F486538
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 949 | 287 | 949 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0213573|Ga0496104_0213573_1164_1736 |
| Length | 190 |
| Sequence | LGFQPAAVAGYAGSGADHEKDKSMDEAERKIALRMIPYGIYVMTAAGADNSLAAATVNWVTQTSFSPPLLAIGVKSDSGVYAAAKASGHFALNILGKGQQGAAFAFFKPAVLEDGKLSGEEIGWAANGAPVLKSAPAVVECRVAQIVELGDHHTFIAEVTGVHVHQHPEGRPDMAVLEMKDLGDKVFYGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 213 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 214 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 215 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 216 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 217 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 239 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 284 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 285 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10102921 | 3300003203 | Unclassified | 850 |
| 2 | JGI26128J50194_1007436 | 3300003347 | Unclassified | 705 |
| 3 | JGI25405J52794_10000633 | 3300003911 | Bacteria | 5264 |
| 4 | Ga0058859_10044750 | 3300004798 | Bacteria | 1833 |
| 5 | Ga0058859_11819114 | 3300004798 | Unclassified | 737 |
| 6 | Ga0058860_11187877 | 3300004801 | Unclassified | 574 |
| 7 | Ga0058860_12238848 | 3300004801 | Unclassified | 1073 |
| 8 | Ga0065712_10037114 | 3300005290 | Bacteria | 919 |
| 9 | Ga0065715_10118079 | 3300005293 | Bacteria | 2327 |
| 10 | Ga0065707_10023398 | 3300005295 | Bacteria | 1525 |
| 11 | Ga0065707_10194343 | 3300005295 | Bacteria | 1344 |
| 12 | Ga0065707_10364960 | 3300005295 | Bacteria | 852 |
| 13 | Ga0070676_10000227 | 3300005328 | Bacteria | 24062 |
| 14 | Ga0070676_10538316 | 3300005328 | Bacteria | 834 |
| 15 | Ga0070683_100133327 | 3300005329 | Bacteria | 2351 |
| 16 | Ga0070690_100900598 | 3300005330 | Bacteria | 692 |
| 17 | Ga0070670_100004572 | 3300005331 | Bacteria | 11607 |
| 18 | Ga0068869_100005890 | 3300005334 | Bacteria | 7740 |
| 19 | Ga0068869_100037331 | 3300005334 | Bacteria | 3454 |
| 20 | Ga0068869_100386964 | 3300005334 | Unclassified | 1147 |
| 21 | Ga0068869_100930135 | 3300005334 | Bacteria | 754 |
| 22 | Ga0070680_100006965 | 3300005336 | Bacteria | 8616 |
| 23 | Ga0070680_100112247 | 3300005336 | Bacteria | 2270 |
| 24 | Ga0070680_100460330 | 3300005336 | Unclassified | 1087 |
| 25 | Ga0070680_100543002 | 3300005336 | Bacteria | 996 |
| 26 | Ga0070682_100001390 | 3300005337 | Bacteria | 13645 |
| 27 | Ga0068868_100116790 | 3300005338 | Bacteria | 2173 |
| 28 | Ga0070660_100004277 | 3300005339 | Bacteria | 9863 |
| 29 | Ga0070689_100831178 | 3300005340 | Bacteria | 814 |
| 30 | Ga0070689_101665050 | 3300005340 | Bacteria | 580 |
| 31 | Ga0070691_10010815 | 3300005341 | Bacteria | 4163 |
| 32 | Ga0070691_10062295 | 3300005341 | Unclassified | 1796 |
| 33 | Ga0070691_10130076 | 3300005341 | Bacteria | 1275 |
| 34 | Ga0070687_100704490 | 3300005343 | Bacteria | 706 |
| 35 | Ga0070661_100000341 | 3300005344 | Bacteria | 37221 |
| 36 | Ga0070692_10074287 | 3300005345 | Bacteria | 1818 |
| 37 | Ga0070692_10141121 | 3300005345 | Bacteria | 1364 |
| 38 | Ga0070668_100434182 | 3300005347 | Bacteria | 1126 |
| 39 | Ga0070668_100723291 | 3300005347 | Bacteria | 879 |
| 40 | Ga0070669_100229391 | 3300005353 | Unclassified | 1471 |
| 41 | Ga0070669_100341484 | 3300005353 | Bacteria | 1214 |
| 42 | Ga0070669_100668224 | 3300005353 | Bacteria | 875 |
| 43 | Ga0070675_100373392 | 3300005354 | Bacteria | 1268 |
| 44 | Ga0070675_100774459 | 3300005354 | Bacteria | 876 |
| 45 | Ga0070671_100294112 | 3300005355 | Unclassified | 1382 |
| 46 | Ga0070673_100020228 | 3300005364 | Bacteria | 4797 |
| 47 | Ga0070673_100572645 | 3300005364 | Bacteria | 1028 |
| 48 | Ga0070688_100203874 | 3300005365 | Bacteria | 1385 |
| 49 | Ga0070659_100006955 | 3300005366 | Bacteria | 8192 |
| 50 | Ga0070703_10001000 | 3300005406 | Bacteria | 8889 |
| 51 | Ga0070703_10064800 | 3300005406 | Unclassified | 1205 |
| 52 | Ga0070703_10314664 | 3300005406 | Bacteria | 657 |
| 53 | Ga0070703_10340909 | 3300005406 | Bacteria | 637 |
| 54 | Ga0070709_10141820 | 3300005434 | Unclassified | 1652 |
| 55 | Ga0070711_100358979 | 3300005439 | Bacteria | 1173 |
| 56 | Ga0070705_100000347 | 3300005440 | Bacteria | 27333 |
| 57 | Ga0070705_100017997 | 3300005440 | Bacteria | 3696 |
| 58 | Ga0070705_100847235 | 3300005440 | Bacteria | 731 |
| 59 | Ga0070700_100060137 | 3300005441 | Bacteria | 2394 |
| 60 | Ga0070700_100083907 | 3300005441 | Bacteria | 2064 |
| 61 | Ga0070700_101012223 | 3300005441 | Bacteria | 684 |
| 62 | Ga0070694_100002904 | 3300005444 | Bacteria | 10181 |
| 63 | Ga0070694_100003572 | 3300005444 | Bacteria | 9292 |
| 64 | Ga0070694_100007439 | 3300005444 | Bacteria | 6677 |
| 65 | Ga0070694_100037649 | 3300005444 | Bacteria | 3209 |
| 66 | Ga0070694_100127919 | 3300005444 | Bacteria | 1831 |
| 67 | Ga0070694_100245565 | 3300005444 | Bacteria | 1352 |
| 68 | Ga0070708_100033790 | 3300005445 | Bacteria | 4444 |
| 69 | Ga0070708_100086698 | 3300005445 | Unclassified | 2844 |
| 70 | Ga0070708_100104594 | 3300005445 | Bacteria | 2596 |
| 71 | Ga0070708_100241513 | 3300005445 | Bacteria | 1696 |
| 72 | Ga0070708_100318338 | 3300005445 | Bacteria | 1465 |
| 73 | Ga0070708_100373423 | 3300005445 | Bacteria | 1344 |
| 74 | Ga0070708_100470603 | 3300005445 | Bacteria | 1186 |
| 75 | Ga0070708_100517177 | 3300005445 | Bacteria | 1126 |
| 76 | Ga0070708_100527874 | 3300005445 | Bacteria | 1113 |
| 77 | Ga0070708_100591943 | 3300005445 | Unclassified | 1046 |
| 78 | Ga0070708_100612254 | 3300005445 | Unclassified | 1027 |
| 79 | Ga0070708_100741436 | 3300005445 | Bacteria | 924 |
| 80 | Ga0070663_100008299 | 3300005455 | Bacteria | 6381 |
| 81 | Ga0070662_100012635 | 3300005457 | Bacteria | 5603 |
| 82 | Ga0070662_100794346 | 3300005457 | Bacteria | 804 |
| 83 | Ga0070681_10088095 | 3300005458 | Bacteria | 3057 |
| 84 | Ga0068867_100000705 | 3300005459 | Bacteria | 22254 |
| 85 | Ga0068867_100275717 | 3300005459 | Unclassified | 1377 |
| 86 | Ga0068867_101617145 | 3300005459 | Bacteria | 606 |
| 87 | Ga0070706_100007224 | 3300005467 | Bacteria | 10437 |
| 88 | Ga0070706_100028050 | 3300005467 | Bacteria | 5180 |
| 89 | Ga0070706_100041629 | 3300005467 | Bacteria | 4241 |
| 90 | Ga0070706_100078854 | 3300005467 | Unclassified | 3049 |
| 91 | Ga0070706_100090178 | 3300005467 | Bacteria | 2843 |
| 92 | Ga0070706_100120234 | 3300005467 | Bacteria | 2448 |
| 93 | Ga0070706_100191966 | 3300005467 | Unclassified | 1908 |
| 94 | Ga0070706_100233485 | 3300005467 | Bacteria | 1717 |
| 95 | Ga0070706_100349212 | 3300005467 | Bacteria | 1379 |
| 96 | Ga0070706_100406410 | 3300005467 | Unclassified | 1268 |
| 97 | Ga0070706_100422637 | 3300005467 | Bacteria | 1240 |
| 98 | Ga0070706_100437952 | 3300005467 | Unclassified | 1217 |
| 99 | Ga0070706_100682525 | 3300005467 | Unclassified | 953 |
| 100 | Ga0070706_101102139 | 3300005467 | Bacteria | 731 |
| 101 | Ga0070707_100011125 | 3300005468 | Bacteria | 8382 |
| 102 | Ga0070707_100012568 | 3300005468 | Bacteria | 7908 |
| 103 | Ga0070707_100026589 | 3300005468 | Bacteria | 5496 |
| 104 | Ga0070707_100044774 | 3300005468 | Bacteria | 4236 |
| 105 | Ga0070707_100070831 | 3300005468 | Bacteria | 3359 |
| 106 | Ga0070707_100184283 | 3300005468 | Bacteria | 2035 |
| 107 | Ga0070707_100187722 | 3300005468 | Bacteria | 2015 |
| 108 | Ga0070707_100205073 | 3300005468 | Bacteria | 1922 |
| 109 | Ga0070707_100295571 | 3300005468 | Bacteria | 1574 |
| 110 | Ga0070707_100297083 | 3300005468 | Unclassified | 1569 |
| 111 | Ga0070707_100298518 | 3300005468 | Bacteria | 1565 |
| 112 | Ga0070698_100002225 | 3300005471 | Bacteria | 21473 |
| 113 | Ga0070698_100040581 | 3300005471 | Bacteria | 4782 |
| 114 | Ga0070698_100046645 | 3300005471 | Bacteria | 4430 |
| 115 | Ga0070698_100225757 | 3300005471 | Unclassified | 1806 |
| 116 | Ga0070698_100233285 | 3300005471 | Bacteria | 1773 |
| 117 | Ga0070698_100276167 | 3300005471 | Bacteria | 1612 |
| 118 | Ga0070698_100461172 | 3300005471 | Bacteria | 1207 |
| 119 | Ga0070698_101319174 | 3300005471 | Bacteria | 672 |
| 120 | Ga0070699_100001487 | 3300005518 | Bacteria | 21471 |
| 121 | Ga0070699_100018486 | 3300005518 | Bacteria | 5986 |
| 122 | Ga0070699_100028870 | 3300005518 | Bacteria | 4782 |
| 123 | Ga0070699_100042645 | 3300005518 | Bacteria | 3926 |
| 124 | Ga0070699_100069410 | 3300005518 | Unclassified | 3062 |
| 125 | Ga0070699_100092422 | 3300005518 | Bacteria | 2646 |
| 126 | Ga0070699_100213010 | 3300005518 | Bacteria | 1720 |
| 127 | Ga0070699_100273996 | 3300005518 | Unclassified | 1511 |
| 128 | Ga0070699_100619971 | 3300005518 | Bacteria | 987 |
| 129 | Ga0070699_100677074 | 3300005518 | Bacteria | 942 |
| 130 | Ga0070699_101178143 | 3300005518 | Bacteria | 703 |
| 131 | Ga0070679_100000403 | 3300005530 | Bacteria | 36876 |
| 132 | Ga0070697_100013678 | 3300005536 | Bacteria | 6368 |
| 133 | Ga0070697_100028606 | 3300005536 | Bacteria | 4464 |
| 134 | Ga0070697_100079707 | 3300005536 | Bacteria | 2696 |
| 135 | Ga0070697_100085044 | 3300005536 | Bacteria | 2610 |
| 136 | Ga0070697_100151863 | 3300005536 | Unclassified | 1952 |
| 137 | Ga0070697_100493491 | 3300005536 | Unclassified | 1070 |
| 138 | Ga0070697_100500812 | 3300005536 | Bacteria | 1062 |
| 139 | Ga0068853_100000808 | 3300005539 | Bacteria | 21801 |
| 140 | Ga0068853_101096397 | 3300005539 | Bacteria | 768 |
| 141 | Ga0070672_100070427 | 3300005543 | Bacteria | 2779 |
| 142 | Ga0070686_100468145 | 3300005544 | Bacteria | 972 |
| 143 | Ga0070686_100975918 | 3300005544 | Bacteria | 693 |
| 144 | Ga0070695_100000668 | 3300005545 | Bacteria | 18292 |
| 145 | Ga0070695_100008983 | 3300005545 | Bacteria | 5939 |
| 146 | Ga0070695_100009584 | 3300005545 | Bacteria | 5768 |
| 147 | Ga0070695_100591417 | 3300005545 | Bacteria | 870 |
| 148 | Ga0070695_100867704 | 3300005545 | Bacteria | 727 |
| 149 | Ga0070695_100917213 | 3300005545 | Bacteria | 708 |
| 150 | Ga0070696_100012891 | 3300005546 | Bacteria | 5611 |
| 151 | Ga0070696_100451077 | 3300005546 | Bacteria | 1015 |
| 152 | Ga0070696_100497160 | 3300005546 | Bacteria | 969 |
| 153 | Ga0070693_100000573 | 3300005547 | Bacteria | 16335 |
| 154 | Ga0070693_100021567 | 3300005547 | Archaea | 3413 |
| 155 | Ga0070665_101231130 | 3300005548 | Bacteria | 759 |
| 156 | Ga0070704_100000240 | 3300005549 | Bacteria | 23438 |
| 157 | Ga0070704_100023353 | 3300005549 | Unclassified | 4038 |
| 158 | Ga0070704_100029417 | 3300005549 | Bacteria | 3668 |
| 159 | Ga0070704_100143886 | 3300005549 | Bacteria | 1865 |
| 160 | Ga0070704_100235121 | 3300005549 | Bacteria | 1497 |
| 161 | Ga0070704_100825338 | 3300005549 | Bacteria | 830 |
| 162 | Ga0070704_101485724 | 3300005549 | Bacteria | 623 |
| 163 | Ga0068855_100000462 | 3300005563 | Bacteria | 50016 |
| 164 | Ga0068855_100002144 | 3300005563 | Bacteria | 24392 |
| 165 | Ga0070664_100004277 | 3300005564 | Bacteria | 11486 |
| 166 | Ga0070664_100174798 | 3300005564 | Bacteria | 1906 |
| 167 | Ga0070664_100311373 | 3300005564 | Bacteria | 1425 |
| 168 | Ga0070664_100884194 | 3300005564 | Bacteria | 837 |
| 169 | Ga0068857_100071998 | 3300005577 | Bacteria | 3080 |
| 170 | Ga0068854_100001177 | 3300005578 | Bacteria | 15680 |
| 171 | Ga0068854_100524511 | 3300005578 | Unclassified | 1001 |
| 172 | Ga0068856_100004303 | 3300005614 | Bacteria | 14209 |
| 173 | Ga0070702_100324020 | 3300005615 | Bacteria | 1075 |
| 174 | Ga0068859_100001671 | 3300005617 | Bacteria | 22591 |
| 175 | Ga0068859_100077917 | 3300005617 | Bacteria | 3355 |
| 176 | Ga0068859_100093820 | 3300005617 | Bacteria | 3053 |
| 177 | Ga0068859_100564167 | 3300005617 | Bacteria | 1232 |
| 178 | Ga0068859_101061443 | 3300005617 | Bacteria | 890 |
| 179 | Ga0068864_100002356 | 3300005618 | Bacteria | 15634 |
| 180 | Ga0068866_10113107 | 3300005718 | Unclassified | 1518 |
| 181 | Ga0068861_100587778 | 3300005719 | Bacteria | 1020 |
| 182 | Ga0068870_10005065 | 3300005840 | Bacteria | 5727 |
| 183 | Ga0068863_100077234 | 3300005841 | Bacteria | 3151 |
| 184 | Ga0068858_100073295 | 3300005842 | Bacteria | 3179 |
| 185 | Ga0068858_100385137 | 3300005842 | Bacteria | 1346 |
| 186 | Ga0068858_100539806 | 3300005842 | Bacteria | 1129 |
| 187 | Ga0068858_101499448 | 3300005842 | Unclassified | 665 |
| 188 | Ga0068860_100009627 | 3300005843 | Bacteria | 9602 |
| 189 | Ga0068860_100053786 | 3300005843 | Bacteria | 3828 |
| 190 | Ga0068860_100078873 | 3300005843 | Bacteria | 3131 |
| 191 | Ga0068860_100085048 | 3300005843 | Bacteria | 3009 |
| 192 | Ga0068860_100097112 | 3300005843 | Bacteria | 2808 |
| 193 | Ga0068860_100134506 | 3300005843 | Bacteria | 2374 |
| 194 | Ga0068860_100375440 | 3300005843 | Bacteria | 1403 |
| 195 | Ga0068860_100613804 | 3300005843 | Bacteria | 1094 |
| 196 | Ga0068862_100002540 | 3300005844 | Bacteria | 16145 |
| 197 | Ga0068862_100020403 | 3300005844 | Bacteria | 5536 |
| 198 | Ga0068862_100054120 | 3300005844 | Bacteria | 3436 |
| 199 | Ga0068862_100577507 | 3300005844 | Bacteria | 1076 |
| 200 | Ga0068862_100998971 | 3300005844 | Bacteria | 827 |
| 201 | Ga0081455_10000074 | 3300005937 | Bacteria | 107319 |
| 202 | Ga0081455_10000513 | 3300005937 | Bacteria | 50176 |
| 203 | Ga0081455_10022703 | 3300005937 | Bacteria | 5856 |
| 204 | Ga0081455_10201906 | 3300005937 | Bacteria | 1488 |
| 205 | Ga0081455_10240170 | 3300005937 | Unclassified | 1332 |
| 206 | Ga0081455_10732229 | 3300005937 | Bacteria | 627 |
| 207 | Ga0081538_10003140 | 3300005981 | Archaea | 15697 |
| 208 | Ga0081538_10035876 | 3300005981 | Bacteria | 3248 |
| 209 | Ga0081538_10041626 | 3300005981 | Unclassified | 2912 |
| 210 | Ga0081540_1005469 | 3300005983 | Bacteria | 9476 |
| 211 | Ga0081540_1035939 | 3300005983 | Bacteria | 2649 |
| 212 | Ga0081540_1036282 | 3300005983 | Unclassified | 2631 |
| 213 | Ga0081539_10000020 | 3300005985 | Bacteria | 366549 |
| 214 | Ga0081539_10047008 | 3300005985 | Bacteria | 2469 |
| 215 | Ga0075432_10115468 | 3300006058 | Bacteria | 1004 |
| 216 | Ga0070716_100051328 | 3300006173 | Bacteria | 2344 |
| 217 | Ga0070712_100104061 | 3300006175 | Bacteria | 2106 |
| 218 | Ga0075428_100001459 | 3300006844 | Bacteria | 25299 |
| 219 | Ga0075428_100015960 | 3300006844 | Bacteria | 8311 |
| 220 | Ga0075428_100016688 | 3300006844 | Bacteria | 8107 |
| 221 | Ga0075428_100107212 | 3300006844 | Bacteria | 3045 |
| 222 | Ga0075428_100244021 | 3300006844 | Bacteria | 1938 |
| 223 | Ga0075428_100326128 | 3300006844 | Bacteria | 1649 |
| 224 | Ga0075428_100368191 | 3300006844 | Bacteria | 1541 |
| 225 | Ga0075428_100511381 | 3300006844 | Bacteria | 1285 |
| 226 | Ga0075428_100613521 | 3300006844 | Bacteria | 1161 |
| 227 | Ga0075428_100891427 | 3300006844 | Archaea | 944 |
| 228 | Ga0075430_100000265 | 3300006846 | Bacteria | 36910 |
| 229 | Ga0075430_100000518 | 3300006846 | Bacteria | 28985 |
| 230 | Ga0075430_100034771 | 3300006846 | Bacteria | 4277 |
| 231 | Ga0075430_100111568 | 3300006846 | Bacteria | 2280 |
| 232 | Ga0075430_100117403 | 3300006846 | Bacteria | 2218 |
| 233 | Ga0075430_100120148 | 3300006846 | Bacteria | 2190 |
| 234 | Ga0075430_100264947 | 3300006846 | Unclassified | 1423 |
| 235 | Ga0075430_100430637 | 3300006846 | Bacteria | 1089 |
| 236 | Ga0075430_100798270 | 3300006846 | Unclassified | 778 |
| 237 | Ga0075431_100000115 | 3300006847 | Bacteria | 51366 |
| 238 | Ga0075431_100020362 | 3300006847 | Bacteria | 6777 |
| 239 | Ga0075431_100024626 | 3300006847 | Bacteria | 6170 |
| 240 | Ga0075431_100030953 | 3300006847 | Bacteria | 5511 |
| 241 | Ga0075431_100034401 | 3300006847 | Bacteria | 5220 |
| 242 | Ga0075431_100098904 | 3300006847 | Unclassified | 3011 |
| 243 | Ga0075431_100163197 | 3300006847 | Bacteria | 2290 |
| 244 | Ga0075431_100172684 | 3300006847 | Archaea | 2221 |
| 245 | Ga0075431_100291566 | 3300006847 | Bacteria | 1650 |
| 246 | Ga0075431_100314368 | 3300006847 | Bacteria | 1580 |
| 247 | Ga0075431_100697601 | 3300006847 | Bacteria | 993 |
| 248 | Ga0075431_100834320 | 3300006847 | Bacteria | 894 |
| 249 | Ga0075431_100881309 | 3300006847 | Unclassified | 865 |
| 250 | Ga0075431_101618479 | 3300006847 | Bacteria | 605 |
| 251 | Ga0075433_10000462 | 3300006852 | Bacteria | 26409 |
| 252 | Ga0075433_10001928 | 3300006852 | Bacteria | 15611 |
| 253 | Ga0075433_10037250 | 3300006852 | Bacteria | 4195 |
| 254 | Ga0075433_10041549 | 3300006852 | Archaea | 3984 |
| 255 | Ga0075433_10054017 | 3300006852 | Bacteria | 3504 |
| 256 | Ga0075433_10058168 | 3300006852 | Bacteria | 3381 |
| 257 | Ga0075433_10067115 | 3300006852 | Bacteria | 3148 |
| 258 | Ga0075433_10068278 | 3300006852 | Bacteria | 3121 |
| 259 | Ga0075433_10154481 | 3300006852 | Bacteria | 2042 |
| 260 | Ga0075433_10172063 | 3300006852 | Unclassified | 1927 |
| 261 | Ga0075433_10274364 | 3300006852 | Unclassified | 1494 |
| 262 | Ga0075433_10295839 | 3300006852 | Bacteria | 1434 |
| 263 | Ga0075433_10341060 | 3300006852 | Bacteria | 1325 |
| 264 | Ga0075433_10341629 | 3300006852 | Unclassified | 1323 |
| 265 | Ga0075433_10388788 | 3300006852 | Bacteria | 1231 |
| 266 | Ga0075434_100000880 | 3300006871 | Bacteria | 24013 |
| 267 | Ga0075434_100002605 | 3300006871 | Bacteria | 15905 |
| 268 | Ga0075434_100005294 | 3300006871 | Bacteria | 11736 |
| 269 | Ga0075434_100010708 | 3300006871 | Bacteria | 8611 |
| 270 | Ga0075434_100026351 | 3300006871 | Bacteria | 5694 |
| 271 | Ga0075434_100038572 | 3300006871 | Bacteria | 4731 |
| 272 | Ga0075434_100116580 | 3300006871 | Bacteria | 2684 |
| 273 | Ga0075434_100116631 | 3300006871 | Bacteria | 2683 |
| 274 | Ga0075434_100236991 | 3300006871 | Bacteria | 1845 |
| 275 | Ga0075434_100280435 | 3300006871 | Bacteria | 1686 |
| 276 | Ga0075434_100322835 | 3300006871 | Unclassified | 1564 |
| 277 | Ga0075434_100435398 | 3300006871 | Bacteria | 1332 |
| 278 | Ga0075434_100437179 | 3300006871 | Bacteria | 1329 |
| 279 | Ga0075429_100000257 | 3300006880 | Bacteria | 36802 |
| 280 | Ga0075429_100002523 | 3300006880 | Bacteria | 15411 |
| 281 | Ga0075429_100027319 | 3300006880 | Bacteria | 4953 |
| 282 | Ga0075429_100042390 | 3300006880 | Bacteria | 3961 |
| 283 | Ga0075429_100066555 | 3300006880 | Bacteria | 3137 |
| 284 | Ga0075429_100072893 | 3300006880 | Bacteria | 2991 |
| 285 | Ga0075429_100078120 | 3300006880 | Bacteria | 2884 |
| 286 | Ga0075429_100093860 | 3300006880 | Bacteria | 2617 |
| 287 | Ga0075429_100376775 | 3300006880 | Bacteria | 1242 |
| 288 | Ga0075429_100377517 | 3300006880 | Bacteria | 1241 |
| 289 | Ga0075429_100612457 | 3300006880 | Bacteria | 954 |
| 290 | Ga0075429_101137491 | 3300006880 | Unclassified | 682 |
| 291 | Ga0068865_100086641 | 3300006881 | Bacteria | 2261 |
| 292 | Ga0068865_100088638 | 3300006881 | Bacteria | 2239 |
| 293 | Ga0075436_100000794 | 3300006914 | Bacteria | 20924 |
| 294 | Ga0075436_100005532 | 3300006914 | Bacteria | 8684 |
| 295 | Ga0075436_100058249 | 3300006914 | Bacteria | 2667 |
| 296 | Ga0075436_100060188 | 3300006914 | Unclassified | 2623 |
| 297 | Ga0075436_100096216 | 3300006914 | Bacteria | 2060 |
| 298 | Ga0075436_100319259 | 3300006914 | Unclassified | 1116 |
| 299 | Ga0075436_100380285 | 3300006914 | Bacteria | 1021 |
| 300 | Ga0075436_100445207 | 3300006914 | Bacteria | 943 |
| 301 | Ga0075436_100497099 | 3300006914 | Bacteria | 892 |
| 302 | Ga0097620_100001671 | 3300006931 | Bacteria | 22591 |
| 303 | Ga0097620_100077920 | 3300006931 | Bacteria | 3355 |
| 304 | Ga0097620_100093819 | 3300006931 | Bacteria | 3053 |
| 305 | Ga0097620_100564147 | 3300006931 | Bacteria | 1232 |
| 306 | Ga0097620_101061445 | 3300006931 | Bacteria | 890 |
| 307 | Ga0075435_100010303 | 3300007076 | Bacteria | 6830 |
| 308 | Ga0075435_100010787 | 3300007076 | Bacteria | 6691 |
| 309 | Ga0075435_100019559 | 3300007076 | Bacteria | 5175 |
| 310 | Ga0075435_100021280 | 3300007076 | Bacteria | 4985 |
| 311 | Ga0075435_100091275 | 3300007076 | Unclassified | 2513 |
| 312 | Ga0075435_100322851 | 3300007076 | Unclassified | 1321 |
| 313 | Ga0075435_100431366 | 3300007076 | Bacteria | 1136 |
| 314 | Ga0075435_101091586 | 3300007076 | Bacteria | 698 |
| 315 | Ga0075435_101377075 | 3300007076 | Unclassified | 618 |
| 316 | Ga0099794_10000632 | 3300007265 | Bacteria | 11743 |
| 317 | Ga0099794_10003812 | 3300007265 | Bacteria | 5824 |
| 318 | Ga0099794_10245584 | 3300007265 | Bacteria | 923 |
| 319 | Ga0105240_10011436 | 3300009093 | Bacteria | 12361 |
| 320 | Ga0111539_10000087 | 3300009094 | Bacteria | 95344 |
| 321 | Ga0111539_10028267 | 3300009094 | Bacteria | 6844 |
| 322 | Ga0111539_10066793 | 3300009094 | Bacteria | 4248 |
| 323 | Ga0111539_10149740 | 3300009094 | Unclassified | 2732 |
| 324 | Ga0111539_11218090 | 3300009094 | Unclassified | 874 |
| 325 | Ga0111539_11668044 | 3300009094 | Unclassified | 739 |
| 326 | Ga0105245_10055259 | 3300009098 | Bacteria | 3566 |
| 327 | Ga0105245_11233719 | 3300009098 | Bacteria | 796 |
| 328 | Ga0105247_10137139 | 3300009101 | Bacteria | 1599 |
| 329 | Ga0114129_10000579 | 3300009147 | Bacteria | 45143 |
| 330 | Ga0114129_10000660 | 3300009147 | Bacteria | 43218 |
| 331 | Ga0114129_10001117 | 3300009147 | Bacteria | 35426 |
| 332 | Ga0114129_10002580 | 3300009147 | Bacteria | 25171 |
| 333 | Ga0114129_10007096 | 3300009147 | Bacteria | 15943 |
| 334 | Ga0114129_10010852 | 3300009147 | Bacteria | 12978 |
| 335 | Ga0114129_10012554 | 3300009147 | Bacteria | 12063 |
| 336 | Ga0114129_10013814 | 3300009147 | Bacteria | 11505 |
| 337 | Ga0114129_10022323 | 3300009147 | Bacteria | 8983 |
| 338 | Ga0114129_10045709 | 3300009147 | Bacteria | 6154 |
| 339 | Ga0114129_10058855 | 3300009147 | Bacteria | 5374 |
| 340 | Ga0114129_10059946 | 3300009147 | Bacteria | 5321 |
| 341 | Ga0114129_10078113 | 3300009147 | Bacteria | 4604 |
| 342 | Ga0114129_10130394 | 3300009147 | Bacteria | 3453 |
| 343 | Ga0114129_10165946 | 3300009147 | Unclassified | 3013 |
| 344 | Ga0114129_10260112 | 3300009147 | Bacteria | 2326 |
| 345 | Ga0114129_10402041 | 3300009147 | Unclassified | 1805 |
| 346 | Ga0114129_10422144 | 3300009147 | Unclassified | 1754 |
| 347 | Ga0114129_10459194 | 3300009147 | Bacteria | 1669 |
| 348 | Ga0114129_10556449 | 3300009147 | Bacteria | 1491 |
| 349 | Ga0114129_10639158 | 3300009147 | Bacteria | 1374 |
| 350 | Ga0114129_10641260 | 3300009147 | Unclassified | 1372 |
| 351 | Ga0114129_10768755 | 3300009147 | Bacteria | 1232 |
| 352 | Ga0114129_10803680 | 3300009147 | Unclassified | 1199 |
| 353 | Ga0114129_11289411 | 3300009147 | Bacteria | 906 |
| 354 | Ga0114129_12406158 | 3300009147 | Bacteria | 631 |
| 355 | Ga0105243_10143648 | 3300009148 | Bacteria | 2039 |
| 356 | Ga0105243_10301041 | 3300009148 | Unclassified | 1453 |
| 357 | Ga0105243_10459975 | 3300009148 | Bacteria | 1196 |
| 358 | Ga0105243_11050988 | 3300009148 | Unclassified | 820 |
| 359 | Ga0105241_10000334 | 3300009174 | Bacteria | 35635 |
| 360 | Ga0105241_10071938 | 3300009174 | Bacteria | 2686 |
| 361 | Ga0105241_10260419 | 3300009174 | Bacteria | 1474 |
| 362 | Ga0105242_10160873 | 3300009176 | Bacteria | 1965 |
| 363 | Ga0105242_10409516 | 3300009176 | Bacteria | 1268 |
| 364 | Ga0105248_10066182 | 3300009177 | Bacteria | 4058 |
| 365 | Ga0105248_11439177 | 3300009177 | Bacteria | 780 |
| 366 | Ga0105248_11769831 | 3300009177 | Bacteria | 701 |
| 367 | Ga0105237_10004494 | 3300009545 | Bacteria | 16118 |
| 368 | Ga0105237_10388258 | 3300009545 | Bacteria | 1401 |
| 369 | Ga0105238_10047700 | 3300009551 | Bacteria | 4318 |
| 370 | Ga0105238_10244327 | 3300009551 | Bacteria | 1773 |
| 371 | Ga0105249_10030373 | 3300009553 | Bacteria | 4885 |
| 372 | Ga0105249_10169675 | 3300009553 | Bacteria | 2115 |
| 373 | Ga0105249_10443414 | 3300009553 | Bacteria | 1336 |
| 374 | Ga0105249_10579430 | 3300009553 | Bacteria | 1175 |
| 375 | Ga0105239_10001412 | 3300010375 | Bacteria | 32056 |
| 376 | Ga0105239_10053250 | 3300010375 | Bacteria | 4439 |
| 377 | Ga0105239_11308034 | 3300010375 | Bacteria | 836 |
| 378 | Ga0105246_10026943 | 3300011119 | Bacteria | 3761 |
| 379 | Ga0157373_10000379 | 3300013100 | Bacteria | 35641 |
| 380 | Ga0157371_10039298 | 3300013102 | Bacteria | 3383 |
| 381 | Ga0157370_10323644 | 3300013104 | Bacteria | 1422 |
| 382 | Ga0157369_10081128 | 3300013105 | Bacteria | 3472 |
| 383 | Ga0157378_10043485 | 3300013297 | Bacteria | 3989 |
| 384 | Ga0157378_10057421 | 3300013297 | Bacteria | 3469 |
| 385 | Ga0163162_10124639 | 3300013306 | Bacteria | 2682 |
| 386 | Ga0163162_10188421 | 3300013306 | Unclassified | 2190 |
| 387 | Ga0163162_10740029 | 3300013306 | Bacteria | 1103 |
| 388 | Ga0163162_10775534 | 3300013306 | Bacteria | 1077 |
| 389 | Ga0163162_10830298 | 3300013306 | Bacteria | 1040 |
| 390 | Ga0157372_10000135 | 3300013307 | Bacteria | 81209 |
| 391 | Ga0157375_10059324 | 3300013308 | Bacteria | 3791 |
| 392 | Ga0157375_10278348 | 3300013308 | Bacteria | 1836 |
| 393 | Ga0157375_10706441 | 3300013308 | Bacteria | 1162 |
| 394 | Ga0157375_10782746 | 3300013308 | Bacteria | 1103 |
| 395 | Ga0157375_10832000 | 3300013308 | Bacteria | 1070 |
| 396 | Ga0163163_10366456 | 3300014325 | Bacteria | 1498 |
| 397 | Ga0163163_10732465 | 3300014325 | Bacteria | 1052 |
| 398 | Ga0157380_10948723 | 3300014326 | Bacteria | 890 |
| 399 | Ga0157377_10943226 | 3300014745 | Bacteria | 649 |
| 400 | Ga0157379_10942539 | 3300014968 | Bacteria | 821 |
| 401 | Ga0207653_10000475 | 3300025885 | Bacteria | 16005 |
| 402 | Ga0207653_10014279 | 3300025885 | Bacteria | 2491 |
| 403 | Ga0207682_10183446 | 3300025893 | Bacteria | 957 |
| 404 | Ga0207642_10612783 | 3300025899 | Bacteria | 679 |
| 405 | Ga0207710_10036217 | 3300025900 | Bacteria | 2174 |
| 406 | Ga0207688_10005719 | 3300025901 | Bacteria | 6764 |
| 407 | Ga0207647_10600638 | 3300025904 | Bacteria | 607 |
| 408 | Ga0207699_11213662 | 3300025906 | Unclassified | 558 |
| 409 | Ga0207645_10000075 | 3300025907 | Bacteria | 71333 |
| 410 | Ga0207643_10001707 | 3300025908 | Bacteria | 12325 |
| 411 | Ga0207684_10002659 | 3300025910 | Bacteria | 17883 |
| 412 | Ga0207684_10004127 | 3300025910 | Bacteria | 13827 |
| 413 | Ga0207684_10012194 | 3300025910 | Bacteria | 7479 |
| 414 | Ga0207684_10019452 | 3300025910 | Bacteria | 5809 |
| 415 | Ga0207684_10046737 | 3300025910 | Bacteria | 3672 |
| 416 | Ga0207684_10114982 | 3300025910 | Bacteria | 2304 |
| 417 | Ga0207684_10223533 | 3300025910 | Unclassified | 1625 |
| 418 | Ga0207684_10263126 | 3300025910 | Bacteria | 1488 |
| 419 | Ga0207684_10271758 | 3300025910 | Bacteria | 1462 |
| 420 | Ga0207684_10430176 | 3300025910 | Unclassified | 1134 |
| 421 | Ga0207684_10432701 | 3300025910 | Bacteria | 1130 |
| 422 | Ga0207684_10623159 | 3300025910 | Bacteria | 920 |
| 423 | Ga0207684_10918797 | 3300025910 | Bacteria | 735 |
| 424 | Ga0207684_11356425 | 3300025910 | Unclassified | 584 |
| 425 | Ga0207654_10001071 | 3300025911 | Bacteria | 14889 |
| 426 | Ga0207654_10013245 | 3300025911 | Bacteria | 4238 |
| 427 | Ga0207654_10395359 | 3300025911 | Bacteria | 960 |
| 428 | Ga0207707_10000135 | 3300025912 | Bacteria | 76964 |
| 429 | Ga0207707_10329878 | 3300025912 | Bacteria | 1316 |
| 430 | Ga0207695_10043920 | 3300025913 | Bacteria | 4758 |
| 431 | Ga0207671_10004038 | 3300025914 | Bacteria | 14234 |
| 432 | Ga0207693_10037917 | 3300025915 | Unclassified | 3797 |
| 433 | Ga0207693_10331980 | 3300025915 | Bacteria | 1190 |
| 434 | Ga0207660_10000688 | 3300025917 | Bacteria | 22592 |
| 435 | Ga0207660_10102098 | 3300025917 | Bacteria | 2144 |
| 436 | Ga0207660_10757954 | 3300025917 | Bacteria | 792 |
| 437 | Ga0207657_10000037 | 3300025919 | Bacteria | 124230 |
| 438 | Ga0207649_10001481 | 3300025920 | Bacteria | 13785 |
| 439 | Ga0207652_10002292 | 3300025921 | Bacteria | 16228 |
| 440 | Ga0207646_10004177 | 3300025922 | Bacteria | 15825 |
| 441 | Ga0207646_10052068 | 3300025922 | Bacteria | 3663 |
| 442 | Ga0207646_10061177 | 3300025922 | Bacteria | 3362 |
| 443 | Ga0207646_10110405 | 3300025922 | Unclassified | 2467 |
| 444 | Ga0207646_10144459 | 3300025922 | Bacteria | 2144 |
| 445 | Ga0207646_10171813 | 3300025922 | Unclassified | 1957 |
| 446 | Ga0207646_10236028 | 3300025922 | Bacteria | 1652 |
| 447 | Ga0207646_10236418 | 3300025922 | Bacteria | 1651 |
| 448 | Ga0207646_10340384 | 3300025922 | Bacteria | 1355 |
| 449 | Ga0207681_10023557 | 3300025923 | Bacteria | 3940 |
| 450 | Ga0207681_10053693 | 3300025923 | Bacteria | 2737 |
| 451 | Ga0207681_10077173 | 3300025923 | Bacteria | 2341 |
| 452 | Ga0207681_10197471 | 3300025923 | Bacteria | 1543 |
| 453 | Ga0207681_10371651 | 3300025923 | Bacteria | 1149 |
| 454 | Ga0207694_10026132 | 3300025924 | Bacteria | 4439 |
| 455 | Ga0207650_10012455 | 3300025925 | Bacteria | 5873 |
| 456 | Ga0207650_10653235 | 3300025925 | Bacteria | 887 |
| 457 | Ga0207687_10541448 | 3300025927 | Bacteria | 976 |
| 458 | Ga0207644_10901903 | 3300025931 | Bacteria | 741 |
| 459 | Ga0207690_10000562 | 3300025932 | Bacteria | 24235 |
| 460 | Ga0207706_10011250 | 3300025933 | Bacteria | 8160 |
| 461 | Ga0207706_10071839 | 3300025933 | Bacteria | 3044 |
| 462 | Ga0207706_10242355 | 3300025933 | Unclassified | 1576 |
| 463 | Ga0207686_10046606 | 3300025934 | Bacteria | 2675 |
| 464 | Ga0207709_10023792 | 3300025935 | Bacteria | 3490 |
| 465 | Ga0207709_10046732 | 3300025935 | Bacteria | 2628 |
| 466 | Ga0207709_10084208 | 3300025935 | Unclassified | 2058 |
| 467 | Ga0207709_10782524 | 3300025935 | Bacteria | 769 |
| 468 | Ga0207709_10918305 | 3300025935 | Bacteria | 712 |
| 469 | Ga0207670_11121844 | 3300025936 | Bacteria | 664 |
| 470 | Ga0207704_10117713 | 3300025938 | Bacteria | 1810 |
| 471 | Ga0207665_10000576 | 3300025939 | Bacteria | 24692 |
| 472 | Ga0207691_10124866 | 3300025940 | Bacteria | 2278 |
| 473 | Ga0207689_10000029 | 3300025942 | Bacteria | 100016 |
| 474 | Ga0207689_10015346 | 3300025942 | Bacteria | 6485 |
| 475 | Ga0207689_10827499 | 3300025942 | Bacteria | 781 |
| 476 | Ga0207689_11442885 | 3300025942 | Bacteria | 576 |
| 477 | Ga0207679_10003224 | 3300025945 | Bacteria | 10063 |
| 478 | Ga0207679_10522503 | 3300025945 | Bacteria | 1062 |
| 479 | Ga0207667_10000652 | 3300025949 | Bacteria | 45007 |
| 480 | Ga0207667_10039416 | 3300025949 | Bacteria | 5036 |
| 481 | Ga0207651_11568805 | 3300025960 | Bacteria | 593 |
| 482 | Ga0207712_10195752 | 3300025961 | Unclassified | 1599 |
| 483 | Ga0207712_10210273 | 3300025961 | Bacteria | 1549 |
| 484 | Ga0207712_10622700 | 3300025961 | Bacteria | 936 |
| 485 | Ga0207668_10161578 | 3300025972 | Bacteria | 1746 |
| 486 | Ga0207668_10822658 | 3300025972 | Bacteria | 823 |
| 487 | Ga0207668_10976694 | 3300025972 | Bacteria | 756 |
| 488 | Ga0207640_10008161 | 3300025981 | Bacteria | 5800 |
| 489 | Ga0207640_10388856 | 3300025981 | Unclassified | 1132 |
| 490 | Ga0207658_10494166 | 3300025986 | Bacteria | 1089 |
| 491 | Ga0207658_10914200 | 3300025986 | Bacteria | 799 |
| 492 | Ga0207677_10378040 | 3300026023 | Bacteria | 1195 |
| 493 | Ga0207703_10049558 | 3300026035 | Bacteria | 3395 |
| 494 | Ga0207703_10664820 | 3300026035 | Bacteria | 989 |
| 495 | Ga0207639_10002456 | 3300026041 | Bacteria | 12435 |
| 496 | Ga0207639_11573387 | 3300026041 | Bacteria | 617 |
| 497 | Ga0207678_10017042 | 3300026067 | Bacteria | 6379 |
| 498 | Ga0207708_11045164 | 3300026075 | Bacteria | 711 |
| 499 | Ga0207702_10014520 | 3300026078 | Bacteria | 6538 |
| 500 | Ga0207641_10065290 | 3300026088 | Bacteria | 3113 |
| 501 | Ga0207641_10336511 | 3300026088 | Bacteria | 1435 |
| 502 | Ga0207641_10391033 | 3300026088 | Bacteria | 1334 |
| 503 | Ga0207641_10887703 | 3300026088 | Bacteria | 885 |
| 504 | Ga0207641_11246449 | 3300026088 | Bacteria | 744 |
| 505 | Ga0207648_10000552 | 3300026089 | Bacteria | 41984 |
| 506 | Ga0207648_10239374 | 3300026089 | Unclassified | 1616 |
| 507 | Ga0207648_10933345 | 3300026089 | Bacteria | 811 |
| 508 | Ga0207676_10030650 | 3300026095 | Bacteria | 4039 |
| 509 | Ga0207676_10148474 | 3300026095 | Bacteria | 2016 |
| 510 | Ga0207674_10000306 | 3300026116 | Bacteria | 62216 |
| 511 | Ga0207674_11817683 | 3300026116 | Bacteria | 576 |
| 512 | Ga0207675_100059884 | 3300026118 | Bacteria | 3554 |
| 513 | Ga0207675_100136389 | 3300026118 | Bacteria | 2329 |
| 514 | Ga0207675_100311563 | 3300026118 | Bacteria | 1535 |
| 515 | Ga0207675_100370393 | 3300026118 | Bacteria | 1407 |
| 516 | Ga0207675_101174561 | 3300026118 | Bacteria | 788 |
| 517 | Ga0207675_101943093 | 3300026118 | Bacteria | 606 |
| 518 | Ga0207698_10653220 | 3300026142 | Bacteria | 1042 |
| 519 | Ga0209969_1019686 | 3300027360 | Bacteria | 1002 |
| 520 | Ga0209967_1019363 | 3300027364 | Bacteria | 989 |
| 521 | Ga0209981_1010822 | 3300027378 | Bacteria | 1254 |
| 522 | Ga0209996_1002549 | 3300027395 | Bacteria | 2257 |
| 523 | Ga0209984_1013550 | 3300027424 | Bacteria | 1071 |
| 524 | Ga0209995_1000572 | 3300027471 | Bacteria | 5610 |
| 525 | Ga0209999_1003314 | 3300027543 | Bacteria | 2873 |
| 526 | Ga0209982_1003328 | 3300027552 | Bacteria | 2280 |
| 527 | Ga0210002_1052629 | 3300027617 | Unclassified | 703 |
| 528 | Ga0209983_1003456 | 3300027665 | Bacteria | 3375 |
| 529 | Ga0209588_1011038 | 3300027671 | Unclassified | 2723 |
| 530 | Ga0209588_1011602 | 3300027671 | Bacteria | 2664 |
| 531 | Ga0209971_1000008 | 3300027682 | Bacteria | 102612 |
| 532 | Ga0209966_1000187 | 3300027695 | Bacteria | 25599 |
| 533 | Ga0209998_10000016 | 3300027717 | Bacteria | 85166 |
| 534 | Ga0209998_10011841 | 3300027717 | Unclassified | 1810 |
| 535 | Ga0209998_10112186 | 3300027717 | Bacteria | 682 |
| 536 | Ga0209974_10001677 | 3300027876 | Bacteria | 8020 |
| 537 | Ga0207428_10000168 | 3300027907 | Bacteria | 91128 |
| 538 | Ga0207428_10000355 | 3300027907 | Bacteria | 59077 |
| 539 | Ga0207428_10034267 | 3300027907 | Bacteria | 4163 |
| 540 | Ga0207428_10036317 | 3300027907 | Unclassified | 4020 |
| 541 | Ga0207428_10057266 | 3300027907 | Bacteria | 3094 |
| 542 | Ga0268266_10907194 | 3300028379 | Bacteria | 852 |
| 543 | Ga0268265_10006105 | 3300028380 | Bacteria | 8177 |
| 544 | Ga0268265_10045245 | 3300028380 | Bacteria | 3283 |
| 545 | Ga0268265_10123390 | 3300028380 | Bacteria | 2138 |
| 546 | Ga0268265_10207679 | 3300028380 | Bacteria | 1704 |
| 547 | Ga0268265_10943130 | 3300028380 | Bacteria | 850 |
| 548 | Ga0268265_11335589 | 3300028380 | Unclassified | 718 |
| 549 | Ga0268264_10029733 | 3300028381 | Bacteria | 4478 |
| 550 | Ga0268264_10101170 | 3300028381 | Bacteria | 2505 |
| 551 | Ga0268264_10235077 | 3300028381 | Bacteria | 1694 |
| 552 | Ga0268264_10355789 | 3300028381 | Unclassified | 1395 |
| 553 | Ga0268264_10688324 | 3300028381 | Bacteria | 1015 |
| 554 | Ga0268264_10773906 | 3300028381 | Bacteria | 957 |
| 555 | Ga0268264_12388443 | 3300028381 | Unclassified | 535 |
| 556 | Ga0265339_10000272 | 3300031249 | Bacteria | 41823 |
| 557 | Ga0265331_10015837 | 3300031250 | Bacteria | 3970 |
| 558 | Ga0265331_10064532 | 3300031250 | Bacteria | 1723 |
| 559 | Ga0265327_10034314 | 3300031251 | Bacteria | 2817 |
| 560 | Ga0307408_100134251 | 3300031548 | Bacteria | 1934 |
| 561 | Ga0265314_10001254 | 3300031711 | Bacteria | 28897 |
| 562 | Ga0265342_10005494 | 3300031712 | Bacteria | 9640 |
| 563 | Ga0307405_11134522 | 3300031731 | Unclassified | 673 |
| 564 | Ga0307406_10674915 | 3300031901 | Bacteria | 860 |
| 565 | Ga0307407_10450038 | 3300031903 | Bacteria | 934 |
| 566 | Ga0307407_11256149 | 3300031903 | Unclassified | 580 |
| 567 | Ga0307412_10196725 | 3300031911 | Bacteria | 1528 |
| 568 | Ga0307416_100017844 | 3300032002 | Bacteria | 4980 |
| 569 | Ga0307414_11262789 | 3300032004 | Bacteria | 685 |
| 570 | Ga0307411_10027915 | 3300032005 | Bacteria | 3423 |
| 571 | Ga0373940_0001428 | 3300035088 | Bacteria | 4316 |
| 572 | Ga0373940_0038110 | 3300035088 | Bacteria | 1311 |
| 573 | Ga0373940_0255079 | 3300035088 | Bacteria | 592 |
| 574 | Ga0373949_0034624 | 3300035090 | Bacteria | 1218 |
| 575 | Ga0373949_0060558 | 3300035090 | Unclassified | 973 |
| 576 | Ga0373949_0087502 | 3300035090 | Bacteria | 838 |
| 577 | Ga0373951_0003456 | 3300035091 | Bacteria | 3828 |
| 578 | Ga0373951_0067232 | 3300035091 | Bacteria | 907 |
| 579 | Ga0373951_0117698 | 3300035091 | Bacteria | 720 |
| 580 | Ga0373932_0036242 | 3300035112 | Bacteria | 1399 |
| 581 | Ga0373932_0066228 | 3300035112 | Bacteria | 1110 |
| 582 | Ga0373939_0029981 | 3300035114 | Unclassified | 1561 |
| 583 | Ga0373941_0048262 | 3300035115 | Bacteria | 1344 |
| 584 | Ga0373941_0090214 | 3300035115 | Bacteria | 1050 |
| 585 | Ga0373960_0194574 | 3300035121 | Unclassified | 714 |
| 586 | Ga0373961_0045720 | 3300035241 | Bacteria | 1281 |
| 587 | Ga0373961_0126002 | 3300035241 | Bacteria | 853 |
| 588 | Ga0373931_0013793 | 3300035691 | Bacteria | 3939 |
| 589 | Ga0395899_0039623 | 3300037312 | Bacteria | 3526 |
| 590 | Ga0395900_0006760 | 3300037418 | Bacteria | 11902 |
| 591 | Ga0395898_0022166 | 3300037466 | Bacteria | 6435 |
| 592 | Ga0395898_0479204 | 3300037466 | Bacteria | 1184 |
| 593 | Ga0395901_0016644 | 3300038443 | Bacteria | 7491 |
| 594 | Ga0395901_0030735 | 3300038443 | Bacteria | 5534 |
| 595 | Ga0242420_012045 | 3300038996 | Bacteria | 1459 |
| 596 | Ga0242420_039512 | 3300038996 | Bacteria | 898 |
| 597 | Ga0439448_0002671 | 3300042005 | Bacteria | 4870 |
| 598 | Ga0439448_0009011 | 3300042005 | Bacteria | 2934 |
| 599 | Ga0439455_0019004 | 3300042012 | Bacteria | 1616 |
| 600 | Ga0439455_0020883 | 3300042012 | Unclassified | 1556 |
| 601 | Ga0439458_0086836 | 3300042157 | Bacteria | 802 |
| 602 | Ga0439459_0012960 | 3300042438 | Bacteria | 1493 |
| 603 | Ga0439464_0002224 | 3300042439 | Bacteria | 4749 |
| 604 | Ga0451577_0009451 | 3300042876 | Bacteria | 9388 |
| 605 | Ga0451577_0012361 | 3300042876 | Bacteria | 8015 |
| 606 | Ga0451577_0056879 | 3300042876 | Bacteria | 3488 |
| 607 | Ga0451577_0428341 | 3300042876 | Bacteria | 1201 |
| 608 | Ga0451577_0473804 | 3300042876 | Bacteria | 1137 |
| 609 | Ga0439440_0108366 | 3300042993 | Bacteria | 762 |
| 610 | Ga0453683_0037750 | 3300044673 | Bacteria | 3038 |
| 611 | Ga0453684_0073068 | 3300044712 | Bacteria | 4326 |
| 612 | Ga0453684_0101813 | 3300044712 | Unclassified | 3513 |
| 613 | Ga0453684_0703299 | 3300044712 | Bacteria | 1098 |
| 614 | Ga0453684_0797419 | 3300044712 | Bacteria | 1019 |
| 615 | Ga0451576_0017221 | 3300045051 | Bacteria | 7948 |
| 616 | Ga0451576_0023457 | 3300045051 | Bacteria | 6679 |
| 617 | Ga0451576_0024938 | 3300045051 | Bacteria | 6452 |
| 618 | Ga0451576_0176633 | 3300045051 | Bacteria | 2229 |
| 619 | Ga0451576_0179161 | 3300045051 | Bacteria | 2213 |
| 620 | Ga0451576_0304129 | 3300045051 | Unclassified | 1668 |
| 621 | Ga0451576_0685697 | 3300045051 | Bacteria | 1076 |
| 622 | Ga0451576_0991665 | 3300045051 | Bacteria | 880 |
| 623 | Ga0451576_1197066 | 3300045051 | Bacteria | 793 |
| 624 | Ga0451576_1297684 | 3300045051 | Bacteria | 759 |
| 625 | Ga0495580_0001207 | 3300046472 | Bacteria | 22745 |
| 626 | Ga0495580_0004677 | 3300046472 | Bacteria | 11479 |
| 627 | Ga0495580_0010780 | 3300046472 | Bacteria | 7099 |
| 628 | Ga0495580_0335090 | 3300046472 | Bacteria | 1027 |
| 629 | Ga0495580_0368641 | 3300046472 | Bacteria | 971 |
| 630 | Ga0495584_0220617 | 3300046491 | Bacteria | 964 |
| 631 | Ga0495594_0020757 | 3300046499 | Bacteria | 3502 |
| 632 | Ga0495656_0216105 | 3300046615 | Unclassified | 957 |
| 633 | Ga0495659_0073168 | 3300046664 | Bacteria | 1288 |
| 634 | Ga0495658_0770757 | 3300046683 | Bacteria | 616 |
| 635 | Ga0495669_0076402 | 3300046684 | Unclassified | 1533 |
| 636 | Ga0495669_0445186 | 3300046684 | Bacteria | 629 |
| 637 | Ga0495670_0244918 | 3300046691 | Bacteria | 955 |
| 638 | Ga0495636_0011896 | 3300047318 | Bacteria | 3448 |
| 639 | Ga0496102_0064353 | 3300048905 | Bacteria | 3359 |
| 640 | Ga0496102_0065144 | 3300048905 | Bacteria | 3339 |
| 641 | Ga0496104_0213573 | 3300048907 | Bacteria | 1841 |
| 642 | Ga0496104_0361093 | 3300048907 | Unclassified | 1365 |
| 643 | Ga0496105_0932002 | 3300048908 | Unclassified | 653 |
| 644 | Ga0496106_0021548 | 3300048909 | Bacteria | 4786 |
| 645 | Ga0496106_0358269 | 3300048909 | Bacteria | 1172 |
| 646 | Ga0496107_0549765 | 3300048910 | Bacteria | 855 |
| 647 | Ga0496112_0132512 | 3300048915 | Bacteria | 2463 |
| 648 | Ga0496117_0109075 | 3300048920 | Bacteria | 1729 |
| 649 | Ga0496117_0197372 | 3300048920 | Bacteria | 1140 |
| 650 | Ga0496118_0098363 | 3300048921 | Bacteria | 1987 |
| 651 | Ga0496121_0000430 | 3300048924 | Bacteria | 82460 |
| 652 | Ga0496121_0002278 | 3300048924 | Bacteria | 29851 |
| 653 | Ga0496121_0144076 | 3300048924 | Bacteria | 1763 |
| 654 | Ga0501031_0227111 | 3300049568 | Unclassified | 1215 |
| 655 | Ga0501031_0368448 | 3300049568 | Bacteria | 930 |
| 656 | Ga0501031_0398171 | 3300049568 | Unclassified | 891 |
| 657 | Ga0501032_0016172 | 3300049569 | Bacteria | 5250 |
| 658 | Ga0501032_0095916 | 3300049569 | Bacteria | 1966 |
| 659 | Ga0501033_0101533 | 3300049570 | Bacteria | 2098 |
| 660 | Ga0501033_0101645 | 3300049570 | Bacteria | 2097 |
| 661 | Ga0501033_0187517 | 3300049570 | Unclassified | 1481 |
| 662 | Ga0501034_0577509 | 3300049571 | Unclassified | 1031 |
| 663 | Ga0501036_0038579 | 3300049572 | Bacteria | 4043 |
| 664 | Ga0501036_0084753 | 3300049572 | Unclassified | 2679 |
| 665 | Ga0501036_0158070 | 3300049572 | Bacteria | 1911 |
| 666 | Ga0501036_0275058 | 3300049572 | Bacteria | 1410 |
| 667 | Ga0501036_0440288 | 3300049572 | Unclassified | 1086 |
| 668 | Ga0501036_0987017 | 3300049572 | Unclassified | 690 |
| 669 | Ga0501037_0045057 | 3300049573 | Bacteria | 3238 |
| 670 | Ga0501037_0047461 | 3300049573 | Bacteria | 3147 |
| 671 | Ga0501038_0053638 | 3300049574 | Bacteria | 3470 |
| 672 | Ga0501038_0059039 | 3300049574 | Bacteria | 3287 |
| 673 | Ga0501038_0283912 | 3300049574 | Unclassified | 1302 |
| 674 | Ga0501038_0750782 | 3300049574 | Bacteria | 728 |
| 675 | Ga0501039_0128383 | 3300049575 | Bacteria | 1989 |
| 676 | Ga0501039_0132666 | 3300049575 | Bacteria | 1955 |
| 677 | Ga0501039_0737542 | 3300049575 | Unclassified | 769 |
| 678 | Ga0501040_0001982 | 3300049576 | Bacteria | 13201 |
| 679 | Ga0501040_0024722 | 3300049576 | Bacteria | 4033 |
| 680 | Ga0501040_0058584 | 3300049576 | Bacteria | 2645 |
| 681 | Ga0501040_0231663 | 3300049576 | Bacteria | 1315 |
| 682 | Ga0501040_0463969 | 3300049576 | Bacteria | 912 |
| 683 | Ga0501040_0662906 | 3300049576 | Bacteria | 754 |
| 684 | Ga0501040_0697913 | 3300049576 | Unclassified | 734 |
| 685 | Ga0501041_0010994 | 3300049577 | Bacteria | 5344 |
| 686 | Ga0501041_0267676 | 3300049577 | Unclassified | 1075 |
| 687 | Ga0501042_0007810 | 3300049578 | Bacteria | 7030 |
| 688 | Ga0501042_0066372 | 3300049578 | Bacteria | 2579 |
| 689 | Ga0501042_0070864 | 3300049578 | Bacteria | 2494 |
| 690 | Ga0501042_0095081 | 3300049578 | Bacteria | 2140 |
| 691 | Ga0501042_0241775 | 3300049578 | Unclassified | 1302 |
| 692 | Ga0501042_0420492 | 3300049578 | Unclassified | 968 |
| 693 | Ga0501042_0486119 | 3300049578 | Unclassified | 896 |
| 694 | Ga0501043_0011980 | 3300049579 | Bacteria | 6784 |
| 695 | Ga0501043_0066858 | 3300049579 | Bacteria | 2823 |
| 696 | Ga0501043_0611521 | 3300049579 | Bacteria | 804 |
| 697 | Ga0501046_0009495 | 3300049580 | Bacteria | 8405 |
| 698 | Ga0501046_0152707 | 3300049580 | Bacteria | 1741 |
| 699 | Ga0501046_0238257 | 3300049580 | Unclassified | 1343 |
| 700 | Ga0501046_0256518 | 3300049580 | Unclassified | 1286 |
| 701 | Ga0501046_0851809 | 3300049580 | Unclassified | 637 |
| 702 | Ga0501047_0169163 | 3300049581 | Unclassified | 2055 |
| 703 | Ga0501048_0605348 | 3300049582 | Bacteria | 787 |
| 704 | Ga0501048_1094094 | 3300049582 | Bacteria | 573 |
| 705 | Ga0501068_0014188 | 3300049584 | Unclassified | 4550 |
| 706 | Ga0501068_0049838 | 3300049584 | Bacteria | 2530 |
| 707 | Ga0501068_0153763 | 3300049584 | Unclassified | 1447 |
| 708 | Ga0501068_0195957 | 3300049584 | Bacteria | 1281 |
| 709 | Ga0501068_0377064 | 3300049584 | Bacteria | 913 |
| 710 | Ga0501069_0230676 | 3300049585 | Bacteria | 1077 |
| 711 | Ga0501070_0017134 | 3300049586 | Bacteria | 6080 |
| 712 | Ga0501071_0344228 | 3300049587 | Bacteria | 1134 |
| 713 | Ga0501071_0367589 | 3300049587 | Bacteria | 1096 |
| 714 | Ga0501071_0376801 | 3300049587 | Bacteria | 1082 |
| 715 | Ga0501071_0550587 | 3300049587 | Bacteria | 886 |
| 716 | Ga0501071_0552428 | 3300049587 | Unclassified | 884 |
| 717 | Ga0501071_0962108 | 3300049587 | Bacteria | 659 |
| 718 | Ga0501072_0030312 | 3300049588 | Bacteria | 4230 |
| 719 | Ga0501072_0041657 | 3300049588 | Bacteria | 3608 |
| 720 | Ga0501072_0083194 | 3300049588 | Unclassified | 2537 |
| 721 | Ga0501072_0181939 | 3300049588 | Unclassified | 1677 |
| 722 | Ga0501072_0293209 | 3300049588 | Unclassified | 1293 |
| 723 | Ga0501072_0338959 | 3300049588 | Bacteria | 1194 |
| 724 | Ga0501072_0429507 | 3300049588 | Bacteria | 1047 |
| 725 | Ga0501072_0804161 | 3300049588 | Bacteria | 736 |
| 726 | Ga0501073_0067235 | 3300049589 | Bacteria | 2498 |
| 727 | Ga0501073_0612758 | 3300049589 | Unclassified | 752 |
| 728 | Ga0501073_1090340 | 3300049589 | Bacteria | 549 |
| 729 | Ga0501074_0002117 | 3300049590 | Bacteria | 13714 |
| 730 | Ga0501074_0009550 | 3300049590 | Bacteria | 7045 |
| 731 | Ga0501074_0035025 | 3300049590 | Bacteria | 3638 |
| 732 | Ga0501075_0004974 | 3300049591 | Bacteria | 9065 |
| 733 | Ga0501075_0019228 | 3300049591 | Bacteria | 4953 |
| 734 | Ga0501075_0068760 | 3300049591 | Bacteria | 2676 |
| 735 | Ga0501075_0106259 | 3300049591 | Bacteria | 2134 |
| 736 | Ga0501075_0133125 | 3300049591 | Bacteria | 1894 |
| 737 | Ga0501075_0510221 | 3300049591 | Bacteria | 917 |
| 738 | Ga0501076_0022605 | 3300049592 | Bacteria | 4834 |
| 739 | Ga0501076_0053305 | 3300049592 | Bacteria | 3205 |
| 740 | Ga0501076_0063606 | 3300049592 | Bacteria | 2940 |
| 741 | Ga0501076_0358165 | 3300049592 | Bacteria | 1198 |
| 742 | Ga0501076_0483273 | 3300049592 | Bacteria | 1020 |
| 743 | Ga0501076_0565617 | 3300049592 | Bacteria | 938 |
| 744 | Ga0501076_0807125 | 3300049592 | Bacteria | 774 |
| 745 | Ga0501076_0852907 | 3300049592 | Bacteria | 751 |
| 746 | Ga0501076_0907176 | 3300049592 | Unclassified | 726 |
| 747 | Ga0501076_0961380 | 3300049592 | Bacteria | 704 |
| 748 | Ga0501077_0006466 | 3300049593 | Bacteria | 7193 |
| 749 | Ga0501077_0021397 | 3300049593 | Bacteria | 4092 |
| 750 | Ga0501077_0022849 | 3300049593 | Bacteria | 3963 |
| 751 | Ga0501077_0075484 | 3300049593 | Bacteria | 2135 |
| 752 | Ga0501077_0087361 | 3300049593 | Bacteria | 1976 |
| 753 | Ga0501077_0091515 | 3300049593 | Bacteria | 1927 |
| 754 | Ga0501077_0106373 | 3300049593 | Bacteria | 1778 |
| 755 | Ga0501077_0127584 | 3300049593 | Bacteria | 1612 |
| 756 | Ga0501077_0206723 | 3300049593 | Bacteria | 1247 |
| 757 | Ga0501077_0210938 | 3300049593 | Unclassified | 1234 |
| 758 | Ga0501079_0035033 | 3300049741 | Bacteria | 3862 |
| 759 | Ga0501079_0047343 | 3300049741 | Bacteria | 3317 |
| 760 | Ga0501079_0071636 | 3300049741 | Bacteria | 2678 |
| 761 | Ga0501079_0237604 | 3300049741 | Unclassified | 1423 |
| 762 | Ga0501079_0385934 | 3300049741 | Unclassified | 1098 |
| 763 | Ga0501079_0524792 | 3300049741 | Bacteria | 931 |
| 764 | Ga0501079_0747879 | 3300049741 | Unclassified | 769 |
| 765 | Ga0501079_1153390 | 3300049741 | Bacteria | 610 |
| 766 | Ga0501080_0020720 | 3300049742 | Bacteria | 6091 |
| 767 | Ga0501080_0276372 | 3300049742 | Bacteria | 1528 |
| 768 | Ga0501081_0002082 | 3300049743 | Bacteria | 12486 |
| 769 | Ga0501081_0003624 | 3300049743 | Bacteria | 9884 |
| 770 | Ga0501081_0008158 | 3300049743 | Bacteria | 6797 |
| 771 | Ga0501081_0022821 | 3300049743 | Bacteria | 4189 |
| 772 | Ga0501081_0038357 | 3300049743 | Bacteria | 3273 |
| 773 | Ga0501081_0135486 | 3300049743 | Bacteria | 1763 |
| 774 | Ga0501081_0135859 | 3300049743 | Unclassified | 1760 |
| 775 | Ga0501081_0240198 | 3300049743 | Unclassified | 1321 |
| 776 | Ga0501081_0268233 | 3300049743 | Bacteria | 1248 |
| 777 | Ga0501081_0304890 | 3300049743 | Bacteria | 1168 |
| 778 | Ga0501081_0436468 | 3300049743 | Bacteria | 972 |
| 779 | Ga0501081_0455201 | 3300049743 | Bacteria | 951 |
| 780 | Ga0501081_0498605 | 3300049743 | Bacteria | 907 |
| 781 | Ga0501081_0574039 | 3300049743 | Unclassified | 843 |
| 782 | Ga0501081_0697597 | 3300049743 | Unclassified | 762 |
| 783 | Ga0501083_0002379 | 3300049744 | Bacteria | 12878 |
| 784 | Ga0501083_0016181 | 3300049744 | Bacteria | 5222 |
| 785 | Ga0501083_0065498 | 3300049744 | Bacteria | 2420 |
| 786 | Ga0501083_0100367 | 3300049744 | Bacteria | 1909 |
| 787 | Ga0501083_0224680 | 3300049744 | Unclassified | 1223 |
| 788 | Ga0501035_0015418 | 3300049822 | Bacteria | 7050 |
| 789 | Ga0501035_0202571 | 3300049822 | Bacteria | 1701 |
| 790 | Ga0501035_1005054 | 3300049822 | Bacteria | 656 |
| 791 | Ga0501044_0000121 | 3300049823 | Bacteria | 93902 |
| 792 | Ga0501044_0009312 | 3300049823 | Bacteria | 10716 |
| 793 | Ga0501045_0000998 | 3300049824 | Bacteria | 18589 |
| 794 | Ga0501045_0015358 | 3300049824 | Bacteria | 5436 |
| 795 | Ga0501045_0018759 | 3300049824 | Bacteria | 4924 |
| 796 | Ga0501045_0160548 | 3300049824 | Bacteria | 1673 |
| 797 | Ga0501045_0217455 | 3300049824 | Unclassified | 1423 |
| 798 | Ga0501045_0264455 | 3300049824 | Unclassified | 1280 |
| 799 | Ga0501045_0520429 | 3300049824 | Unclassified | 883 |
| 800 | Ga0501045_0541002 | 3300049824 | Bacteria | 864 |
| 801 | Ga0501045_0629557 | 3300049824 | Bacteria | 793 |
| 802 | Ga0501045_0724879 | 3300049824 | Unclassified | 733 |
| 803 | nmdc:mga05p37_1053355_c1 | 3300050507 | Bacteria | 858 |
| 804 | nmdc:mga05p37_1087355_c1 | 3300050507 | Unclassified | 839 |
| 805 | nmdc:mga05p37_1239306_c1 | 3300050507 | Bacteria | 767 |
| 806 | nmdc:mga05p37_1447_c1 | 3300050507 | Bacteria | 27609 |
| 807 | nmdc:mga05p37_1453785_c1 | 3300050507 | Unclassified | 686 |
| 808 | nmdc:mga05p37_165552_c1 | 3300050507 | Unclassified | 2699 |
| 809 | nmdc:mga05p37_1713740_c1 | 3300050507 | Unclassified | 612 |
| 810 | nmdc:mga05p37_173543_c1 | 3300050507 | Bacteria | 2628 |
| 811 | nmdc:mga05p37_26490_c1 | 3300050507 | Bacteria | 7052 |
| 812 | nmdc:mga05p37_279370_c1 | 3300050507 | Unclassified | 1992 |
| 813 | nmdc:mga05p37_32437_c1 | 3300050507 | Bacteria | 6387 |
| 814 | nmdc:mga05p37_32456_c1 | 3300050507 | Bacteria | 6385 |
| 815 | nmdc:mga05p37_328086_c1 | 3300050507 | Unclassified | 1809 |
| 816 | nmdc:mga05p37_388525_c1 | 3300050507 | Bacteria | 1633 |
| 817 | nmdc:mga05p37_399654_c1 | 3300050507 | Unclassified | 1605 |
| 818 | nmdc:mga05p37_4034_c1 | 3300050507 | Bacteria | 17155 |
| 819 | nmdc:mga05p37_404716_c1 | 3300050507 | Bacteria | 1593 |
| 820 | nmdc:mga05p37_415226_c1 | 3300050507 | Unclassified | 1568 |
| 821 | nmdc:mga05p37_52253_c1 | 3300050507 | Bacteria | 5025 |
| 822 | nmdc:mga05p37_628967_c1 | 3300050507 | Bacteria | 1206 |
| 823 | nmdc:mga05p37_633658_c1 | 3300050507 | Bacteria | 1201 |
| 824 | nmdc:mga05p37_67090_c1 | 3300050507 | Bacteria | 4414 |
| 825 | nmdc:mga05p37_68146_c1 | 3300050507 | Bacteria | 4377 |
| 826 | nmdc:mga05p37_702_c1 | 3300050507 | Bacteria | 37071 |
| 827 | nmdc:mga05p37_938824_c1 | 3300050507 | Bacteria | 927 |
| 828 | nmdc:mga05p37_98891_c1 | 3300050507 | Bacteria | 3594 |
| 829 | nmdc:mga09592_127724_c1 | 3300050508 | Bacteria | 2186 |
| 830 | nmdc:mga09592_30955_c1 | 3300050508 | Archaea | 4456 |
| 831 | nmdc:mga09592_324884_c1 | 3300050508 | Bacteria | 1333 |
| 832 | nmdc:mga09592_351263_c1 | 3300050508 | Bacteria | 1276 |
| 833 | nmdc:mga09592_448901_c1 | 3300050508 | Bacteria | 1113 |
| 834 | nmdc:mga09592_50504_c1 | 3300050508 | Bacteria | 3508 |
| 835 | nmdc:mga09592_6073_c1 | 3300050508 | Bacteria | 9844 |
| 836 | nmdc:mga09592_64281_c1 | 3300050508 | Bacteria | 3106 |
| 837 | nmdc:mga09592_711441_c1 | 3300050508 | Bacteria | 854 |
| 838 | nmdc:mga09592_774126_c1 | 3300050508 | Unclassified | 813 |
| 839 | nmdc:mga09592_82262_c1 | 3300050508 | Bacteria | 2744 |
| 840 | nmdc:mga09592_856738_c1 | 3300050508 | Bacteria | 766 |
| 841 | nmdc:mga09592_9034_c1 | 3300050508 | Bacteria | 5322 |
| 842 | nmdc:mga09592_917271_c1 | 3300050508 | Unclassified | 736 |
| 843 | nmdc:mga09592_976620_c1 | 3300050508 | Bacteria | 709 |
| 844 | nmdc:mga0qj67_503823_c1 | 3300050509 | Unclassified | 973 |
| 845 | nmdc:mga0qj67_683630_c1 | 3300050509 | Unclassified | 817 |
| 846 | nmdc:mga0qj67_6981_c1 | 3300050509 | Bacteria | 8317 |
| 847 | nmdc:mga0qj67_729772_c1 | 3300050509 | Bacteria | 787 |
| 848 | nmdc:mga0qj67_7532_c1 | 3300050509 | Bacteria | 8043 |
| 849 | nmdc:mga0qj67_92821_c1 | 3300050509 | Bacteria | 2427 |
| 850 | nmdc:mga0qj67_98912_c1 | 3300050509 | Bacteria | 2350 |
| 851 | nmdc:mga06r32_1052242_c1 | 3300050510 | Unclassified | 765 |
| 852 | nmdc:mga06r32_112856_c1 | 3300050510 | Bacteria | 2675 |
| 853 | nmdc:mga06r32_155934_c1 | 3300050510 | Bacteria | 2265 |
| 854 | nmdc:mga06r32_196063_c1 | 3300050510 | Bacteria | 2007 |
| 855 | nmdc:mga06r32_309363_c1 | 3300050510 | Bacteria | 1566 |
| 856 | nmdc:mga06r32_33788_c1 | 3300050510 | Bacteria | 4819 |
| 857 | nmdc:mga06r32_4707_c1 | 3300050510 | Bacteria | 12267 |
| 858 | nmdc:mga06r32_871821_c1 | 3300050510 | Unclassified | 858 |
| 859 | nmdc:mga08y16_1106_c1 | 3300050511 | Bacteria | 5765 |
| 860 | nmdc:mga08y16_19058_c1 | 3300050511 | Bacteria | 7229 |
| 861 | nmdc:mga08y16_19072_c1 | 3300050511 | Bacteria | 7226 |
| 862 | nmdc:mga08y16_337312_c1 | 3300050511 | Bacteria | 1550 |
| 863 | nmdc:mga08y16_36954_c1 | 3300050511 | Bacteria | 5129 |
| 864 | nmdc:mga08y16_382488_c1 | 3300050511 | Unclassified | 1443 |
| 865 | nmdc:mga0n895_11260_c1 | 3300050512 | Bacteria | 7968 |
| 866 | nmdc:mga0n895_1275819_c1 | 3300050512 | Unclassified | 706 |
| 867 | nmdc:mga0n895_13403_c1 | 3300050512 | Bacteria | 7393 |
| 868 | nmdc:mga0n895_17372_c1 | 3300050512 | Bacteria | 6630 |
| 869 | nmdc:mga0n895_186_c1 | 3300050512 | Bacteria | 38327 |
| 870 | nmdc:mga0n895_209879_c1 | 3300050512 | Unclassified | 1978 |
| 871 | nmdc:mga0n895_22584_c1 | 3300050512 | Bacteria | 5901 |
| 872 | nmdc:mga0n895_241132_c1 | 3300050512 | Unclassified | 1835 |
| 873 | nmdc:mga0n895_287244_c1 | 3300050512 | Unclassified | 1668 |
| 874 | nmdc:mga0n895_308962_c1 | 3300050512 | Bacteria | 1603 |
| 875 | nmdc:mga0n895_386948_c1 | 3300050512 | Unclassified | 1415 |
| 876 | nmdc:mga0n895_436907_c1 | 3300050512 | Unclassified | 1322 |
| 877 | nmdc:mga0n895_452584_c1 | 3300050512 | Bacteria | 1296 |
| 878 | nmdc:mga0n895_5330_c1 | 3300050512 | Bacteria | 10714 |
| 879 | nmdc:mga0n895_5865_c1 | 3300050512 | Bacteria | 10322 |
| 880 | nmdc:mga0n895_688210_c1 | 3300050512 | Bacteria | 1019 |
| 881 | nmdc:mga0rr50_121958_c1 | 3300050513 | Unclassified | 2076 |
| 882 | nmdc:mga0rr50_13486_c1 | 3300050513 | Bacteria | 5322 |
| 883 | nmdc:mga0rr50_224656_c1 | 3300050513 | Bacteria | 1552 |
| 884 | nmdc:mga0rr50_458468_c1 | 3300050513 | Bacteria | 1081 |
| 885 | nmdc:mga0rr50_55930_c1 | 3300050513 | Bacteria | 2946 |
| 886 | nmdc:mga0rr50_629_c1 | 3300050513 | Bacteria | 18926 |
| 887 | nmdc:mga0rr50_7815_c1 | 3300050513 | Bacteria | 6628 |
| 888 | nmdc:mga0rr50_91183_c1 | 3300050513 | Bacteria | 2373 |
| 889 | nmdc:mga0rr50_99206_c1 | 3300050513 | Unclassified | 2285 |
| 890 | nmdc:mga08x19_315205_c1 | 3300050514 | Bacteria | 1088 |
| 891 | nmdc:mga08x19_379302_c1 | 3300050514 | Bacteria | 990 |
| 892 | nmdc:mga08x19_44987_c1 | 3300050514 | Unclassified | 2820 |
| 893 | nmdc:mga08x19_55183_c1 | 3300050514 | Bacteria | 2560 |
| 894 | nmdc:mga08x19_65730_c1 | 3300050514 | Bacteria | 2356 |
| 895 | nmdc:mga08x19_90121_c1 | 3300050514 | Unclassified | 2023 |
| 896 | nmdc:mga0a205_12965_c1 | 3300050515 | Bacteria | 7736 |
| 897 | nmdc:mga0a205_135357_c1 | 3300050515 | Bacteria | 2364 |
| 898 | nmdc:mga0a205_17686_c1 | 3300050515 | Bacteria | 6691 |
| 899 | nmdc:mga0a205_182897_c1 | 3300050515 | Bacteria | 1990 |
| 900 | nmdc:mga0a205_206867_c1 | 3300050515 | Unclassified | 1852 |
| 901 | nmdc:mga0a205_215435_c1 | 3300050515 | Bacteria | 1130 |
| 902 | nmdc:mga0a205_216785_c1 | 3300050515 | Unclassified | 1801 |
| 903 | nmdc:mga0a205_233741_c1 | 3300050515 | Unclassified | 1721 |
| 904 | nmdc:mga0a205_245503_c1 | 3300050515 | Bacteria | 1671 |
| 905 | nmdc:mga0a205_250874_c1 | 3300050515 | Bacteria | 1649 |
| 906 | nmdc:mga0a205_259375_c1 | 3300050515 | Bacteria | 1616 |
| 907 | nmdc:mga0a205_2643_c1 | 3300050515 | Bacteria | 15831 |
| 908 | nmdc:mga0a205_265783_c1 | 3300050515 | Unclassified | 1593 |
| 909 | nmdc:mga0a205_289770_c1 | 3300050515 | Bacteria | 1512 |
| 910 | nmdc:mga0a205_358159_c1 | 3300050515 | Bacteria | 1326 |
| 911 | nmdc:mga0a205_4159_c1 | 3300050515 | Bacteria | 12967 |
| 912 | nmdc:mga0a205_49373_c1 | 3300050515 | Bacteria | 4062 |
| 913 | nmdc:mga0a205_523029_c1 | 3300050515 | Bacteria | 1043 |
| 914 | nmdc:mga0a205_564550_c1 | 3300050515 | Bacteria | 993 |
| 915 | nmdc:mga0a205_83386_c1 | 3300050515 | Bacteria | 3087 |
| 916 | Ga0501084_0014517 | 3300054114 | Bacteria | 6530 |
| 917 | Ga0501084_0033887 | 3300054114 | Bacteria | 4271 |
| 918 | Ga0501084_0098523 | 3300054114 | Bacteria | 2455 |
| 919 | Ga0501084_0187345 | 3300054114 | Unclassified | 1746 |
| 920 | Ga0501084_0257768 | 3300054114 | Bacteria | 1472 |
| 921 | Ga0501084_0279110 | 3300054114 | Unclassified | 1411 |
| 922 | Ga0501084_0290440 | 3300054114 | Bacteria | 1381 |
| 923 | Ga0501084_0321313 | 3300054114 | Unclassified | 1307 |
| 924 | Ga0501084_0425833 | 3300054114 | Bacteria | 1122 |
| 925 | Ga0501084_0879269 | 3300054114 | Bacteria | 754 |
| 926 | Ga0590074_024727 | 3300059423 | Bacteria | 1045 |
| 927 | Ga0590075_011669 | 3300059424 | Bacteria | 2127 |
| 928 | Ga0590077_065822 | 3300059426 | Bacteria | 824 |
| 929 | Ga0501082_0001040 | 3300060353 | Bacteria | 24529 |
| 930 | Ga0501082_0002202 | 3300060353 | Bacteria | 17048 |
| 931 | Ga0501082_0005588 | 3300060353 | Bacteria | 10923 |
| 932 | Ga0501082_0347057 | 3300060353 | Bacteria | 1294 |
| 933 | Ga0501082_0350813 | 3300060353 | Bacteria | 1286 |
| 934 | Ga0501082_0388015 | 3300060353 | Unclassified | 1218 |
| 935 | Ga0501082_0656002 | 3300060353 | Bacteria | 918 |
| 936 | Ga0501082_1379990 | 3300060353 | Unclassified | 615 |
| 937 | Ga0501082_1441790 | 3300060353 | Unclassified | 601 |
| 938 | Ga0530510_0000244 | 3300061734 | Bacteria | 34085 |
| 939 | Ga0530510_0005130 | 3300061734 | Bacteria | 9036 |
| 940 | Ga0530510_0005522 | 3300061734 | Bacteria | 8757 |
| 941 | Ga0530510_0029517 | 3300061734 | Bacteria | 3937 |
| 942 | Ga0530510_0033237 | 3300061734 | Bacteria | 3714 |
| 943 | Ga0530510_0126761 | 3300061734 | Bacteria | 1877 |
| 944 | Ga0530510_0132295 | 3300061734 | Bacteria | 1836 |
| 945 | Ga0530510_0156915 | 3300061734 | Bacteria | 1682 |
| 946 | Ga0530510_0203231 | 3300061734 | Bacteria | 1472 |
| 947 | Ga0530510_0244514 | 3300061734 | Unclassified | 1336 |
| 948 | Ga0530510_0278875 | 3300061734 | Bacteria | 1248 |
| 949 | Ga0530510_0313006 | 3300061734 | Unclassified | 1176 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048920 | Ga0496117_0197372 | Ga0496117_0197372_14_484 | 156 |
| 2 | 3300049592 | Ga0501076_0358165 | Ga0501076_0358165_22_492 | 156 |
| 3 | 3300006844 | Ga0075428_100107212 | Ga0075428_1001072124 | 165 |
| 4 | 3300006847 | Ga0075431_100030953 | Ga0075431_1000309533 | 165 |
| 5 | 3300009147 | Ga0114129_10459194 | Ga0114129_104591942 | 165 |
| 6 | 3300009148 | Ga0105243_11050988 | Ga0105243_110509882 | 165 |
| 7 | 3300026118 | Ga0207675_100311563 | Ga0207675_1003115632 | 165 |
| 8 | 3300028380 | Ga0268265_10943130 | Ga0268265_109431301 | 165 |
| 9 | 3300050507 | nmdc:mga05p37_938824_c1 | nmdc:mga05p37_938824_c1_355_855 | 165 |
| 10 | 3300050508 | nmdc:mga09592_976620_c1 | nmdc:mga09592_976620_c1_94_594 | 165 |
| 11 | 3300050510 | nmdc:mga06r32_309363_c1 | nmdc:mga06r32_309363_c1_538_1038 | 165 |
| 12 | 3300005328 | Ga0070676_10538316 | Ga0070676_105383161 | 166 |
| 13 | 3300005334 | Ga0068869_100930135 | Ga0068869_1009301351 | 166 |
| 14 | 3300005336 | Ga0070680_100112247 | Ga0070680_1001122472 | 166 |
| 15 | 3300005336 | Ga0070680_100543002 | Ga0070680_1005430021 | 166 |
| 16 | 3300005340 | Ga0070689_100831178 | Ga0070689_1008311782 | 166 |
| 17 | 3300005343 | Ga0070687_100704490 | Ga0070687_1007044901 | 166 |
| 18 | 3300005345 | Ga0070692_10074287 | Ga0070692_100742872 | 166 |
| 19 | 3300005353 | Ga0070669_100341484 | Ga0070669_1003414841 | 166 |
| 20 | 3300005365 | Ga0070688_100203874 | Ga0070688_1002038742 | 166 |
| 21 | 3300005406 | Ga0070703_10314664 | Ga0070703_103146641 | 166 |
| 22 | 3300005441 | Ga0070700_100083907 | Ga0070700_1000839071 | 166 |
| 23 | 3300005444 | Ga0070694_100037649 | Ga0070694_1000376492 | 166 |
| 24 | 3300005445 | Ga0070708_100517177 | Ga0070708_1005171771 | 166 |
| 25 | 3300005445 | Ga0070708_100612254 | Ga0070708_1006122542 | 166 |
| 26 | 3300005457 | Ga0070662_100794346 | Ga0070662_1007943461 | 166 |
| 27 | 3300005458 | Ga0070681_10088095 | Ga0070681_100880952 | 166 |
| 28 | 3300005459 | Ga0068867_101617145 | Ga0068867_1016171451 | 166 |
| 29 | 3300005467 | Ga0070706_100078854 | Ga0070706_1000788542 | 166 |
| 30 | 3300005468 | Ga0070707_100012568 | Ga0070707_1000125688 | 166 |
| 31 | 3300005468 | Ga0070707_100044774 | Ga0070707_1000447745 | 166 |
| 32 | 3300005468 | Ga0070707_100295571 | Ga0070707_1002955712 | 166 |
| 33 | 3300005471 | Ga0070698_100225757 | Ga0070698_1002257572 | 166 |
| 34 | 3300005471 | Ga0070698_100461172 | Ga0070698_1004611721 | 166 |
| 35 | 3300005536 | Ga0070697_100493491 | Ga0070697_1004934912 | 166 |
| 36 | 3300005539 | Ga0068853_101096397 | Ga0068853_1010963971 | 166 |
| 37 | 3300005544 | Ga0070686_100975918 | Ga0070686_1009759181 | 166 |
| 38 | 3300005545 | Ga0070695_100591417 | Ga0070695_1005914172 | 166 |
| 39 | 3300005549 | Ga0070704_100029417 | Ga0070704_1000294172 | 166 |
| 40 | 3300005549 | Ga0070704_100143886 | Ga0070704_1001438861 | 166 |
| 41 | 3300005549 | Ga0070704_101485724 | Ga0070704_1014857241 | 166 |
| 42 | 3300005564 | Ga0070664_100311373 | Ga0070664_1003113732 | 166 |
| 43 | 3300005578 | Ga0068854_100524511 | Ga0068854_1005245111 | 166 |
| 44 | 3300005615 | Ga0070702_100324020 | Ga0070702_1003240202 | 166 |
| 45 | 3300005617 | Ga0068859_100077917 | Ga0068859_1000779173 | 166 |
| 46 | 3300005617 | Ga0068859_100093820 | Ga0068859_1000938204 | 166 |
| 47 | 3300005617 | Ga0068859_100564167 | Ga0068859_1005641673 | 166 |
| 48 | 3300005617 | Ga0068859_101061443 | Ga0068859_1010614432 | 166 |
| 49 | 3300005842 | Ga0068858_100539806 | Ga0068858_1005398062 | 166 |
| 50 | 3300005842 | Ga0068858_101499448 | Ga0068858_1014994481 | 166 |
| 51 | 3300005843 | Ga0068860_100053786 | Ga0068860_1000537862 | 166 |
| 52 | 3300005843 | Ga0068860_100097112 | Ga0068860_1000971121 | 166 |
| 53 | 3300005843 | Ga0068860_100613804 | Ga0068860_1006138042 | 166 |
| 54 | 3300005844 | Ga0068862_100054120 | Ga0068862_1000541201 | 166 |
| 55 | 3300005937 | Ga0081455_10732229 | Ga0081455_107322291 | 166 |
| 56 | 3300006844 | Ga0075428_100001459 | Ga0075428_10000145913 | 166 |
| 57 | 3300006844 | Ga0075428_100016688 | Ga0075428_1000166885 | 166 |
| 58 | 3300006844 | Ga0075428_100326128 | Ga0075428_1003261282 | 166 |
| 59 | 3300006846 | Ga0075430_100000265 | Ga0075430_10000026517 | 166 |
| 60 | 3300006846 | Ga0075430_100000518 | Ga0075430_10000051831 | 166 |
| 61 | 3300006847 | Ga0075431_100024626 | Ga0075431_1000246267 | 166 |
| 62 | 3300006847 | Ga0075431_100034401 | Ga0075431_1000344012 | 166 |
| 63 | 3300006847 | Ga0075431_100834320 | Ga0075431_1008343202 | 166 |
| 64 | 3300006847 | Ga0075431_100881309 | Ga0075431_1008813092 | 166 |
| 65 | 3300006852 | Ga0075433_10054017 | Ga0075433_100540172 | 166 |
| 66 | 3300006852 | Ga0075433_10154481 | Ga0075433_101544813 | 166 |
| 67 | 3300006871 | Ga0075434_100116580 | Ga0075434_1001165803 | 166 |
| 68 | 3300006880 | Ga0075429_100000257 | Ga0075429_10000025723 | 166 |
| 69 | 3300006880 | Ga0075429_100042390 | Ga0075429_1000423903 | 166 |
| 70 | 3300006880 | Ga0075429_100066555 | Ga0075429_1000665553 | 166 |
| 71 | 3300006880 | Ga0075429_100377517 | Ga0075429_1003775172 | 166 |
| 72 | 3300006881 | Ga0068865_100086641 | Ga0068865_1000866411 | 166 |
| 73 | 3300006881 | Ga0068865_100088638 | Ga0068865_1000886382 | 166 |
| 74 | 3300006931 | Ga0097620_100077920 | Ga0097620_1000779201 | 166 |
| 75 | 3300006931 | Ga0097620_100093819 | Ga0097620_1000938191 | 166 |
| 76 | 3300006931 | Ga0097620_100564147 | Ga0097620_1005641473 | 166 |
| 77 | 3300006931 | Ga0097620_101061445 | Ga0097620_1010614451 | 166 |
| 78 | 3300009094 | Ga0111539_10000087 | Ga0111539_1000008786 | 166 |
| 79 | 3300009094 | Ga0111539_11218090 | Ga0111539_112180902 | 166 |
| 80 | 3300009098 | Ga0105245_11233719 | Ga0105245_112337192 | 166 |
| 81 | 3300009101 | Ga0105247_10137139 | Ga0105247_101371391 | 166 |
| 82 | 3300009147 | Ga0114129_10002580 | Ga0114129_1000258018 | 166 |
| 83 | 3300009147 | Ga0114129_10059946 | Ga0114129_100599467 | 166 |
| 84 | 3300009147 | Ga0114129_10260112 | Ga0114129_102601123 | 166 |
| 85 | 3300009147 | Ga0114129_10402041 | Ga0114129_104020412 | 166 |
| 86 | 3300009148 | Ga0105243_10459975 | Ga0105243_104599753 | 166 |
| 87 | 3300009174 | Ga0105241_10260419 | Ga0105241_102604191 | 166 |
| 88 | 3300009176 | Ga0105242_10160873 | Ga0105242_101608732 | 166 |
| 89 | 3300009177 | Ga0105248_10066182 | Ga0105248_100661825 | 166 |
| 90 | 3300009177 | Ga0105248_11439177 | Ga0105248_114391771 | 166 |
| 91 | 3300009177 | Ga0105248_11769831 | Ga0105248_117698311 | 166 |
| 92 | 3300009553 | Ga0105249_10030373 | Ga0105249_100303736 | 166 |
| 93 | 3300009553 | Ga0105249_10579430 | Ga0105249_105794302 | 166 |
| 94 | 3300010375 | Ga0105239_11308034 | Ga0105239_113080342 | 166 |
| 95 | 3300013297 | Ga0157378_10043485 | Ga0157378_100434853 | 166 |
| 96 | 3300013306 | Ga0163162_10740029 | Ga0163162_107400291 | 166 |
| 97 | 3300013308 | Ga0157375_10059324 | Ga0157375_100593243 | 166 |
| 98 | 3300014325 | Ga0163163_10732465 | Ga0163163_107324652 | 166 |
| 99 | 3300014745 | Ga0157377_10943226 | Ga0157377_109432261 | 166 |
| 100 | 3300025900 | Ga0207710_10036217 | Ga0207710_100362173 | 166 |
| 101 | 3300025904 | Ga0207647_10600638 | Ga0207647_106006381 | 166 |
| 102 | 3300025910 | Ga0207684_10430176 | Ga0207684_104301762 | 166 |
| 103 | 3300025911 | Ga0207654_10013245 | Ga0207654_100132454 | 166 |
| 104 | 3300025912 | Ga0207707_10329878 | Ga0207707_103298782 | 166 |
| 105 | 3300025917 | Ga0207660_10102098 | Ga0207660_101020983 | 166 |
| 106 | 3300025917 | Ga0207660_10757954 | Ga0207660_107579541 | 166 |
| 107 | 3300025922 | Ga0207646_10144459 | Ga0207646_101444593 | 166 |
| 108 | 3300025922 | Ga0207646_10171813 | Ga0207646_101718132 | 166 |
| 109 | 3300025922 | Ga0207646_10236418 | Ga0207646_102364182 | 166 |
| 110 | 3300025923 | Ga0207681_10053693 | Ga0207681_100536935 | 166 |
| 111 | 3300025923 | Ga0207681_10077173 | Ga0207681_100771733 | 166 |
| 112 | 3300025933 | Ga0207706_10071839 | Ga0207706_100718391 | 166 |
| 113 | 3300025933 | Ga0207706_10242355 | Ga0207706_102423552 | 166 |
| 114 | 3300025934 | Ga0207686_10046606 | Ga0207686_100466063 | 166 |
| 115 | 3300025935 | Ga0207709_10023792 | Ga0207709_100237923 | 166 |
| 116 | 3300025935 | Ga0207709_10782524 | Ga0207709_107825242 | 166 |
| 117 | 3300025936 | Ga0207670_11121844 | Ga0207670_111218441 | 166 |
| 118 | 3300025938 | Ga0207704_10117713 | Ga0207704_101177133 | 166 |
| 119 | 3300025942 | Ga0207689_11442885 | Ga0207689_114428851 | 166 |
| 120 | 3300025945 | Ga0207679_10522503 | Ga0207679_105225032 | 166 |
| 121 | 3300025960 | Ga0207651_11568805 | Ga0207651_115688051 | 166 |
| 122 | 3300025961 | Ga0207712_10622700 | Ga0207712_106227001 | 166 |
| 123 | 3300025981 | Ga0207640_10388856 | Ga0207640_103888562 | 166 |
| 124 | 3300025986 | Ga0207658_10914200 | Ga0207658_109142001 | 166 |
| 125 | 3300026035 | Ga0207703_10664820 | Ga0207703_106648201 | 166 |
| 126 | 3300026075 | Ga0207708_11045164 | Ga0207708_110451641 | 166 |
| 127 | 3300026088 | Ga0207641_10887703 | Ga0207641_108877031 | 166 |
| 128 | 3300026088 | Ga0207641_11246449 | Ga0207641_112464491 | 166 |
| 129 | 3300026089 | Ga0207648_10933345 | Ga0207648_109333451 | 166 |
| 130 | 3300026095 | Ga0207676_10148474 | Ga0207676_101484741 | 166 |
| 131 | 3300026116 | Ga0207674_11817683 | Ga0207674_118176831 | 166 |
| 132 | 3300026118 | Ga0207675_100059884 | Ga0207675_1000598841 | 166 |
| 133 | 3300026118 | Ga0207675_100136389 | Ga0207675_1001363893 | 166 |
| 134 | 3300027717 | Ga0209998_10011841 | Ga0209998_100118411 | 166 |
| 135 | 3300027907 | Ga0207428_10000355 | Ga0207428_1000035532 | 166 |
| 136 | 3300027907 | Ga0207428_10036317 | Ga0207428_100363172 | 166 |
| 137 | 3300028380 | Ga0268265_10123390 | Ga0268265_101233903 | 166 |
| 138 | 3300028381 | Ga0268264_10773906 | Ga0268264_107739061 | 166 |
| 139 | 3300031548 | Ga0307408_100134251 | Ga0307408_1001342512 | 166 |
| 140 | 3300031731 | Ga0307405_11134522 | Ga0307405_111345221 | 166 |
| 141 | 3300031901 | Ga0307406_10674915 | Ga0307406_106749152 | 166 |
| 142 | 3300031903 | Ga0307407_11256149 | Ga0307407_112561491 | 166 |
| 143 | 3300031911 | Ga0307412_10196725 | Ga0307412_101967252 | 166 |
| 144 | 3300032002 | Ga0307416_100017844 | Ga0307416_1000178442 | 166 |
| 145 | 3300032005 | Ga0307411_10027915 | Ga0307411_100279152 | 166 |
| 146 | 3300035090 | Ga0373949_0034624 | Ga0373949_0034624_622_1149 | 166 |
| 147 | 3300035091 | Ga0373951_0117698 | Ga0373951_0117698_86_613 | 166 |
| 148 | 3300035112 | Ga0373932_0066228 | Ga0373932_0066228_449_976 | 166 |
| 149 | 3300035241 | Ga0373961_0045720 | Ga0373961_0045720_575_1102 | 166 |
| 150 | 3300035691 | Ga0373931_0013793 | Ga0373931_0013793_1741_2268 | 166 |
| 151 | 3300037312 | Ga0395899_0039623 | Ga0395899_0039623_485_985 | 166 |
| 152 | 3300037418 | Ga0395900_0006760 | Ga0395900_0006760_9402_9902 | 166 |
| 153 | 3300037466 | Ga0395898_0022166 | Ga0395898_0022166_86_586 | 166 |
| 154 | 3300038443 | Ga0395901_0016644 | Ga0395901_0016644_4364_4864 | 166 |
| 155 | 3300038996 | Ga0242420_039512 | Ga0242420_039512_116_616 | 166 |
| 156 | 3300042876 | Ga0451577_0012361 | Ga0451577_0012361_4888_5388 | 166 |
| 157 | 3300042876 | Ga0451577_0473804 | Ga0451577_0473804_21_548 | 166 |
| 158 | 3300044673 | Ga0453683_0037750 | Ga0453683_0037750_43_543 | 166 |
| 159 | 3300044712 | Ga0453684_0101813 | Ga0453684_0101813_1676_2176 | 166 |
| 160 | 3300045051 | Ga0451576_0024938 | Ga0451576_0024938_5774_6274 | 166 |
| 161 | 3300045051 | Ga0451576_0176633 | Ga0451576_0176633_1503_2003 | 166 |
| 162 | 3300045051 | Ga0451576_0304129 | Ga0451576_0304129_57_557 | 166 |
| 163 | 3300046491 | Ga0495584_0220617 | Ga0495584_0220617_226_726 | 166 |
| 164 | 3300046499 | Ga0495594_0020757 | Ga0495594_0020757_1779_2279 | 166 |
| 165 | 3300046615 | Ga0495656_0216105 | Ga0495656_0216105_142_642 | 166 |
| 166 | 3300046664 | Ga0495659_0073168 | Ga0495659_0073168_537_1037 | 166 |
| 167 | 3300046684 | Ga0495669_0076402 | Ga0495669_0076402_424_924 | 166 |
| 168 | 3300048905 | Ga0496102_0064353 | Ga0496102_0064353_510_1037 | 166 |
| 169 | 3300048910 | Ga0496107_0549765 | Ga0496107_0549765_93_620 | 166 |
| 170 | 3300049576 | Ga0501040_0463969 | Ga0501040_0463969_366_866 | 166 |
| 171 | 3300049584 | Ga0501068_0377064 | Ga0501068_0377064_80_580 | 166 |
| 172 | 3300049588 | Ga0501072_0338959 | Ga0501072_0338959_132_632 | 166 |
| 173 | 3300049588 | Ga0501072_0429507 | Ga0501072_0429507_310_810 | 166 |
| 174 | 3300049591 | Ga0501075_0133125 | Ga0501075_0133125_119_619 | 166 |
| 175 | 3300049592 | Ga0501076_0053305 | Ga0501076_0053305_1774_2274 | 166 |
| 176 | 3300049592 | Ga0501076_0852907 | Ga0501076_0852907_19_519 | 166 |
| 177 | 3300049593 | Ga0501077_0087361 | Ga0501077_0087361_1291_1791 | 166 |
| 178 | 3300049741 | Ga0501079_0071636 | Ga0501079_0071636_1452_1952 | 166 |
| 179 | 3300049741 | Ga0501079_0385934 | Ga0501079_0385934_494_994 | 166 |
| 180 | 3300049742 | Ga0501080_0276372 | Ga0501080_0276372_113_613 | 166 |
| 181 | 3300049824 | Ga0501045_0629557 | Ga0501045_0629557_122_622 | 166 |
| 182 | 3300050507 | nmdc:mga05p37_1053355_c1 | nmdc:mga05p37_1053355_c1_169_669 | 166 |
| 183 | 3300050507 | nmdc:mga05p37_173543_c1 | nmdc:mga05p37_173543_c1_1571_2071 | 166 |
| 184 | 3300050507 | nmdc:mga05p37_328086_c1 | nmdc:mga05p37_328086_c1_765_1265 | 166 |
| 185 | 3300050508 | nmdc:mga09592_127724_c1 | nmdc:mga09592_127724_c1_1356_1856 | 166 |
| 186 | 3300050508 | nmdc:mga09592_351263_c1 | nmdc:mga09592_351263_c1_557_1057 | 166 |
| 187 | 3300050508 | nmdc:mga09592_6073_c1 | nmdc:mga09592_6073_c1_2397_2897 | 166 |
| 188 | 3300050508 | nmdc:mga09592_64281_c1 | nmdc:mga09592_64281_c1_2412_2912 | 166 |
| 189 | 3300050509 | nmdc:mga0qj67_6981_c1 | nmdc:mga0qj67_6981_c1_4201_4701 | 166 |
| 190 | 3300050509 | nmdc:mga0qj67_7532_c1 | nmdc:mga0qj67_7532_c1_588_1088 | 166 |
| 191 | 3300050510 | nmdc:mga06r32_33788_c1 | nmdc:mga06r32_33788_c1_3612_4112 | 166 |
| 192 | 3300050510 | nmdc:mga06r32_4707_c1 | nmdc:mga06r32_4707_c1_621_1121 | 166 |
| 193 | 3300050510 | nmdc:mga06r32_871821_c1 | nmdc:mga06r32_871821_c1_203_703 | 166 |
| 194 | 3300050511 | nmdc:mga08y16_19058_c1 | nmdc:mga08y16_19058_c1_6100_6600 | 166 |
| 195 | 3300050511 | nmdc:mga08y16_19072_c1 | nmdc:mga08y16_19072_c1_4153_4680 | 166 |
| 196 | 3300050512 | nmdc:mga0n895_1275819_c1 | nmdc:mga0n895_1275819_c1_171_671 | 166 |
| 197 | 3300050512 | nmdc:mga0n895_287244_c1 | nmdc:mga0n895_287244_c1_113_613 | 166 |
| 198 | 3300050515 | nmdc:mga0a205_12965_c1 | nmdc:mga0a205_12965_c1_6110_6610 | 166 |
| 199 | 3300050515 | nmdc:mga0a205_259375_c1 | nmdc:mga0a205_259375_c1_293_793 | 166 |
| 200 | 3300054114 | Ga0501084_0098523 | Ga0501084_0098523_544_1044 | 166 |
| 201 | 3300054114 | Ga0501084_0257768 | Ga0501084_0257768_480_980 | 166 |
| 202 | 3300059423 | Ga0590074_024727 | Ga0590074_024727_490_990 | 166 |
| 203 | 3300060353 | Ga0501082_0347057 | Ga0501082_0347057_376_876 | 166 |
| 204 | 3300061734 | Ga0530510_0278875 | Ga0530510_0278875_590_1090 | 166 |
| 205 | 3300003203 | JGI25406J46586_10102921 | JGI25406J46586_101029212 | 167 |
| 206 | 3300003347 | JGI26128J50194_1007436 | JGI26128J50194_10074361 | 167 |
| 207 | 3300003911 | JGI25405J52794_10000633 | JGI25405J52794_100006332 | 167 |
| 208 | 3300004798 | Ga0058859_10044750 | Ga0058859_100447502 | 167 |
| 209 | 3300004798 | Ga0058859_11819114 | Ga0058859_118191142 | 167 |
| 210 | 3300004801 | Ga0058860_11187877 | Ga0058860_111878771 | 167 |
| 211 | 3300004801 | Ga0058860_12238848 | Ga0058860_122388481 | 167 |
| 212 | 3300005290 | Ga0065712_10037114 | Ga0065712_100371141 | 167 |
| 213 | 3300005293 | Ga0065715_10118079 | Ga0065715_101180792 | 167 |
| 214 | 3300005295 | Ga0065707_10023398 | Ga0065707_100233982 | 167 |
| 215 | 3300005295 | Ga0065707_10194343 | Ga0065707_101943431 | 167 |
| 216 | 3300005295 | Ga0065707_10364960 | Ga0065707_103649601 | 167 |
| 217 | 3300005328 | Ga0070676_10000227 | Ga0070676_1000022723 | 167 |
| 218 | 3300005329 | Ga0070683_100133327 | Ga0070683_1001333272 | 167 |
| 219 | 3300005330 | Ga0070690_100900598 | Ga0070690_1009005981 | 167 |
| 220 | 3300005331 | Ga0070670_100004572 | Ga0070670_1000045722 | 167 |
| 221 | 3300005334 | Ga0068869_100005890 | Ga0068869_1000058902 | 167 |
| 222 | 3300005334 | Ga0068869_100037331 | Ga0068869_1000373311 | 167 |
| 223 | 3300005334 | Ga0068869_100386964 | Ga0068869_1003869641 | 167 |
| 224 | 3300005336 | Ga0070680_100006965 | Ga0070680_1000069659 | 167 |
| 225 | 3300005336 | Ga0070680_100460330 | Ga0070680_1004603302 | 167 |
| 226 | 3300005337 | Ga0070682_100001390 | Ga0070682_1000013909 | 167 |
| 227 | 3300005338 | Ga0068868_100116790 | Ga0068868_1001167902 | 167 |
| 228 | 3300005339 | Ga0070660_100004277 | Ga0070660_1000042772 | 167 |
| 229 | 3300005340 | Ga0070689_101665050 | Ga0070689_1016650501 | 167 |
| 230 | 3300005341 | Ga0070691_10010815 | Ga0070691_100108152 | 167 |
| 231 | 3300005341 | Ga0070691_10062295 | Ga0070691_100622952 | 167 |
| 232 | 3300005341 | Ga0070691_10130076 | Ga0070691_101300762 | 167 |
| 233 | 3300005344 | Ga0070661_100000341 | Ga0070661_10000034135 | 167 |
| 234 | 3300005345 | Ga0070692_10141121 | Ga0070692_101411212 | 167 |
| 235 | 3300005347 | Ga0070668_100434182 | Ga0070668_1004341822 | 167 |
| 236 | 3300005347 | Ga0070668_100723291 | Ga0070668_1007232912 | 167 |
| 237 | 3300005353 | Ga0070669_100229391 | Ga0070669_1002293912 | 167 |
| 238 | 3300005353 | Ga0070669_100668224 | Ga0070669_1006682242 | 167 |
| 239 | 3300005354 | Ga0070675_100373392 | Ga0070675_1003733921 | 167 |
| 240 | 3300005354 | Ga0070675_100774459 | Ga0070675_1007744592 | 167 |
| 241 | 3300005355 | Ga0070671_100294112 | Ga0070671_1002941122 | 167 |
| 242 | 3300005364 | Ga0070673_100020228 | Ga0070673_1000202283 | 167 |
| 243 | 3300005364 | Ga0070673_100572645 | Ga0070673_1005726452 | 167 |
| 244 | 3300005366 | Ga0070659_100006955 | Ga0070659_1000069552 | 167 |
| 245 | 3300005406 | Ga0070703_10001000 | Ga0070703_100010005 | 167 |
| 246 | 3300005406 | Ga0070703_10064800 | Ga0070703_100648001 | 167 |
| 247 | 3300005406 | Ga0070703_10340909 | Ga0070703_103409091 | 167 |
| 248 | 3300005434 | Ga0070709_10141820 | Ga0070709_101418202 | 167 |
| 249 | 3300005439 | Ga0070711_100358979 | Ga0070711_1003589792 | 167 |
| 250 | 3300005440 | Ga0070705_100000347 | Ga0070705_10000034719 | 167 |
| 251 | 3300005440 | Ga0070705_100017997 | Ga0070705_1000179973 | 167 |
| 252 | 3300005440 | Ga0070705_100847235 | Ga0070705_1008472351 | 167 |
| 253 | 3300005441 | Ga0070700_100060137 | Ga0070700_1000601371 | 167 |
| 254 | 3300005441 | Ga0070700_101012223 | Ga0070700_1010122231 | 167 |
| 255 | 3300005444 | Ga0070694_100002904 | Ga0070694_10000290410 | 167 |
| 256 | 3300005444 | Ga0070694_100003572 | Ga0070694_1000035726 | 167 |
| 257 | 3300005444 | Ga0070694_100007439 | Ga0070694_1000074396 | 167 |
| 258 | 3300005444 | Ga0070694_100127919 | Ga0070694_1001279192 | 167 |
| 259 | 3300005444 | Ga0070694_100245565 | Ga0070694_1002455651 | 167 |
| 260 | 3300005445 | Ga0070708_100033790 | Ga0070708_1000337902 | 167 |
| 261 | 3300005445 | Ga0070708_100086698 | Ga0070708_1000866985 | 167 |
| 262 | 3300005445 | Ga0070708_100104594 | Ga0070708_1001045942 | 167 |
| 263 | 3300005445 | Ga0070708_100241513 | Ga0070708_1002415133 | 167 |
| 264 | 3300005445 | Ga0070708_100318338 | Ga0070708_1003183382 | 167 |
| 265 | 3300005445 | Ga0070708_100373423 | Ga0070708_1003734232 | 167 |
| 266 | 3300005445 | Ga0070708_100470603 | Ga0070708_1004706032 | 167 |
| 267 | 3300005445 | Ga0070708_100527874 | Ga0070708_1005278742 | 167 |
| 268 | 3300005445 | Ga0070708_100591943 | Ga0070708_1005919432 | 167 |
| 269 | 3300005445 | Ga0070708_100741436 | Ga0070708_1007414361 | 167 |
| 270 | 3300005455 | Ga0070663_100008299 | Ga0070663_1000082995 | 167 |
| 271 | 3300005457 | Ga0070662_100012635 | Ga0070662_1000126357 | 167 |
| 272 | 3300005459 | Ga0068867_100000705 | Ga0068867_10000070513 | 167 |
| 273 | 3300005459 | Ga0068867_100275717 | Ga0068867_1002757172 | 167 |
| 274 | 3300005467 | Ga0070706_100007224 | Ga0070706_1000072245 | 167 |
| 275 | 3300005467 | Ga0070706_100028050 | Ga0070706_1000280503 | 167 |
| 276 | 3300005467 | Ga0070706_100041629 | Ga0070706_1000416295 | 167 |
| 277 | 3300005467 | Ga0070706_100090178 | Ga0070706_1000901784 | 167 |
| 278 | 3300005467 | Ga0070706_100120234 | Ga0070706_1001202342 | 167 |
| 279 | 3300005467 | Ga0070706_100191966 | Ga0070706_1001919662 | 167 |
| 280 | 3300005467 | Ga0070706_100233485 | Ga0070706_1002334853 | 167 |
| 281 | 3300005467 | Ga0070706_100349212 | Ga0070706_1003492122 | 167 |
| 282 | 3300005467 | Ga0070706_100406410 | Ga0070706_1004064102 | 167 |
| 283 | 3300005467 | Ga0070706_100422637 | Ga0070706_1004226371 | 167 |
| 284 | 3300005467 | Ga0070706_100437952 | Ga0070706_1004379522 | 167 |
| 285 | 3300005467 | Ga0070706_100682525 | Ga0070706_1006825251 | 167 |
| 286 | 3300005467 | Ga0070706_101102139 | Ga0070706_1011021391 | 167 |
| 287 | 3300005468 | Ga0070707_100011125 | Ga0070707_10001112510 | 167 |
| 288 | 3300005468 | Ga0070707_100026589 | Ga0070707_1000265896 | 167 |
| 289 | 3300005468 | Ga0070707_100070831 | Ga0070707_1000708314 | 167 |
| 290 | 3300005468 | Ga0070707_100184283 | Ga0070707_1001842833 | 167 |
| 291 | 3300005468 | Ga0070707_100187722 | Ga0070707_1001877222 | 167 |
| 292 | 3300005468 | Ga0070707_100205073 | Ga0070707_1002050732 | 167 |
| 293 | 3300005468 | Ga0070707_100297083 | Ga0070707_1002970832 | 167 |
| 294 | 3300005468 | Ga0070707_100298518 | Ga0070707_1002985181 | 167 |
| 295 | 3300005471 | Ga0070698_100002225 | Ga0070698_10000222518 | 167 |
| 296 | 3300005471 | Ga0070698_100040581 | Ga0070698_1000405812 | 167 |
| 297 | 3300005471 | Ga0070698_100046645 | Ga0070698_1000466452 | 167 |
| 298 | 3300005471 | Ga0070698_100233285 | Ga0070698_1002332852 | 167 |
| 299 | 3300005471 | Ga0070698_100276167 | Ga0070698_1002761672 | 167 |
| 300 | 3300005471 | Ga0070698_101319174 | Ga0070698_1013191741 | 167 |
| 301 | 3300005518 | Ga0070699_100001487 | Ga0070699_10000148716 | 167 |
| 302 | 3300005518 | Ga0070699_100018486 | Ga0070699_1000184862 | 167 |
| 303 | 3300005518 | Ga0070699_100028870 | Ga0070699_1000288704 | 167 |
| 304 | 3300005518 | Ga0070699_100042645 | Ga0070699_1000426453 | 167 |
| 305 | 3300005518 | Ga0070699_100069410 | Ga0070699_1000694104 | 167 |
| 306 | 3300005518 | Ga0070699_100092422 | Ga0070699_1000924223 | 167 |
| 307 | 3300005518 | Ga0070699_100213010 | Ga0070699_1002130103 | 167 |
| 308 | 3300005518 | Ga0070699_100273996 | Ga0070699_1002739961 | 167 |
| 309 | 3300005518 | Ga0070699_100619971 | Ga0070699_1006199712 | 167 |
| 310 | 3300005518 | Ga0070699_100677074 | Ga0070699_1006770742 | 167 |
| 311 | 3300005518 | Ga0070699_101178143 | Ga0070699_1011781431 | 167 |
| 312 | 3300005530 | Ga0070679_100000403 | Ga0070679_1000004039 | 167 |
| 313 | 3300005536 | Ga0070697_100013678 | Ga0070697_1000136787 | 167 |
| 314 | 3300005536 | Ga0070697_100028606 | Ga0070697_1000286063 | 167 |
| 315 | 3300005536 | Ga0070697_100079707 | Ga0070697_1000797073 | 167 |
| 316 | 3300005536 | Ga0070697_100085044 | Ga0070697_1000850441 | 167 |
| 317 | 3300005536 | Ga0070697_100151863 | Ga0070697_1001518633 | 167 |
| 318 | 3300005536 | Ga0070697_100500812 | Ga0070697_1005008122 | 167 |
| 319 | 3300005539 | Ga0068853_100000808 | Ga0068853_1000008087 | 167 |
| 320 | 3300005543 | Ga0070672_100070427 | Ga0070672_1000704272 | 167 |
| 321 | 3300005544 | Ga0070686_100468145 | Ga0070686_1004681452 | 167 |
| 322 | 3300005545 | Ga0070695_100000668 | Ga0070695_1000006687 | 167 |
| 323 | 3300005545 | Ga0070695_100008983 | Ga0070695_1000089832 | 167 |
| 324 | 3300005545 | Ga0070695_100009584 | Ga0070695_1000095841 | 167 |
| 325 | 3300005545 | Ga0070695_100867704 | Ga0070695_1008677042 | 167 |
| 326 | 3300005545 | Ga0070695_100917213 | Ga0070695_1009172131 | 167 |
| 327 | 3300005546 | Ga0070696_100012891 | Ga0070696_1000128912 | 167 |
| 328 | 3300005546 | Ga0070696_100451077 | Ga0070696_1004510771 | 167 |
| 329 | 3300005546 | Ga0070696_100497160 | Ga0070696_1004971602 | 167 |
| 330 | 3300005547 | Ga0070693_100000573 | Ga0070693_10000057311 | 167 |
| 331 | 3300005547 | Ga0070693_100021567 | Ga0070693_1000215672 | 167 |
| 332 | 3300005548 | Ga0070665_101231130 | Ga0070665_1012311301 | 167 |
| 333 | 3300005549 | Ga0070704_100000240 | Ga0070704_10000024023 | 167 |
| 334 | 3300005549 | Ga0070704_100023353 | Ga0070704_1000233534 | 167 |
| 335 | 3300005549 | Ga0070704_100235121 | Ga0070704_1002351212 | 167 |
| 336 | 3300005549 | Ga0070704_100825338 | Ga0070704_1008253382 | 167 |
| 337 | 3300005563 | Ga0068855_100000462 | Ga0068855_10000046221 | 167 |
| 338 | 3300005563 | Ga0068855_100002144 | Ga0068855_10000214414 | 167 |
| 339 | 3300005564 | Ga0070664_100004277 | Ga0070664_1000042772 | 167 |
| 340 | 3300005564 | Ga0070664_100174798 | Ga0070664_1001747982 | 167 |
| 341 | 3300005564 | Ga0070664_100884194 | Ga0070664_1008841942 | 167 |
| 342 | 3300005577 | Ga0068857_100071998 | Ga0068857_1000719982 | 167 |
| 343 | 3300005578 | Ga0068854_100001177 | Ga0068854_1000011777 | 167 |
| 344 | 3300005614 | Ga0068856_100004303 | Ga0068856_1000043037 | 167 |
| 345 | 3300005617 | Ga0068859_100001671 | Ga0068859_1000016715 | 167 |
| 346 | 3300005618 | Ga0068864_100002356 | Ga0068864_1000023569 | 167 |
| 347 | 3300005718 | Ga0068866_10113107 | Ga0068866_101131072 | 167 |
| 348 | 3300005719 | Ga0068861_100587778 | Ga0068861_1005877782 | 167 |
| 349 | 3300005840 | Ga0068870_10005065 | Ga0068870_100050655 | 167 |
| 350 | 3300005841 | Ga0068863_100077234 | Ga0068863_1000772345 | 167 |
| 351 | 3300005842 | Ga0068858_100073295 | Ga0068858_1000732954 | 167 |
| 352 | 3300005842 | Ga0068858_100385137 | Ga0068858_1003851373 | 167 |
| 353 | 3300005843 | Ga0068860_100009627 | Ga0068860_1000096278 | 167 |
| 354 | 3300005843 | Ga0068860_100078873 | Ga0068860_1000788732 | 167 |
| 355 | 3300005843 | Ga0068860_100085048 | Ga0068860_1000850482 | 167 |
| 356 | 3300005843 | Ga0068860_100134506 | Ga0068860_1001345062 | 167 |
| 357 | 3300005843 | Ga0068860_100375440 | Ga0068860_1003754403 | 167 |
| 358 | 3300005844 | Ga0068862_100002540 | Ga0068862_1000025409 | 167 |
| 359 | 3300005844 | Ga0068862_100020403 | Ga0068862_1000204032 | 167 |
| 360 | 3300005844 | Ga0068862_100577507 | Ga0068862_1005775072 | 167 |
| 361 | 3300005844 | Ga0068862_100998971 | Ga0068862_1009989712 | 167 |
| 362 | 3300005937 | Ga0081455_10000074 | Ga0081455_1000007479 | 167 |
| 363 | 3300005937 | Ga0081455_10000513 | Ga0081455_1000051321 | 167 |
| 364 | 3300005937 | Ga0081455_10022703 | Ga0081455_100227032 | 167 |
| 365 | 3300005937 | Ga0081455_10201906 | Ga0081455_102019063 | 167 |
| 366 | 3300005937 | Ga0081455_10240170 | Ga0081455_102401701 | 167 |
| 367 | 3300005981 | Ga0081538_10003140 | Ga0081538_100031407 | 167 |
| 368 | 3300005981 | Ga0081538_10035876 | Ga0081538_100358762 | 167 |
| 369 | 3300005981 | Ga0081538_10041626 | Ga0081538_100416263 | 167 |
| 370 | 3300005983 | Ga0081540_1005469 | Ga0081540_10054699 | 167 |
| 371 | 3300005983 | Ga0081540_1035939 | Ga0081540_10359392 | 167 |
| 372 | 3300005983 | Ga0081540_1036282 | Ga0081540_10362823 | 167 |
| 373 | 3300005985 | Ga0081539_10000020 | Ga0081539_10000020291 | 167 |
| 374 | 3300005985 | Ga0081539_10047008 | Ga0081539_100470082 | 167 |
| 375 | 3300006058 | Ga0075432_10115468 | Ga0075432_101154682 | 167 |
| 376 | 3300006173 | Ga0070716_100051328 | Ga0070716_1000513282 | 167 |
| 377 | 3300006175 | Ga0070712_100104061 | Ga0070712_1001040613 | 167 |
| 378 | 3300006844 | Ga0075428_100015960 | Ga0075428_1000159607 | 167 |
| 379 | 3300006844 | Ga0075428_100244021 | Ga0075428_1002440213 | 167 |
| 380 | 3300006844 | Ga0075428_100368191 | Ga0075428_1003681912 | 167 |
| 381 | 3300006844 | Ga0075428_100511381 | Ga0075428_1005113812 | 167 |
| 382 | 3300006844 | Ga0075428_100613521 | Ga0075428_1006135212 | 167 |
| 383 | 3300006844 | Ga0075428_100891427 | Ga0075428_1008914272 | 167 |
| 384 | 3300006846 | Ga0075430_100034771 | Ga0075430_1000347715 | 167 |
| 385 | 3300006846 | Ga0075430_100111568 | Ga0075430_1001115684 | 167 |
| 386 | 3300006846 | Ga0075430_100117403 | Ga0075430_1001174033 | 167 |
| 387 | 3300006846 | Ga0075430_100120148 | Ga0075430_1001201483 | 167 |
| 388 | 3300006846 | Ga0075430_100264947 | Ga0075430_1002649472 | 167 |
| 389 | 3300006846 | Ga0075430_100430637 | Ga0075430_1004306372 | 167 |
| 390 | 3300006846 | Ga0075430_100798270 | Ga0075430_1007982701 | 167 |
| 391 | 3300006847 | Ga0075431_100000115 | Ga0075431_10000011557 | 167 |
| 392 | 3300006847 | Ga0075431_100020362 | Ga0075431_1000203622 | 167 |
| 393 | 3300006847 | Ga0075431_100098904 | Ga0075431_1000989042 | 167 |
| 394 | 3300006847 | Ga0075431_100163197 | Ga0075431_1001631973 | 167 |
| 395 | 3300006847 | Ga0075431_100172684 | Ga0075431_1001726842 | 167 |
| 396 | 3300006847 | Ga0075431_100291566 | Ga0075431_1002915662 | 167 |
| 397 | 3300006847 | Ga0075431_100314368 | Ga0075431_1003143682 | 167 |
| 398 | 3300006847 | Ga0075431_100697601 | Ga0075431_1006976011 | 167 |
| 399 | 3300006847 | Ga0075431_101618479 | Ga0075431_1016184791 | 167 |
| 400 | 3300006852 | Ga0075433_10000462 | Ga0075433_1000046219 | 167 |
| 401 | 3300006852 | Ga0075433_10001928 | Ga0075433_1000192811 | 167 |
| 402 | 3300006852 | Ga0075433_10037250 | Ga0075433_100372502 | 167 |
| 403 | 3300006852 | Ga0075433_10041549 | Ga0075433_100415494 | 167 |
| 404 | 3300006852 | Ga0075433_10058168 | Ga0075433_100581682 | 167 |
| 405 | 3300006852 | Ga0075433_10067115 | Ga0075433_100671153 | 167 |
| 406 | 3300006852 | Ga0075433_10068278 | Ga0075433_100682781 | 167 |
| 407 | 3300006852 | Ga0075433_10172063 | Ga0075433_101720632 | 167 |
| 408 | 3300006852 | Ga0075433_10274364 | Ga0075433_102743641 | 167 |
| 409 | 3300006852 | Ga0075433_10295839 | Ga0075433_102958392 | 167 |
| 410 | 3300006852 | Ga0075433_10341060 | Ga0075433_103410602 | 167 |
| 411 | 3300006852 | Ga0075433_10341629 | Ga0075433_103416292 | 167 |
| 412 | 3300006852 | Ga0075433_10388788 | Ga0075433_103887882 | 167 |
| 413 | 3300006871 | Ga0075434_100000880 | Ga0075434_1000008802 | 167 |
| 414 | 3300006871 | Ga0075434_100002605 | Ga0075434_1000026058 | 167 |
| 415 | 3300006871 | Ga0075434_100005294 | Ga0075434_1000052942 | 167 |
| 416 | 3300006871 | Ga0075434_100010708 | Ga0075434_1000107085 | 167 |
| 417 | 3300006871 | Ga0075434_100026351 | Ga0075434_1000263515 | 167 |
| 418 | 3300006871 | Ga0075434_100038572 | Ga0075434_1000385726 | 167 |
| 419 | 3300006871 | Ga0075434_100116631 | Ga0075434_1001166312 | 167 |
| 420 | 3300006871 | Ga0075434_100236991 | Ga0075434_1002369912 | 167 |
| 421 | 3300006871 | Ga0075434_100280435 | Ga0075434_1002804353 | 167 |
| 422 | 3300006871 | Ga0075434_100322835 | Ga0075434_1003228352 | 167 |
| 423 | 3300006871 | Ga0075434_100435398 | Ga0075434_1004353982 | 167 |
| 424 | 3300006871 | Ga0075434_100437179 | Ga0075434_1004371792 | 167 |
| 425 | 3300006880 | Ga0075429_100002523 | Ga0075429_10000252317 | 167 |
| 426 | 3300006880 | Ga0075429_100027319 | Ga0075429_1000273194 | 167 |
| 427 | 3300006880 | Ga0075429_100072893 | Ga0075429_1000728932 | 167 |
| 428 | 3300006880 | Ga0075429_100078120 | Ga0075429_1000781203 | 167 |
| 429 | 3300006880 | Ga0075429_100093860 | Ga0075429_1000938602 | 167 |
| 430 | 3300006880 | Ga0075429_100376775 | Ga0075429_1003767752 | 167 |
| 431 | 3300006880 | Ga0075429_100612457 | Ga0075429_1006124572 | 167 |
| 432 | 3300006880 | Ga0075429_101137491 | Ga0075429_1011374912 | 167 |
| 433 | 3300006914 | Ga0075436_100000794 | Ga0075436_1000007946 | 167 |
| 434 | 3300006914 | Ga0075436_100005532 | Ga0075436_1000055323 | 167 |
| 435 | 3300006914 | Ga0075436_100058249 | Ga0075436_1000582493 | 167 |
| 436 | 3300006914 | Ga0075436_100060188 | Ga0075436_1000601882 | 167 |
| 437 | 3300006914 | Ga0075436_100096216 | Ga0075436_1000962162 | 167 |
| 438 | 3300006914 | Ga0075436_100319259 | Ga0075436_1003192592 | 167 |
| 439 | 3300006914 | Ga0075436_100380285 | Ga0075436_1003802852 | 167 |
| 440 | 3300006914 | Ga0075436_100445207 | Ga0075436_1004452072 | 167 |
| 441 | 3300006914 | Ga0075436_100497099 | Ga0075436_1004970991 | 167 |
| 442 | 3300006931 | Ga0097620_100001671 | Ga0097620_1000016715 | 167 |
| 443 | 3300007076 | Ga0075435_100010303 | Ga0075435_1000103032 | 167 |
| 444 | 3300007076 | Ga0075435_100010787 | Ga0075435_1000107871 | 167 |
| 445 | 3300007076 | Ga0075435_100019559 | Ga0075435_1000195594 | 167 |
| 446 | 3300007076 | Ga0075435_100021280 | Ga0075435_1000212805 | 167 |
| 447 | 3300007076 | Ga0075435_100091275 | Ga0075435_1000912752 | 167 |
| 448 | 3300007076 | Ga0075435_100322851 | Ga0075435_1003228512 | 167 |
| 449 | 3300007076 | Ga0075435_100431366 | Ga0075435_1004313661 | 167 |
| 450 | 3300007076 | Ga0075435_101091586 | Ga0075435_1010915861 | 167 |
| 451 | 3300007076 | Ga0075435_101377075 | Ga0075435_1013770751 | 167 |
| 452 | 3300007265 | Ga0099794_10000632 | Ga0099794_100006326 | 167 |
| 453 | 3300007265 | Ga0099794_10003812 | Ga0099794_100038125 | 167 |
| 454 | 3300007265 | Ga0099794_10245584 | Ga0099794_102455842 | 167 |
| 455 | 3300009093 | Ga0105240_10011436 | Ga0105240_100114367 | 167 |
| 456 | 3300009094 | Ga0111539_10028267 | Ga0111539_100282678 | 167 |
| 457 | 3300009094 | Ga0111539_10066793 | Ga0111539_100667931 | 167 |
| 458 | 3300009094 | Ga0111539_10149740 | Ga0111539_101497403 | 167 |
| 459 | 3300009094 | Ga0111539_11668044 | Ga0111539_116680442 | 167 |
| 460 | 3300009098 | Ga0105245_10055259 | Ga0105245_100552594 | 167 |
| 461 | 3300009147 | Ga0114129_10000579 | Ga0114129_1000057912 | 167 |
| 462 | 3300009147 | Ga0114129_10000660 | Ga0114129_1000066026 | 167 |
| 463 | 3300009147 | Ga0114129_10001117 | Ga0114129_1000111712 | 167 |
| 464 | 3300009147 | Ga0114129_10007096 | Ga0114129_100070964 | 167 |
| 465 | 3300009147 | Ga0114129_10010852 | Ga0114129_1001085212 | 167 |
| 466 | 3300009147 | Ga0114129_10012554 | Ga0114129_100125542 | 167 |
| 467 | 3300009147 | Ga0114129_10013814 | Ga0114129_100138148 | 167 |
| 468 | 3300009147 | Ga0114129_10022323 | Ga0114129_100223237 | 167 |
| 469 | 3300009147 | Ga0114129_10045709 | Ga0114129_100457097 | 167 |
| 470 | 3300009147 | Ga0114129_10058855 | Ga0114129_100588557 | 167 |
| 471 | 3300009147 | Ga0114129_10078113 | Ga0114129_100781132 | 167 |
| 472 | 3300009147 | Ga0114129_10130394 | Ga0114129_101303944 | 167 |
| 473 | 3300009147 | Ga0114129_10165946 | Ga0114129_101659462 | 167 |
| 474 | 3300009147 | Ga0114129_10422144 | Ga0114129_104221442 | 167 |
| 475 | 3300009147 | Ga0114129_10556449 | Ga0114129_105564492 | 167 |
| 476 | 3300009147 | Ga0114129_10639158 | Ga0114129_106391581 | 167 |
| 477 | 3300009147 | Ga0114129_10641260 | Ga0114129_106412602 | 167 |
| 478 | 3300009147 | Ga0114129_10768755 | Ga0114129_107687552 | 167 |
| 479 | 3300009147 | Ga0114129_10803680 | Ga0114129_108036801 | 167 |
| 480 | 3300009147 | Ga0114129_11289411 | Ga0114129_112894111 | 167 |
| 481 | 3300009147 | Ga0114129_12406158 | Ga0114129_124061581 | 167 |
| 482 | 3300009148 | Ga0105243_10143648 | Ga0105243_101436482 | 167 |
| 483 | 3300009148 | Ga0105243_10301041 | Ga0105243_103010412 | 167 |
| 484 | 3300009174 | Ga0105241_10000334 | Ga0105241_1000033412 | 167 |
| 485 | 3300009174 | Ga0105241_10071938 | Ga0105241_100719382 | 167 |
| 486 | 3300009176 | Ga0105242_10409516 | Ga0105242_104095162 | 167 |
| 487 | 3300009545 | Ga0105237_10004494 | Ga0105237_100044942 | 167 |
| 488 | 3300009545 | Ga0105237_10388258 | Ga0105237_103882582 | 167 |
| 489 | 3300009551 | Ga0105238_10047700 | Ga0105238_100477004 | 167 |
| 490 | 3300009551 | Ga0105238_10244327 | Ga0105238_102443272 | 167 |
| 491 | 3300009553 | Ga0105249_10169675 | Ga0105249_101696754 | 167 |
| 492 | 3300009553 | Ga0105249_10443414 | Ga0105249_104434142 | 167 |
| 493 | 3300010375 | Ga0105239_10001412 | Ga0105239_1000141222 | 167 |
| 494 | 3300010375 | Ga0105239_10053250 | Ga0105239_100532505 | 167 |
| 495 | 3300011119 | Ga0105246_10026943 | Ga0105246_100269432 | 167 |
| 496 | 3300013100 | Ga0157373_10000379 | Ga0157373_1000037927 | 167 |
| 497 | 3300013102 | Ga0157371_10039298 | Ga0157371_100392982 | 167 |
| 498 | 3300013104 | Ga0157370_10323644 | Ga0157370_103236442 | 167 |
| 499 | 3300013105 | Ga0157369_10081128 | Ga0157369_100811281 | 167 |
| 500 | 3300013297 | Ga0157378_10057421 | Ga0157378_100574212 | 167 |
| 501 | 3300013306 | Ga0163162_10124639 | Ga0163162_101246395 | 167 |
| 502 | 3300013306 | Ga0163162_10188421 | Ga0163162_101884212 | 167 |
| 503 | 3300013306 | Ga0163162_10775534 | Ga0163162_107755342 | 167 |
| 504 | 3300013306 | Ga0163162_10830298 | Ga0163162_108302982 | 167 |
| 505 | 3300013307 | Ga0157372_10000135 | Ga0157372_1000013532 | 167 |
| 506 | 3300013308 | Ga0157375_10278348 | Ga0157375_102783482 | 167 |
| 507 | 3300013308 | Ga0157375_10706441 | Ga0157375_107064411 | 167 |
| 508 | 3300013308 | Ga0157375_10782746 | Ga0157375_107827462 | 167 |
| 509 | 3300013308 | Ga0157375_10832000 | Ga0157375_108320003 | 167 |
| 510 | 3300014325 | Ga0163163_10366456 | Ga0163163_103664561 | 167 |
| 511 | 3300014326 | Ga0157380_10948723 | Ga0157380_109487232 | 167 |
| 512 | 3300014968 | Ga0157379_10942539 | Ga0157379_109425392 | 167 |
| 513 | 3300025885 | Ga0207653_10000475 | Ga0207653_1000047511 | 167 |
| 514 | 3300025885 | Ga0207653_10014279 | Ga0207653_100142793 | 167 |
| 515 | 3300025893 | Ga0207682_10183446 | Ga0207682_101834462 | 167 |
| 516 | 3300025899 | Ga0207642_10612783 | Ga0207642_106127832 | 167 |
| 517 | 3300025901 | Ga0207688_10005719 | Ga0207688_100057192 | 167 |
| 518 | 3300025906 | Ga0207699_11213662 | Ga0207699_112136621 | 167 |
| 519 | 3300025907 | Ga0207645_10000075 | Ga0207645_1000007514 | 167 |
| 520 | 3300025908 | Ga0207643_10001707 | Ga0207643_100017079 | 167 |
| 521 | 3300025910 | Ga0207684_10002659 | Ga0207684_100026597 | 167 |
| 522 | 3300025910 | Ga0207684_10004127 | Ga0207684_100041279 | 167 |
| 523 | 3300025910 | Ga0207684_10012194 | Ga0207684_100121945 | 167 |
| 524 | 3300025910 | Ga0207684_10019452 | Ga0207684_100194521 | 167 |
| 525 | 3300025910 | Ga0207684_10046737 | Ga0207684_100467373 | 167 |
| 526 | 3300025910 | Ga0207684_10114982 | Ga0207684_101149821 | 167 |
| 527 | 3300025910 | Ga0207684_10223533 | Ga0207684_102235332 | 167 |
| 528 | 3300025910 | Ga0207684_10263126 | Ga0207684_102631262 | 167 |
| 529 | 3300025910 | Ga0207684_10271758 | Ga0207684_102717582 | 167 |
| 530 | 3300025910 | Ga0207684_10432701 | Ga0207684_104327012 | 167 |
| 531 | 3300025910 | Ga0207684_10623159 | Ga0207684_106231591 | 167 |
| 532 | 3300025910 | Ga0207684_10918797 | Ga0207684_109187971 | 167 |
| 533 | 3300025910 | Ga0207684_11356425 | Ga0207684_113564251 | 167 |
| 534 | 3300025911 | Ga0207654_10001071 | Ga0207654_100010714 | 167 |
| 535 | 3300025911 | Ga0207654_10395359 | Ga0207654_103953592 | 167 |
| 536 | 3300025912 | Ga0207707_10000135 | Ga0207707_1000013528 | 167 |
| 537 | 3300025913 | Ga0207695_10043920 | Ga0207695_100439202 | 167 |
| 538 | 3300025914 | Ga0207671_10004038 | Ga0207671_100040382 | 167 |
| 539 | 3300025915 | Ga0207693_10037917 | Ga0207693_100379176 | 167 |
| 540 | 3300025915 | Ga0207693_10331980 | Ga0207693_103319802 | 167 |
| 541 | 3300025917 | Ga0207660_10000688 | Ga0207660_100006889 | 167 |
| 542 | 3300025919 | Ga0207657_10000037 | Ga0207657_1000003784 | 167 |
| 543 | 3300025920 | Ga0207649_10001481 | Ga0207649_100014812 | 167 |
| 544 | 3300025921 | Ga0207652_10002292 | Ga0207652_1000229211 | 167 |
| 545 | 3300025922 | Ga0207646_10004177 | Ga0207646_100041779 | 167 |
| 546 | 3300025922 | Ga0207646_10052068 | Ga0207646_100520683 | 167 |
| 547 | 3300025922 | Ga0207646_10061177 | Ga0207646_100611773 | 167 |
| 548 | 3300025922 | Ga0207646_10110405 | Ga0207646_101104053 | 167 |
| 549 | 3300025922 | Ga0207646_10236028 | Ga0207646_102360282 | 167 |
| 550 | 3300025922 | Ga0207646_10340384 | Ga0207646_103403842 | 167 |
| 551 | 3300025923 | Ga0207681_10023557 | Ga0207681_100235572 | 167 |
| 552 | 3300025923 | Ga0207681_10197471 | Ga0207681_101974713 | 167 |
| 553 | 3300025923 | Ga0207681_10371651 | Ga0207681_103716512 | 167 |
| 554 | 3300025924 | Ga0207694_10026132 | Ga0207694_100261324 | 167 |
| 555 | 3300025925 | Ga0207650_10012455 | Ga0207650_100124552 | 167 |
| 556 | 3300025925 | Ga0207650_10653235 | Ga0207650_106532351 | 167 |
| 557 | 3300025927 | Ga0207687_10541448 | Ga0207687_105414482 | 167 |
| 558 | 3300025931 | Ga0207644_10901903 | Ga0207644_109019031 | 167 |
| 559 | 3300025932 | Ga0207690_10000562 | Ga0207690_100005626 | 167 |
| 560 | 3300025933 | Ga0207706_10011250 | Ga0207706_100112507 | 167 |
| 561 | 3300025935 | Ga0207709_10046732 | Ga0207709_100467324 | 167 |
| 562 | 3300025935 | Ga0207709_10084208 | Ga0207709_100842082 | 167 |
| 563 | 3300025935 | Ga0207709_10918305 | Ga0207709_109183051 | 167 |
| 564 | 3300025939 | Ga0207665_10000576 | Ga0207665_1000057616 | 167 |
| 565 | 3300025940 | Ga0207691_10124866 | Ga0207691_101248661 | 167 |
| 566 | 3300025942 | Ga0207689_10000029 | Ga0207689_1000002958 | 167 |
| 567 | 3300025942 | Ga0207689_10015346 | Ga0207689_100153462 | 167 |
| 568 | 3300025942 | Ga0207689_10827499 | Ga0207689_108274992 | 167 |
| 569 | 3300025945 | Ga0207679_10003224 | Ga0207679_100032243 | 167 |
| 570 | 3300025949 | Ga0207667_10000652 | Ga0207667_1000065226 | 167 |
| 571 | 3300025949 | Ga0207667_10039416 | Ga0207667_100394162 | 167 |
| 572 | 3300025961 | Ga0207712_10195752 | Ga0207712_101957522 | 167 |
| 573 | 3300025961 | Ga0207712_10210273 | Ga0207712_102102732 | 167 |
| 574 | 3300025972 | Ga0207668_10161578 | Ga0207668_101615783 | 167 |
| 575 | 3300025972 | Ga0207668_10822658 | Ga0207668_108226582 | 167 |
| 576 | 3300025972 | Ga0207668_10976694 | Ga0207668_109766941 | 167 |
| 577 | 3300025981 | Ga0207640_10008161 | Ga0207640_100081612 | 167 |
| 578 | 3300025986 | Ga0207658_10494166 | Ga0207658_104941661 | 167 |
| 579 | 3300026023 | Ga0207677_10378040 | Ga0207677_103780402 | 167 |
| 580 | 3300026035 | Ga0207703_10049558 | Ga0207703_100495581 | 167 |
| 581 | 3300026041 | Ga0207639_10002456 | Ga0207639_100024563 | 167 |
| 582 | 3300026041 | Ga0207639_11573387 | Ga0207639_115733871 | 167 |
| 583 | 3300026067 | Ga0207678_10017042 | Ga0207678_100170423 | 167 |
| 584 | 3300026078 | Ga0207702_10014520 | Ga0207702_100145204 | 167 |
| 585 | 3300026088 | Ga0207641_10065290 | Ga0207641_100652903 | 167 |
| 586 | 3300026088 | Ga0207641_10336511 | Ga0207641_103365112 | 167 |
| 587 | 3300026088 | Ga0207641_10391033 | Ga0207641_103910332 | 167 |
| 588 | 3300026089 | Ga0207648_10000552 | Ga0207648_1000055221 | 167 |
| 589 | 3300026089 | Ga0207648_10239374 | Ga0207648_102393742 | 167 |
| 590 | 3300026095 | Ga0207676_10030650 | Ga0207676_100306502 | 167 |
| 591 | 3300026116 | Ga0207674_10000306 | Ga0207674_1000030643 | 167 |
| 592 | 3300026118 | Ga0207675_100370393 | Ga0207675_1003703931 | 167 |
| 593 | 3300026118 | Ga0207675_101174561 | Ga0207675_1011745612 | 167 |
| 594 | 3300026118 | Ga0207675_101943093 | Ga0207675_1019430931 | 167 |
| 595 | 3300026142 | Ga0207698_10653220 | Ga0207698_106532202 | 167 |
| 596 | 3300027360 | Ga0209969_1019686 | Ga0209969_10196861 | 167 |
| 597 | 3300027364 | Ga0209967_1019363 | Ga0209967_10193632 | 167 |
| 598 | 3300027378 | Ga0209981_1010822 | Ga0209981_10108222 | 167 |
| 599 | 3300027395 | Ga0209996_1002549 | Ga0209996_10025491 | 167 |
| 600 | 3300027424 | Ga0209984_1013550 | Ga0209984_10135502 | 167 |
| 601 | 3300027471 | Ga0209995_1000572 | Ga0209995_10005725 | 167 |
| 602 | 3300027543 | Ga0209999_1003314 | Ga0209999_10033142 | 167 |
| 603 | 3300027552 | Ga0209982_1003328 | Ga0209982_10033282 | 167 |
| 604 | 3300027617 | Ga0210002_1052629 | Ga0210002_10526291 | 167 |
| 605 | 3300027665 | Ga0209983_1003456 | Ga0209983_10034562 | 167 |
| 606 | 3300027671 | Ga0209588_1011038 | Ga0209588_10110383 | 167 |
| 607 | 3300027671 | Ga0209588_1011602 | Ga0209588_10116022 | 167 |
| 608 | 3300027682 | Ga0209971_1000008 | Ga0209971_100000890 | 167 |
| 609 | 3300027695 | Ga0209966_1000187 | Ga0209966_100018715 | 167 |
| 610 | 3300027717 | Ga0209998_10000016 | Ga0209998_1000001612 | 167 |
| 611 | 3300027717 | Ga0209998_10112186 | Ga0209998_101121861 | 167 |
| 612 | 3300027876 | Ga0209974_10001677 | Ga0209974_100016777 | 167 |
| 613 | 3300027907 | Ga0207428_10000168 | Ga0207428_1000016833 | 167 |
| 614 | 3300027907 | Ga0207428_10034267 | Ga0207428_100342674 | 167 |
| 615 | 3300027907 | Ga0207428_10057266 | Ga0207428_100572663 | 167 |
| 616 | 3300028379 | Ga0268266_10907194 | Ga0268266_109071942 | 167 |
| 617 | 3300028380 | Ga0268265_10006105 | Ga0268265_100061057 | 167 |
| 618 | 3300028380 | Ga0268265_10045245 | Ga0268265_100452453 | 167 |
| 619 | 3300028380 | Ga0268265_10207679 | Ga0268265_102076791 | 167 |
| 620 | 3300028380 | Ga0268265_11335589 | Ga0268265_113355892 | 167 |
| 621 | 3300028381 | Ga0268264_10029733 | Ga0268264_100297334 | 167 |
| 622 | 3300028381 | Ga0268264_10101170 | Ga0268264_101011703 | 167 |
| 623 | 3300028381 | Ga0268264_10235077 | Ga0268264_102350772 | 167 |
| 624 | 3300028381 | Ga0268264_10355789 | Ga0268264_103557891 | 167 |
| 625 | 3300028381 | Ga0268264_10688324 | Ga0268264_106883242 | 167 |
| 626 | 3300028381 | Ga0268264_12388443 | Ga0268264_123884431 | 167 |
| 627 | 3300031249 | Ga0265339_10000272 | Ga0265339_100002726 | 167 |
| 628 | 3300031250 | Ga0265331_10015837 | Ga0265331_100158373 | 167 |
| 629 | 3300031250 | Ga0265331_10064532 | Ga0265331_100645322 | 167 |
| 630 | 3300031251 | Ga0265327_10034314 | Ga0265327_100343142 | 167 |
| 631 | 3300031711 | Ga0265314_10001254 | Ga0265314_1000125422 | 167 |
| 632 | 3300031712 | Ga0265342_10005494 | Ga0265342_100054949 | 167 |
| 633 | 3300031903 | Ga0307407_10450038 | Ga0307407_104500382 | 167 |
| 634 | 3300032004 | Ga0307414_11262789 | Ga0307414_112627891 | 167 |
| 635 | 3300035088 | Ga0373940_0001428 | Ga0373940_0001428_1838_2341 | 167 |
| 636 | 3300035088 | Ga0373940_0038110 | Ga0373940_0038110_101_604 | 167 |
| 637 | 3300035088 | Ga0373940_0255079 | Ga0373940_0255079_33_536 | 167 |
| 638 | 3300035090 | Ga0373949_0060558 | Ga0373949_0060558_122_625 | 167 |
| 639 | 3300035090 | Ga0373949_0087502 | Ga0373949_0087502_304_807 | 167 |
| 640 | 3300035091 | Ga0373951_0003456 | Ga0373951_0003456_150_653 | 167 |
| 641 | 3300035091 | Ga0373951_0067232 | Ga0373951_0067232_386_889 | 167 |
| 642 | 3300035112 | Ga0373932_0036242 | Ga0373932_0036242_635_1138 | 167 |
| 643 | 3300035114 | Ga0373939_0029981 | Ga0373939_0029981_491_994 | 167 |
| 644 | 3300035115 | Ga0373941_0048262 | Ga0373941_0048262_658_1161 | 167 |
| 645 | 3300035115 | Ga0373941_0090214 | Ga0373941_0090214_429_932 | 167 |
| 646 | 3300035121 | Ga0373960_0194574 | Ga0373960_0194574_105_608 | 167 |
| 647 | 3300035241 | Ga0373961_0126002 | Ga0373961_0126002_288_791 | 167 |
| 648 | 3300037466 | Ga0395898_0479204 | Ga0395898_0479204_237_740 | 167 |
| 649 | 3300038443 | Ga0395901_0030735 | Ga0395901_0030735_3570_4073 | 167 |
| 650 | 3300038996 | Ga0242420_012045 | Ga0242420_012045_922_1425 | 167 |
| 651 | 3300042005 | Ga0439448_0002671 | Ga0439448_0002671_1667_2170 | 167 |
| 652 | 3300042005 | Ga0439448_0009011 | Ga0439448_0009011_2227_2730 | 167 |
| 653 | 3300042012 | Ga0439455_0019004 | Ga0439455_0019004_666_1169 | 167 |
| 654 | 3300042012 | Ga0439455_0020883 | Ga0439455_0020883_790_1293 | 167 |
| 655 | 3300042157 | Ga0439458_0086836 | Ga0439458_0086836_64_567 | 167 |
| 656 | 3300042438 | Ga0439459_0012960 | Ga0439459_0012960_886_1389 | 167 |
| 657 | 3300042439 | Ga0439464_0002224 | Ga0439464_0002224_2304_2807 | 167 |
| 658 | 3300042876 | Ga0451577_0009451 | Ga0451577_0009451_151_654 | 167 |
| 659 | 3300042876 | Ga0451577_0056879 | Ga0451577_0056879_1994_2497 | 167 |
| 660 | 3300042876 | Ga0451577_0428341 | Ga0451577_0428341_342_845 | 167 |
| 661 | 3300042993 | Ga0439440_0108366 | Ga0439440_0108366_102_605 | 167 |
| 662 | 3300044712 | Ga0453684_0073068 | Ga0453684_0073068_3493_3996 | 167 |
| 663 | 3300044712 | Ga0453684_0703299 | Ga0453684_0703299_255_758 | 167 |
| 664 | 3300044712 | Ga0453684_0797419 | Ga0453684_0797419_250_753 | 167 |
| 665 | 3300045051 | Ga0451576_0017221 | Ga0451576_0017221_4361_4864 | 167 |
| 666 | 3300045051 | Ga0451576_0023457 | Ga0451576_0023457_1864_2367 | 167 |
| 667 | 3300045051 | Ga0451576_0179161 | Ga0451576_0179161_775_1278 | 167 |
| 668 | 3300045051 | Ga0451576_0685697 | Ga0451576_0685697_533_1036 | 167 |
| 669 | 3300045051 | Ga0451576_0991665 | Ga0451576_0991665_361_864 | 167 |
| 670 | 3300045051 | Ga0451576_1197066 | Ga0451576_1197066_74_577 | 167 |
| 671 | 3300045051 | Ga0451576_1297684 | Ga0451576_1297684_43_546 | 167 |
| 672 | 3300046472 | Ga0495580_0001207 | Ga0495580_0001207_11134_11637 | 167 |
| 673 | 3300046472 | Ga0495580_0004677 | Ga0495580_0004677_5730_6233 | 167 |
| 674 | 3300046472 | Ga0495580_0010780 | Ga0495580_0010780_6418_6921 | 167 |
| 675 | 3300046472 | Ga0495580_0335090 | Ga0495580_0335090_440_943 | 167 |
| 676 | 3300046472 | Ga0495580_0368641 | Ga0495580_0368641_154_657 | 167 |
| 677 | 3300046683 | Ga0495658_0770757 | Ga0495658_0770757_38_541 | 167 |
| 678 | 3300046684 | Ga0495669_0445186 | Ga0495669_0445186_85_588 | 167 |
| 679 | 3300046691 | Ga0495670_0244918 | Ga0495670_0244918_302_805 | 167 |
| 680 | 3300047318 | Ga0495636_0011896 | Ga0495636_0011896_1628_2131 | 167 |
| 681 | 3300048905 | Ga0496102_0065144 | Ga0496102_0065144_22_525 | 167 |
| 682 | 3300048907 | Ga0496104_0213573 | Ga0496104_0213573_1164_1736 | 167 |
| 683 | 3300048907 | Ga0496104_0361093 | Ga0496104_0361093_823_1326 | 167 |
| 684 | 3300048908 | Ga0496105_0932002 | Ga0496105_0932002_32_604 | 167 |
| 685 | 3300048909 | Ga0496106_0021548 | Ga0496106_0021548_3480_3983 | 167 |
| 686 | 3300048909 | Ga0496106_0358269 | Ga0496106_0358269_363_866 | 167 |
| 687 | 3300048915 | Ga0496112_0132512 | Ga0496112_0132512_1733_2236 | 167 |
| 688 | 3300048920 | Ga0496117_0109075 | Ga0496117_0109075_1188_1691 | 167 |
| 689 | 3300048921 | Ga0496118_0098363 | Ga0496118_0098363_1469_1972 | 167 |
| 690 | 3300048924 | Ga0496121_0000430 | Ga0496121_0000430_53004_53507 | 167 |
| 691 | 3300048924 | Ga0496121_0002278 | Ga0496121_0002278_17250_17753 | 167 |
| 692 | 3300048924 | Ga0496121_0144076 | Ga0496121_0144076_289_852 | 167 |
| 693 | 3300049568 | Ga0501031_0227111 | Ga0501031_0227111_419_922 | 167 |
| 694 | 3300049568 | Ga0501031_0368448 | Ga0501031_0368448_339_842 | 167 |
| 695 | 3300049568 | Ga0501031_0398171 | Ga0501031_0398171_12_515 | 167 |
| 696 | 3300049569 | Ga0501032_0016172 | Ga0501032_0016172_841_1344 | 167 |
| 697 | 3300049569 | Ga0501032_0095916 | Ga0501032_0095916_1278_1781 | 167 |
| 698 | 3300049570 | Ga0501033_0101533 | Ga0501033_0101533_691_1194 | 167 |
| 699 | 3300049570 | Ga0501033_0101645 | Ga0501033_0101645_342_845 | 167 |
| 700 | 3300049570 | Ga0501033_0187517 | Ga0501033_0187517_642_1145 | 167 |
| 701 | 3300049571 | Ga0501034_0577509 | Ga0501034_0577509_346_849 | 167 |
| 702 | 3300049572 | Ga0501036_0038579 | Ga0501036_0038579_3299_3802 | 167 |
| 703 | 3300049572 | Ga0501036_0084753 | Ga0501036_0084753_671_1174 | 167 |
| 704 | 3300049572 | Ga0501036_0158070 | Ga0501036_0158070_1113_1616 | 167 |
| 705 | 3300049572 | Ga0501036_0275058 | Ga0501036_0275058_69_572 | 167 |
| 706 | 3300049572 | Ga0501036_0440288 | Ga0501036_0440288_79_690 | 167 |
| 707 | 3300049572 | Ga0501036_0987017 | Ga0501036_0987017_152_655 | 167 |
| 708 | 3300049573 | Ga0501037_0045057 | Ga0501037_0045057_566_1069 | 167 |
| 709 | 3300049573 | Ga0501037_0047461 | Ga0501037_0047461_449_952 | 167 |
| 710 | 3300049574 | Ga0501038_0053638 | Ga0501038_0053638_2689_3192 | 167 |
| 711 | 3300049574 | Ga0501038_0059039 | Ga0501038_0059039_2595_3098 | 167 |
| 712 | 3300049574 | Ga0501038_0283912 | Ga0501038_0283912_110_613 | 167 |
| 713 | 3300049574 | Ga0501038_0750782 | Ga0501038_0750782_154_657 | 167 |
| 714 | 3300049575 | Ga0501039_0128383 | Ga0501039_0128383_832_1335 | 167 |
| 715 | 3300049575 | Ga0501039_0132666 | Ga0501039_0132666_1312_1815 | 167 |
| 716 | 3300049575 | Ga0501039_0737542 | Ga0501039_0737542_157_660 | 167 |
| 717 | 3300049576 | Ga0501040_0001982 | Ga0501040_0001982_5125_5628 | 167 |
| 718 | 3300049576 | Ga0501040_0024722 | Ga0501040_0024722_461_964 | 167 |
| 719 | 3300049576 | Ga0501040_0058584 | Ga0501040_0058584_1780_2394 | 167 |
| 720 | 3300049576 | Ga0501040_0231663 | Ga0501040_0231663_220_723 | 167 |
| 721 | 3300049576 | Ga0501040_0662906 | Ga0501040_0662906_80_583 | 167 |
| 722 | 3300049576 | Ga0501040_0697913 | Ga0501040_0697913_193_696 | 167 |
| 723 | 3300049577 | Ga0501041_0010994 | Ga0501041_0010994_2240_2743 | 167 |
| 724 | 3300049577 | Ga0501041_0267676 | Ga0501041_0267676_154_657 | 167 |
| 725 | 3300049578 | Ga0501042_0007810 | Ga0501042_0007810_6464_6967 | 167 |
| 726 | 3300049578 | Ga0501042_0066372 | Ga0501042_0066372_2009_2512 | 167 |
| 727 | 3300049578 | Ga0501042_0070864 | Ga0501042_0070864_1797_2300 | 167 |
| 728 | 3300049578 | Ga0501042_0095081 | Ga0501042_0095081_827_1330 | 167 |
| 729 | 3300049578 | Ga0501042_0241775 | Ga0501042_0241775_690_1193 | 167 |
| 730 | 3300049578 | Ga0501042_0420492 | Ga0501042_0420492_102_605 | 167 |
| 731 | 3300049578 | Ga0501042_0486119 | Ga0501042_0486119_234_737 | 167 |
| 732 | 3300049579 | Ga0501043_0011980 | Ga0501043_0011980_1568_2071 | 167 |
| 733 | 3300049579 | Ga0501043_0066858 | Ga0501043_0066858_1228_1731 | 167 |
| 734 | 3300049579 | Ga0501043_0611521 | Ga0501043_0611521_282_785 | 167 |
| 735 | 3300049580 | Ga0501046_0009495 | Ga0501046_0009495_7542_8045 | 167 |
| 736 | 3300049580 | Ga0501046_0152707 | Ga0501046_0152707_602_1105 | 167 |
| 737 | 3300049580 | Ga0501046_0238257 | Ga0501046_0238257_28_531 | 167 |
| 738 | 3300049580 | Ga0501046_0256518 | Ga0501046_0256518_286_852 | 167 |
| 739 | 3300049580 | Ga0501046_0851809 | Ga0501046_0851809_32_535 | 167 |
| 740 | 3300049581 | Ga0501047_0169163 | Ga0501047_0169163_1534_2037 | 167 |
| 741 | 3300049582 | Ga0501048_0605348 | Ga0501048_0605348_122_625 | 167 |
| 742 | 3300049582 | Ga0501048_1094094 | Ga0501048_1094094_13_516 | 167 |
| 743 | 3300049584 | Ga0501068_0014188 | Ga0501068_0014188_4019_4522 | 167 |
| 744 | 3300049584 | Ga0501068_0049838 | Ga0501068_0049838_1332_1835 | 167 |
| 745 | 3300049584 | Ga0501068_0153763 | Ga0501068_0153763_833_1336 | 167 |
| 746 | 3300049584 | Ga0501068_0195957 | Ga0501068_0195957_172_675 | 167 |
| 747 | 3300049585 | Ga0501069_0230676 | Ga0501069_0230676_323_826 | 167 |
| 748 | 3300049586 | Ga0501070_0017134 | Ga0501070_0017134_3616_4119 | 167 |
| 749 | 3300049587 | Ga0501071_0344228 | Ga0501071_0344228_460_963 | 167 |
| 750 | 3300049587 | Ga0501071_0367589 | Ga0501071_0367589_479_982 | 167 |
| 751 | 3300049587 | Ga0501071_0376801 | Ga0501071_0376801_297_896 | 167 |
| 752 | 3300049587 | Ga0501071_0550587 | Ga0501071_0550587_210_713 | 167 |
| 753 | 3300049587 | Ga0501071_0552428 | Ga0501071_0552428_195_698 | 167 |
| 754 | 3300049587 | Ga0501071_0962108 | Ga0501071_0962108_141_644 | 167 |
| 755 | 3300049588 | Ga0501072_0030312 | Ga0501072_0030312_2634_3137 | 167 |
| 756 | 3300049588 | Ga0501072_0041657 | Ga0501072_0041657_1899_2465 | 167 |
| 757 | 3300049588 | Ga0501072_0083194 | Ga0501072_0083194_413_916 | 167 |
| 758 | 3300049588 | Ga0501072_0181939 | Ga0501072_0181939_988_1491 | 167 |
| 759 | 3300049588 | Ga0501072_0293209 | Ga0501072_0293209_324_845 | 167 |
| 760 | 3300049588 | Ga0501072_0804161 | Ga0501072_0804161_187_690 | 167 |
| 761 | 3300049589 | Ga0501073_0067235 | Ga0501073_0067235_1621_2124 | 167 |
| 762 | 3300049589 | Ga0501073_0612758 | Ga0501073_0612758_147_650 | 167 |
| 763 | 3300049589 | Ga0501073_1090340 | Ga0501073_1090340_17_520 | 167 |
| 764 | 3300049590 | Ga0501074_0002117 | Ga0501074_0002117_6727_7230 | 167 |
| 765 | 3300049590 | Ga0501074_0009550 | Ga0501074_0009550_5476_5979 | 167 |
| 766 | 3300049590 | Ga0501074_0035025 | Ga0501074_0035025_1626_2129 | 167 |
| 767 | 3300049591 | Ga0501075_0004974 | Ga0501075_0004974_8475_8978 | 167 |
| 768 | 3300049591 | Ga0501075_0019228 | Ga0501075_0019228_717_1220 | 167 |
| 769 | 3300049591 | Ga0501075_0068760 | Ga0501075_0068760_1499_2110 | 167 |
| 770 | 3300049591 | Ga0501075_0106259 | Ga0501075_0106259_471_974 | 167 |
| 771 | 3300049591 | Ga0501075_0510221 | Ga0501075_0510221_115_618 | 167 |
| 772 | 3300049592 | Ga0501076_0022605 | Ga0501076_0022605_2795_3394 | 167 |
| 773 | 3300049592 | Ga0501076_0063606 | Ga0501076_0063606_2271_2882 | 167 |
| 774 | 3300049592 | Ga0501076_0483273 | Ga0501076_0483273_404_907 | 167 |
| 775 | 3300049592 | Ga0501076_0565617 | Ga0501076_0565617_222_725 | 167 |
| 776 | 3300049592 | Ga0501076_0807125 | Ga0501076_0807125_176_679 | 167 |
| 777 | 3300049592 | Ga0501076_0907176 | Ga0501076_0907176_160_663 | 167 |
| 778 | 3300049592 | Ga0501076_0961380 | Ga0501076_0961380_17_520 | 167 |
| 779 | 3300049593 | Ga0501077_0006466 | Ga0501077_0006466_1353_1856 | 167 |
| 780 | 3300049593 | Ga0501077_0021397 | Ga0501077_0021397_2516_3115 | 167 |
| 781 | 3300049593 | Ga0501077_0022849 | Ga0501077_0022849_3079_3582 | 167 |
| 782 | 3300049593 | Ga0501077_0075484 | Ga0501077_0075484_1255_1758 | 167 |
| 783 | 3300049593 | Ga0501077_0091515 | Ga0501077_0091515_1142_1645 | 167 |
| 784 | 3300049593 | Ga0501077_0106373 | Ga0501077_0106373_953_1456 | 167 |
| 785 | 3300049593 | Ga0501077_0127584 | Ga0501077_0127584_1000_1503 | 167 |
| 786 | 3300049593 | Ga0501077_0206723 | Ga0501077_0206723_487_990 | 167 |
| 787 | 3300049593 | Ga0501077_0210938 | Ga0501077_0210938_658_1161 | 167 |
| 788 | 3300049741 | Ga0501079_0035033 | Ga0501079_0035033_1047_1550 | 167 |
| 789 | 3300049741 | Ga0501079_0047343 | Ga0501079_0047343_103_606 | 167 |
| 790 | 3300049741 | Ga0501079_0237604 | Ga0501079_0237604_20_619 | 167 |
| 791 | 3300049741 | Ga0501079_0524792 | Ga0501079_0524792_188_754 | 167 |
| 792 | 3300049741 | Ga0501079_0747879 | Ga0501079_0747879_157_660 | 167 |
| 793 | 3300049741 | Ga0501079_1153390 | Ga0501079_1153390_80_583 | 167 |
| 794 | 3300049742 | Ga0501080_0020720 | Ga0501080_0020720_4286_4789 | 167 |
| 795 | 3300049743 | Ga0501081_0002082 | Ga0501081_0002082_3985_4488 | 167 |
| 796 | 3300049743 | Ga0501081_0003624 | Ga0501081_0003624_2356_2859 | 167 |
| 797 | 3300049743 | Ga0501081_0008158 | Ga0501081_0008158_2998_3501 | 167 |
| 798 | 3300049743 | Ga0501081_0022821 | Ga0501081_0022821_1203_1706 | 167 |
| 799 | 3300049743 | Ga0501081_0038357 | Ga0501081_0038357_485_1051 | 167 |
| 800 | 3300049743 | Ga0501081_0135486 | Ga0501081_0135486_1183_1686 | 167 |
| 801 | 3300049743 | Ga0501081_0135859 | Ga0501081_0135859_323_934 | 167 |
| 802 | 3300049743 | Ga0501081_0240198 | Ga0501081_0240198_211_714 | 167 |
| 803 | 3300049743 | Ga0501081_0268233 | Ga0501081_0268233_698_1201 | 167 |
| 804 | 3300049743 | Ga0501081_0304890 | Ga0501081_0304890_304_807 | 167 |
| 805 | 3300049743 | Ga0501081_0436468 | Ga0501081_0436468_172_675 | 167 |
| 806 | 3300049743 | Ga0501081_0455201 | Ga0501081_0455201_142_645 | 167 |
| 807 | 3300049743 | Ga0501081_0498605 | Ga0501081_0498605_65_568 | 167 |
| 808 | 3300049743 | Ga0501081_0574039 | Ga0501081_0574039_40_543 | 167 |
| 809 | 3300049743 | Ga0501081_0697597 | Ga0501081_0697597_246_749 | 167 |
| 810 | 3300049744 | Ga0501083_0002379 | Ga0501083_0002379_424_927 | 167 |
| 811 | 3300049744 | Ga0501083_0016181 | Ga0501083_0016181_2475_2978 | 167 |
| 812 | 3300049744 | Ga0501083_0065498 | Ga0501083_0065498_10_513 | 167 |
| 813 | 3300049744 | Ga0501083_0100367 | Ga0501083_0100367_434_937 | 167 |
| 814 | 3300049744 | Ga0501083_0224680 | Ga0501083_0224680_678_1181 | 167 |
| 815 | 3300049822 | Ga0501035_0015418 | Ga0501035_0015418_1059_1562 | 167 |
| 816 | 3300049822 | Ga0501035_0202571 | Ga0501035_0202571_49_552 | 167 |
| 817 | 3300049822 | Ga0501035_1005054 | Ga0501035_1005054_73_576 | 167 |
| 818 | 3300049823 | Ga0501044_0000121 | Ga0501044_0000121_64327_64830 | 167 |
| 819 | 3300049823 | Ga0501044_0009312 | Ga0501044_0009312_6180_6683 | 167 |
| 820 | 3300049824 | Ga0501045_0000998 | Ga0501045_0000998_8903_9406 | 167 |
| 821 | 3300049824 | Ga0501045_0015358 | Ga0501045_0015358_318_821 | 167 |
| 822 | 3300049824 | Ga0501045_0018759 | Ga0501045_0018759_2055_2558 | 167 |
| 823 | 3300049824 | Ga0501045_0160548 | Ga0501045_0160548_420_923 | 167 |
| 824 | 3300049824 | Ga0501045_0217455 | Ga0501045_0217455_294_797 | 167 |
| 825 | 3300049824 | Ga0501045_0264455 | Ga0501045_0264455_110_613 | 167 |
| 826 | 3300049824 | Ga0501045_0520429 | Ga0501045_0520429_207_710 | 167 |
| 827 | 3300049824 | Ga0501045_0541002 | Ga0501045_0541002_213_779 | 167 |
| 828 | 3300049824 | Ga0501045_0724879 | Ga0501045_0724879_109_612 | 167 |
| 829 | 3300050507 | nmdc:mga05p37_1087355_c1 | nmdc:mga05p37_1087355_c1_226_729 | 167 |
| 830 | 3300050507 | nmdc:mga05p37_1239306_c1 | nmdc:mga05p37_1239306_c1_85_588 | 167 |
| 831 | 3300050507 | nmdc:mga05p37_1447_c1 | nmdc:mga05p37_1447_c1_1264_1770 | 167 |
| 832 | 3300050507 | nmdc:mga05p37_1453785_c1 | nmdc:mga05p37_1453785_c1_106_609 | 167 |
| 833 | 3300050507 | nmdc:mga05p37_165552_c1 | nmdc:mga05p37_165552_c1_1234_1737 | 167 |
| 834 | 3300050507 | nmdc:mga05p37_1713740_c1 | nmdc:mga05p37_1713740_c1_15_518 | 167 |
| 835 | 3300050507 | nmdc:mga05p37_26490_c1 | nmdc:mga05p37_26490_c1_1417_1920 | 167 |
| 836 | 3300050507 | nmdc:mga05p37_279370_c1 | nmdc:mga05p37_279370_c1_721_1224 | 167 |
| 837 | 3300050507 | nmdc:mga05p37_32437_c1 | nmdc:mga05p37_32437_c1_4321_4914 | 167 |
| 838 | 3300050507 | nmdc:mga05p37_32456_c1 | nmdc:mga05p37_32456_c1_5742_6245 | 167 |
| 839 | 3300050507 | nmdc:mga05p37_388525_c1 | nmdc:mga05p37_388525_c1_467_970 | 167 |
| 840 | 3300050507 | nmdc:mga05p37_399654_c1 | nmdc:mga05p37_399654_c1_1029_1532 | 167 |
| 841 | 3300050507 | nmdc:mga05p37_4034_c1 | nmdc:mga05p37_4034_c1_1929_2432 | 167 |
| 842 | 3300050507 | nmdc:mga05p37_404716_c1 | nmdc:mga05p37_404716_c1_404_907 | 167 |
| 843 | 3300050507 | nmdc:mga05p37_415226_c1 | nmdc:mga05p37_415226_c1_665_1168 | 167 |
| 844 | 3300050507 | nmdc:mga05p37_52253_c1 | nmdc:mga05p37_52253_c1_4496_4999 | 167 |
| 845 | 3300050507 | nmdc:mga05p37_628967_c1 | nmdc:mga05p37_628967_c1_222_728 | 167 |
| 846 | 3300050507 | nmdc:mga05p37_633658_c1 | nmdc:mga05p37_633658_c1_561_1064 | 167 |
| 847 | 3300050507 | nmdc:mga05p37_67090_c1 | nmdc:mga05p37_67090_c1_1775_2278 | 167 |
| 848 | 3300050507 | nmdc:mga05p37_68146_c1 | nmdc:mga05p37_68146_c1_3233_3739 | 167 |
| 849 | 3300050507 | nmdc:mga05p37_702_c1 | nmdc:mga05p37_702_c1_28148_28654 | 167 |
| 850 | 3300050507 | nmdc:mga05p37_98891_c1 | nmdc:mga05p37_98891_c1_2401_2904 | 167 |
| 851 | 3300050508 | nmdc:mga09592_30955_c1 | nmdc:mga09592_30955_c1_1967_2470 | 167 |
| 852 | 3300050508 | nmdc:mga09592_324884_c1 | nmdc:mga09592_324884_c1_523_1026 | 167 |
| 853 | 3300050508 | nmdc:mga09592_448901_c1 | nmdc:mga09592_448901_c1_175_678 | 167 |
| 854 | 3300050508 | nmdc:mga09592_50504_c1 | nmdc:mga09592_50504_c1_140_643 | 167 |
| 855 | 3300050508 | nmdc:mga09592_711441_c1 | nmdc:mga09592_711441_c1_331_837 | 167 |
| 856 | 3300050508 | nmdc:mga09592_774126_c1 | nmdc:mga09592_774126_c1_35_538 | 167 |
| 857 | 3300050508 | nmdc:mga09592_82262_c1 | nmdc:mga09592_82262_c1_1997_2590 | 167 |
| 858 | 3300050508 | nmdc:mga09592_856738_c1 | nmdc:mga09592_856738_c1_86_589 | 167 |
| 859 | 3300050508 | nmdc:mga09592_9034_c1 | nmdc:mga09592_9034_c1_1759_2265 | 167 |
| 860 | 3300050508 | nmdc:mga09592_917271_c1 | nmdc:mga09592_917271_c1_54_557 | 167 |
| 861 | 3300050509 | nmdc:mga0qj67_503823_c1 | nmdc:mga0qj67_503823_c1_72_578 | 167 |
| 862 | 3300050509 | nmdc:mga0qj67_683630_c1 | nmdc:mga0qj67_683630_c1_119_622 | 167 |
| 863 | 3300050509 | nmdc:mga0qj67_729772_c1 | nmdc:mga0qj67_729772_c1_145_648 | 167 |
| 864 | 3300050509 | nmdc:mga0qj67_92821_c1 | nmdc:mga0qj67_92821_c1_1238_1741 | 167 |
| 865 | 3300050509 | nmdc:mga0qj67_98912_c1 | nmdc:mga0qj67_98912_c1_1445_1948 | 167 |
| 866 | 3300050510 | nmdc:mga06r32_1052242_c1 | nmdc:mga06r32_1052242_c1_229_732 | 167 |
| 867 | 3300050510 | nmdc:mga06r32_112856_c1 | nmdc:mga06r32_112856_c1_273_779 | 167 |
| 868 | 3300050510 | nmdc:mga06r32_155934_c1 | nmdc:mga06r32_155934_c1_1484_1987 | 167 |
| 869 | 3300050510 | nmdc:mga06r32_196063_c1 | nmdc:mga06r32_196063_c1_568_1071 | 167 |
| 870 | 3300050511 | nmdc:mga08y16_1106_c1 | nmdc:mga08y16_1106_c1_4950_5453 | 167 |
| 871 | 3300050511 | nmdc:mga08y16_337312_c1 | nmdc:mga08y16_337312_c1_526_1029 | 167 |
| 872 | 3300050511 | nmdc:mga08y16_36954_c1 | nmdc:mga08y16_36954_c1_3746_4249 | 167 |
| 873 | 3300050511 | nmdc:mga08y16_382488_c1 | nmdc:mga08y16_382488_c1_674_1177 | 167 |
| 874 | 3300050512 | nmdc:mga0n895_11260_c1 | nmdc:mga0n895_11260_c1_4251_4754 | 167 |
| 875 | 3300050512 | nmdc:mga0n895_13403_c1 | nmdc:mga0n895_13403_c1_4116_4709 | 167 |
| 876 | 3300050512 | nmdc:mga0n895_17372_c1 | nmdc:mga0n895_17372_c1_3050_3553 | 167 |
| 877 | 3300050512 | nmdc:mga0n895_186_c1 | nmdc:mga0n895_186_c1_21047_21553 | 167 |
| 878 | 3300050512 | nmdc:mga0n895_209879_c1 | nmdc:mga0n895_209879_c1_1106_1609 | 167 |
| 879 | 3300050512 | nmdc:mga0n895_22584_c1 | nmdc:mga0n895_22584_c1_4307_4810 | 167 |
| 880 | 3300050512 | nmdc:mga0n895_241132_c1 | nmdc:mga0n895_241132_c1_868_1371 | 167 |
| 881 | 3300050512 | nmdc:mga0n895_308962_c1 | nmdc:mga0n895_308962_c1_866_1369 | 167 |
| 882 | 3300050512 | nmdc:mga0n895_386948_c1 | nmdc:mga0n895_386948_c1_569_1072 | 167 |
| 883 | 3300050512 | nmdc:mga0n895_436907_c1 | nmdc:mga0n895_436907_c1_604_1107 | 167 |
| 884 | 3300050512 | nmdc:mga0n895_452584_c1 | nmdc:mga0n895_452584_c1_290_793 | 167 |
| 885 | 3300050512 | nmdc:mga0n895_5330_c1 | nmdc:mga0n895_5330_c1_1378_1881 | 167 |
| 886 | 3300050512 | nmdc:mga0n895_5865_c1 | nmdc:mga0n895_5865_c1_3606_4109 | 167 |
| 887 | 3300050512 | nmdc:mga0n895_688210_c1 | nmdc:mga0n895_688210_c1_470_973 | 167 |
| 888 | 3300050513 | nmdc:mga0rr50_121958_c1 | nmdc:mga0rr50_121958_c1_1159_1662 | 167 |
| 889 | 3300050513 | nmdc:mga0rr50_13486_c1 | nmdc:mga0rr50_13486_c1_3608_4111 | 167 |
| 890 | 3300050513 | nmdc:mga0rr50_224656_c1 | nmdc:mga0rr50_224656_c1_555_1058 | 167 |
| 891 | 3300050513 | nmdc:mga0rr50_458468_c1 | nmdc:mga0rr50_458468_c1_112_615 | 167 |
| 892 | 3300050513 | nmdc:mga0rr50_55930_c1 | nmdc:mga0rr50_55930_c1_2009_2512 | 167 |
| 893 | 3300050513 | nmdc:mga0rr50_629_c1 | nmdc:mga0rr50_629_c1_10498_11004 | 167 |
| 894 | 3300050513 | nmdc:mga0rr50_7815_c1 | nmdc:mga0rr50_7815_c1_670_1263 | 167 |
| 895 | 3300050513 | nmdc:mga0rr50_91183_c1 | nmdc:mga0rr50_91183_c1_47_550 | 167 |
| 896 | 3300050513 | nmdc:mga0rr50_99206_c1 | nmdc:mga0rr50_99206_c1_1205_1708 | 167 |
| 897 | 3300050514 | nmdc:mga08x19_315205_c1 | nmdc:mga08x19_315205_c1_398_901 | 167 |
| 898 | 3300050514 | nmdc:mga08x19_379302_c1 | nmdc:mga08x19_379302_c1_314_817 | 167 |
| 899 | 3300050514 | nmdc:mga08x19_44987_c1 | nmdc:mga08x19_44987_c1_991_1494 | 167 |
| 900 | 3300050514 | nmdc:mga08x19_55183_c1 | nmdc:mga08x19_55183_c1_1109_1612 | 167 |
| 901 | 3300050514 | nmdc:mga08x19_65730_c1 | nmdc:mga08x19_65730_c1_303_806 | 167 |
| 902 | 3300050514 | nmdc:mga08x19_90121_c1 | nmdc:mga08x19_90121_c1_868_1371 | 167 |
| 903 | 3300050515 | nmdc:mga0a205_135357_c1 | nmdc:mga0a205_135357_c1_1521_2024 | 167 |
| 904 | 3300050515 | nmdc:mga0a205_17686_c1 | nmdc:mga0a205_17686_c1_4449_5042 | 167 |
| 905 | 3300050515 | nmdc:mga0a205_182897_c1 | nmdc:mga0a205_182897_c1_937_1440 | 167 |
| 906 | 3300050515 | nmdc:mga0a205_206867_c1 | nmdc:mga0a205_206867_c1_272_775 | 167 |
| 907 | 3300050515 | nmdc:mga0a205_215435_c1 | nmdc:mga0a205_215435_c1_104_607 | 167 |
| 908 | 3300050515 | nmdc:mga0a205_216785_c1 | nmdc:mga0a205_216785_c1_788_1291 | 167 |
| 909 | 3300050515 | nmdc:mga0a205_233741_c1 | nmdc:mga0a205_233741_c1_518_1021 | 167 |
| 910 | 3300050515 | nmdc:mga0a205_245503_c1 | nmdc:mga0a205_245503_c1_103_606 | 167 |
| 911 | 3300050515 | nmdc:mga0a205_250874_c1 | nmdc:mga0a205_250874_c1_343_846 | 167 |
| 912 | 3300050515 | nmdc:mga0a205_2643_c1 | nmdc:mga0a205_2643_c1_12616_13119 | 167 |
| 913 | 3300050515 | nmdc:mga0a205_265783_c1 | nmdc:mga0a205_265783_c1_997_1500 | 167 |
| 914 | 3300050515 | nmdc:mga0a205_289770_c1 | nmdc:mga0a205_289770_c1_477_980 | 167 |
| 915 | 3300050515 | nmdc:mga0a205_358159_c1 | nmdc:mga0a205_358159_c1_306_809 | 167 |
| 916 | 3300050515 | nmdc:mga0a205_4159_c1 | nmdc:mga0a205_4159_c1_355_861 | 167 |
| 917 | 3300050515 | nmdc:mga0a205_49373_c1 | nmdc:mga0a205_49373_c1_1583_2086 | 167 |
| 918 | 3300050515 | nmdc:mga0a205_523029_c1 | nmdc:mga0a205_523029_c1_292_795 | 167 |
| 919 | 3300050515 | nmdc:mga0a205_564550_c1 | nmdc:mga0a205_564550_c1_150_653 | 167 |
| 920 | 3300050515 | nmdc:mga0a205_83386_c1 | nmdc:mga0a205_83386_c1_1369_1875 | 167 |
| 921 | 3300054114 | Ga0501084_0014517 | Ga0501084_0014517_6000_6503 | 167 |
| 922 | 3300054114 | Ga0501084_0033887 | Ga0501084_0033887_3079_3582 | 167 |
| 923 | 3300054114 | Ga0501084_0187345 | Ga0501084_0187345_1091_1594 | 167 |
| 924 | 3300054114 | Ga0501084_0279110 | Ga0501084_0279110_696_1199 | 167 |
| 925 | 3300054114 | Ga0501084_0290440 | Ga0501084_0290440_341_844 | 167 |
| 926 | 3300054114 | Ga0501084_0321313 | Ga0501084_0321313_711_1214 | 167 |
| 927 | 3300054114 | Ga0501084_0425833 | Ga0501084_0425833_169_735 | 167 |
| 928 | 3300054114 | Ga0501084_0879269 | Ga0501084_0879269_23_526 | 167 |
| 929 | 3300059424 | Ga0590075_011669 | Ga0590075_011669_1087_1590 | 167 |
| 930 | 3300059426 | Ga0590077_065822 | Ga0590077_065822_224_727 | 167 |
| 931 | 3300060353 | Ga0501082_0001040 | Ga0501082_0001040_10744_11247 | 167 |
| 932 | 3300060353 | Ga0501082_0002202 | Ga0501082_0002202_6253_6756 | 167 |
| 933 | 3300060353 | Ga0501082_0005588 | Ga0501082_0005588_5604_6107 | 167 |
| 934 | 3300060353 | Ga0501082_0350813 | Ga0501082_0350813_162_665 | 167 |
| 935 | 3300060353 | Ga0501082_0388015 | Ga0501082_0388015_606_1109 | 167 |
| 936 | 3300060353 | Ga0501082_0656002 | Ga0501082_0656002_371_901 | 167 |
| 937 | 3300060353 | Ga0501082_1379990 | Ga0501082_1379990_28_531 | 167 |
| 938 | 3300060353 | Ga0501082_1441790 | Ga0501082_1441790_40_543 | 167 |
| 939 | 3300061734 | Ga0530510_0000244 | Ga0530510_0000244_16155_16658 | 167 |
| 940 | 3300061734 | Ga0530510_0005130 | Ga0530510_0005130_5001_5504 | 167 |
| 941 | 3300061734 | Ga0530510_0005522 | Ga0530510_0005522_1805_2308 | 167 |
| 942 | 3300061734 | Ga0530510_0029517 | Ga0530510_0029517_766_1269 | 167 |
| 943 | 3300061734 | Ga0530510_0033237 | Ga0530510_0033237_2279_2782 | 167 |
| 944 | 3300061734 | Ga0530510_0126761 | Ga0530510_0126761_663_1166 | 167 |
| 945 | 3300061734 | Ga0530510_0132295 | Ga0530510_0132295_1068_1571 | 167 |
| 946 | 3300061734 | Ga0530510_0156915 | Ga0530510_0156915_982_1548 | 167 |
| 947 | 3300061734 | Ga0530510_0203231 | Ga0530510_0203231_896_1399 | 167 |
| 948 | 3300061734 | Ga0530510_0244514 | Ga0530510_0244514_133_636 | 167 |
| 949 | 3300061734 | Ga0530510_0313006 | Ga0530510_0313006_568_1071 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zoe-assembly1.cif.gz_A | crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde | 0.8669 | 15 | 142 |
| 3zoh-assembly1.cif.gz_D | crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound 1-cyclohex-2-enone | 0.862 | 14 | 143 |
| 3zoe-assembly1.cif.gz_B | crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde | 0.845 | 14 | 148 |
| 1wgb-assembly1.cif.gz_A | crystal structure of a probable flavoprotein from thermus thermophilus hb8 | 0.8442 | 1 | 167 |
| 1wgb-assembly1.cif.gz_A | crystal structure of a probable flavoprotein from thermus thermophilus hb8 | 0.8392 | 1 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53254_5_167_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8499 | 15 | 159 | 2.30.110.10 |
| 2r0xA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8476 | 11 | 144 | 2.30.110.10 |
| 1wgbA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8457 | 2 | 154 | 2.30.110.10 |
| 3zoeB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.845 | 14 | 148 | 2.30.110.10 |
| 1i0sA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8348 | 15 | 154 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354Q5M7-F1-model_v4 | Flavin reductase | 0.9636 | 18 | 167 |
GO:0010181
GO:0042602 |
| AF-A0A353LU56-F1-model_v4 | Flavin reductase | 0.9606 | 61 | 167 |
GO:0010181
GO:0016646 |
| AF-A0A537QTR8-F1-model_v4 | Flavin reductase family protein | 0.9585 | 44 | 167 |
GO:0010181
GO:0042602 |
| AF-A0A2D8PIH3-F1-model_v4 | Flavin reductase | 0.9559 | 18 | 142 |
GO:0010181
GO:0042602 |
| AF-A0A354Q5M7-F1-model_v4 | Flavin reductase | 0.9512 | 18 | 167 |
GO:0010181
GO:0042602 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar