F486639

General Info

Members Datasets Scaffolds Average Seq Length
952 585 1904 203

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056681323|8056688955
Length 220
Sequence LIGPTPKANNKFEEETSMKLYYSPGACSLSPHIALLEAGLPYELVKVDVRAKKLENGDDFLQVNPKGQVPALRLDSGELVTEGPVIVQMIADKAADKNLAPAQRSAERYKLLEWLNFITTELHKNFSPLFAPVLSDDTKAFFKDRLMGKFKYVDSQLAGRDYLLGNQFTVADGYLFTMLTWADRMKFDLSGLPNLLAYKARVAARPKVQEALAKEGLKAA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
197 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
204 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
205 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
245 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
246 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
247 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
248 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
249 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
250 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
251 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
252 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
253 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
254 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
255 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
270 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
294 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
326 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
329 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
330 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
331 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
332 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
357 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
362 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
386 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
387 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
388 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
389 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
390 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
391 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
392 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
393 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
394 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
395 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
396 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
397 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
398 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
399 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
400 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
401 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
402 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
403 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
404 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
405 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
406 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
407 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
408 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
409 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
410 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
411 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
412 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
413 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
414 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
415 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
416 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
417 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
418 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
419 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
422 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
423 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
424 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
425 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
426 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
427 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
428 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
429 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
430 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
431 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
432 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
433 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
434 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
435 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
436 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
437 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
438 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
439 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
440 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
441 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
442 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
443 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
444 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
445 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
446 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
447 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
448 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
449 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
450 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
451 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
452 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
453 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
454 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
455 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
456 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
457 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
458 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
459 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
460 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
461 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
462 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
463 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
464 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
465 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
466 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
467 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
468 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
469 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
470 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
471 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
472 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
473 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
474 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
475 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
476 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
477 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
478 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
479 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
480 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
481 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
482 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
483 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
484 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
485 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
486 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
487 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
488 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
489 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
490 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
491 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
492 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
493 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
494 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
495 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
496 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
497 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
498 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
499 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
500 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
501 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
502 2922368715
503 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
504 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
505 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
506 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
507 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
508 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
509 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
510 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
511 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
512 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
513 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
514 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
515 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
516 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
517 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
518 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
519 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
520 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
521 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
522 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
523 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
524 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
525 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
526 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
527 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
528 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
529 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
530 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
531 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
532 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
533 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
534 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
535 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
536 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
537 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
538 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
539 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
540 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
541 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
542 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
543 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
544 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
545 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
546 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
547 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
548 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
549 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
550 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
551 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
552 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
553 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
554 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
555 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
556 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
557 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
558 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
559 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
560 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
561 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
562 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
563 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
564 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
565 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
566 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
567 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
568 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
569 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
570 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
571 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
572 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
573 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
574 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
575 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
576 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
577 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
578 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
579 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
580 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
581 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
582 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
583 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
584 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
585 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.6
Metatranscriptomes 0.42
Isolates 15.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.6
Nodule 12.71
Rhizoplane 4.83
Rhizosphere 55.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10070279 3300001979 Bacteria 940
2 JGI24743J22301_10023047 3300001991 Bacteria 1197
3 JGI24735J21928_10118153 3300002067 Bacteria 763
4 JGI24750J21931_1022862 3300002070 Bacteria 885
5 JGI24745J21846_1026411 3300002073 Bacteria 692
6 JGI24033J26618_1009455 3300002155 Bacteria 1135
7 JGI25153J46596_10002687 3300003215 Bacteria 10145
8 JGI25153J46596_10027497 3300003215 Bacteria 1991
9 JGI25160J50197_1002508 3300003354 Bacteria 8524
10 JGI25160J50197_1013763 3300003354 Bacteria 2741
11 JGI25404J52841_10001084 3300003659 Bacteria 4566
12 JGI25404J52841_10049795 3300003659 Bacteria 881
13 JGI25404J52841_10064653 3300003659 Bacteria 765
14 Ga0055539_1001877 3300003752 Bacteria 3536
15 Ga0055539_1015542 3300003752 Bacteria 925
16 Ga0055524_1028043 3300003775 Bacteria 1695
17 Ga0055531_10004010 3300003794 Bacteria 9131
18 JGI25405J52794_10062418 3300003911 Bacteria 807
19 Ga0055543_1002823 3300004625 Bacteria 5492
20 Ga0065165_1001384 3300005262 Bacteria 26615
21 Ga0065165_1001884 3300005262 Bacteria 20242
22 Ga0065165_1018981 3300005262 Bacteria 2470
23 Ga0065707_10273844 3300005295 Bacteria 1064
24 Ga0070658_10410692 3300005327 Bacteria 1163
25 Ga0070658_10793941 3300005327 Bacteria 822
26 Ga0070676_10264009 3300005328 Bacteria 1154
27 Ga0070670_100292145 3300005331 Bacteria 1424
28 Ga0068869_100024100 3300005334 Bacteria 4213
29 Ga0070666_10081184 3300005335 Bacteria 2216
30 Ga0068868_100368121 3300005338 Bacteria 1234
31 Ga0068868_101144159 3300005338 Bacteria 717
32 Ga0070660_100172075 3300005339 Bacteria 1749
33 Ga0070660_100385894 3300005339 Bacteria 1157
34 Ga0070689_100071006 3300005340 Bacteria 2719
35 Ga0070689_100541942 3300005340 Bacteria 1001
36 Ga0070691_10325113 3300005341 Bacteria 847
37 Ga0070668_100087736 3300005347 Bacteria 2448
38 Ga0070675_100107631 3300005354 Bacteria 2354
39 Ga0070671_100027203 3300005355 Bacteria 4705
40 Ga0070671_100152948 3300005355 Bacteria 1948
41 Ga0070674_100030159 3300005356 Bacteria 3580
42 Ga0070674_100345721 3300005356 Bacteria 1200
43 Ga0070674_100751708 3300005356 Bacteria 838
44 Ga0070659_100215494 3300005366 Bacteria 1583
45 Ga0070659_100368753 3300005366 Bacteria 1207
46 Ga0070659_100531800 3300005366 Bacteria 1005
47 Ga0070659_100732305 3300005366 Bacteria 857
48 Ga0070667_100034414 3300005367 Bacteria 4238
49 Ga0070667_100077183 3300005367 Bacteria 2844
50 Ga0070667_100324031 3300005367 Bacteria 1391
51 Ga0070667_100414486 3300005367 Bacteria 1227
52 Ga0070709_10025076 3300005434 Bacteria 3519
53 Ga0070714_100154939 3300005435 Bacteria 2068
54 Ga0070714_100158138 3300005435 Bacteria 2048
55 Ga0070714_100273529 3300005435 Bacteria 1567
56 Ga0070714_100462159 3300005435 Bacteria 1207
57 Ga0070710_10007676 3300005437 Bacteria 5230
58 Ga0070710_10017497 3300005437 Bacteria 3670
59 Ga0070710_10350754 3300005437 Bacteria 977
60 Ga0070711_100030689 3300005439 Bacteria 3561
61 Ga0070705_100296465 3300005440 Bacteria 1157
62 Ga0070708_100814579 3300005445 Bacteria 878
63 Ga0070663_100037260 3300005455 Bacteria 3384
64 Ga0070663_100086966 3300005455 Bacteria 2309
65 Ga0070663_100332838 3300005455 Bacteria 1224
66 Ga0070663_100393936 3300005455 Bacteria 1131
67 Ga0070678_100074704 3300005456 Bacteria 2548
68 Ga0070678_100560341 3300005456 Bacteria 1015
69 Ga0070681_10320167 3300005458 Bacteria 1460
70 Ga0070681_10727242 3300005458 Bacteria 909
71 Ga0068867_100072410 3300005459 Bacteria 2579
72 Ga0068867_100103438 3300005459 Bacteria 2178
73 Ga0070685_10045784 3300005466 Bacteria 2510
74 Ga0070707_100590661 3300005468 Bacteria 1073
75 Ga0070698_101029749 3300005471 Bacteria 771
76 Ga0070699_100457330 3300005518 Bacteria 1157
77 Ga0070679_100062825 3300005530 Bacteria 3702
78 Ga0070697_100036552 3300005536 Bacteria 3967
79 Ga0068853_100191217 3300005539 Bacteria 1859
80 Ga0068853_100233952 3300005539 Bacteria 1682
81 Ga0070672_100234298 3300005543 Bacteria 1543
82 Ga0070672_100897753 3300005543 Bacteria 783
83 Ga0070686_100140531 3300005544 Bacteria 1680
84 Ga0070695_100241095 3300005545 Bacteria 1311
85 Ga0070693_100045107 3300005547 Bacteria 2497
86 Ga0070665_100052003 3300005548 Bacteria 4109
87 Ga0070665_100072030 3300005548 Bacteria 3463
88 Ga0070665_100170781 3300005548 Bacteria 2176
89 Ga0070704_100666831 3300005549 Bacteria 919
90 Ga0068855_100081565 3300005563 Bacteria 3749
91 Ga0068855_100147563 3300005563 Bacteria 2676
92 Ga0068855_100299849 3300005563 Bacteria 1780
93 Ga0068855_100305999 3300005563 Bacteria 1759
94 Ga0068857_100886721 3300005577 Bacteria 855
95 Ga0068854_100092286 3300005578 Bacteria 2255
96 Ga0068854_100554959 3300005578 Bacteria 975
97 Ga0068854_100996930 3300005578 Bacteria 741
98 Ga0068856_100044076 3300005614 Bacteria 4389
99 Ga0068856_100090558 3300005614 Bacteria 3042
100 Ga0068856_100166604 3300005614 Bacteria 2214
101 Ga0068856_100739463 3300005614 Bacteria 1004
102 Ga0068852_100120915 3300005616 Bacteria 2397
103 Ga0068852_100445222 3300005616 Bacteria 1281
104 Ga0068859_100136339 3300005617 Bacteria 2527
105 Ga0068859_100408096 3300005617 Bacteria 1454
106 Ga0068864_100070647 3300005618 Bacteria 3038
107 Ga0068864_100168995 3300005618 Bacteria 1993
108 Ga0068861_100451940 3300005719 Bacteria 1151
109 Ga0068861_100524811 3300005719 Bacteria 1074
110 Ga0068851_10176709 3300005834 Bacteria 1181
111 Ga0068863_100168896 3300005841 Bacteria 2097
112 Ga0068863_100222282 3300005841 Bacteria 1820
113 Ga0068863_100654027 3300005841 Bacteria 1042
114 Ga0068858_100074099 3300005842 Bacteria 3160
115 Ga0068858_100229804 3300005842 Bacteria 1758
116 Ga0068860_100002365 3300005843 Bacteria 19823
117 Ga0068862_100101137 3300005844 Bacteria 2521
118 Ga0068862_100480778 3300005844 Bacteria 1176
119 Ga0081455_10010801 3300005937 Bacteria 9229
120 Ga0081455_10091185 3300005937 Bacteria 2469
121 Ga0081540_1007106 3300005983 Bacteria 8040
122 Ga0081540_1017698 3300005983 Bacteria 4400
123 Ga0081540_1055431 3300005983 Bacteria 1931
124 Ga0081540_1091411 3300005983 Bacteria 1338
125 Ga0081539_10042008 3300005985 Bacteria 2667
126 Ga0070717_10127083 3300006028 Bacteria 2189
127 Ga0070717_10479605 3300006028 Bacteria 1123
128 Ga0070717_10623295 3300006028 Bacteria 979
129 Ga0070717_11069856 3300006028 Bacteria 735
130 Ga0075365_10043967 3300006038 Bacteria 2925
131 Ga0075365_10133466 3300006038 Bacteria 1719
132 Ga0075365_10243026 3300006038 Bacteria 1264
133 Ga0075365_10309864 3300006038 Bacteria 1111
134 Ga0075365_10730304 3300006038 Bacteria 699
135 Ga0075368_10044809 3300006042 Bacteria 1746
136 Ga0075368_10123050 3300006042 Bacteria 1075
137 Ga0075363_100031396 3300006048 Bacteria 2754
138 Ga0075363_100032809 3300006048 Bacteria 2700
139 Ga0075363_100061975 3300006048 Bacteria 2016
140 Ga0075363_100274761 3300006048 Bacteria 974
141 Ga0075364_10045198 3300006051 Bacteria 2866
142 Ga0075364_10051953 3300006051 Bacteria 2677
143 Ga0075364_10185016 3300006051 Bacteria 1410
144 Ga0070715_10112384 3300006163 Bacteria 1287
145 Ga0070716_100029491 3300006173 Bacteria 2967
146 Ga0070716_100715182 3300006173 Bacteria 767
147 Ga0070716_100871980 3300006173 Bacteria 702
148 Ga0070712_100002502 3300006175 Bacteria 11336
149 Ga0075362_10137835 3300006177 Bacteria 1165
150 Ga0075362_10328390 3300006177 Bacteria 763
151 Ga0075367_10265906 3300006178 Bacteria 1077
152 Ga0075367_10330149 3300006178 Bacteria 961
153 Ga0075367_10382843 3300006178 Bacteria 889
154 Ga0075369_10016277 3300006186 Bacteria 2998
155 Ga0075369_10022274 3300006186 Bacteria 2612
156 Ga0075369_10101314 3300006186 Bacteria 1292
157 Ga0075369_10110338 3300006186 Bacteria 1239
158 Ga0075366_10037190 3300006195 Bacteria 2872
159 Ga0075366_10063261 3300006195 Bacteria 2199
160 Ga0075366_10090908 3300006195 Bacteria 1828
161 Ga0097621_100365856 3300006237 Bacteria 1286
162 Ga0097621_100598381 3300006237 Bacteria 1007
163 Ga0075370_10017101 3300006353 Bacteria 3914
164 Ga0075370_10059735 3300006353 Bacteria 2170
165 Ga0075370_10144586 3300006353 Bacteria 1391
166 Ga0068871_100356171 3300006358 Bacteria 1295
167 Ga0075428_100093432 3300006844 Bacteria 3279
168 Ga0075428_100132488 3300006844 Bacteria 2711
169 Ga0075433_10365808 3300006852 Bacteria 1274
170 Ga0075434_100087181 3300006871 Bacteria 3122
171 Ga0075434_100749266 3300006871 Bacteria 994
172 Ga0075429_100194312 3300006880 Bacteria 1778
173 Ga0068865_100088840 3300006881 Bacteria 2237
174 Ga0097620_100136346 3300006931 Bacteria 2527
175 Ga0097620_100408126 3300006931 Bacteria 1454
176 Ga0099825_1033069 3300006941 Bacteria 2037
177 Ga0099794_10061677 3300007265 Bacteria 1822
178 Ga0099794_10222771 3300007265 Bacteria 969
179 Ga0099794_10262116 3300007265 Bacteria 892
180 Ga0099794_10298374 3300007265 Bacteria 834
181 Ga0099795_10199026 3300007788 Bacteria 844
182 Ga0105250_10248742 3300009092 Bacteria 759
183 Ga0105240_10038100 3300009093 Bacteria 6171
184 Ga0105240_11380544 3300009093 Bacteria 741
185 Ga0105245_10126357 3300009098 Bacteria 2394
186 Ga0105247_10053579 3300009101 Bacteria 2489
187 Ga0105247_10582522 3300009101 Bacteria 827
188 Ga0114129_10115775 3300009147 Bacteria 3694
189 Ga0114129_11271383 3300009147 Bacteria 913
190 Ga0105243_10095149 3300009148 Bacteria 2461
191 Ga0105243_10251585 3300009148 Bacteria 1578
192 Ga0105243_10407851 3300009148 Bacteria 1264
193 Ga0105241_10043287 3300009174 Bacteria 3410
194 Ga0105241_10055235 3300009174 Bacteria 3042
195 Ga0105241_10059854 3300009174 Bacteria 2929
196 Ga0105241_10431244 3300009174 Bacteria 1162
197 Ga0105242_10129450 3300009176 Bacteria 2176
198 Ga0105242_10685197 3300009176 Bacteria 1001
199 Ga0105248_10125872 3300009177 Bacteria 2891
200 Ga0105248_10148714 3300009177 Bacteria 2643
201 Ga0105248_10665719 3300009177 Bacteria 1174
202 Ga0105248_10924498 3300009177 Bacteria 985
203 Ga0105237_10053369 3300009545 Bacteria 4054
204 Ga0105237_10083423 3300009545 Bacteria 3187
205 Ga0105237_10133518 3300009545 Bacteria 2477
206 Ga0105237_10141114 3300009545 Bacteria 2403
207 Ga0105237_10264580 3300009545 Bacteria 1723
208 Ga0105237_10309456 3300009545 Bacteria 1583
209 Ga0105237_10782514 3300009545 Bacteria 961
210 Ga0105238_10052077 3300009551 Bacteria 4115
211 Ga0105238_10161889 3300009551 Bacteria 2213
212 Ga0105238_10375968 3300009551 Bacteria 1412
213 Ga0105238_10435593 3300009551 Bacteria 1307
214 Ga0105239_10029068 3300010375 Bacteria 6076
215 Ga0105239_10155030 3300010375 Bacteria 2558
216 Ga0105239_10178855 3300010375 Bacteria 2373
217 Ga0105239_10230928 3300010375 Bacteria 2076
218 Ga0105239_10337634 3300010375 Bacteria 1700
219 Ga0105239_10785769 3300010375 Bacteria 1090
220 Ga0105246_10317492 3300011119 Bacteria 1264
221 Ga0105246_10650685 3300011119 Bacteria 917
222 Ga0157373_10241439 3300013100 Bacteria 1277
223 Ga0157373_10710703 3300013100 Bacteria 737
224 Ga0157370_10037004 3300013104 Bacteria 4734
225 Ga0157370_10087858 3300013104 Bacteria 2920
226 Ga0157370_10468590 3300013104 Bacteria 1158
227 Ga0157370_11045805 3300013104 Bacteria 738
228 Ga0157369_10005008 3300013105 Bacteria 15516
229 Ga0157369_10031311 3300013105 Bacteria 5857
230 Ga0157369_11002269 3300013105 Bacteria 855
231 Ga0157374_10272618 3300013296 Bacteria 1669
232 Ga0157374_10311256 3300013296 Bacteria 1559
233 Ga0157374_11058568 3300013296 Bacteria 831
234 Ga0157378_10391795 3300013297 Bacteria 1366
235 Ga0157378_11221886 3300013297 Bacteria 791
236 Ga0163162_10110805 3300013306 Bacteria 2842
237 Ga0163162_10164198 3300013306 Bacteria 2344
238 Ga0163162_10753070 3300013306 Bacteria 1093
239 Ga0157372_10599617 3300013307 Bacteria 1284
240 Ga0157372_10692354 3300013307 Bacteria 1186
241 Ga0157372_11209546 3300013307 Bacteria 873
242 Ga0157375_10185462 3300013308 Bacteria 2233
243 Ga0157375_10203640 3300013308 Bacteria 2135
244 Ga0163163_10209798 3300014325 Bacteria 1997
245 Ga0163163_10366657 3300014325 Bacteria 1497
246 Ga0163163_10475472 3300014325 Bacteria 1310
247 Ga0157380_10048480 3300014326 Bacteria 3346
248 Ga0157380_10355892 3300014326 Bacteria 1372
249 Ga0182008_10135735 3300014497 Bacteria 1229
250 Ga0182008_10345411 3300014497 Bacteria 788
251 Ga0182008_10429229 3300014497 Bacteria 715
252 Ga0157377_10127433 3300014745 Bacteria 1550
253 Ga0157379_10137333 3300014968 Bacteria 2203
254 Ga0157379_11227605 3300014968 Bacteria 722
255 Ga0157376_10233249 3300014969 Bacteria 1711
256 Ga0157376_10233853 3300014969 Bacteria 1708
257 Ga0182007_10024034 3300015262 Bacteria 2137
258 Ga0163161_10066888 3300017792 Bacteria 2624
259 Ga0163161_10436629 3300017792 Bacteria 1056
260 Ga0163161_10461145 3300017792 Bacteria 1029
261 Ga0197907_11128244 3300020069 Bacteria 712
262 Ga0206350_11642153 3300020080 Bacteria 728
263 Ga0154015_1675993 3300020610 Bacteria 1013
264 Ga0213871_10056169 3300021441 Bacteria 1089
265 Ga0213871_10110699 3300021441 Bacteria 811
266 Ga0224712_10325459 3300022467 Bacteria 723
267 Ga0209563_101023 3300025230 Bacteria 8138
268 Ga0207425_1003754 3300025245 Bacteria 4744
269 Ga0209677_100296 3300025253 Bacteria 32613
270 Ga0209677_101907 3300025253 Bacteria 8412
271 Ga0209148_1002306 3300025254 Bacteria 6841
272 Ga0209233_1002524 3300025261 Bacteria 6687
273 Ga0209233_1018863 3300025261 Bacteria 1845
274 Ga0209233_1020913 3300025261 Bacteria 1706
275 Ga0209455_1006532 3300025272 Bacteria 3428
276 Ga0209455_1009306 3300025272 Bacteria 2591
277 Ga0209673_1047456 3300025273 Bacteria 1164
278 Ga0209564_1007378 3300025295 Bacteria 5691
279 Ga0209758_1000030 3300025297 Bacteria 509217
280 Ga0209758_1004010 3300025297 Bacteria 12729
281 Ga0209758_1004113 3300025297 Bacteria 12464
282 Ga0209758_1004414 3300025297 Bacteria 11726
283 Ga0209758_1004721 3300025297 Bacteria 11115
284 Ga0209758_1004871 3300025297 Bacteria 10811
285 Ga0209758_1014782 3300025297 Bacteria 4116
286 Ga0209256_1009896 3300025299 Bacteria 4095
287 Ga0207426_1000380 3300025302 Bacteria 76046
288 Ga0207426_1000905 3300025302 Bacteria 29814
289 Ga0207426_1005208 3300025302 Bacteria 6037
290 Ga0209257_1005857 3300025304 Bacteria 8319
291 Ga0207697_10072769 3300025315 Bacteria 1442
292 Ga0207697_10096908 3300025315 Bacteria 1254
293 Ga0207692_10011512 3300025898 Bacteria 3769
294 Ga0207710_10045476 3300025900 Bacteria 1958
295 Ga0207710_10110943 3300025900 Bacteria 1302
296 Ga0207710_10116927 3300025900 Bacteria 1270
297 Ga0207710_10150203 3300025900 Bacteria 1130
298 Ga0207688_10042822 3300025901 Bacteria 2520
299 Ga0207688_10082752 3300025901 Bacteria 1835
300 Ga0207688_10146781 3300025901 Bacteria 1391
301 Ga0207680_10067865 3300025903 Bacteria 2198
302 Ga0207680_10079259 3300025903 Bacteria 2059
303 Ga0207647_10015238 3300025904 Bacteria 5279
304 Ga0207647_10128945 3300025904 Bacteria 1487
305 Ga0207647_10155707 3300025904 Bacteria 1334
306 Ga0207685_10375779 3300025905 Bacteria 723
307 Ga0207699_10139579 3300025906 Bacteria 1591
308 Ga0207699_10183133 3300025906 Bacteria 1409
309 Ga0207699_10314395 3300025906 Bacteria 1097
310 Ga0207645_10180374 3300025907 Bacteria 1385
311 Ga0207643_10138465 3300025908 Bacteria 1453
312 Ga0207705_10555863 3300025909 Bacteria 892
313 Ga0207654_10061259 3300025911 Bacteria 2201
314 Ga0207654_10087934 3300025911 Bacteria 1887
315 Ga0207654_10126733 3300025911 Bacteria 1611
316 Ga0207707_10424760 3300025912 Bacteria 1139
317 Ga0207695_10000059 3300025913 Bacteria 363920
318 Ga0207695_10034149 3300025913 Bacteria 5537
319 Ga0207671_10008401 3300025914 Bacteria 8765
320 Ga0207671_10056398 3300025914 Bacteria 2911
321 Ga0207671_10088417 3300025914 Bacteria 2331
322 Ga0207671_10323493 3300025914 Bacteria 1220
323 Ga0207671_10425439 3300025914 Bacteria 1057
324 Ga0207693_10081806 3300025915 Bacteria 2529
325 Ga0207663_10024893 3300025916 Bacteria 3452
326 Ga0207663_10220289 3300025916 Bacteria 1380
327 Ga0207660_10133283 3300025917 Bacteria 1893
328 Ga0207657_10001268 3300025919 Bacteria 26929
329 Ga0207657_10043103 3300025919 Bacteria 3977
330 Ga0207649_10180389 3300025920 Bacteria 1478
331 Ga0207649_10254277 3300025920 Bacteria 1267
332 Ga0207649_10283998 3300025920 Bacteria 1204
333 Ga0207652_10258957 3300025921 Bacteria 1569
334 Ga0207694_10057528 3300025924 Bacteria 3023
335 Ga0207694_10283551 3300025924 Bacteria 1361
336 Ga0207694_10320498 3300025924 Bacteria 1279
337 Ga0207650_10848416 3300025925 Bacteria 775
338 Ga0207659_10254277 3300025926 Bacteria 1427
339 Ga0207700_10008094 3300025928 Bacteria 6488
340 Ga0207700_10181917 3300025928 Bacteria 1761
341 Ga0207700_10760503 3300025928 Bacteria 866
342 Ga0207700_11054673 3300025928 Bacteria 727
343 Ga0207664_10173894 3300025929 Bacteria 1845
344 Ga0207664_10747822 3300025929 Bacteria 879
345 Ga0207644_10660412 3300025931 Bacteria 870
346 Ga0207706_10076709 3300025933 Bacteria 2939
347 Ga0207706_10412904 3300025933 Bacteria 1170
348 Ga0207706_10483436 3300025933 Bacteria 1070
349 Ga0207686_10278834 3300025934 Bacteria 1233
350 Ga0207709_10098314 3300025935 Bacteria 1930
351 Ga0207709_10620170 3300025935 Bacteria 858
352 Ga0207670_10046923 3300025936 Bacteria 2873
353 Ga0207669_10237752 3300025937 Bacteria 1348
354 Ga0207669_10518106 3300025937 Bacteria 957
355 Ga0207704_10212465 3300025938 Bacteria 1425
356 Ga0207665_10069217 3300025939 Bacteria 2406
357 Ga0207665_10239356 3300025939 Bacteria 1337
358 Ga0207691_10306513 3300025940 Bacteria 1363
359 Ga0207691_10358942 3300025940 Bacteria 1246
360 Ga0207691_10485102 3300025940 Bacteria 1050
361 Ga0207711_10081814 3300025941 Bacteria 2822
362 Ga0207711_10254332 3300025941 Bacteria 1614
363 Ga0207689_10105026 3300025942 Bacteria 2321
364 Ga0207689_10171259 3300025942 Bacteria 1790
365 Ga0207689_10184381 3300025942 Bacteria 1721
366 Ga0207679_10344389 3300025945 Bacteria 1297
367 Ga0207679_10973607 3300025945 Bacteria 777
368 Ga0207667_10114654 3300025949 Bacteria 2778
369 Ga0207667_10149431 3300025949 Bacteria 2405
370 Ga0207712_10096271 3300025961 Bacteria 2191
371 Ga0207712_10184368 3300025961 Bacteria 1642
372 Ga0207668_10182755 3300025972 Bacteria 1655
373 Ga0207668_10216756 3300025972 Bacteria 1534
374 Ga0207658_11198525 3300025986 Bacteria 694
375 Ga0207677_10130326 3300026023 Bacteria 1908
376 Ga0207677_10148005 3300026023 Bacteria 1807
377 Ga0207677_10353590 3300026023 Bacteria 1232
378 Ga0207703_10039702 3300026035 Bacteria 3763
379 Ga0207703_10129381 3300026035 Bacteria 2178
380 Ga0207703_10221845 3300026035 Bacteria 1691
381 Ga0207639_10128202 3300026041 Bacteria 2096
382 Ga0207639_10338048 3300026041 Bacteria 1342
383 Ga0207678_10059949 3300026067 Bacteria 3274
384 Ga0207678_10199350 3300026067 Bacteria 1711
385 Ga0207678_10223682 3300026067 Bacteria 1611
386 Ga0207678_10310594 3300026067 Bacteria 1356
387 Ga0207708_10092119 3300026075 Bacteria 2338
388 Ga0207702_10543077 3300026078 Bacteria 1136
389 Ga0207641_10755166 3300026088 Bacteria 960
390 Ga0207648_10062167 3300026089 Bacteria 3256
391 Ga0207648_10131935 3300026089 Bacteria 2199
392 Ga0207648_10183982 3300026089 Bacteria 1850
393 Ga0207676_10112407 3300026095 Bacteria 2281
394 Ga0207674_10057755 3300026116 Bacteria 3933
395 Ga0207674_10065875 3300026116 Bacteria 3651
396 Ga0207674_10424833 3300026116 Bacteria 1284
397 Ga0207674_10658347 3300026116 Bacteria 1011
398 Ga0207675_100472370 3300026118 Bacteria 1245
399 Ga0207683_10203024 3300026121 Bacteria 1802
400 Ga0207683_10246026 3300026121 Bacteria 1631
401 Ga0207683_10473755 3300026121 Bacteria 1155
402 Ga0209389_1000422 3300027296 Bacteria 25086
403 Ga0209489_104637 3300027361 Bacteria 25086
404 Ga0209700_100018 3300027363 Bacteria 238200
405 Ga0209813_10024408 3300027866 Bacteria 1729
406 Ga0207428_10272567 3300027907 Bacteria 1258
407 Ga0268266_10010325 3300028379 Bacteria 8169
408 Ga0268266_10028219 3300028379 Bacteria 4771
409 Ga0268266_10038564 3300028379 Bacteria 4067
410 Ga0268266_10048665 3300028379 Bacteria 3634
411 Ga0268265_10009382 3300028380 Bacteria 6612
412 Ga0268265_10037688 3300028380 Bacteria 3550
413 Ga0268265_10333454 3300028380 Bacteria 1378
414 Ga0268264_10000049 3300028381 Bacteria 329992
415 Ga0268264_10182106 3300028381 Bacteria 1909
416 Ga0265326_10013524 3300028558 Bacteria 2385
417 Ga0265319_1029105 3300028563 Bacteria 1941
418 Ga0265334_10001384 3300028573 Bacteria 11697
419 Ga0265336_10000786 3300028666 Bacteria 16776
420 Ga0307515_10564010 3300028794 Bacteria 748
421 Ga0265338_10000024 3300028800 Bacteria 297778
422 Ga0265324_10005055 3300029957 Bacteria 5782
423 Ga0307511_10224668 3300030521 Bacteria 938
424 Ga0265330_10012419 3300031235 Bacteria 3983
425 Ga0265339_10007762 3300031249 Bacteria 6899
426 Ga0307513_10532916 3300031456 Bacteria 888
427 Ga0307509_10119807 3300031507 Bacteria 2612
428 Ga0307509_10283896 3300031507 Bacteria 1415
429 Ga0307408_100089127 3300031548 Bacteria 2325
430 Ga0307508_10000397 3300031616 Bacteria 52462
431 Ga0265314_10063520 3300031711 Bacteria 2504
432 Ga0307516_10009088 3300031730 Bacteria 11131
433 Ga0307516_10123654 3300031730 Bacteria 2374
434 Ga0307413_10102293 3300031824 Bacteria 1896
435 Ga0307406_10137379 3300031901 Bacteria 1725
436 Ga0307406_10276284 3300031901 Bacteria 1279
437 Ga0307407_10153833 3300031903 Bacteria 1498
438 Ga0307412_10161294 3300031911 Bacteria 1666
439 Ga0307409_100590092 3300031995 Bacteria 1096
440 Ga0307416_100259261 3300032002 Bacteria 1698
441 Ga0307416_100985101 3300032002 Bacteria 946
442 Ga0307414_10940760 3300032004 Bacteria 794
443 Ga0307415_100177548 3300032126 Bacteria 1667
444 Ga0307510_10062668 3300033180 Bacteria 3797
445 Ga0307510_10081497 3300033180 Bacteria 3137
446 Ga0373954_0057840 3300035118 Bacteria 1826
447 Ga0373961_0200870 3300035241 Bacteria 703
448 Ga0373927_0185960 3300035695 Bacteria 1363
449 Ga0373933_0000184 3300035724 Bacteria 41316
450 Ga0373947_0027631 3300035725 Bacteria 3322
451 Ga0373937_0056787 3300036401 Bacteria 3595
452 Ga0373925_0379381 3300037068 Bacteria 1151
453 Ga0395900_0002921 3300037418 Bacteria 18614
454 Ga0395900_0052474 3300037418 Bacteria 4197
455 Ga0395898_0044675 3300037466 Bacteria 4359
456 Ga0395898_0072179 3300037466 Bacteria 3335
457 Ga0395898_0234635 3300037466 Bacteria 1749
458 Ga0395898_0476664 3300037466 Bacteria 1187
459 Ga0395905_0007671 3300037471 Bacteria 10707
460 Ga0436364_0575382 3300037853 Bacteria 811
461 Ga0395901_0045452 3300038443 Bacteria 4557
462 Ga0395901_0218302 3300038443 Bacteria 1994
463 Ga0436365_0939836 3300039437 Bacteria 1246
464 Ga0436365_1449853 3300039437 Bacteria 1094
465 Ga0436360_0361752 3300039438 Bacteria 999
466 Ga0436361_0772824 3300039447 Bacteria 2448
467 Ga0436361_1020089 3300039447 Bacteria 3519
468 Ga0436363_1552770 3300039450 Bacteria 644
469 Ga0451791_0864963 3300041451 Bacteria 1069
470 Ga0451793_1259725 3300041452 Bacteria 1974
471 Ga0451797_0338536 3300041453 Bacteria 1666
472 Ga0451795_0008202 3300041456 Bacteria 1089
473 Ga0451798_0278979 3300041458 Bacteria 1406
474 Ga0451802_0733235 3300041460 Bacteria 2372
475 Ga0451802_1734208 3300041460 Bacteria 859
476 Ga0451804_1066560 3300041463 Bacteria 776
477 Ga0451833_1100129 3300041491 Bacteria 1412
478 Ga0451835_0707947 3300041492 Bacteria 713
479 Ga0451849_0998563 3300041505 Bacteria 784
480 Ga0451849_1521950 3300041505 Bacteria 1132
481 Ga0451855_0185743 3300041511 Bacteria 1068
482 Ga0439445_0086756 3300042004 Bacteria 879
483 Ga0439455_0084448 3300042012 Bacteria 866
484 Ga0466969_0069821 3300044656 Bacteria 1691
485 Ga0466972_0136946 3300044658 Bacteria 1152
486 Ga0466965_0140215 3300044683 Bacteria 1258
487 Ga0466961_0261509 3300044693 Bacteria 1061
488 Ga0466963_0215843 3300044694 Bacteria 1343
489 Ga0466964_0071643 3300044706 Bacteria 1467
490 Ga0466964_0120971 3300044706 Bacteria 1180
491 Ga0466968_0012068 3300044735 Bacteria 3375
492 Ga0466968_0015164 3300044735 Bacteria 3052
493 Ga0466970_0044021 3300044765 Bacteria 2377
494 Ga0466957_0353290 3300044842 Bacteria 997
495 Ga0466960_0010496 3300044901 Bacteria 3849
496 Ga0466960_0239294 3300044901 Bacteria 1005
497 Ga0466959_0336918 3300045049 Bacteria 1029
498 Ga0466959_0551677 3300045049 Bacteria 777
499 Ga0466967_0858212 3300045976 Bacteria 902
500 Ga0495617_143334 3300046452 Bacteria 762
501 Ga0495627_117765 3300046453 Bacteria 751
502 Ga0495592_0013603 3300046454 Bacteria 6190
503 Ga0495592_0093899 3300046454 Bacteria 2148
504 Ga0495603_0326166 3300046455 Bacteria 881
505 Ga0495629_0017024 3300046459 Bacteria 5215
506 Ga0495638_0006107 3300046460 Bacteria 8816
507 Ga0495638_0250871 3300046460 Bacteria 975
508 Ga0495641_0233390 3300046461 Bacteria 826
509 Ga0495651_0015787 3300046462 Bacteria 5846
510 Ga0495651_0132246 3300046462 Bacteria 1820
511 Ga0495653_0419365 3300046463 Bacteria 847
512 Ga0495662_0122125 3300046476 Bacteria 1279
513 Ga0495664_0017988 3300046477 Bacteria 4042
514 Ga0495585_0158060 3300046492 Bacteria 1178
515 Ga0495585_0445194 3300046492 Bacteria 620
516 Ga0495594_0090495 3300046499 Bacteria 1714
517 Ga0495594_0183973 3300046499 Bacteria 1190
518 Ga0495596_0162244 3300046500 Bacteria 869
519 Ga0495583_0091164 3300046506 Bacteria 1312
520 Ga0495583_0091199 3300046506 Bacteria 1311
521 Ga0495606_0015595 3300046507 Bacteria 5844
522 Ga0495606_0015792 3300046507 Bacteria 5795
523 Ga0495606_0254475 3300046507 Bacteria 972
524 Ga0495608_0060838 3300046511 Bacteria 2485
525 Ga0495618_0065943 3300046514 Bacteria 2301
526 Ga0495620_0044782 3300046515 Bacteria 1920
527 Ga0495631_0203979 3300046518 Bacteria 845
528 Ga0495632_0153854 3300046519 Bacteria 1062
529 Ga0495632_0181689 3300046519 Bacteria 963
530 Ga0495643_0011879 3300046522 Bacteria 5278
531 Ga0495643_0040023 3300046522 Bacteria 2561
532 Ga0495643_0124899 3300046522 Bacteria 1296
533 Ga0495644_0028972 3300046523 Bacteria 2094
534 Ga0495648_0064211 3300046524 Bacteria 2164
535 Ga0495648_0085990 3300046524 Bacteria 1775
536 Ga0495663_0012568 3300046525 Bacteria 2359
537 Ga0495642_0329192 3300046528 Bacteria 670
538 Ga0495652_0049518 3300046529 Bacteria 3596
539 Ga0495652_0169370 3300046529 Bacteria 1687
540 Ga0495654_0079503 3300046530 Bacteria 1540
541 Ga0495640_0117591 3300046533 Bacteria 1730
542 Ga0495640_0134135 3300046533 Bacteria 1600
543 Ga0495587_0049180 3300046536 Bacteria 2496
544 Ga0495598_0090972 3300046537 Bacteria 995
545 Ga0495609_0055427 3300046538 Bacteria 1759
546 Ga0495609_0097300 3300046538 Bacteria 1276
547 Ga0495621_0083196 3300046539 Bacteria 1196
548 Ga0495597_0015757 3300046542 Bacteria 3577
549 Ga0495645_0011219 3300046543 Bacteria 6300
550 Ga0495622_0012074 3300046557 Bacteria 3994
551 Ga0495622_0020966 3300046557 Bacteria 3043
552 Ga0495622_0170880 3300046557 Bacteria 977
553 Ga0495667_0071025 3300046559 Bacteria 2271
554 Ga0495656_0013227 3300046615 Bacteria 3064
555 Ga0495656_0134318 3300046615 Bacteria 1180
556 Ga0495668_0016967 3300046616 Bacteria 4229
557 Ga0495668_0456479 3300046616 Bacteria 703
558 Ga0495611_0051238 3300046648 Bacteria 1860
559 Ga0495611_0107749 3300046648 Bacteria 1296
560 Ga0495625_0086912 3300046660 Bacteria 2168
561 Ga0495635_0039768 3300046663 Bacteria 3252
562 Ga0495659_0032034 3300046664 Bacteria 1837
563 Ga0495659_0090634 3300046664 Bacteria 1173
564 Ga0495661_0056070 3300046665 Bacteria 2359
565 Ga0495661_0265131 3300046665 Bacteria 871
566 Ga0495588_0017782 3300046674 Bacteria 3458
567 Ga0495588_0092663 3300046674 Bacteria 1583
568 Ga0495588_0269398 3300046674 Bacteria 897
569 Ga0495599_0023972 3300046678 Bacteria 3816
570 Ga0495599_0098729 3300046678 Bacteria 1820
571 Ga0495646_0069090 3300046680 Bacteria 2085
572 Ga0495646_0134730 3300046680 Bacteria 1387
573 Ga0495669_0002847 3300046684 Bacteria 7103
574 Ga0495613_0075255 3300046689 Bacteria 2458
575 Ga0495613_0377547 3300046689 Bacteria 970
576 Ga0495624_0207387 3300046690 Bacteria 1189
577 Ga0495624_0223924 3300046690 Bacteria 1140
578 Ga0495671_0153421 3300046692 Bacteria 1121
579 Ga0495649_0239079 3300046694 Bacteria 935
580 Ga0495600_0162083 3300046809 Bacteria 1445
581 Ga0495660_0136494 3300046810 Bacteria 1225
582 Ga0495581_0037811 3300047315 Bacteria 2793
583 Ga0495604_0013629 3300047317 Bacteria 6482
584 Ga0495604_0262298 3300047317 Bacteria 1174
585 Ga0495636_0028358 3300047318 Bacteria 2283
586 Ga0495636_0304841 3300047318 Bacteria 745
587 Ga0495672_0025297 3300047320 Bacteria 3803
588 Ga0495680_0010136 3300047322 Bacteria 8421
589 Ga0495680_0056184 3300047322 Bacteria 3048
590 Ga0495683_0029412 3300047323 Bacteria 2808
591 Ga0495687_022001 3300047443 Bacteria 3070
592 Ga0495679_017376 3300047446 Bacteria 2576
593 Ga0495673_0038506 3300047469 Bacteria 2175
594 Ga0495673_0052399 3300047469 Bacteria 1783
595 Ga0495673_0121419 3300047469 Bacteria 1034
596 Ga0495681_0234879 3300047470 Bacteria 730
597 Ga0495602_0050311 3300048088 Bacteria 3724
598 Ga0495626_0103962 3300048091 Bacteria 1236
599 Ga0496100_0137695 3300048903 Bacteria 1727
600 Ga0496101_0099300 3300048904 Bacteria 2176
601 Ga0496101_0142929 3300048904 Bacteria 1825
602 Ga0496101_0753899 3300048904 Bacteria 768
603 Ga0496102_0001927 3300048905 Bacteria 17864
604 Ga0496103_0008691 3300048906 Bacteria 6028
605 Ga0496103_0705031 3300048906 Bacteria 640
606 Ga0496104_0013299 3300048907 Bacteria 7420
607 Ga0496104_0052875 3300048907 Bacteria 3836
608 Ga0496104_0420274 3300048907 Bacteria 1249
609 Ga0496104_0482713 3300048907 Bacteria 1151
610 Ga0496105_0008929 3300048908 Bacteria 7815
611 Ga0496105_0040401 3300048908 Bacteria 3846
612 Ga0496106_0007753 3300048909 Bacteria 7946
613 Ga0496106_0541440 3300048909 Bacteria 934
614 Ga0496106_0551014 3300048909 Bacteria 925
615 Ga0496107_0162459 3300048910 Bacteria 1655
616 Ga0496108_0060921 3300048911 Bacteria 3175
617 Ga0496108_0244693 3300048911 Bacteria 1560
618 Ga0496108_0477119 3300048911 Bacteria 1090
619 Ga0496109_0051675 3300048912 Bacteria 3743
620 Ga0496109_0382161 3300048912 Bacteria 1330
621 Ga0496109_0781699 3300048912 Bacteria 893
622 Ga0496110_0021279 3300048913 Bacteria 5488
623 Ga0496110_0111957 3300048913 Bacteria 2454
624 Ga0496110_0240179 3300048913 Bacteria 1648
625 Ga0496110_0255516 3300048913 Bacteria 1595
626 Ga0496111_0108568 3300048914 Bacteria 2043
627 Ga0496112_0126590 3300048915 Bacteria 2525
628 Ga0496112_0353626 3300048915 Bacteria 1411
629 Ga0496113_0032457 3300048916 Bacteria 3796
630 Ga0496113_0042908 3300048916 Bacteria 3344
631 Ga0496113_0043780 3300048916 Bacteria 3314
632 Ga0496114_0014098 3300048917 Bacteria 6408
633 Ga0496115_0137042 3300048918 Bacteria 2018
634 Ga0496115_0269402 3300048918 Bacteria 1399
635 Ga0496115_0618978 3300048918 Bacteria 859
636 Ga0496116_0000934 3300048919 Bacteria 35950
637 Ga0496116_0044302 3300048919 Bacteria 3024
638 Ga0496117_0076442 3300048920 Bacteria 2220
639 Ga0496117_0096089 3300048920 Bacteria 1891
640 Ga0496117_0190106 3300048920 Bacteria 1170
641 Ga0496117_0286943 3300048920 Bacteria 878
642 Ga0496118_0006819 3300048921 Bacteria 12392
643 Ga0496118_0062580 3300048921 Bacteria 2745
644 Ga0496118_0065220 3300048921 Bacteria 2666
645 Ga0496118_0207495 3300048921 Bacteria 1153
646 Ga0496118_0213770 3300048921 Bacteria 1129
647 Ga0496118_0216553 3300048921 Bacteria 1119
648 Ga0496119_0027312 3300048922 Bacteria 3926
649 Ga0496119_0090300 3300048922 Bacteria 1742
650 Ga0496119_0115149 3300048922 Bacteria 1486
651 Ga0496119_0158387 3300048922 Bacteria 1206
652 Ga0496121_0000998 3300048924 Bacteria 50597
653 Ga0496121_0025232 3300048924 Bacteria 5648
654 Ga0496121_0049187 3300048924 Bacteria 3578
655 Ga0496121_0068950 3300048924 Bacteria 2857
656 Ga0496121_0166731 3300048924 Bacteria 1604
657 Ga0496121_0281393 3300048924 Bacteria 1137
658 Ga0496121_0413836 3300048924 Bacteria 879
659 Ga0496122_0036435 3300048925 Bacteria 3977
660 Ga0496122_0150419 3300048925 Bacteria 1438
661 Ga0496123_0179418 3300048926 Bacteria 1108
662 Ga0496124_0005318 3300048927 Bacteria 14551
663 Ga0496124_0030909 3300048927 Bacteria 4744
664 Ga0496125_0000664 3300048928 Bacteria 57244
665 Ga0496125_0022463 3300048928 Bacteria 5858
666 Ga0496125_0030594 3300048928 Bacteria 4813
667 Ga0496125_0072536 3300048928 Bacteria 2682
668 Ga0496125_0102786 3300048928 Bacteria 2099
669 Ga0496126_0009156 3300048929 Bacteria 10570
670 Ga0496126_0011178 3300048929 Bacteria 9317
671 Ga0496126_0041507 3300048929 Bacteria 4257
672 Ga0496126_0045480 3300048929 Bacteria 4034
673 Ga0496126_0093523 3300048929 Bacteria 2639
674 Ga0496126_0094334 3300048929 Bacteria 2626
675 Ga0496126_0101451 3300048929 Bacteria 2517
676 Ga0496126_0103267 3300048929 Bacteria 2491
677 Ga0496126_0118342 3300048929 Bacteria 2300
678 Ga0496126_0248017 3300048929 Bacteria 1485
679 Ga0496126_0266594 3300048929 Bacteria 1422
680 Ga0496126_0499531 3300048929 Bacteria 972
681 Ga0495682_0006059 3300049460 Bacteria 4932
682 Ga0501031_0314840 3300049568 Bacteria 1014
683 Ga0501032_0128562 3300049569 Bacteria 1672
684 Ga0501032_0224073 3300049569 Bacteria 1223
685 Ga0501034_0133579 3300049571 Bacteria 2464
686 Ga0501034_0450531 3300049571 Bacteria 1205
687 Ga0501036_0142854 3300049572 Bacteria 2019
688 Ga0501037_0030608 3300049573 Bacteria 3977
689 Ga0501043_0759157 3300049579 Bacteria 704
690 Ga0501046_0108753 3300049580 Bacteria 2120
691 Ga0501046_0150803 3300049580 Bacteria 1754
692 Ga0501069_0061869 3300049585 Bacteria 2091
693 Ga0501069_0107150 3300049585 Bacteria 1589
694 Ga0501074_0074136 3300049590 Bacteria 2444
695 Ga0501035_0026468 3300049822 Bacteria 5306
696 Ga0501035_0030142 3300049822 Bacteria 4946
697 Ga0501035_0660915 3300049822 Bacteria 846
698 Ga0501044_0117437 3300049823 Bacteria 2664
699 Ga0501044_0155941 3300049823 Bacteria 2263
700 Ga0501044_0294088 3300049823 Bacteria 1555
701 nmdc:mga03683_103204_c2 3300050489 Bacteria 948
702 nmdc:mga03683_40398_c1 3300050489 Bacteria 1913
703 nmdc:mga03683_93605_c1 3300050489 Bacteria 1313
704 nmdc:mga03n38_16615_c1 3300050490 Bacteria 2373
705 nmdc:mga00v17_104406_c1 3300050491 Bacteria 1792
706 nmdc:mga00v17_466659_c1 3300050491 Bacteria 819
707 nmdc:mga00v17_85920_c1 3300050491 Bacteria 1971
708 nmdc:mga0yw44_101965_c1 3300050492 Bacteria 1829
709 nmdc:mga0yw44_14189_c1 3300050492 Bacteria 4221
710 nmdc:mga0yw44_194988_c1 3300050492 Bacteria 1337
711 nmdc:mga0yw44_339065_c1 3300050492 Bacteria 1011
712 nmdc:mga0yw44_63420_c1 3300050492 Bacteria 2272
713 nmdc:mga0yw44_778687_c1 3300050492 Bacteria 650
714 nmdc:mga0k408_208559_c1 3300050493 Bacteria 1167
715 nmdc:mga0k408_2733_c1 3300050493 Bacteria 9374
716 nmdc:mga0k408_40213_c1 3300050493 Bacteria 2313
717 nmdc:mga06z11_13447_c1 3300050494 Bacteria 3595
718 nmdc:mga06z11_140084_c1 3300050494 Bacteria 1367
719 nmdc:mga06z11_281036_c1 3300050494 Bacteria 986
720 nmdc:mga06z11_343029_c1 3300050494 Bacteria 893
721 nmdc:mga04h51_38851_c1 3300050495 Bacteria 1544
722 nmdc:mga04h51_7750_c1 3300050495 Bacteria 2847
723 nmdc:mga07m45_102147_c1 3300050496 Bacteria 1647
724 nmdc:mga07m45_111246_c1 3300050496 Bacteria 1578
725 nmdc:mga07m45_268168_c1 3300050496 Bacteria 993
726 nmdc:mga07m45_7180_c2 3300050496 Bacteria 4088
727 nmdc:mga07m45_98402_c1 3300050496 Bacteria 1679
728 nmdc:mga05p37_258606_c1 3300050507 Bacteria 2085
729 nmdc:mga08y16_330897_c1 3300050511 Bacteria 1567
730 nmdc:mga0n895_85049_c1 3300050512 Bacteria 3157
731 nmdc:mga0rr50_65210_c1 3300050513 Bacteria 2758
732 nmdc:mga08x19_198067_c1 3300050514 Bacteria 1376
733 nmdc:mga0a205_209296_c1 3300050515 Bacteria 1839
734 nmdc:mga0sz30_109202_c1 3300050516 Bacteria 1212
735 nmdc:mga0sz30_34453_c1 3300050516 Bacteria 2108
736 nmdc:mga0sz30_61261_c1 3300050516 Bacteria 1608
737 Ga0500635_0009236 3300053080 Bacteria 2731
738 Ga0500635_0130696 3300053080 Bacteria 946
739 Ga0495595_0313868 3300053084 Bacteria 789
740 Ga0500578_0089259 3300053086 Bacteria 1957
741 Ga0500578_0108100 3300053086 Bacteria 1755
742 Ga0500643_000231 3300053087 Bacteria 51641
743 Ga0500646_0069980 3300053090 Bacteria 1050
744 Ga0500647_0047063 3300053091 Bacteria 2073
745 Ga0500583_0007518 3300053092 Bacteria 3842
746 Ga0500583_0280862 3300053092 Bacteria 817
747 Ga0500566_0030213 3300053094 Bacteria 3160
748 Ga0500641_0034829 3300053096 Bacteria 2006
749 Ga0500554_028804 3300053102 Bacteria 1617
750 Ga0500555_000892 3300053103 Bacteria 10609
751 Ga0500556_0044676 3300053104 Bacteria 1577
752 Ga0500557_000224 3300053105 Bacteria 8839
753 Ga0500557_060383 3300053105 Bacteria 1231
754 Ga0500562_011820 3300053108 Bacteria 2217
755 Ga0500569_112164 3300053109 Bacteria 902
756 Ga0500592_006320 3300053116 Bacteria 1887
757 Ga0500594_0024122 3300053118 Bacteria 1547
758 Ga0500594_0035000 3300053118 Bacteria 1345
759 Ga0500595_084342 3300053119 Bacteria 926
760 Ga0500595_089024 3300053119 Bacteria 895
761 Ga0500597_129955 3300053120 Bacteria 1089
762 Ga0500607_132870 3300053121 Bacteria 1183
763 Ga0500607_136812 3300053121 Bacteria 1159
764 Ga0500608_118696 3300053122 Bacteria 1202
765 Ga0500614_110981 3300053123 Bacteria 799
766 Ga0500618_035462 3300053125 Bacteria 1158
767 Ga0500642_0050889 3300053130 Bacteria 1828
768 Ga0500642_0132866 3300053130 Bacteria 1166
769 Ga0500658_0023093 3300053134 Bacteria 2372
770 Ga0500559_0000379 3300053136 Bacteria 32520
771 Ga0500559_0040095 3300053136 Bacteria 2038
772 Ga0500559_0057617 3300053136 Bacteria 1726
773 Ga0500577_0064390 3300053142 Bacteria 1419
774 Ga0500577_0088980 3300053142 Bacteria 1244
775 Ga0500588_0040620 3300053146 Bacteria 1399
776 Ga0500589_045114 3300053147 Bacteria 2053
777 Ga0500589_103424 3300053147 Bacteria 1233
778 Ga0500590_051705 3300053148 Bacteria 2087
779 Ga0500603_001753 3300053150 Bacteria 4876
780 Ga0500604_0087764 3300053151 Bacteria 1012
781 Ga0500616_0013977 3300053153 Bacteria 4630
782 Ga0500622_0027617 3300053156 Bacteria 2992
783 Ga0500622_0066951 3300053156 Bacteria 1822
784 Ga0500627_0041455 3300053158 Bacteria 1979
785 Ga0500633_0108871 3300053160 Bacteria 1025
786 Ga0500634_0072196 3300053161 Bacteria 1802
787 Ga0500638_035164 3300053162 Bacteria 2426
788 Ga0500636_0000301 3300053177 Bacteria 27451
789 Ga0500636_0097364 3300053177 Bacteria 1677
790 Ga0500637_0048629 3300053178 Bacteria 2412
791 Ga0500637_0050591 3300053178 Bacteria 2367
792 Ga0500576_066629 3300053725 Bacteria 1560
793 Ga0500625_006641 3300053729 Bacteria 4947
794 Ga0500609_003727 3300053731 Bacteria 2125
795 Ga0500609_034080 3300053731 Bacteria 701
796 Ga0500596_039239 3300053735 Bacteria 752
797 Ga0500601_004555 3300053737 Bacteria 1511
798 Ga0500601_006109 3300053737 Bacteria 1327
799 Ga0500661_007550 3300055283 Bacteria 2008
800 8056688955 8056681323 Bacteria 8472857
801 2507505744 2507262055 Bacteria 8048963
802 2508539940 2508501009 Bacteria 7784016
803 2508696005 2508501042 Bacteria 8719808
804 2509150776 2508501128 Bacteria 8613869
805 2511398866 2511231028 Bacteria 8046582
806 2513649442 2513237095 Bacteria 8976980
807 2513678361 2513237098 Bacteria 9902361
808 2513715542 2513237104 Bacteria 10034502
809 2513874054 2513237139 Bacteria 8737671
810 2514010175 2513237161 Bacteria 8871253
811 2515627731 2515154112 Bacteria 8294334
812 2517107023 2517093001 Bacteria 9002274
813 2524467867 2524023210 Bacteria 9029266
814 2528854744 2528768022 Bacteria 10457665
815 2603858072 2602042107 Bacteria 6226103
816 2617350183 2617270735 Bacteria 9163226
817 2723842145 2721755755 Bacteria 8322773
818 2793059174 2791355196 Bacteria 7323613
819 2805920411 2802429603 Bacteria 8777136
820 2818237120 2816332527 Bacteria 8933356
821 2824603596 2824600985 Bacteria 8488197
822 2824610987 2824609381 Bacteria 8672835
823 2824664322 2824661429 Bacteria 9877870
824 2824678180 2824671348 Bacteria 8369588
825 2824694561 2824687955 Bacteria 8360029
826 2824698611 2824696289 Bacteria 8335049
827 2824709322 2824704595 Bacteria 9667483
828 2824754863 2824753945 Bacteria 9787441
829 2824765283 2824763712 Bacteria 9792355
830 2824778123 2824773399 Bacteria 8360218
831 2838125912 2838122688 Bacteria 8803140
832 2841942694 2841941048 Bacteria 8688029
833 2841952955 2841949485 Bacteria 8680857
834 2841962962 2841957949 Bacteria 8652217
835 2841971018 2841966195 Bacteria 8673214
836 2841977724 2841974524 Bacteria 8931498
837 2841984714 2841983080 Bacteria 8395090
838 2844321652 2844315083 Bacteria 8138177
839 2847939635 2847930680 Bacteria 9342022
840 2847943089 2847939898 Bacteria 8606328
841 2849076835 2849076700 Bacteria 7039503
842 2874593780 2874590934 Bacteria 8299676
843 2874606997 2874604998 Bacteria 7834745
844 2874621994 2874620515 Bacteria 8290088
845 2874629345 2874628541 Bacteria 8630250
846 2874648019 2874645413 Bacteria 8214782
847 2876762366 2876761206 Bacteria 10111113
848 2876772005 2876771140 Bacteria 8287509
849 2876812664 2876808645 Bacteria 8824342
850 2876826400 2876818435 Bacteria 8274608
851 2879077567 2879074833 Bacteria 8279565
852 2879089560 2879083081 Bacteria 8587928
853 2879105493 2879099564 Bacteria 10442239
854 2879115068 2879110137 Bacteria 8907982
855 2879134352 2879127579 Bacteria 8294491
856 2885369087 2885366525 Bacteria 8326213
857 2885392194 2885383462 Bacteria 9473874
858 2888380170 2888378607 Bacteria 9652610
859 2888390134 2888388044 Bacteria 7304136
860 2888420928 2888419890 Bacteria 7857137
861 2889034907 2889033259 Bacteria 9099371
862 2903727773 2903727486 Bacteria 8281579
863 2903773073 2903768456 Bacteria 9749579
864 2904669414 2904666416 Bacteria 8226587
865 2904714471 2904711408 Bacteria 9771557
866 2906602741 2906602504 Bacteria 8295279
867 2906644530 2906643746 Bacteria 8722424
868 2922377705
869 2929623325 2929615660 Bacteria 9193770
870 2929632584 2929624759 Bacteria 9339455
871 2932788202 2932784394 Bacteria 9704911
872 2932794847 2932794094 Bacteria 7915132
873 2932805361 2932801729 Bacteria 7987968
874 2932813573 2932809354 Bacteria 9135765
875 2932832663 2932828146 Bacteria 9745859
876 2933585228 2933577622 Bacteria 9116884
877 2935614795 2935608549 Bacteria 8203142
878 2935620153 2935616580 Bacteria 9032984
879 2935640471 2935638405 Bacteria 10015038
880 2935649193 2935648319 Bacteria 8801166
881 2935658035 2935656913 Bacteria 8965014
882 2935668665 2935665750 Bacteria 9571747
883 2935681967 2935675223 Bacteria 9928132
884 2935686973 2935684952 Bacteria 9590419
885 2935697057 2935694250 Bacteria 9291695
886 2935709825 2935703347 Bacteria 10242284
887 2935716661 2935713505 Bacteria 9608509
888 2935723214 2935722832 Bacteria 9608746
889 2935734771 2935732158 Bacteria 9706831
890 2935744438 2935741537 Bacteria 9707219
891 2935752939 2935750917 Bacteria 9590372
892 2935766837 2935760218 Bacteria 9817913
893 2935775601 2935769743 Bacteria 7878163
894 2935777947 2935777560 Bacteria 8077691
895 2935791345 2935785616 Bacteria 7962367
896 2935799657 2935793552 Bacteria 8012592
897 2935804585 2935801545 Bacteria 9301974
898 2935815738 2935810662 Bacteria 9401221
899 2935826165 2935819856 Bacteria 8261050
900 2935831977 2935827899 Bacteria 10038562
901 2935841191 2935837841 Bacteria 9454360
902 2935853661 2935847175 Bacteria 8228321
903 2935859039 2935855204 Bacteria 9035059
904 2935864220 2935864058 Bacteria 9784707
905 2935875428 2935873716 Bacteria 9632195
906 2935887558 2935883170 Bacteria 7964738
907 2935964300 2935959822 Bacteria 7869783
908 2935978396 2935975950 Bacteria 8347125
909 2935985472 2935984226 Bacteria 8302647
910 2935995593 2935992306 Bacteria 9802711
911 2936008013 2936002035 Bacteria 9362176
912 2936012254 2936011229 Bacteria 8801034
913 2936020665 2936019824 Bacteria 8804134
914 2936029547 2936028420 Bacteria 8965941
915 2936041640 2936037263 Bacteria 9446081
916 2936048129 2936046547 Bacteria 8903709
917 2936056760 2936055302 Bacteria 8785755
918 2940558852 2940556831 Bacteria 9590747
919 2941532213 2941531003 Bacteria 7653939
920 2941543417 2941538514 Bacteria 9402094
921 3005506451 3005506211 Bacteria 6943378
922 3005597929 3005594810 Bacteria 8716512
923 3005602026 3005594810 Bacteria 8716512
924 3005717760 3005710791 Bacteria 7622528
925 3005724807 3005718088 Bacteria 8283608
926 8006929228 8006926726 Bacteria 6749210
927 8006988551 8006984368 Bacteria 9651211
928 8016517570 8016511872 Bacteria 9921665
929 8016531847 8016530956 Bacteria 8155261
930 8016545048 8016539877 Bacteria 8155419
931 8016557031 8016548790 Bacteria 8155074
932 8016565377 8016557553 Bacteria 8154380
933 8016570124 8016566248 Bacteria 8158151
934 8016582691 8016575299 Bacteria 8154085
935 8016585632 8016583857 Bacteria 10421953
936 8016603016 8016595262 Bacteria 8149947
937 8016605915 8016603502 Bacteria 8731218
938 8016617805 8016613128 Bacteria 8794220
939 8016635091 8016630954 Bacteria 9217207
940 8017059050 8017057580 Bacteria 10023680
941 8019531670 8019530166 Bacteria 8155624
942 8019539869 8019538911 Bacteria 7872763
943 8019550789 8019547302 Bacteria 7996444
944 8019607099 8019597564 Bacteria 10041141
945 8019611410 8019608314 Bacteria 10042931
946 8019622155 8019619141 Bacteria 9218857
947 8019631157 8019629233 Bacteria 8687553
948 8019651888 8019648815 Bacteria 10014479
949 8019667965 8019659431 Bacteria 8577854
950 8019687568 8019678201 Bacteria 8863603
951 8055743267 8055742211 Bacteria 9226248
952 8056975528 8056967851 Bacteria 9038162
953 JGI24740J21852_10070279
954 JGI24743J22301_10023047
955 JGI24735J21928_10118153
956 JGI24750J21931_1022862
957 JGI24745J21846_1026411
958 JGI24033J26618_1009455
959 JGI25153J46596_10002687
960 JGI25153J46596_10027497
961 JGI25160J50197_1002508
962 JGI25160J50197_1013763
963 JGI25404J52841_10001084
964 JGI25404J52841_10049795
965 JGI25404J52841_10064653
966 Ga0055539_1001877
967 Ga0055539_1015542
968 Ga0055524_1028043
969 Ga0055531_10004010
970 JGI25405J52794_10062418
971 Ga0055543_1002823
972 Ga0065165_1001384
973 Ga0065165_1001884
974 Ga0065165_1018981
975 Ga0065707_10273844
976 Ga0070658_10410692
977 Ga0070658_10793941
978 Ga0070676_10264009
979 Ga0070670_100292145
980 Ga0068869_100024100
981 Ga0070666_10081184
982 Ga0068868_100368121
983 Ga0068868_101144159
984 Ga0070660_100172075
985 Ga0070660_100385894
986 Ga0070689_100071006
987 Ga0070689_100541942
988 Ga0070691_10325113
989 Ga0070668_100087736
990 Ga0070675_100107631
991 Ga0070671_100027203
992 Ga0070671_100152948
993 Ga0070674_100030159
994 Ga0070674_100345721
995 Ga0070674_100751708
996 Ga0070659_100215494
997 Ga0070659_100368753
998 Ga0070659_100531800
999 Ga0070659_100732305
1000 Ga0070667_100034414
1001 Ga0070667_100077183
1002 Ga0070667_100324031
1003 Ga0070667_100414486
1004 Ga0070709_10025076
1005 Ga0070714_100154939
1006 Ga0070714_100158138
1007 Ga0070714_100273529
1008 Ga0070714_100462159
1009 Ga0070710_10007676
1010 Ga0070710_10017497
1011 Ga0070710_10350754
1012 Ga0070711_100030689
1013 Ga0070705_100296465
1014 Ga0070708_100814579
1015 Ga0070663_100037260
1016 Ga0070663_100086966
1017 Ga0070663_100332838
1018 Ga0070663_100393936
1019 Ga0070678_100074704
1020 Ga0070678_100560341
1021 Ga0070681_10320167
1022 Ga0070681_10727242
1023 Ga0068867_100072410
1024 Ga0068867_100103438
1025 Ga0070685_10045784
1026 Ga0070707_100590661
1027 Ga0070698_101029749
1028 Ga0070699_100457330
1029 Ga0070679_100062825
1030 Ga0070697_100036552
1031 Ga0068853_100191217
1032 Ga0068853_100233952
1033 Ga0070672_100234298
1034 Ga0070672_100897753
1035 Ga0070686_100140531
1036 Ga0070695_100241095
1037 Ga0070693_100045107
1038 Ga0070665_100052003
1039 Ga0070665_100072030
1040 Ga0070665_100170781
1041 Ga0070704_100666831
1042 Ga0068855_100081565
1043 Ga0068855_100147563
1044 Ga0068855_100299849
1045 Ga0068855_100305999
1046 Ga0068857_100886721
1047 Ga0068854_100092286
1048 Ga0068854_100554959
1049 Ga0068854_100996930
1050 Ga0068856_100044076
1051 Ga0068856_100090558
1052 Ga0068856_100166604
1053 Ga0068856_100739463
1054 Ga0068852_100120915
1055 Ga0068852_100445222
1056 Ga0068859_100136339
1057 Ga0068859_100408096
1058 Ga0068864_100070647
1059 Ga0068864_100168995
1060 Ga0068861_100451940
1061 Ga0068861_100524811
1062 Ga0068851_10176709
1063 Ga0068863_100168896
1064 Ga0068863_100222282
1065 Ga0068863_100654027
1066 Ga0068858_100074099
1067 Ga0068858_100229804
1068 Ga0068860_100002365
1069 Ga0068862_100101137
1070 Ga0068862_100480778
1071 Ga0081455_10010801
1072 Ga0081455_10091185
1073 Ga0081540_1007106
1074 Ga0081540_1017698
1075 Ga0081540_1055431
1076 Ga0081540_1091411
1077 Ga0081539_10042008
1078 Ga0070717_10127083
1079 Ga0070717_10479605
1080 Ga0070717_10623295
1081 Ga0070717_11069856
1082 Ga0075365_10043967
1083 Ga0075365_10133466
1084 Ga0075365_10243026
1085 Ga0075365_10309864
1086 Ga0075365_10730304
1087 Ga0075368_10044809
1088 Ga0075368_10123050
1089 Ga0075363_100031396
1090 Ga0075363_100032809
1091 Ga0075363_100061975
1092 Ga0075363_100274761
1093 Ga0075364_10045198
1094 Ga0075364_10051953
1095 Ga0075364_10185016
1096 Ga0070715_10112384
1097 Ga0070716_100029491
1098 Ga0070716_100715182
1099 Ga0070716_100871980
1100 Ga0070712_100002502
1101 Ga0075362_10137835
1102 Ga0075362_10328390
1103 Ga0075367_10265906
1104 Ga0075367_10330149
1105 Ga0075367_10382843
1106 Ga0075369_10016277
1107 Ga0075369_10022274
1108 Ga0075369_10101314
1109 Ga0075369_10110338
1110 Ga0075366_10037190
1111 Ga0075366_10063261
1112 Ga0075366_10090908
1113 Ga0097621_100365856
1114 Ga0097621_100598381
1115 Ga0075370_10017101
1116 Ga0075370_10059735
1117 Ga0075370_10144586
1118 Ga0068871_100356171
1119 Ga0075428_100093432
1120 Ga0075428_100132488
1121 Ga0075433_10365808
1122 Ga0075434_100087181
1123 Ga0075434_100749266
1124 Ga0075429_100194312
1125 Ga0068865_100088840
1126 Ga0097620_100136346
1127 Ga0097620_100408126
1128 Ga0099825_1033069
1129 Ga0099794_10061677
1130 Ga0099794_10222771
1131 Ga0099794_10262116
1132 Ga0099794_10298374
1133 Ga0099795_10199026
1134 Ga0105250_10248742
1135 Ga0105240_10038100
1136 Ga0105240_11380544
1137 Ga0105245_10126357
1138 Ga0105247_10053579
1139 Ga0105247_10582522
1140 Ga0114129_10115775
1141 Ga0114129_11271383
1142 Ga0105243_10095149
1143 Ga0105243_10251585
1144 Ga0105243_10407851
1145 Ga0105241_10043287
1146 Ga0105241_10055235
1147 Ga0105241_10059854
1148 Ga0105241_10431244
1149 Ga0105242_10129450
1150 Ga0105242_10685197
1151 Ga0105248_10125872
1152 Ga0105248_10148714
1153 Ga0105248_10665719
1154 Ga0105248_10924498
1155 Ga0105237_10053369
1156 Ga0105237_10083423
1157 Ga0105237_10133518
1158 Ga0105237_10141114
1159 Ga0105237_10264580
1160 Ga0105237_10309456
1161 Ga0105237_10782514
1162 Ga0105238_10052077
1163 Ga0105238_10161889
1164 Ga0105238_10375968
1165 Ga0105238_10435593
1166 Ga0105239_10029068
1167 Ga0105239_10155030
1168 Ga0105239_10178855
1169 Ga0105239_10230928
1170 Ga0105239_10337634
1171 Ga0105239_10785769
1172 Ga0105246_10317492
1173 Ga0105246_10650685
1174 Ga0157373_10241439
1175 Ga0157373_10710703
1176 Ga0157370_10037004
1177 Ga0157370_10087858
1178 Ga0157370_10468590
1179 Ga0157370_11045805
1180 Ga0157369_10005008
1181 Ga0157369_10031311
1182 Ga0157369_11002269
1183 Ga0157374_10272618
1184 Ga0157374_10311256
1185 Ga0157374_11058568
1186 Ga0157378_10391795
1187 Ga0157378_11221886
1188 Ga0163162_10110805
1189 Ga0163162_10164198
1190 Ga0163162_10753070
1191 Ga0157372_10599617
1192 Ga0157372_10692354
1193 Ga0157372_11209546
1194 Ga0157375_10185462
1195 Ga0157375_10203640
1196 Ga0163163_10209798
1197 Ga0163163_10366657
1198 Ga0163163_10475472
1199 Ga0157380_10048480
1200 Ga0157380_10355892
1201 Ga0182008_10135735
1202 Ga0182008_10345411
1203 Ga0182008_10429229
1204 Ga0157377_10127433
1205 Ga0157379_10137333
1206 Ga0157379_11227605
1207 Ga0157376_10233249
1208 Ga0157376_10233853
1209 Ga0182007_10024034
1210 Ga0163161_10066888
1211 Ga0163161_10436629
1212 Ga0163161_10461145
1213 Ga0197907_11128244
1214 Ga0206350_11642153
1215 Ga0154015_1675993
1216 Ga0213871_10056169
1217 Ga0213871_10110699
1218 Ga0224712_10325459
1219 Ga0209563_101023
1220 Ga0207425_1003754
1221 Ga0209677_100296
1222 Ga0209677_101907
1223 Ga0209148_1002306
1224 Ga0209233_1002524
1225 Ga0209233_1018863
1226 Ga0209233_1020913
1227 Ga0209455_1006532
1228 Ga0209455_1009306
1229 Ga0209673_1047456
1230 Ga0209564_1007378
1231 Ga0209758_1000030
1232 Ga0209758_1004010
1233 Ga0209758_1004113
1234 Ga0209758_1004414
1235 Ga0209758_1004721
1236 Ga0209758_1004871
1237 Ga0209758_1014782
1238 Ga0209256_1009896
1239 Ga0207426_1000380
1240 Ga0207426_1000905
1241 Ga0207426_1005208
1242 Ga0209257_1005857
1243 Ga0207697_10072769
1244 Ga0207697_10096908
1245 Ga0207692_10011512
1246 Ga0207710_10045476
1247 Ga0207710_10110943
1248 Ga0207710_10116927
1249 Ga0207710_10150203
1250 Ga0207688_10042822
1251 Ga0207688_10082752
1252 Ga0207688_10146781
1253 Ga0207680_10067865
1254 Ga0207680_10079259
1255 Ga0207647_10015238
1256 Ga0207647_10128945
1257 Ga0207647_10155707
1258 Ga0207685_10375779
1259 Ga0207699_10139579
1260 Ga0207699_10183133
1261 Ga0207699_10314395
1262 Ga0207645_10180374
1263 Ga0207643_10138465
1264 Ga0207705_10555863
1265 Ga0207654_10061259
1266 Ga0207654_10087934
1267 Ga0207654_10126733
1268 Ga0207707_10424760
1269 Ga0207695_10000059
1270 Ga0207695_10034149
1271 Ga0207671_10008401
1272 Ga0207671_10056398
1273 Ga0207671_10088417
1274 Ga0207671_10323493
1275 Ga0207671_10425439
1276 Ga0207693_10081806
1277 Ga0207663_10024893
1278 Ga0207663_10220289
1279 Ga0207660_10133283
1280 Ga0207657_10001268
1281 Ga0207657_10043103
1282 Ga0207649_10180389
1283 Ga0207649_10254277
1284 Ga0207649_10283998
1285 Ga0207652_10258957
1286 Ga0207694_10057528
1287 Ga0207694_10283551
1288 Ga0207694_10320498
1289 Ga0207650_10848416
1290 Ga0207659_10254277
1291 Ga0207700_10008094
1292 Ga0207700_10181917
1293 Ga0207700_10760503
1294 Ga0207700_11054673
1295 Ga0207664_10173894
1296 Ga0207664_10747822
1297 Ga0207644_10660412
1298 Ga0207706_10076709
1299 Ga0207706_10412904
1300 Ga0207706_10483436
1301 Ga0207686_10278834
1302 Ga0207709_10098314
1303 Ga0207709_10620170
1304 Ga0207670_10046923
1305 Ga0207669_10237752
1306 Ga0207669_10518106
1307 Ga0207704_10212465
1308 Ga0207665_10069217
1309 Ga0207665_10239356
1310 Ga0207691_10306513
1311 Ga0207691_10358942
1312 Ga0207691_10485102
1313 Ga0207711_10081814
1314 Ga0207711_10254332
1315 Ga0207689_10105026
1316 Ga0207689_10171259
1317 Ga0207689_10184381
1318 Ga0207679_10344389
1319 Ga0207679_10973607
1320 Ga0207667_10114654
1321 Ga0207667_10149431
1322 Ga0207712_10096271
1323 Ga0207712_10184368
1324 Ga0207668_10182755
1325 Ga0207668_10216756
1326 Ga0207658_11198525
1327 Ga0207677_10130326
1328 Ga0207677_10148005
1329 Ga0207677_10353590
1330 Ga0207703_10039702
1331 Ga0207703_10129381
1332 Ga0207703_10221845
1333 Ga0207639_10128202
1334 Ga0207639_10338048
1335 Ga0207678_10059949
1336 Ga0207678_10199350
1337 Ga0207678_10223682
1338 Ga0207678_10310594
1339 Ga0207708_10092119
1340 Ga0207702_10543077
1341 Ga0207641_10755166
1342 Ga0207648_10062167
1343 Ga0207648_10131935
1344 Ga0207648_10183982
1345 Ga0207676_10112407
1346 Ga0207674_10057755
1347 Ga0207674_10065875
1348 Ga0207674_10424833
1349 Ga0207674_10658347
1350 Ga0207675_100472370
1351 Ga0207683_10203024
1352 Ga0207683_10246026
1353 Ga0207683_10473755
1354 Ga0209389_1000422
1355 Ga0209489_104637
1356 Ga0209700_100018
1357 Ga0209813_10024408
1358 Ga0207428_10272567
1359 Ga0268266_10010325
1360 Ga0268266_10028219
1361 Ga0268266_10038564
1362 Ga0268266_10048665
1363 Ga0268265_10009382
1364 Ga0268265_10037688
1365 Ga0268265_10333454
1366 Ga0268264_10000049
1367 Ga0268264_10182106
1368 Ga0265326_10013524
1369 Ga0265319_1029105
1370 Ga0265334_10001384
1371 Ga0265336_10000786
1372 Ga0307515_10564010
1373 Ga0265338_10000024
1374 Ga0265324_10005055
1375 Ga0307511_10224668
1376 Ga0265330_10012419
1377 Ga0265339_10007762
1378 Ga0307513_10532916
1379 Ga0307509_10119807
1380 Ga0307509_10283896
1381 Ga0307408_100089127
1382 Ga0307508_10000397
1383 Ga0265314_10063520
1384 Ga0307516_10009088
1385 Ga0307516_10123654
1386 Ga0307413_10102293
1387 Ga0307406_10137379
1388 Ga0307406_10276284
1389 Ga0307407_10153833
1390 Ga0307412_10161294
1391 Ga0307409_100590092
1392 Ga0307416_100259261
1393 Ga0307416_100985101
1394 Ga0307414_10940760
1395 Ga0307415_100177548
1396 Ga0307510_10062668
1397 Ga0307510_10081497
1398 Ga0373954_0057840
1399 Ga0373961_0200870
1400 Ga0373927_0185960
1401 Ga0373933_0000184
1402 Ga0373947_0027631
1403 Ga0373937_0056787
1404 Ga0373925_0379381
1405 Ga0395900_0002921
1406 Ga0395900_0052474
1407 Ga0395898_0044675
1408 Ga0395898_0072179
1409 Ga0395898_0234635
1410 Ga0395898_0476664
1411 Ga0395905_0007671
1412 Ga0436364_0575382
1413 Ga0395901_0045452
1414 Ga0395901_0218302
1415 Ga0436365_0939836
1416 Ga0436365_1449853
1417 Ga0436360_0361752
1418 Ga0436361_0772824
1419 Ga0436361_1020089
1420 Ga0436363_1552770
1421 Ga0451791_0864963
1422 Ga0451793_1259725
1423 Ga0451797_0338536
1424 Ga0451795_0008202
1425 Ga0451798_0278979
1426 Ga0451802_0733235
1427 Ga0451802_1734208
1428 Ga0451804_1066560
1429 Ga0451833_1100129
1430 Ga0451835_0707947
1431 Ga0451849_0998563
1432 Ga0451849_1521950
1433 Ga0451855_0185743
1434 Ga0439445_0086756
1435 Ga0439455_0084448
1436 Ga0466969_0069821
1437 Ga0466972_0136946
1438 Ga0466965_0140215
1439 Ga0466961_0261509
1440 Ga0466963_0215843
1441 Ga0466964_0071643
1442 Ga0466964_0120971
1443 Ga0466968_0012068
1444 Ga0466968_0015164
1445 Ga0466970_0044021
1446 Ga0466957_0353290
1447 Ga0466960_0010496
1448 Ga0466960_0239294
1449 Ga0466959_0336918
1450 Ga0466959_0551677
1451 Ga0466967_0858212
1452 Ga0495617_143334
1453 Ga0495627_117765
1454 Ga0495592_0013603
1455 Ga0495592_0093899
1456 Ga0495603_0326166
1457 Ga0495629_0017024
1458 Ga0495638_0006107
1459 Ga0495638_0250871
1460 Ga0495641_0233390
1461 Ga0495651_0015787
1462 Ga0495651_0132246
1463 Ga0495653_0419365
1464 Ga0495662_0122125
1465 Ga0495664_0017988
1466 Ga0495585_0158060
1467 Ga0495585_0445194
1468 Ga0495594_0090495
1469 Ga0495594_0183973
1470 Ga0495596_0162244
1471 Ga0495583_0091164
1472 Ga0495583_0091199
1473 Ga0495606_0015595
1474 Ga0495606_0015792
1475 Ga0495606_0254475
1476 Ga0495608_0060838
1477 Ga0495618_0065943
1478 Ga0495620_0044782
1479 Ga0495631_0203979
1480 Ga0495632_0153854
1481 Ga0495632_0181689
1482 Ga0495643_0011879
1483 Ga0495643_0040023
1484 Ga0495643_0124899
1485 Ga0495644_0028972
1486 Ga0495648_0064211
1487 Ga0495648_0085990
1488 Ga0495663_0012568
1489 Ga0495642_0329192
1490 Ga0495652_0049518
1491 Ga0495652_0169370
1492 Ga0495654_0079503
1493 Ga0495640_0117591
1494 Ga0495640_0134135
1495 Ga0495587_0049180
1496 Ga0495598_0090972
1497 Ga0495609_0055427
1498 Ga0495609_0097300
1499 Ga0495621_0083196
1500 Ga0495597_0015757
1501 Ga0495645_0011219
1502 Ga0495622_0012074
1503 Ga0495622_0020966
1504 Ga0495622_0170880
1505 Ga0495667_0071025
1506 Ga0495656_0013227
1507 Ga0495656_0134318
1508 Ga0495668_0016967
1509 Ga0495668_0456479
1510 Ga0495611_0051238
1511 Ga0495611_0107749
1512 Ga0495625_0086912
1513 Ga0495635_0039768
1514 Ga0495659_0032034
1515 Ga0495659_0090634
1516 Ga0495661_0056070
1517 Ga0495661_0265131
1518 Ga0495588_0017782
1519 Ga0495588_0092663
1520 Ga0495588_0269398
1521 Ga0495599_0023972
1522 Ga0495599_0098729
1523 Ga0495646_0069090
1524 Ga0495646_0134730
1525 Ga0495669_0002847
1526 Ga0495613_0075255
1527 Ga0495613_0377547
1528 Ga0495624_0207387
1529 Ga0495624_0223924
1530 Ga0495671_0153421
1531 Ga0495649_0239079
1532 Ga0495600_0162083
1533 Ga0495660_0136494
1534 Ga0495581_0037811
1535 Ga0495604_0013629
1536 Ga0495604_0262298
1537 Ga0495636_0028358
1538 Ga0495636_0304841
1539 Ga0495672_0025297
1540 Ga0495680_0010136
1541 Ga0495680_0056184
1542 Ga0495683_0029412
1543 Ga0495687_022001
1544 Ga0495679_017376
1545 Ga0495673_0038506
1546 Ga0495673_0052399
1547 Ga0495673_0121419
1548 Ga0495681_0234879
1549 Ga0495602_0050311
1550 Ga0495626_0103962
1551 Ga0496100_0137695
1552 Ga0496101_0099300
1553 Ga0496101_0142929
1554 Ga0496101_0753899
1555 Ga0496102_0001927
1556 Ga0496103_0008691
1557 Ga0496103_0705031
1558 Ga0496104_0013299
1559 Ga0496104_0052875
1560 Ga0496104_0420274
1561 Ga0496104_0482713
1562 Ga0496105_0008929
1563 Ga0496105_0040401
1564 Ga0496106_0007753
1565 Ga0496106_0541440
1566 Ga0496106_0551014
1567 Ga0496107_0162459
1568 Ga0496108_0060921
1569 Ga0496108_0244693
1570 Ga0496108_0477119
1571 Ga0496109_0051675
1572 Ga0496109_0382161
1573 Ga0496109_0781699
1574 Ga0496110_0021279
1575 Ga0496110_0111957
1576 Ga0496110_0240179
1577 Ga0496110_0255516
1578 Ga0496111_0108568
1579 Ga0496112_0126590
1580 Ga0496112_0353626
1581 Ga0496113_0032457
1582 Ga0496113_0042908
1583 Ga0496113_0043780
1584 Ga0496114_0014098
1585 Ga0496115_0137042
1586 Ga0496115_0269402
1587 Ga0496115_0618978
1588 Ga0496116_0000934
1589 Ga0496116_0044302
1590 Ga0496117_0076442
1591 Ga0496117_0096089
1592 Ga0496117_0190106
1593 Ga0496117_0286943
1594 Ga0496118_0006819
1595 Ga0496118_0062580
1596 Ga0496118_0065220
1597 Ga0496118_0207495
1598 Ga0496118_0213770
1599 Ga0496118_0216553
1600 Ga0496119_0027312
1601 Ga0496119_0090300
1602 Ga0496119_0115149
1603 Ga0496119_0158387
1604 Ga0496121_0000998
1605 Ga0496121_0025232
1606 Ga0496121_0049187
1607 Ga0496121_0068950
1608 Ga0496121_0166731
1609 Ga0496121_0281393
1610 Ga0496121_0413836
1611 Ga0496122_0036435
1612 Ga0496122_0150419
1613 Ga0496123_0179418
1614 Ga0496124_0005318
1615 Ga0496124_0030909
1616 Ga0496125_0000664
1617 Ga0496125_0022463
1618 Ga0496125_0030594
1619 Ga0496125_0072536
1620 Ga0496125_0102786
1621 Ga0496126_0009156
1622 Ga0496126_0011178
1623 Ga0496126_0041507
1624 Ga0496126_0045480
1625 Ga0496126_0093523
1626 Ga0496126_0094334
1627 Ga0496126_0101451
1628 Ga0496126_0103267
1629 Ga0496126_0118342
1630 Ga0496126_0248017
1631 Ga0496126_0266594
1632 Ga0496126_0499531
1633 Ga0495682_0006059
1634 Ga0501031_0314840
1635 Ga0501032_0128562
1636 Ga0501032_0224073
1637 Ga0501034_0133579
1638 Ga0501034_0450531
1639 Ga0501036_0142854
1640 Ga0501037_0030608
1641 Ga0501043_0759157
1642 Ga0501046_0108753
1643 Ga0501046_0150803
1644 Ga0501069_0061869
1645 Ga0501069_0107150
1646 Ga0501074_0074136
1647 Ga0501035_0026468
1648 Ga0501035_0030142
1649 Ga0501035_0660915
1650 Ga0501044_0117437
1651 Ga0501044_0155941
1652 Ga0501044_0294088
1653 nmdc:mga03683_103204_c2
1654 nmdc:mga03683_40398_c1
1655 nmdc:mga03683_93605_c1
1656 nmdc:mga03n38_16615_c1
1657 nmdc:mga00v17_104406_c1
1658 nmdc:mga00v17_466659_c1
1659 nmdc:mga00v17_85920_c1
1660 nmdc:mga0yw44_101965_c1
1661 nmdc:mga0yw44_14189_c1
1662 nmdc:mga0yw44_194988_c1
1663 nmdc:mga0yw44_339065_c1
1664 nmdc:mga0yw44_63420_c1
1665 nmdc:mga0yw44_778687_c1
1666 nmdc:mga0k408_208559_c1
1667 nmdc:mga0k408_2733_c1
1668 nmdc:mga0k408_40213_c1
1669 nmdc:mga06z11_13447_c1
1670 nmdc:mga06z11_140084_c1
1671 nmdc:mga06z11_281036_c1
1672 nmdc:mga06z11_343029_c1
1673 nmdc:mga04h51_38851_c1
1674 nmdc:mga04h51_7750_c1
1675 nmdc:mga07m45_102147_c1
1676 nmdc:mga07m45_111246_c1
1677 nmdc:mga07m45_268168_c1
1678 nmdc:mga07m45_7180_c2
1679 nmdc:mga07m45_98402_c1
1680 nmdc:mga05p37_258606_c1
1681 nmdc:mga08y16_330897_c1
1682 nmdc:mga0n895_85049_c1
1683 nmdc:mga0rr50_65210_c1
1684 nmdc:mga08x19_198067_c1
1685 nmdc:mga0a205_209296_c1
1686 nmdc:mga0sz30_109202_c1
1687 nmdc:mga0sz30_34453_c1
1688 nmdc:mga0sz30_61261_c1
1689 Ga0500635_0009236
1690 Ga0500635_0130696
1691 Ga0495595_0313868
1692 Ga0500578_0089259
1693 Ga0500578_0108100
1694 Ga0500643_000231
1695 Ga0500646_0069980
1696 Ga0500647_0047063
1697 Ga0500583_0007518
1698 Ga0500583_0280862
1699 Ga0500566_0030213
1700 Ga0500641_0034829
1701 Ga0500554_028804
1702 Ga0500555_000892
1703 Ga0500556_0044676
1704 Ga0500557_000224
1705 Ga0500557_060383
1706 Ga0500562_011820
1707 Ga0500569_112164
1708 Ga0500592_006320
1709 Ga0500594_0024122
1710 Ga0500594_0035000
1711 Ga0500595_084342
1712 Ga0500595_089024
1713 Ga0500597_129955
1714 Ga0500607_132870
1715 Ga0500607_136812
1716 Ga0500608_118696
1717 Ga0500614_110981
1718 Ga0500618_035462
1719 Ga0500642_0050889
1720 Ga0500642_0132866
1721 Ga0500658_0023093
1722 Ga0500559_0000379
1723 Ga0500559_0040095
1724 Ga0500559_0057617
1725 Ga0500577_0064390
1726 Ga0500577_0088980
1727 Ga0500588_0040620
1728 Ga0500589_045114
1729 Ga0500589_103424
1730 Ga0500590_051705
1731 Ga0500603_001753
1732 Ga0500604_0087764
1733 Ga0500616_0013977
1734 Ga0500622_0027617
1735 Ga0500622_0066951
1736 Ga0500627_0041455
1737 Ga0500633_0108871
1738 Ga0500634_0072196
1739 Ga0500638_035164
1740 Ga0500636_0000301
1741 Ga0500636_0097364
1742 Ga0500637_0048629
1743 Ga0500637_0050591
1744 Ga0500576_066629
1745 Ga0500625_006641
1746 Ga0500609_003727
1747 Ga0500609_034080
1748 Ga0500596_039239
1749 Ga0500601_004555
1750 Ga0500601_006109
1751 Ga0500661_007550
1752 8056688955
1753 2507505744
1754 2508539940
1755 2508696005
1756 2509150776
1757 2511398866
1758 2513649442
1759 2513678361
1760 2513715542
1761 2513874054
1762 2514010175
1763 2515627731
1764 2517107023
1765 2524467867
1766 2528854744
1767 2603858072
1768 2617350183
1769 2723842145
1770 2793059174
1771 2805920411
1772 2818237120
1773 2824603596
1774 2824610987
1775 2824664322
1776 2824678180
1777 2824694561
1778 2824698611
1779 2824709322
1780 2824754863
1781 2824765283
1782 2824778123
1783 2838125912
1784 2841942694
1785 2841952955
1786 2841962962
1787 2841971018
1788 2841977724
1789 2841984714
1790 2844321652
1791 2847939635
1792 2847943089
1793 2849076835
1794 2874593780
1795 2874606997
1796 2874621994
1797 2874629345
1798 2874648019
1799 2876762366
1800 2876772005
1801 2876812664
1802 2876826400
1803 2879077567
1804 2879089560
1805 2879105493
1806 2879115068
1807 2879134352
1808 2885369087
1809 2885392194
1810 2888380170
1811 2888390134
1812 2888420928
1813 2889034907
1814 2903727773
1815 2903773073
1816 2904669414
1817 2904714471
1818 2906602741
1819 2906644530
1820 2922377705
1821 2929623325
1822 2929632584
1823 2932788202
1824 2932794847
1825 2932805361
1826 2932813573
1827 2932832663
1828 2933585228
1829 2935614795
1830 2935620153
1831 2935640471
1832 2935649193
1833 2935658035
1834 2935668665
1835 2935681967
1836 2935686973
1837 2935697057
1838 2935709825
1839 2935716661
1840 2935723214
1841 2935734771
1842 2935744438
1843 2935752939
1844 2935766837
1845 2935775601
1846 2935777947
1847 2935791345
1848 2935799657
1849 2935804585
1850 2935815738
1851 2935826165
1852 2935831977
1853 2935841191
1854 2935853661
1855 2935859039
1856 2935864220
1857 2935875428
1858 2935887558
1859 2935964300
1860 2935978396
1861 2935985472
1862 2935995593
1863 2936008013
1864 2936012254
1865 2936020665
1866 2936029547
1867 2936041640
1868 2936048129
1869 2936056760
1870 2940558852
1871 2941532213
1872 2941543417
1873 3005506451
1874 3005597929
1875 3005602026
1876 3005717760
1877 3005724807
1878 8006929228
1879 8006988551
1880 8016517570
1881 8016531847
1882 8016545048
1883 8016557031
1884 8016565377
1885 8016570124
1886 8016582691
1887 8016585632
1888 8016603016
1889 8016605915
1890 8016617805
1891 8016635091
1892 8017059050
1893 8019531670
1894 8019539869
1895 8019550789
1896 8019607099
1897 8019611410
1898 8019622155
1899 8019631157
1900 8019651888
1901 8019667965
1902 8019687568
1903 8055743267
1904 8056975528

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

25

93

0.94

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

16

92

0.93

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

117

206

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

120

201

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

20

98

0.87

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

120

215

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uap-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath 0.9815 2 201
1pmt-assembly1.cif.gz_A glutathione transferase from proteus mirabilis 0.9786 1 201
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.9785 1 200
4gci-assembly1.cif.gz_B crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione, monoclinic form 0.9773 2 199
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.9738 1 200
ID Description Score Start End Superfamily
af_P0A9D2_2_199_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9769 3 199 3.50.50.60
af_P0A9D2_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9731 1 79 3.40.30.10
af_P0A9D2_2_199_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9673 3 199 3.50.50.60
4gf0B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9666 1 80 3.40.30.10
2dsaD02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9634 83 188 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A2J4QS22-F1-model_v4 Glutathione transferase GstA 0.9944 1 69 GO:0016740
AF-A0A4Q5Y0N2-F1-model_v4 deleted 0.9908 1 74
AF-A0A849KJL6-F1-model_v4 Glutathione transferase GstA (EC 2.5.1.18) 0.9886 2 202 GO:0016740
AF-A0A2K4Y2H2-F1-model_v4 deleted 0.9884 1 201
AF-A0A7U3Z1M1-F1-model_v4 Glutathione S-transferase domain protein 0.9875 1 201 GO:0016740

Map