_1000345718 179
468 3300025918 Ga0207662_10080808 Ga0207662_100808082 179
469 3300025919 Ga0207657_10146650 Ga0207657_101466502 179
470 3300025920 Ga0207649_10352116 Ga0207649_103521162 179
471 3300025923 Ga0207681_10000010 Ga0207681_10000010124 179
472 3300025923 Ga0207681_10000020 Ga0207681_1000002080 179
473 3300025924 Ga0207694_10003254 Ga0207694_100032542 179
474 3300025924 Ga0207694_10774217 Ga0207694_107742171 179
475 3300025925 Ga0207650_10000354 Ga0207650_1000035433 179
476 3300025925 Ga0207650_10093199 Ga0207650_100931991 179
477 3300025931 Ga0207644_10000007 Ga0207644_10000007110 179
478 3300025931 Ga0207644_10008404 Ga0207644_100084043 179
479 3300025932 Ga0207690_10285539 Ga0207690_102855392 179
480 3300025933 Ga0207706_10051291 Ga0207706_100512912 179
481 3300025936 Ga0207670_10032086 Ga0207670_100320865 179
482 3300025941 Ga0207711_10000004 Ga0207711_10000004297 179
483 3300025941 Ga0207711_10011919 Ga0207711_100119192 179
484 3300025941 Ga0207711_10076009 Ga0207711_100760092 179
485 3300025945 Ga0207679_10911472 Ga0207679_109114722 179
486 3300025949 Ga0207667_10000603 Ga0207667_1000060341 179
487 3300025961 Ga0207712_10000009 Ga0207712_10000009453 179
488 3300025961 Ga0207712_10000510 Ga0207712_1000051022 179
489 3300025961 Ga0207712_10018856 Ga0207712_100188562 179
490 3300025972 Ga0207668_10002028 Ga0207668_1000202812 179
491 3300025972 Ga0207668_10006578 Ga0207668_100065789 179
492 3300025981 Ga0207640_10367889 Ga0207640_103678892 179
493 3300025981 Ga0207640_10599555 Ga0207640_105995551 179
494 3300025986 Ga0207658_10001005 Ga0207658_1000100514 179
495 3300025986 Ga0207658_10001129 Ga0207658_1000112913 179
496 3300025986 Ga0207658_10001394 Ga0207658_1000139421 179
497 3300026035 Ga0207703_10002095 Ga0207703_100020959 179
498 3300026035 Ga0207703_10007252 Ga0207703_1000725214 179
499 3300026041 Ga0207639_10003338 Ga0207639_100033381 179
500 3300026041 Ga0207639_10021197 Ga0207639_100211978 179
501 3300026067 Ga0207678_10048806 Ga0207678_100488062 179
502 3300026078 Ga0207702_10000723 Ga0207702_1000072329 179
503 3300026088 Ga0207641_10000018 Ga0207641_1000001833 179
504 3300026088 Ga0207641_10000386 Ga0207641_1000038641 179
505 3300026088 Ga0207641_10056278 Ga0207641_100562785 179
506 3300026095 Ga0207676_10000276 Ga0207676_1000027614 179
507 3300026095 Ga0207676_10001455 Ga0207676_1000145513 179
508 3300026095 Ga0207676_10003438 Ga0207676_100034385 179
509 3300026116 Ga0207674_10066737 Ga0207674_100667373 179
510 3300026116 Ga0207674_10074826 Ga0207674_100748265 179
511 3300026118 Ga0207675_100000110 Ga0207675_10000011019 179
512 3300026118 Ga0207675_100000329 Ga0207675_10000032932 179
513 3300026118 Ga0207675_100689672 Ga0207675_1006896722 179
514 3300026142 Ga0207698_10006839 Ga0207698_100068392 179
515 3300026142 Ga0207698_10116692 Ga0207698_101166924 179
516 3300028379 Ga0268266_10000009 Ga0268266_10000009595 179
517 3300028379 Ga0268266_10241808 Ga0268266_102418084 179
518 3300028380 Ga0268265_10000058 Ga0268265_1000005861 179
519 3300028380 Ga0268265_10000097 Ga0268265_1000009781 179
520 3300028380 Ga0268265_10000149 Ga0268265_1000014981 179
521 3300028380 Ga0268265_10192792 Ga0268265_101927922 179
522 3300028381 Ga0268264_10000003 Ga0268264_100000031075 179
523 3300028381 Ga0268264_10000106 Ga0268264_10000106181 179
524 3300028786 Ga0307517_10231038 Ga0307517_102310382 179
525 3300031548 Ga0307408_100366558 Ga0307408_1003665582 179
526 3300031731 Ga0307405_10491549 Ga0307405_104915492 179
527 3300031824 Ga0307413_10034190 Ga0307413_100341902 179
528 3300031852 Ga0307410_10376873 Ga0307410_103768732 179
529 3300031901 Ga0307406_10138671 Ga0307406_101386714 179
530 3300031911 Ga0307412_10014907 Ga0307412_100149074 179
531 3300032004 Ga0307414_10356668 Ga0307414_103566681 179
532 3300032004 Ga0307414_10407337 Ga0307414_104073372 179
533 3300046460 Ga0495638_0000014 Ga0495638_0000014_201053_201592 179
534 3300046501 Ga0495607_0037621 Ga0495607_0037621_1567_2106 179
535 3300046506 Ga0495583_0000557 Ga0495583_0000557_19025_19564 179
536 3300046519 Ga0495632_0000446 Ga0495632_0000446_17386_17925 179
537 3300046519 Ga0495632_0188767 Ga0495632_0188767_374_913 179
538 3300046524 Ga0495648_0000021 Ga0495648_0000021_227093_227632 179
539 3300046558 Ga0495633_0010366 Ga0495633_0010366_3995_4534 179
540 3300046692 Ga0495671_0000028 Ga0495671_0000028_19148_19687 179
541 3300046692 Ga0495671_0131335 Ga0495671_0131335_398_943 179
542 3300047469 Ga0495673_0000058 Ga0495673_0000058_215304_215843 179
543 3300048905 Ga0496102_0025183 Ga0496102_0025183_2547_3086 179
544 3300048905 Ga0496102_0225699 Ga0496102_0225699_513_1052 179
545 3300048906 Ga0496103_0002036 Ga0496103_0002036_12381_12920 179
546 3300048906 Ga0496103_0014765 Ga0496103_0014765_1865_2404 179
547 3300048906 Ga0496103_0460315 Ga0496103_0460315_182_730 179
548 3300048907 Ga0496104_0125628 Ga0496104_0125628_894_1433 179
549 3300048908 Ga0496105_0066116 Ga0496105_0066116_1018_1557 179
550 3300048910 Ga0496107_0059004 Ga0496107_0059004_1313_1852 179
551 3300048919 Ga0496116_0020839 Ga0496116_0020839_889_1428 179
552 3300048920 Ga0496117_0004000 Ga0496117_0004000_12911_13450 179
553 3300048920 Ga0496117_0005912 Ga0496117_0005912_9337_9876 179
554 3300048920 Ga0496117_0009616 Ga0496117_0009616_1672_2211 179
555 3300048921 Ga0496118_0002183 Ga0496118_0002183_4077_4616 179
556 3300048921 Ga0496118_0002784 Ga0496118_0002784_11166_11705 179
557 3300048921 Ga0496118_0030499 Ga0496118_0030499_2419_2958 179
558 3300048926 Ga0496123_0134808 Ga0496123_0134808_623_1162 179
559 3300048927 Ga0496124_0060812 Ga0496124_0060812_678_1217 179
560 3300048929 Ga0496126_0072263 Ga0496126_0072263_894_1439 179
561 3300053094 Ga0500566_0015005 Ga0500566_0015005_2183_2722 179
562 3300053120 Ga0500597_002858 Ga0500597_002858_927_1466 179
563 3300053157 Ga0500624_000004 Ga0500624_000004_83099_83638 179
564 3300053157 Ga0500624_000095 Ga0500624_000095_20643_21188 179
565 3300053177 Ga0500636_0004155 Ga0500636_0004155_3615_4160 179
566 3300053178 Ga0500637_0000454 Ga0500637_0000454_10598_11137 179
567 2162886006 SwRhRL3b_contig_2766702 SwRhRL3b_0922.00000800 180
568 3300001989 JGI24739J22299_10006876 JGI24739J22299_100068767 180
569 3300001990 JGI24737J22298_10076137 JGI24737J22298_100761372 180
570 3300002075 JGI24738J21930_10020685 JGI24738J21930_100206852 180
571 3300002076 JGI24749J21850_1000179 JGI24749J21850_10001794 180
572 3300002459 JGI24751J29686_10000022 JGI24751J29686_1000002214 180
573 3300003214 JGI25165J46597_1000010 JGI25165J46597_100001018 180
574 3300003781 Ga0055536_1002944 Ga0055536_10029447 180
575 3300003781 Ga0055536_1019463 Ga0055536_10194634 180
576 3300003784 Ga0055534_1014749 Ga0055534_10147492 180
577 3300003791 Ga0055530_10000203 Ga0055530_1000020328 180
578 3300003794 Ga0055531_10005683 Ga0055531_100056836 180
579 3300003794 Ga0055531_10006693 Ga0055531_100066932 180
580 3300005295 Ga0065707_10082321 Ga0065707_100823213 180
581 3300005295 Ga0065707_10250722 Ga0065707_102507222 180
582 3300005295 Ga0065707_10316426 Ga0065707_103164262 180
583 3300005327 Ga0070658_10100600 Ga0070658_101006002 180
584 3300005327 Ga0070658_10359976 Ga0070658_103599761 180
585 3300005331 Ga0070670_100000006 Ga0070670_100000006273 180
586 3300005331 Ga0070670_100002325 Ga0070670_1000023258 180
587 3300005334 Ga0068869_100725405 Ga0068869_1007254052 180
588 3300005337 Ga0070682_100509515 Ga0070682_1005095151 180
589 3300005339 Ga0070660_100309086 Ga0070660_1003090862 180
590 3300005344 Ga0070661_100374564 Ga0070661_1003745642 180
591 3300005347 Ga0070668_100002152 Ga0070668_10000215212 180
592 3300005353 Ga0070669_100000036 Ga0070669_100000036111 180
593 3300005353 Ga0070669_100049847 Ga0070669_1000498472 180
594 3300005355 Ga0070671_100000273 Ga0070671_1000002738 180
595 3300005364 Ga0070673_100617176 Ga0070673_1006171762 180
596 3300005366 Ga0070659_100727003 Ga0070659_1007270031 180
597 3300005367 Ga0070667_100000298 Ga0070667_1000002981 180
598 3300005367 Ga0070667_100000398 Ga0070667_10000039825 180
599 3300005367 Ga0070667_100002347 Ga0070667_1000023474 180
600 3300005458 Ga0070681_11001110 Ga0070681_110011101 180
601 3300005459 Ga0068867_100169110 Ga0068867_1001691102 180
602 3300005530 Ga0070679_100199935 Ga0070679_1001999352 180
603 3300005530 Ga0070679_100671658 Ga0070679_1006716582 180
604 3300005539 Ga0068853_100016381 Ga0068853_1000163815 180
605 3300005539 Ga0068853_100467353 Ga0068853_1004673532 180
606 3300005539 Ga0068853_100894298 Ga0068853_1008942982 180
607 3300005548 Ga0070665_100332902 Ga0070665_1003329022 180
608 3300005548 Ga0070665_100511047 Ga0070665_1005110471 180
609 3300005563 Ga0068855_100000667 Ga0068855_10000066720 180
610 3300005563 Ga0068855_101055868 Ga0068855_1010558681 180
611 3300005577 Ga0068857_100380072 Ga0068857_1003800722 180
612 3300005577 Ga0068857_100555250 Ga0068857_1005552502 180
613 3300005578 Ga0068854_100008336 Ga0068854_1000083368 180
614 3300005578 Ga0068854_100083318 Ga0068854_1000833182 180
615 3300005578 Ga0068854_100908063 Ga0068854_1009080632 180
616 3300005614 Ga0068856_100100701 Ga0068856_1001007012 180
617 3300005616 Ga0068852_100086066 Ga0068852_1000860662 180
618 3300005617 Ga0068859_100007071 Ga0068859_1000070714 180
619 3300005617 Ga0068859_100028197 Ga0068859_1000281976 180
620 3300005618 Ga0068864_100000014 Ga0068864_10000001440 180
621 3300005618 Ga0068864_100001484 Ga0068864_10000148414 180
622 3300005618 Ga0068864_100009598 Ga0068864_1000095982 180
623 3300005719 Ga0068861_100031375 Ga0068861_1000313754 180
624 3300005841 Ga0068863_100015329 Ga0068863_1000153295 180
625 3300005841 Ga0068863_100025444 Ga0068863_1000254441 180
626 3300005842 Ga0068858_100000487 Ga0068858_1000004875 180
627 3300005842 Ga0068858_100000957 Ga0068858_10000095731 180
628 3300005842 Ga0068858_100001582 Ga0068858_10000158210 180
629 3300005843 Ga0068860_100000143 Ga0068860_10000014334 180
630 3300005843 Ga0068860_100000412 Ga0068860_1000004122 180
631 3300005843 Ga0068860_100001278 Ga0068860_10000127824 180
632 3300005844 Ga0068862_100000007 Ga0068862_100000007271 180
633 3300005844 Ga0068862_100000014 Ga0068862_10000001494 180
634 3300005844 Ga0068862_100000810 Ga0068862_10000081022 180
635 3300005844 Ga0068862_100096973 Ga0068862_1000969732 180
636 3300005844 Ga0068862_100292157 Ga0068862_1002921573 180
637 3300005937 Ga0081455_10000405 Ga0081455_1000040550 180
638 3300006051 Ga0075364_10061051 Ga0075364_100610514 180
639 3300006195 Ga0075366_10104846 Ga0075366_101048462 180
640 3300006237 Ga0097621_100193783 Ga0097621_1001937833 180
641 3300006237 Ga0097621_100385789 Ga0097621_1003857891 180
642 3300006353 Ga0075370_10026022 Ga0075370_100260222 180
643 3300006358 Ga0068871_100315503 Ga0068871_1003155032 180
644 3300006358 Ga0068871_100784643 Ga0068871_1007846432 180
645 3300006931 Ga0097620_100007071 Ga0097620_1000070714 180
646 3300006931 Ga0097620_100028198 Ga0097620_1000281986 180
647 3300009093 Ga0105240_10110084 Ga0105240_101100842 180
648 3300009098 Ga0105245_10005729 Ga0105245_100057296 180
649 3300009174 Ga0105241_10640398 Ga0105241_106403982 180
650 3300009177 Ga0105248_10000113 Ga0105248_1000011336 180
651 3300009177 Ga0105248_10144662 Ga0105248_101446622 180
652 3300009177 Ga0105248_10222120 Ga0105248_102221204 180
653 3300009551 Ga0105238_10116166 Ga0105238_101161664 180
654 3300009551 Ga0105238_10226626 Ga0105238_102266263 180
655 3300009553 Ga0105249_10000002 Ga0105249_10000002304 180
656 3300009553 Ga0105249_10687866 Ga0105249_106878662 180
657 3300010375 Ga0105239_10145283 Ga0105239_101452835 180
658 3300010375 Ga0105239_10332665 Ga0105239_103326652 180
659 3300010375 Ga0105239_11184609 Ga0105239_111846091 180
660 3300013296 Ga0157374_10033722 Ga0157374_100337222 180
661 3300013297 Ga0157378_10014680 Ga0157378_100146802 180
662 3300013297 Ga0157378_10131445 Ga0157378_101314452 180
663 3300013297 Ga0157378_10247544 Ga0157378_102475442 180
664 3300013306 Ga0163162_10001555 Ga0163162_1000155519 180
665 3300013306 Ga0163162_10609628 Ga0163162_106096282 180
666 3300013308 Ga0157375_10840863 Ga0157375_108408632 180
667 3300014326 Ga0157380_10000042 Ga0157380_1000004246 180
668 3300014326 Ga0157380_10009001 Ga0157380_100090014 180
669 3300014326 Ga0157380_10098586 Ga0157380_100985862 180
670 3300017792 Ga0163161_10138163 Ga0163161_101381632 180
671 3300017792 Ga0163161_10614660 Ga0163161_106146602 180
672 3300021388 Ga0213875_10000820 Ga0213875_1000082015 180
673 3300025261 Ga0209233_1000044 Ga0209233_1000044465 180
674 3300025272 Ga0209455_1008948 Ga0209455_10089482 180
675 3300025291 Ga0209675_1000399 Ga0209675_100039936 180
676 3300025292 Ga0209676_1000358 Ga0209676_100035817 180
677 3300025292 Ga0209676_1000829 Ga0209676_100082912 180
678 3300025292 Ga0209676_1001005 Ga0209676_100100521 180
679 3300025294 Ga0209025_1017474 Ga0209025_10174743 180
680 3300025298 Ga0209050_1000437 Ga0209050_100043723 180
681 3300025298 Ga0209050_1020129 Ga0209050_10201293 180
682 3300025298 Ga0209050_1040150 Ga0209050_10401503 180
683 3300025304 Ga0209257_1000328 Ga0209257_100032834 180
684 3300025304 Ga0209257_1004831 Ga0209257_10048317 180
685 3300025304 Ga0209257_1007735 Ga0209257_10077359 180
686 3300025304 Ga0209257_1046897 Ga0209257_10468972 180
687 3300025904 Ga0207647_10132150 Ga0207647_101321502 180
688 3300025913 Ga0207695_10091029 Ga0207695_100910293 180
689 3300025919 Ga0207657_10262423 Ga0207657_102624232 180
690 3300025923 Ga0207681_10000001 Ga0207681_1000000137 180
691 3300025923 Ga0207681_10004630 Ga0207681_1000463012 180
692 3300025923 Ga0207681_10625461 Ga0207681_106254611 180
693 3300025924 Ga0207694_10048382 Ga0207694_100483822 180
694 3300025924 Ga0207694_10104889 Ga0207694_101048894 180
695 3300025924 Ga0207694_10156022 Ga0207694_101560223 180
696 3300025925 Ga0207650_10000023 Ga0207650_1000002337 180
697 3300025925 Ga0207650_10002062 Ga0207650_100020623 180
698 3300025927 Ga0207687_10001020 Ga0207687_100010207 180
699 3300025931 Ga0207644_10000283 Ga0207644_1000028334 180
700 3300025933 Ga0207706_10010038 Ga0207706_100100388 180
701 3300025941 Ga0207711_10003287 Ga0207711_1000328715 180
702 3300025941 Ga0207711_10116915 Ga0207711_101169152 180
703 3300025941 Ga0207711_10142200 Ga0207711_101422004 180
704 3300025945 Ga0207679_10802779 Ga0207679_108027792 180
705 3300025949 Ga0207667_10024985 Ga0207667_100249859 180
706 3300025949 Ga0207667_10823067 Ga0207667_108230672 180
707 3300025949 Ga0207667_10853012 Ga0207667_108530122 180
708 3300025961 Ga0207712_10000002 Ga0207712_10000002675 180
709 3300025961 Ga0207712_10458833 Ga0207712_104588332 180
710 3300025972 Ga0207668_10001363 Ga0207668_100013634 180
711 3300025972 Ga0207668_10039903 Ga0207668_100399032 180
712 3300025981 Ga0207640_10020510 Ga0207640_100205102 180
713 3300025981 Ga0207640_10384262 Ga0207640_103842621 180
714 3300025981 Ga0207640_10798783 Ga0207640_107987832 180
715 3300025986 Ga0207658_10000026 Ga0207658_10000026153 180
716 3300025986 Ga0207658_10000254 Ga0207658_100002541 180
717 3300025986 Ga0207658_10001522 Ga0207658_100015224 180
718 3300026035 Ga0207703_10000108 Ga0207703_1000010856 180
719 3300026035 Ga0207703_10000845 Ga0207703_100008452 180
720 3300026035 Ga0207703_10001794 Ga0207703_1000179410 180
721 3300026041 Ga0207639_10035037 Ga0207639_100350375 180
722 3300026041 Ga0207639_10137934 Ga0207639_101379342 180
723 3300026078 Ga0207702_10093967 Ga0207702_100939672 180
724 3300026088 Ga0207641_10000346 Ga0207641_1000034631 180
725 3300026088 Ga0207641_10013111 Ga0207641_100131112 180
726 3300026088 Ga0207641_10017585 Ga0207641_100175852 180
727 3300026095 Ga0207676_10000017 Ga0207676_1000001739 180
728 3300026095 Ga0207676_10000137 Ga0207676_1000013766 180
729 3300026095 Ga0207676_10022019 Ga0207676_100220196 180
730 3300026116 Ga0207674_10010611 Ga0207674_1001061110 180
731 3300026116 Ga0207674_10659422 Ga0207674_106594222 180
732 3300026118 Ga0207675_100000280 Ga0207675_10000028031 180
733 3300026121 Ga0207683_10196466 Ga0207683_101964662 180
734 3300026142 Ga0207698_10384683 Ga0207698_103846832 180
735 3300028379 Ga0268266_10399215 Ga0268266_103992152 180
736 3300028380 Ga0268265_10000002 Ga0268265_1000000237 180
737 3300028380 Ga0268265_10000607 Ga0268265_1000060738 180
738 3300028380 Ga0268265_10001059 Ga0268265_1000105916 180
739 3300028380 Ga0268265_10121344 Ga0268265_101213442 180
740 3300028381 Ga0268264_10000076 Ga0268264_1000007634 180
741 3300028381 Ga0268264_10000083 Ga0268264_100000831 180
742 3300028381 Ga0268264_10000634 Ga0268264_1000063433 180
743 3300028786 Ga0307517_10013945 Ga0307517_100139455 180
744 3300031456 Ga0307513_10049071 Ga0307513_100490714 180
745 3300031507 Ga0307509_10042055 Ga0307509_100420556 180
746 3300031548 Ga0307408_100008545 Ga0307408_1000085452 180
747 3300031548 Ga0307408_100008592 Ga0307408_1000085926 180
748 3300031548 Ga0307408_100409157 Ga0307408_1004091572 180
749 3300031548 Ga0307408_100633645 Ga0307408_1006336452 180
750 3300031548 Ga0307408_100676087 Ga0307408_1006760871 180
751 3300031616 Ga0307508_10005032 Ga0307508_100050322 180
752 3300031731 Ga0307405_10041988 Ga0307405_100419883 180
753 3300031731 Ga0307405_10137760 Ga0307405_101377602 180
754 3300031731 Ga0307405_10285238 Ga0307405_102852383 180
755 3300031731 Ga0307405_10355492 Ga0307405_103554921 180
756 3300031731 Ga0307405_10574013 Ga0307405_105740132 180
757 3300031901 Ga0307406_10002345 Ga0307406_100023454 180
758 3300031901 Ga0307406_10400810 Ga0307406_104008102 180
759 3300031911 Ga0307412_10003855 Ga0307412_100038553 180
760 3300031911 Ga0307412_10026822 Ga0307412_100268222 180
761 3300031911 Ga0307412_10052383 Ga0307412_100523832 180
762 3300031911 Ga0307412_10064718 Ga0307412_100647184 180
763 3300031911 Ga0307412_10065516 Ga0307412_100655162 180
764 3300031911 Ga0307412_10157651 Ga0307412_101576512 180
765 3300032002 Ga0307416_100110021 Ga0307416_1001100212 180
766 3300032002 Ga0307416_101011654 Ga0307416_1010116542 180
767 3300032004 Ga0307414_10000239 Ga0307414_1000023919 180
768 3300032004 Ga0307414_10009181 Ga0307414_100091813 180
769 3300032004 Ga0307414_10018842 Ga0307414_100188423 180
770 3300032004 Ga0307414_10023279 Ga0307414_100232794 180
771 3300032004 Ga0307414_10419870 Ga0307414_104198702 180
772 3300032004 Ga0307414_10503440 Ga0307414_105034402 180
773 3300032005 Ga0307411_10049357 Ga0307411_100493572 180
774 3300035695 Ga0373927_0096292 Ga0373927_0096292_880_1422 180
775 3300037853 Ga0436364_1409528 Ga0436364_1409528_8096_8641 180
776 3300038705 Ga0237819_03124 Ga0237819_03124_2358_2903 180
777 3300039450 Ga0436363_0901981 Ga0436363_0901981_234_776 180
778 3300041443 Ga0451789_0057199 Ga0451789_0057199_46_588 180
779 3300041459 Ga0451800_0410130 Ga0451800_0410130_91_633 180
780 3300041460 Ga0451802_2041707 Ga0451802_2041707_95_637 180
781 3300046457 Ga0495590_0280425 Ga0495590_0280425_27_572 180
782 3300046460 Ga0495638_0000732 Ga0495638_0000732_34639_35181 180
783 3300046460 Ga0495638_0004896 Ga0495638_0004896_8266_8811 180
784 3300046460 Ga0495638_0054875 Ga0495638_0054875_1175_1717 180
785 3300046475 Ga0495639_0354264 Ga0495639_0354264_74_616 180
786 3300046492 Ga0495585_0039871 Ga0495585_0039871_1994_2536 180
787 3300046506 Ga0495583_0001125 Ga0495583_0001125_15991_16536 180
788 3300046506 Ga0495583_0015490 Ga0495583_0015490_3421_3963 180
789 3300046507 Ga0495606_0000259 Ga0495606_0000259_79698_80240 180
790 3300046520 Ga0495637_0020660 Ga0495637_0020660_1310_1852 180
791 3300046520 Ga0495637_0078074 Ga0495637_0078074_592_1134 180
792 3300046522 Ga0495643_0044540 Ga0495643_0044540_1857_2399 180
793 3300046524 Ga0495648_0020266 Ga0495648_0020266_4046_4588 180
794 3300046524 Ga0495648_0065607 Ga0495648_0065607_1439_1984 180
795 3300046530 Ga0495654_0001113 Ga0495654_0001113_11093_11635 180
796 3300046530 Ga0495654_0096529 Ga0495654_0096529_348_890 180
797 3300046538 Ga0495609_0294533 Ga0495609_0294533_13_555 180
798 3300046542 Ga0495597_0013437 Ga0495597_0013437_1216_1758 180
799 3300046557 Ga0495622_0021745 Ga0495622_0021745_1682_2224 180
800 3300046557 Ga0495622_0067429 Ga0495622_0067429_615_1166 180
801 3300046616 Ga0495668_0000387 Ga0495668_0000387_35157_35705 180
802 3300046616 Ga0495668_0012858 Ga0495668_0012858_3565_4107 180
803 3300046616 Ga0495668_0017893 Ga0495668_0017893_1736_2278 180
804 3300046616 Ga0495668_0042229 Ga0495668_0042229_317_859 180
805 3300046616 Ga0495668_0069004 Ga0495668_0069004_1007_1549 180
806 3300046660 Ga0495625_0000031 Ga0495625_0000031_105461_106003 180
807 3300046660 Ga0495625_0002611 Ga0495625_0002611_17112_17654 180
808 3300046660 Ga0495625_0013677 Ga0495625_0013677_5538_6080 180
809 3300046665 Ga0495661_0092822 Ga0495661_0092822_796_1341 180
810 3300046684 Ga0495669_0041952 Ga0495669_0041952_30_572 180
811 3300046691 Ga0495670_0002882 Ga0495670_0002882_153_695 180
812 3300046691 Ga0495670_0011648 Ga0495670_0011648_965_1510 180
813 3300046691 Ga0495670_0014291 Ga0495670_0014291_1115_1657 180
814 3300046692 Ga0495671_0007026 Ga0495671_0007026_2405_2956 180
815 3300046692 Ga0495671_0015741 Ga0495671_0015741_2569_3114 180
816 3300046692 Ga0495671_0361940 Ga0495671_0361940_50_595 180
817 3300046694 Ga0495649_0228736 Ga0495649_0228736_363_905 180
818 3300046794 Ga0495589_0076479 Ga0495589_0076479_77_619 180
819 3300046810 Ga0495660_0164844 Ga0495660_0164844_58_600 180
820 3300047445 Ga0495677_0003536 Ga0495677_0003536_4346_4888 180
821 3300047469 Ga0495673_0013172 Ga0495673_0013172_417_962 180
822 3300047472 Ga0495686_0000139 Ga0495686_0000139_115589_116134 180
823 3300047472 Ga0495686_0000523 Ga0495686_0000523_51810_52352 180
824 3300047472 Ga0495686_0001582 Ga0495686_0001582_6969_7511 180
825 3300047472 Ga0495686_0010788 Ga0495686_0010788_3221_3763 180
826 3300048905 Ga0496102_0000034 Ga0496102_0000034_163039_163581 180
827 3300048905 Ga0496102_0832373 Ga0496102_0832373_267_812 180
828 3300048906 Ga0496103_0000026 Ga0496103_0000026_163039_163581 180
829 3300048918 Ga0496115_0256703 Ga0496115_0256703_690_1232 180
830 3300048919 Ga0496116_0002308 Ga0496116_0002308_7126_7668 180
831 3300048919 Ga0496116_0290060 Ga0496116_0290060_199_741 180
832 3300048920 Ga0496117_0000072 Ga0496117_0000072_187579_188121 180
833 3300048920 Ga0496117_0061114 Ga0496117_0061114_1551_2096 180
834 3300048921 Ga0496118_0000030 Ga0496118_0000030_50246_50896 180
835 3300048922 Ga0496119_0011873 Ga0496119_0011873_1176_1826 180
836 3300048925 Ga0496122_0000359 Ga0496122_0000359_60452_61003 180
837 3300048926 Ga0496123_0002200 Ga0496123_0002200_4241_4792 180
838 3300048926 Ga0496123_0071430 Ga0496123_0071430_1591_2136 180
839 3300048927 Ga0496124_0000061 Ga0496124_0000061_50246_50896 180
840 3300048927 Ga0496124_0210206 Ga0496124_0210206_741_1286 180
841 3300048928 Ga0496125_0180549 Ga0496125_0180549_365_910 180
842 3300048928 Ga0496125_0342270 Ga0496125_0342270_307_852 180
843 3300048928 Ga0496125_0424528 Ga0496125_0424528_157_699 180
844 3300048929 Ga0496126_0142042 Ga0496126_0142042_1430_1981 180
845 3300049459 Ga0495678_067352 Ga0495678_067352_484_1026 180
846 3300049460 Ga0495682_0005472 Ga0495682_0005472_2061_2606 180
847 3300049513 Ga0501290_010424 Ga0501290_010424_546_1088 180
848 3300049515 Ga0501292_000003 Ga0501292_000003_158729_159271 180
849 3300049516 Ga0501293_014882 Ga0501293_014882_145_687 180
850 3300049517 Ga0501294_001507 Ga0501294_001507_616_1158 180
851 3300049523 Ga0501300_000435 Ga0501300_000435_5323_5865 180
852 3300049523 Ga0501300_006309 Ga0501300_006309_144_686 180
853 3300049568 Ga0501031_0063333 Ga0501031_0063333_1533_2084 180
854 3300049569 Ga0501032_0010092 Ga0501032_0010092_4579_5130 180
855 3300049569 Ga0501032_0116551 Ga0501032_0116551_260_826 180
856 3300049570 Ga0501033_0086928 Ga0501033_0086928_434_1078 180
857 3300049570 Ga0501033_0108351 Ga0501033_0108351_97_648 180
858 3300049571 Ga0501034_0008195 Ga0501034_0008195_6981_7526 180
859 3300049571 Ga0501034_0027966 Ga0501034_0027966_5082_5633 180
860 3300049572 Ga0501036_0147928 Ga0501036_0147928_84_635 180
861 3300049572 Ga0501036_0515586 Ga0501036_0515586_278_922 180
862 3300049573 Ga0501037_0635499 Ga0501037_0635499_54_698 180
863 3300049574 Ga0501038_0022352 Ga0501038_0022352_1031_1582 180
864 3300049575 Ga0501039_0530071 Ga0501039_0530071_129_773 180
865 3300049579 Ga0501043_0057451 Ga0501043_0057451_1254_1898 180
866 3300049579 Ga0501043_0135872 Ga0501043_0135872_1200_1766 180
867 3300049580 Ga0501046_0132703 Ga0501046_0132703_1142_1708 180
868 3300049581 Ga0501047_0001517 Ga0501047_0001517_12512_13078 180
869 3300049582 Ga0501048_0119258 Ga0501048_0119258_799_1365 180
870 3300049649 Ga0501198_038966 Ga0501198_038966_31_576 180
871 3300049652 Ga0501202_003716 Ga0501202_003716_212_754 180
872 3300049653 Ga0501206_004721 Ga0501206_004721_537_1079 180
873 3300049654 Ga0501207_014963 Ga0501207_014963_597_1139 180
874 3300049662 Ga0501222_000605 Ga0501222_000605_2056_2598 180
875 3300049663 Ga0501223_000090 Ga0501223_000090_7086_7631 180
876 3300049663 Ga0501223_002495 Ga0501223_002495_2631_3173 180
877 3300049664 Ga0501224_000025 Ga0501224_000025_25523_26068 180
878 3300049664 Ga0501224_001119 Ga0501224_001119_1696_2238 180
879 3300049665 Ga0501227_002177 Ga0501227_002177_2890_3432 180
880 3300049668 Ga0501233_000238 Ga0501233_000238_3934_4479 180
881 3300049669 Ga0501235_043485 Ga0501235_043485_226_771 180
882 3300049674 Ga0501242_023965 Ga0501242_023965_12_554 180
883 3300049679 Ga0501249_000067 Ga0501249_000067_8410_8976 180
884 3300049686 Ga0501257_000019 Ga0501257_000019_31248_31790 180
885 3300049686 Ga0501257_009301 Ga0501257_009301_728_1270 180
886 3300049688 Ga0501259_000022 Ga0501259_000022_21099_21641 180
887 3300049690 Ga0501261_000007 Ga0501261_000007_2662_3204 180
888 3300049704 Ga0501221_002092 Ga0501221_002092_2147_2689 180
889 3300049704 Ga0501221_017434 Ga0501221_017434_12_557 180
890 3300049705 Ga0501225_0000115 Ga0501225_0000115_15263_15808 180
891 3300049707 Ga0501234_000307 Ga0501234_000307_6096_6641 180
892 3300049708 Ga0501245_017803 Ga0501245_017803_275_817 180
893 3300049775 Ga0501279_000082 Ga0501279_000082_2636_3178 180
894 3300049776 Ga0501280_000047 Ga0501280_000047_2646_3188 180
895 3300049776 Ga0501280_000638 Ga0501280_000638_2412_2954 180
896 3300049777 Ga0501281_00165 Ga0501281_00165_7101_7643 180
897 3300049778 Ga0501282_000814 Ga0501282_000814_394_936 180
898 3300049822 Ga0501035_0076990 Ga0501035_0076990_1876_2427 180
899 3300049822 Ga0501035_0296075 Ga0501035_0296075_293_844 180
900 3300049823 Ga0501044_0153977 Ga0501044_0153977_1314_1865 180
901 3300049823 Ga0501044_0232027 Ga0501044_0232027_624_1175 180
902 3300049853 Ga0501226_000020 Ga0501226_000020_25326_25871 180
903 3300053087 Ga0500643_000293 Ga0500643_000293_1372_1914 180
904 3300053087 Ga0500643_000709 Ga0500643_000709_16483_17025 180
905 3300053087 Ga0500643_000824 Ga0500643_000824_17586_18128 180
906 3300053087 Ga0500643_000847 Ga0500643_000847_16756_17307 180
907 3300053087 Ga0500643_017589 Ga0500643_017589_1401_1946 180
908 3300053091 Ga0500647_0067941 Ga0500647_0067941_858_1400 180
909 3300053092 Ga0500583_0330907 Ga0500583_0330907_63_605 180
910 3300053093 Ga0500651_0071175 Ga0500651_0071175_1166_1708 180
911 3300053094 Ga0500566_0050704 Ga0500566_0050704_435_977 180
912 3300053096 Ga0500641_0062406 Ga0500641_0062406_814_1356 180
913 3300053103 Ga0500555_000708 Ga0500555_000708_6239_6784 180
914 3300053108 Ga0500562_128708 Ga0500562_128708_110_652 180
915 3300053116 Ga0500592_000543 Ga0500592_000543_1741_2283 180
916 3300053116 Ga0500592_000812 Ga0500592_000812_668_1210 180
917 3300053116 Ga0500592_004915 Ga0500592_004915_813_1355 180
918 3300053116 Ga0500592_015284 Ga0500592_015284_616_1173 180
919 3300053116 Ga0500592_023894 Ga0500592_023894_240_782 180
920 3300053118 Ga0500594_0008100 Ga0500594_0008100_453_998 180
921 3300053118 Ga0500594_0020557 Ga0500594_0020557_1025_1576 180
922 3300053119 Ga0500595_047484 Ga0500595_047484_380_922 180
923 3300053123 Ga0500614_029717 Ga0500614_029717_358_900 180
924 3300053125 Ga0500618_011159 Ga0500618_011159_425_967 180
925 3300053133 Ga0500655_000411 Ga0500655_000411_7709_8251 180
926 3300053134 Ga0500658_0018148 Ga0500658_0018148_1715_2257 180
927 3300053134 Ga0500658_0027407 Ga0500658_0027407_1366_1908 180
928 3300053134 Ga0500658_0168690 Ga0500658_0168690_301_867 180
929 3300053136 Ga0500559_0001245 Ga0500559_0001245_13972_14514 180
930 3300053136 Ga0500559_0019742 Ga0500559_0019742_2292_2834 180
931 3300053136 Ga0500559_0026803 Ga0500559_0026803_1467_2009 180
932 3300053139 Ga0500568_0025795 Ga0500568_0025795_1229_1771 180
933 3300053139 Ga0500568_0047498 Ga0500568_0047498_843_1385 180
934 3300053140 Ga0500573_0000041 Ga0500573_0000041_79440_79982 180
935 3300053148 Ga0500590_002280 Ga0500590_002280_5676_6218 180
936 3300053151 Ga0500604_0030240 Ga0500604_0030240_298_840 180
937 3300053153 Ga0500616_0112681 Ga0500616_0112681_476_1018 180
938 3300053153 Ga0500616_0145388 Ga0500616_0145388_182_724 180
939 3300053157 Ga0500624_016035 Ga0500624_016035_498_1040 180
940 3300053158 Ga0500627_0000056 Ga0500627_0000056_25134_25691 180
941 3300053158 Ga0500627_0000374 Ga0500627_0000374_3192_3734 180
942 3300053158 Ga0500627_0000418 Ga0500627_0000418_4237_4779 180
943 3300053158 Ga0500627_0036703 Ga0500627_0036703_203_745 180
944 3300053158 Ga0500627_0105744 Ga0500627_0105744_691_1233 180
945 3300053158 Ga0500627_0155528 Ga0500627_0155528_30_572 180
946 3300053158 Ga0500627_0165050 Ga0500627_0165050_137_721 180
947 3300053177 Ga0500636_0043398 Ga0500636_0043398_2033_2575 180
948 3300053177 Ga0500636_0135147 Ga0500636_0135147_765_1307 180
949 3300053724 Ga0500570_000528 Ga0500570_000528_5267_5809 180
950 3300053727 Ga0500611_001307 Ga0500611_001307_837_1379 180
951 3300053730 Ga0500645_103965 Ga0500645_103965_234_776 180
952 3300053737 Ga0500601_012482 Ga0500601_012482_166_708 180
953 iso_pu_bacteria 2643221541 2643727822 180
954 iso_pu_bacteria 2643221605 2644038937 180
955 iso_pu_bacteria 2643221606 2644043228 180
956 iso_pu_bacteria 2643221671 2644395341 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

40

117

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.9027 2 168
2rfl-assembly2.cif.gz_B crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8991 2 168
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8981 2 168
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8925 2 168
2rfl-assembly6.cif.gz_F crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8886 2 166
ID Description Score Start End Superfamily
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9205 8 169 3.40.50.1240
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9094 8 169 3.40.50.1240
4hbzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8769 2 168 3.40.50.1240
2rflF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8687 2 166 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8596 2 168 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7H0GC17-F1-model_v4 deleted 0.9809 1 171
AF-A0A537MJY4-F1-model_v4 Histidine phosphatase family protein 0.9761 1 171
AF-A0A7H0GC17-F1-model_v4 deleted 0.9752 1 171
AF-A0A1L3JAK2-F1-model_v4 Histidine phosphatase family protein 0.9738 1 180
AF-A0A1B2AGG6-F1-model_v4 Histidine phosphatase superfamily (Branch 1) 0.9685 1 177

Feature Viewer

pLDDT pTM Quality
95.74 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map