F486538

General Info

Members Datasets Scaffolds Average Seq Length
949 287 949 168

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0213573|Ga0496104_0213573_1164_1736
Length 190
Sequence LGFQPAAVAGYAGSGADHEKDKSMDEAERKIALRMIPYGIYVMTAAGADNSLAAATVNWVTQTSFSPPLLAIGVKSDSGVYAAAKASGHFALNILGKGQQGAAFAFFKPAVLEDGKLSGEEIGWAANGAPVLKSAPAVVECRVAQIVELGDHHTFIAEVTGVHVHQHPEGRPDMAVLEMKDLGDKVFYGG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
215 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
216 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.95
Rhizosphere 98
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10102921 3300003203 Unclassified 850
2 JGI26128J50194_1007436 3300003347 Unclassified 705
3 JGI25405J52794_10000633 3300003911 Bacteria 5264
4 Ga0058859_10044750 3300004798 Bacteria 1833
5 Ga0058859_11819114 3300004798 Unclassified 737
6 Ga0058860_11187877 3300004801 Unclassified 574
7 Ga0058860_12238848 3300004801 Unclassified 1073
8 Ga0065712_10037114 3300005290 Bacteria 919
9 Ga0065715_10118079 3300005293 Bacteria 2327
10 Ga0065707_10023398 3300005295 Bacteria 1525
11 Ga0065707_10194343 3300005295 Bacteria 1344
12 Ga0065707_10364960 3300005295 Bacteria 852
13 Ga0070676_10000227 3300005328 Bacteria 24062
14 Ga0070676_10538316 3300005328 Bacteria 834
15 Ga0070683_100133327 3300005329 Bacteria 2351
16 Ga0070690_100900598 3300005330 Bacteria 692
17 Ga0070670_100004572 3300005331 Bacteria 11607
18 Ga0068869_100005890 3300005334 Bacteria 7740
19 Ga0068869_100037331 3300005334 Bacteria 3454
20 Ga0068869_100386964 3300005334 Unclassified 1147
21 Ga0068869_100930135 3300005334 Bacteria 754
22 Ga0070680_100006965 3300005336 Bacteria 8616
23 Ga0070680_100112247 3300005336 Bacteria 2270
24 Ga0070680_100460330 3300005336 Unclassified 1087
25 Ga0070680_100543002 3300005336 Bacteria 996
26 Ga0070682_100001390 3300005337 Bacteria 13645
27 Ga0068868_100116790 3300005338 Bacteria 2173
28 Ga0070660_100004277 3300005339 Bacteria 9863
29 Ga0070689_100831178 3300005340 Bacteria 814
30 Ga0070689_101665050 3300005340 Bacteria 580
31 Ga0070691_10010815 3300005341 Bacteria 4163
32 Ga0070691_10062295 3300005341 Unclassified 1796
33 Ga0070691_10130076 3300005341 Bacteria 1275
34 Ga0070687_100704490 3300005343 Bacteria 706
35 Ga0070661_100000341 3300005344 Bacteria 37221
36 Ga0070692_10074287 3300005345 Bacteria 1818
37 Ga0070692_10141121 3300005345 Bacteria 1364
38 Ga0070668_100434182 3300005347 Bacteria 1126
39 Ga0070668_100723291 3300005347 Bacteria 879
40 Ga0070669_100229391 3300005353 Unclassified 1471
41 Ga0070669_100341484 3300005353 Bacteria 1214
42 Ga0070669_100668224 3300005353 Bacteria 875
43 Ga0070675_100373392 3300005354 Bacteria 1268
44 Ga0070675_100774459 3300005354 Bacteria 876
45 Ga0070671_100294112 3300005355 Unclassified 1382
46 Ga0070673_100020228 3300005364 Bacteria 4797
47 Ga0070673_100572645 3300005364 Bacteria 1028
48 Ga0070688_100203874 3300005365 Bacteria 1385
49 Ga0070659_100006955 3300005366 Bacteria 8192
50 Ga0070703_10001000 3300005406 Bacteria 8889
51 Ga0070703_10064800 3300005406 Unclassified 1205
52 Ga0070703_10314664 3300005406 Bacteria 657
53 Ga0070703_10340909 3300005406 Bacteria 637
54 Ga0070709_10141820 3300005434 Unclassified 1652
55 Ga0070711_100358979 3300005439 Bacteria 1173
56 Ga0070705_100000347 3300005440 Bacteria 27333
57 Ga0070705_100017997 3300005440 Bacteria 3696
58 Ga0070705_100847235 3300005440 Bacteria 731
59 Ga0070700_100060137 3300005441 Bacteria 2394
60 Ga0070700_100083907 3300005441 Bacteria 2064
61 Ga0070700_101012223 3300005441 Bacteria 684
62 Ga0070694_100002904 3300005444 Bacteria 10181
63 Ga0070694_100003572 3300005444 Bacteria 9292
64 Ga0070694_100007439 3300005444 Bacteria 6677
65 Ga0070694_100037649 3300005444 Bacteria 3209
66 Ga0070694_100127919 3300005444 Bacteria 1831
67 Ga0070694_100245565 3300005444 Bacteria 1352
68 Ga0070708_100033790 3300005445 Bacteria 4444
69 Ga0070708_100086698 3300005445 Unclassified 2844
70 Ga0070708_100104594 3300005445 Bacteria 2596
71 Ga0070708_100241513 3300005445 Bacteria 1696
72 Ga0070708_100318338 3300005445 Bacteria 1465
73 Ga0070708_100373423 3300005445 Bacteria 1344
74 Ga0070708_100470603 3300005445 Bacteria 1186
75 Ga0070708_100517177 3300005445 Bacteria 1126
76 Ga0070708_100527874 3300005445 Bacteria 1113
77 Ga0070708_100591943 3300005445 Unclassified 1046
78 Ga0070708_100612254 3300005445 Unclassified 1027
79 Ga0070708_100741436 3300005445 Bacteria 924
80 Ga0070663_100008299 3300005455 Bacteria 6381
81 Ga0070662_100012635 3300005457 Bacteria 5603
82 Ga0070662_100794346 3300005457 Bacteria 804
83 Ga0070681_10088095 3300005458 Bacteria 3057
84 Ga0068867_100000705 3300005459 Bacteria 22254
85 Ga0068867_100275717 3300005459 Unclassified 1377
86 Ga0068867_101617145 3300005459 Bacteria 606
87 Ga0070706_100007224 3300005467 Bacteria 10437
88 Ga0070706_100028050 3300005467 Bacteria 5180
89 Ga0070706_100041629 3300005467 Bacteria 4241
90 Ga0070706_100078854 3300005467 Unclassified 3049
91 Ga0070706_100090178 3300005467 Bacteria 2843
92 Ga0070706_100120234 3300005467 Bacteria 2448
93 Ga0070706_100191966 3300005467 Unclassified 1908
94 Ga0070706_100233485 3300005467 Bacteria 1717
95 Ga0070706_100349212 3300005467 Bacteria 1379
96 Ga0070706_100406410 3300005467 Unclassified 1268
97 Ga0070706_100422637 3300005467 Bacteria 1240
98 Ga0070706_100437952 3300005467 Unclassified 1217
99 Ga0070706_100682525 3300005467 Unclassified 953
100 Ga0070706_101102139 3300005467 Bacteria 731
101 Ga0070707_100011125 3300005468 Bacteria 8382
102 Ga0070707_100012568 3300005468 Bacteria 7908
103 Ga0070707_100026589 3300005468 Bacteria 5496
104 Ga0070707_100044774 3300005468 Bacteria 4236
105 Ga0070707_100070831 3300005468 Bacteria 3359
106 Ga0070707_100184283 3300005468 Bacteria 2035
107 Ga0070707_100187722 3300005468 Bacteria 2015
108 Ga0070707_100205073 3300005468 Bacteria 1922
109 Ga0070707_100295571 3300005468 Bacteria 1574
110 Ga0070707_100297083 3300005468 Unclassified 1569
111 Ga0070707_100298518 3300005468 Bacteria 1565
112 Ga0070698_100002225 3300005471 Bacteria 21473
113 Ga0070698_100040581 3300005471 Bacteria 4782
114 Ga0070698_100046645 3300005471 Bacteria 4430
115 Ga0070698_100225757 3300005471 Unclassified 1806
116 Ga0070698_100233285 3300005471 Bacteria 1773
117 Ga0070698_100276167 3300005471 Bacteria 1612
118 Ga0070698_100461172 3300005471 Bacteria 1207
119 Ga0070698_101319174 3300005471 Bacteria 672
120 Ga0070699_100001487 3300005518 Bacteria 21471
121 Ga0070699_100018486 3300005518 Bacteria 5986
122 Ga0070699_100028870 3300005518 Bacteria 4782
123 Ga0070699_100042645 3300005518 Bacteria 3926
124 Ga0070699_100069410 3300005518 Unclassified 3062
125 Ga0070699_100092422 3300005518 Bacteria 2646
126 Ga0070699_100213010 3300005518 Bacteria 1720
127 Ga0070699_100273996 3300005518 Unclassified 1511
128 Ga0070699_100619971 3300005518 Bacteria 987
129 Ga0070699_100677074 3300005518 Bacteria 942
130 Ga0070699_101178143 3300005518 Bacteria 703
131 Ga0070679_100000403 3300005530 Bacteria 36876
132 Ga0070697_100013678 3300005536 Bacteria 6368
133 Ga0070697_100028606 3300005536 Bacteria 4464
134 Ga0070697_100079707 3300005536 Bacteria 2696
135 Ga0070697_100085044 3300005536 Bacteria 2610
136 Ga0070697_100151863 3300005536 Unclassified 1952
137 Ga0070697_100493491 3300005536 Unclassified 1070
138 Ga0070697_100500812 3300005536 Bacteria 1062
139 Ga0068853_100000808 3300005539 Bacteria 21801
140 Ga0068853_101096397 3300005539 Bacteria 768
141 Ga0070672_100070427 3300005543 Bacteria 2779
142 Ga0070686_100468145 3300005544 Bacteria 972
143 Ga0070686_100975918 3300005544 Bacteria 693
144 Ga0070695_100000668 3300005545 Bacteria 18292
145 Ga0070695_100008983 3300005545 Bacteria 5939
146 Ga0070695_100009584 3300005545 Bacteria 5768
147 Ga0070695_100591417 3300005545 Bacteria 870
148 Ga0070695_100867704 3300005545 Bacteria 727
149 Ga0070695_100917213 3300005545 Bacteria 708
150 Ga0070696_100012891 3300005546 Bacteria 5611
151 Ga0070696_100451077 3300005546 Bacteria 1015
152 Ga0070696_100497160 3300005546 Bacteria 969
153 Ga0070693_100000573 3300005547 Bacteria 16335
154 Ga0070693_100021567 3300005547 Archaea 3413
155 Ga0070665_101231130 3300005548 Bacteria 759
156 Ga0070704_100000240 3300005549 Bacteria 23438
157 Ga0070704_100023353 3300005549 Unclassified 4038
158 Ga0070704_100029417 3300005549 Bacteria 3668
159 Ga0070704_100143886 3300005549 Bacteria 1865
160 Ga0070704_100235121 3300005549 Bacteria 1497
161 Ga0070704_100825338 3300005549 Bacteria 830
162 Ga0070704_101485724 3300005549 Bacteria 623
163 Ga0068855_100000462 3300005563 Bacteria 50016
164 Ga0068855_100002144 3300005563 Bacteria 24392
165 Ga0070664_100004277 3300005564 Bacteria 11486
166 Ga0070664_100174798 3300005564 Bacteria 1906
167 Ga0070664_100311373 3300005564 Bacteria 1425
168 Ga0070664_100884194 3300005564 Bacteria 837
169 Ga0068857_100071998 3300005577 Bacteria 3080
170 Ga0068854_100001177 3300005578 Bacteria 15680
171 Ga0068854_100524511 3300005578 Unclassified 1001
172 Ga0068856_100004303 3300005614 Bacteria 14209
173 Ga0070702_100324020 3300005615 Bacteria 1075
174 Ga0068859_100001671 3300005617 Bacteria 22591
175 Ga0068859_100077917 3300005617 Bacteria 3355
176 Ga0068859_100093820 3300005617 Bacteria 3053
177 Ga0068859_100564167 3300005617 Bacteria 1232
178 Ga0068859_101061443 3300005617 Bacteria 890
179 Ga0068864_100002356 3300005618 Bacteria 15634
180 Ga0068866_10113107 3300005718 Unclassified 1518
181 Ga0068861_100587778 3300005719 Bacteria 1020
182 Ga0068870_10005065 3300005840 Bacteria 5727
183 Ga0068863_100077234 3300005841 Bacteria 3151
184 Ga0068858_100073295 3300005842 Bacteria 3179
185 Ga0068858_100385137 3300005842 Bacteria 1346
186 Ga0068858_100539806 3300005842 Bacteria 1129
187 Ga0068858_101499448 3300005842 Unclassified 665
188 Ga0068860_100009627 3300005843 Bacteria 9602
189 Ga0068860_100053786 3300005843 Bacteria 3828
190 Ga0068860_100078873 3300005843 Bacteria 3131
191 Ga0068860_100085048 3300005843 Bacteria 3009
192 Ga0068860_100097112 3300005843 Bacteria 2808
193 Ga0068860_100134506 3300005843 Bacteria 2374
194 Ga0068860_100375440 3300005843 Bacteria 1403
195 Ga0068860_100613804 3300005843 Bacteria 1094
196 Ga0068862_100002540 3300005844 Bacteria 16145
197 Ga0068862_100020403 3300005844 Bacteria 5536
198 Ga0068862_100054120 3300005844 Bacteria 3436
199 Ga0068862_100577507 3300005844 Bacteria 1076
200 Ga0068862_100998971 3300005844 Bacteria 827
201 Ga0081455_10000074 3300005937 Bacteria 107319
202 Ga0081455_10000513 3300005937 Bacteria 50176
203 Ga0081455_10022703 3300005937 Bacteria 5856
204 Ga0081455_10201906 3300005937 Bacteria 1488
205 Ga0081455_10240170 3300005937 Unclassified 1332
206 Ga0081455_10732229 3300005937 Bacteria 627
207 Ga0081538_10003140 3300005981 Archaea 15697
208 Ga0081538_10035876 3300005981 Bacteria 3248
209 Ga0081538_10041626 3300005981 Unclassified 2912
210 Ga0081540_1005469 3300005983 Bacteria 9476
211 Ga0081540_1035939 3300005983 Bacteria 2649
212 Ga0081540_1036282 3300005983 Unclassified 2631
213 Ga0081539_10000020 3300005985 Bacteria 366549
214 Ga0081539_10047008 3300005985 Bacteria 2469
215 Ga0075432_10115468 3300006058 Bacteria 1004
216 Ga0070716_100051328 3300006173 Bacteria 2344
217 Ga0070712_100104061 3300006175 Bacteria 2106
218 Ga0075428_100001459 3300006844 Bacteria 25299
219 Ga0075428_100015960 3300006844 Bacteria 8311
220 Ga0075428_100016688 3300006844 Bacteria 8107
221 Ga0075428_100107212 3300006844 Bacteria 3045
222 Ga0075428_100244021 3300006844 Bacteria 1938
223 Ga0075428_100326128 3300006844 Bacteria 1649
224 Ga0075428_100368191 3300006844 Bacteria 1541
225 Ga0075428_100511381 3300006844 Bacteria 1285
226 Ga0075428_100613521 3300006844 Bacteria 1161
227 Ga0075428_100891427 3300006844 Archaea 944
228 Ga0075430_100000265 3300006846 Bacteria 36910
229 Ga0075430_100000518 3300006846 Bacteria 28985
230 Ga0075430_100034771 3300006846 Bacteria 4277
231 Ga0075430_100111568 3300006846 Bacteria 2280
232 Ga0075430_100117403 3300006846 Bacteria 2218
233 Ga0075430_100120148 3300006846 Bacteria 2190
234 Ga0075430_100264947 3300006846 Unclassified 1423
235 Ga0075430_100430637 3300006846 Bacteria 1089
236 Ga0075430_100798270 3300006846 Unclassified 778
237 Ga0075431_100000115 3300006847 Bacteria 51366
238 Ga0075431_100020362 3300006847 Bacteria 6777
239 Ga0075431_100024626 3300006847 Bacteria 6170
240 Ga0075431_100030953 3300006847 Bacteria 5511
241 Ga0075431_100034401 3300006847 Bacteria 5220
242 Ga0075431_100098904 3300006847 Unclassified 3011
243 Ga0075431_100163197 3300006847 Bacteria 2290
244 Ga0075431_100172684 3300006847 Archaea 2221
245 Ga0075431_100291566 3300006847 Bacteria 1650
246 Ga0075431_100314368 3300006847 Bacteria 1580
247 Ga0075431_100697601 3300006847 Bacteria 993
248 Ga0075431_100834320 3300006847 Bacteria 894
249 Ga0075431_100881309 3300006847 Unclassified 865
250 Ga0075431_101618479 3300006847 Bacteria 605
251 Ga0075433_10000462 3300006852 Bacteria 26409
252 Ga0075433_10001928 3300006852 Bacteria 15611
253 Ga0075433_10037250 3300006852 Bacteria 4195
254 Ga0075433_10041549 3300006852 Archaea 3984
255 Ga0075433_10054017 3300006852 Bacteria 3504
256 Ga0075433_10058168 3300006852 Bacteria 3381
257 Ga0075433_10067115 3300006852 Bacteria 3148
258 Ga0075433_10068278 3300006852 Bacteria 3121
259 Ga0075433_10154481 3300006852 Bacteria 2042
260 Ga0075433_10172063 3300006852 Unclassified 1927
261 Ga0075433_10274364 3300006852 Unclassified 1494
262 Ga0075433_10295839 3300006852 Bacteria 1434
263 Ga0075433_10341060 3300006852 Bacteria 1325
264 Ga0075433_10341629 3300006852 Unclassified 1323
265 Ga0075433_10388788 3300006852 Bacteria 1231
266 Ga0075434_100000880 3300006871 Bacteria 24013
267 Ga0075434_100002605 3300006871 Bacteria 15905
268 Ga0075434_100005294 3300006871 Bacteria 11736
269 Ga0075434_100010708 3300006871 Bacteria 8611
270 Ga0075434_100026351 3300006871 Bacteria 5694
271 Ga0075434_100038572 3300006871 Bacteria 4731
272 Ga0075434_100116580 3300006871 Bacteria 2684
273 Ga0075434_100116631 3300006871 Bacteria 2683
274 Ga0075434_100236991 3300006871 Bacteria 1845
275 Ga0075434_100280435 3300006871 Bacteria 1686
276 Ga0075434_100322835 3300006871 Unclassified 1564
277 Ga0075434_100435398 3300006871 Bacteria 1332
278 Ga0075434_100437179 3300006871 Bacteria 1329
279 Ga0075429_100000257 3300006880 Bacteria 36802
280 Ga0075429_100002523 3300006880 Bacteria 15411
281 Ga0075429_100027319 3300006880 Bacteria 4953
282 Ga0075429_100042390 3300006880 Bacteria 3961
283 Ga0075429_100066555 3300006880 Bacteria 3137
284 Ga0075429_100072893 3300006880 Bacteria 2991
285 Ga0075429_100078120 3300006880 Bacteria 2884
286 Ga0075429_100093860 3300006880 Bacteria 2617
287 Ga0075429_100376775 3300006880 Bacteria 1242
288 Ga0075429_100377517 3300006880 Bacteria 1241
289 Ga0075429_100612457 3300006880 Bacteria 954
290 Ga0075429_101137491 3300006880 Unclassified 682
291 Ga0068865_100086641 3300006881 Bacteria 2261
292 Ga0068865_100088638 3300006881 Bacteria 2239
293 Ga0075436_100000794 3300006914 Bacteria 20924
294 Ga0075436_100005532 3300006914 Bacteria 8684
295 Ga0075436_100058249 3300006914 Bacteria 2667
296 Ga0075436_100060188 3300006914 Unclassified 2623
297 Ga0075436_100096216 3300006914 Bacteria 2060
298 Ga0075436_100319259 3300006914 Unclassified 1116
299 Ga0075436_100380285 3300006914 Bacteria 1021
300 Ga0075436_100445207 3300006914 Bacteria 943
301 Ga0075436_100497099 3300006914 Bacteria 892
302 Ga0097620_100001671 3300006931 Bacteria 22591
303 Ga0097620_100077920 3300006931 Bacteria 3355
304 Ga0097620_100093819 3300006931 Bacteria 3053
305 Ga0097620_100564147 3300006931 Bacteria 1232
306 Ga0097620_101061445 3300006931 Bacteria 890
307 Ga0075435_100010303 3300007076 Bacteria 6830
308 Ga0075435_100010787 3300007076 Bacteria 6691
309 Ga0075435_100019559 3300007076 Bacteria 5175
310 Ga0075435_100021280 3300007076 Bacteria 4985
311 Ga0075435_100091275 3300007076 Unclassified 2513
312 Ga0075435_100322851 3300007076 Unclassified 1321
313 Ga0075435_100431366 3300007076 Bacteria 1136
314 Ga0075435_101091586 3300007076 Bacteria 698
315 Ga0075435_101377075 3300007076 Unclassified 618
316 Ga0099794_10000632 3300007265 Bacteria 11743
317 Ga0099794_10003812 3300007265 Bacteria 5824
318 Ga0099794_10245584 3300007265 Bacteria 923
319 Ga0105240_10011436 3300009093 Bacteria 12361
320 Ga0111539_10000087 3300009094 Bacteria 95344
321 Ga0111539_10028267 3300009094 Bacteria 6844
322 Ga0111539_10066793 3300009094 Bacteria 4248
323 Ga0111539_10149740 3300009094 Unclassified 2732
324 Ga0111539_11218090 3300009094 Unclassified 874
325 Ga0111539_11668044 3300009094 Unclassified 739
326 Ga0105245_10055259 3300009098 Bacteria 3566
327 Ga0105245_11233719 3300009098 Bacteria 796
328 Ga0105247_10137139 3300009101 Bacteria 1599
329 Ga0114129_10000579 3300009147 Bacteria 45143
330 Ga0114129_10000660 3300009147 Bacteria 43218
331 Ga0114129_10001117 3300009147 Bacteria 35426
332 Ga0114129_10002580 3300009147 Bacteria 25171
333 Ga0114129_10007096 3300009147 Bacteria 15943
334 Ga0114129_10010852 3300009147 Bacteria 12978
335 Ga0114129_10012554 3300009147 Bacteria 12063
336 Ga0114129_10013814 3300009147 Bacteria 11505
337 Ga0114129_10022323 3300009147 Bacteria 8983
338 Ga0114129_10045709 3300009147 Bacteria 6154
339 Ga0114129_10058855 3300009147 Bacteria 5374
340 Ga0114129_10059946 3300009147 Bacteria 5321
341 Ga0114129_10078113 3300009147 Bacteria 4604
342 Ga0114129_10130394 3300009147 Bacteria 3453
343 Ga0114129_10165946 3300009147 Unclassified 3013
344 Ga0114129_10260112 3300009147 Bacteria 2326
345 Ga0114129_10402041 3300009147 Unclassified 1805
346 Ga0114129_10422144 3300009147 Unclassified 1754
347 Ga0114129_10459194 3300009147 Bacteria 1669
348 Ga0114129_10556449 3300009147 Bacteria 1491
349 Ga0114129_10639158 3300009147 Bacteria 1374
350 Ga0114129_10641260 3300009147 Unclassified 1372
351 Ga0114129_10768755 3300009147 Bacteria 1232
352 Ga0114129_10803680 3300009147 Unclassified 1199
353 Ga0114129_11289411 3300009147 Bacteria 906
354 Ga0114129_12406158 3300009147 Bacteria 631
355 Ga0105243_10143648 3300009148 Bacteria 2039
356 Ga0105243_10301041 3300009148 Unclassified 1453
357 Ga0105243_10459975 3300009148 Bacteria 1196
358 Ga0105243_11050988 3300009148 Unclassified 820
359 Ga0105241_10000334 3300009174 Bacteria 35635
360 Ga0105241_10071938 3300009174 Bacteria 2686
361 Ga0105241_10260419 3300009174 Bacteria 1474
362 Ga0105242_10160873 3300009176 Bacteria 1965
363 Ga0105242_10409516 3300009176 Bacteria 1268
364 Ga0105248_10066182 3300009177 Bacteria 4058
365 Ga0105248_11439177 3300009177 Bacteria 780
366 Ga0105248_11769831 3300009177 Bacteria 701
367 Ga0105237_10004494 3300009545 Bacteria 16118
368 Ga0105237_10388258 3300009545 Bacteria 1401
369 Ga0105238_10047700 3300009551 Bacteria 4318
370 Ga0105238_10244327 3300009551 Bacteria 1773
371 Ga0105249_10030373 3300009553 Bacteria 4885
372 Ga0105249_10169675 3300009553 Bacteria 2115
373 Ga0105249_10443414 3300009553 Bacteria 1336
374 Ga0105249_10579430 3300009553 Bacteria 1175
375 Ga0105239_10001412 3300010375 Bacteria 32056
376 Ga0105239_10053250 3300010375 Bacteria 4439
377 Ga0105239_11308034 3300010375 Bacteria 836
378 Ga0105246_10026943 3300011119 Bacteria 3761
379 Ga0157373_10000379 3300013100 Bacteria 35641
380 Ga0157371_10039298 3300013102 Bacteria 3383
381 Ga0157370_10323644 3300013104 Bacteria 1422
382 Ga0157369_10081128 3300013105 Bacteria 3472
383 Ga0157378_10043485 3300013297 Bacteria 3989
384 Ga0157378_10057421 3300013297 Bacteria 3469
385 Ga0163162_10124639 3300013306 Bacteria 2682
386 Ga0163162_10188421 3300013306 Unclassified 2190
387 Ga0163162_10740029 3300013306 Bacteria 1103
388 Ga0163162_10775534 3300013306 Bacteria 1077
389 Ga0163162_10830298 3300013306 Bacteria 1040
390 Ga0157372_10000135 3300013307 Bacteria 81209
391 Ga0157375_10059324 3300013308 Bacteria 3791
392 Ga0157375_10278348 3300013308 Bacteria 1836
393 Ga0157375_10706441 3300013308 Bacteria 1162
394 Ga0157375_10782746 3300013308 Bacteria 1103
395 Ga0157375_10832000 3300013308 Bacteria 1070
396 Ga0163163_10366456 3300014325 Bacteria 1498
397 Ga0163163_10732465 3300014325 Bacteria 1052
398 Ga0157380_10948723 3300014326 Bacteria 890
399 Ga0157377_10943226 3300014745 Bacteria 649
400 Ga0157379_10942539 3300014968 Bacteria 821
401 Ga0207653_10000475 3300025885 Bacteria 16005
402 Ga0207653_10014279 3300025885 Bacteria 2491
403 Ga0207682_10183446 3300025893 Bacteria 957
404 Ga0207642_10612783 3300025899 Bacteria 679
405 Ga0207710_10036217 3300025900 Bacteria 2174
406 Ga0207688_10005719 3300025901 Bacteria 6764
407 Ga0207647_10600638 3300025904 Bacteria 607
408 Ga0207699_11213662 3300025906 Unclassified 558
409 Ga0207645_10000075 3300025907 Bacteria 71333
410 Ga0207643_10001707 3300025908 Bacteria 12325
411 Ga0207684_10002659 3300025910 Bacteria 17883
412 Ga0207684_10004127 3300025910 Bacteria 13827
413 Ga0207684_10012194 3300025910 Bacteria 7479
414 Ga0207684_10019452 3300025910 Bacteria 5809
415 Ga0207684_10046737 3300025910 Bacteria 3672
416 Ga0207684_10114982 3300025910 Bacteria 2304
417 Ga0207684_10223533 3300025910 Unclassified 1625
418 Ga0207684_10263126 3300025910 Bacteria 1488
419 Ga0207684_10271758 3300025910 Bacteria 1462
420 Ga0207684_10430176 3300025910 Unclassified 1134
421 Ga0207684_10432701 3300025910 Bacteria 1130
422 Ga0207684_10623159 3300025910 Bacteria 920
423 Ga0207684_10918797 3300025910 Bacteria 735
424 Ga0207684_11356425 3300025910 Unclassified 584
425 Ga0207654_10001071 3300025911 Bacteria 14889
426 Ga0207654_10013245 3300025911 Bacteria 4238
427 Ga0207654_10395359 3300025911 Bacteria 960
428 Ga0207707_10000135 3300025912 Bacteria 76964
429 Ga0207707_10329878 3300025912 Bacteria 1316
430 Ga0207695_10043920 3300025913 Bacteria 4758
431 Ga0207671_10004038 3300025914 Bacteria 14234
432 Ga0207693_10037917 3300025915 Unclassified 3797
433 Ga0207693_10331980 3300025915 Bacteria 1190
434 Ga0207660_10000688 3300025917 Bacteria 22592
435 Ga0207660_10102098 3300025917 Bacteria 2144
436 Ga0207660_10757954 3300025917 Bacteria 792
437 Ga0207657_10000037 3300025919 Bacteria 124230
438 Ga0207649_10001481 3300025920 Bacteria 13785
439 Ga0207652_10002292 3300025921 Bacteria 16228
440 Ga0207646_10004177 3300025922 Bacteria 15825
441 Ga0207646_10052068 3300025922 Bacteria 3663
442 Ga0207646_10061177 3300025922 Bacteria 3362
443 Ga0207646_10110405 3300025922 Unclassified 2467
444 Ga0207646_10144459 3300025922 Bacteria 2144
445 Ga0207646_10171813 3300025922 Unclassified 1957
446 Ga0207646_10236028 3300025922 Bacteria 1652
447 Ga0207646_10236418 3300025922 Bacteria 1651
448 Ga0207646_10340384 3300025922 Bacteria 1355
449 Ga0207681_10023557 3300025923 Bacteria 3940
450 Ga0207681_10053693 3300025923 Bacteria 2737
451 Ga0207681_10077173 3300025923 Bacteria 2341
452 Ga0207681_10197471 3300025923 Bacteria 1543
453 Ga0207681_10371651 3300025923 Bacteria 1149
454 Ga0207694_10026132 3300025924 Bacteria 4439
455 Ga0207650_10012455 3300025925 Bacteria 5873
456 Ga0207650_10653235 3300025925 Bacteria 887
457 Ga0207687_10541448 3300025927 Bacteria 976
458 Ga0207644_10901903 3300025931 Bacteria 741
459 Ga0207690_10000562 3300025932 Bacteria 24235
460 Ga0207706_10011250 3300025933 Bacteria 8160
461 Ga0207706_10071839 3300025933 Bacteria 3044
462 Ga0207706_10242355 3300025933 Unclassified 1576
463 Ga0207686_10046606 3300025934 Bacteria 2675
464 Ga0207709_10023792 3300025935 Bacteria 3490
465 Ga0207709_10046732 3300025935 Bacteria 2628
466 Ga0207709_10084208 3300025935 Unclassified 2058
467 Ga0207709_10782524 3300025935 Bacteria 769
468 Ga0207709_10918305 3300025935 Bacteria 712
469 Ga0207670_11121844 3300025936 Bacteria 664
470 Ga0207704_10117713 3300025938 Bacteria 1810
471 Ga0207665_10000576 3300025939 Bacteria 24692
472 Ga0207691_10124866 3300025940 Bacteria 2278
473 Ga0207689_10000029 3300025942 Bacteria 100016
474 Ga0207689_10015346 3300025942 Bacteria 6485
475 Ga0207689_10827499 3300025942 Bacteria 781
476 Ga0207689_11442885 3300025942 Bacteria 576
477 Ga0207679_10003224 3300025945 Bacteria 10063
478 Ga0207679_10522503 3300025945 Bacteria 1062
479 Ga0207667_10000652 3300025949 Bacteria 45007
480 Ga0207667_10039416 3300025949 Bacteria 5036
481 Ga0207651_11568805 3300025960 Bacteria 593
482 Ga0207712_10195752 3300025961 Unclassified 1599
483 Ga0207712_10210273 3300025961 Bacteria 1549
484 Ga0207712_10622700 3300025961 Bacteria 936
485 Ga0207668_10161578 3300025972 Bacteria 1746
486 Ga0207668_10822658 3300025972 Bacteria 823
487 Ga0207668_10976694 3300025972 Bacteria 756
488 Ga0207640_10008161 3300025981 Bacteria 5800
489 Ga0207640_10388856 3300025981 Unclassified 1132
490 Ga0207658_10494166 3300025986 Bacteria 1089
491 Ga0207658_10914200 3300025986 Bacteria 799
492 Ga0207677_10378040 3300026023 Bacteria 1195
493 Ga0207703_10049558 3300026035 Bacteria 3395
494 Ga0207703_10664820 3300026035 Bacteria 989
495 Ga0207639_10002456 3300026041 Bacteria 12435
496 Ga0207639_11573387 3300026041 Bacteria 617
497 Ga0207678_10017042 3300026067 Bacteria 6379
498 Ga0207708_11045164 3300026075 Bacteria 711
499 Ga0207702_10014520 3300026078 Bacteria 6538
500 Ga0207641_10065290 3300026088 Bacteria 3113
501 Ga0207641_10336511 3300026088 Bacteria 1435
502 Ga0207641_10391033 3300026088 Bacteria 1334
503 Ga0207641_10887703 3300026088 Bacteria 885
504 Ga0207641_11246449 3300026088 Bacteria 744
505 Ga0207648_10000552 3300026089 Bacteria 41984
506 Ga0207648_10239374 3300026089 Unclassified 1616
507 Ga0207648_10933345 3300026089 Bacteria 811
508 Ga0207676_10030650 3300026095 Bacteria 4039
509 Ga0207676_10148474 3300026095 Bacteria 2016
510 Ga0207674_10000306 3300026116 Bacteria 62216
511 Ga0207674_11817683 3300026116 Bacteria 576
512 Ga0207675_100059884 3300026118 Bacteria 3554
513 Ga0207675_100136389 3300026118 Bacteria 2329
514 Ga0207675_100311563 3300026118 Bacteria 1535
515 Ga0207675_100370393 3300026118 Bacteria 1407
516 Ga0207675_101174561 3300026118 Bacteria 788
517 Ga0207675_101943093 3300026118 Bacteria 606
518 Ga0207698_10653220 3300026142 Bacteria 1042
519 Ga0209969_1019686 3300027360 Bacteria 1002
520 Ga0209967_1019363 3300027364 Bacteria 989
521 Ga0209981_1010822 3300027378 Bacteria 1254
522 Ga0209996_1002549 3300027395 Bacteria 2257
523 Ga0209984_1013550 3300027424 Bacteria 1071
524 Ga0209995_1000572 3300027471 Bacteria 5610
525 Ga0209999_1003314 3300027543 Bacteria 2873
526 Ga0209982_1003328 3300027552 Bacteria 2280
527 Ga0210002_1052629 3300027617 Unclassified 703
528 Ga0209983_1003456 3300027665 Bacteria 3375
529 Ga0209588_1011038 3300027671 Unclassified 2723
530 Ga0209588_1011602 3300027671 Bacteria 2664
531 Ga0209971_1000008 3300027682 Bacteria 102612
532 Ga0209966_1000187 3300027695 Bacteria 25599
533 Ga0209998_10000016 3300027717 Bacteria 85166
534 Ga0209998_10011841 3300027717 Unclassified 1810
535 Ga0209998_10112186 3300027717 Bacteria 682
536 Ga0209974_10001677 3300027876 Bacteria 8020
537 Ga0207428_10000168 3300027907 Bacteria 91128
538 Ga0207428_10000355 3300027907 Bacteria 59077
539 Ga0207428_10034267 3300027907 Bacteria 4163
540 Ga0207428_10036317 3300027907 Unclassified 4020
541 Ga0207428_10057266 3300027907 Bacteria 3094
542 Ga0268266_10907194 3300028379 Bacteria 852
543 Ga0268265_10006105 3300028380 Bacteria 8177
544 Ga0268265_10045245 3300028380 Bacteria 3283
545 Ga0268265_10123390 3300028380 Bacteria 2138
546 Ga0268265_10207679 3300028380 Bacteria 1704
547 Ga0268265_10943130 3300028380 Bacteria 850
548 Ga0268265_11335589 3300028380 Unclassified 718
549 Ga0268264_10029733 3300028381 Bacteria 4478
550 Ga0268264_10101170 3300028381 Bacteria 2505
551 Ga0268264_10235077 3300028381 Bacteria 1694
552 Ga0268264_10355789 3300028381 Unclassified 1395
553 Ga0268264_10688324 3300028381 Bacteria 1015
554 Ga0268264_10773906 3300028381 Bacteria 957
555 Ga0268264_12388443 3300028381 Unclassified 535
556 Ga0265339_10000272 3300031249 Bacteria 41823
557 Ga0265331_10015837 3300031250 Bacteria 3970
558 Ga0265331_10064532 3300031250 Bacteria 1723
559 Ga0265327_10034314 3300031251 Bacteria 2817
560 Ga0307408_100134251 3300031548 Bacteria 1934
561 Ga0265314_10001254 3300031711 Bacteria 28897
562 Ga0265342_10005494 3300031712 Bacteria 9640
563 Ga0307405_11134522 3300031731 Unclassified 673
564 Ga0307406_10674915 3300031901 Bacteria 860
565 Ga0307407_10450038 3300031903 Bacteria 934
566 Ga0307407_11256149 3300031903 Unclassified 580
567 Ga0307412_10196725 3300031911 Bacteria 1528
568 Ga0307416_100017844 3300032002 Bacteria 4980
569 Ga0307414_11262789 3300032004 Bacteria 685
570 Ga0307411_10027915 3300032005 Bacteria 3423
571 Ga0373940_0001428 3300035088 Bacteria 4316
572 Ga0373940_0038110 3300035088 Bacteria 1311
573 Ga0373940_0255079 3300035088 Bacteria 592
574 Ga0373949_0034624 3300035090 Bacteria 1218
575 Ga0373949_0060558 3300035090 Unclassified 973
576 Ga0373949_0087502 3300035090 Bacteria 838
577 Ga0373951_0003456 3300035091 Bacteria 3828
578 Ga0373951_0067232 3300035091 Bacteria 907
579 Ga0373951_0117698 3300035091 Bacteria 720
580 Ga0373932_0036242 3300035112 Bacteria 1399
581 Ga0373932_0066228 3300035112 Bacteria 1110
582 Ga0373939_0029981 3300035114 Unclassified 1561
583 Ga0373941_0048262 3300035115 Bacteria 1344
584 Ga0373941_0090214 3300035115 Bacteria 1050
585 Ga0373960_0194574 3300035121 Unclassified 714
586 Ga0373961_0045720 3300035241 Bacteria 1281
587 Ga0373961_0126002 3300035241 Bacteria 853
588 Ga0373931_0013793 3300035691 Bacteria 3939
589 Ga0395899_0039623 3300037312 Bacteria 3526
590 Ga0395900_0006760 3300037418 Bacteria 11902
591 Ga0395898_0022166 3300037466 Bacteria 6435
592 Ga0395898_0479204 3300037466 Bacteria 1184
593 Ga0395901_0016644 3300038443 Bacteria 7491
594 Ga0395901_0030735 3300038443 Bacteria 5534
595 Ga0242420_012045 3300038996 Bacteria 1459
596 Ga0242420_039512 3300038996 Bacteria 898
597 Ga0439448_0002671 3300042005 Bacteria 4870
598 Ga0439448_0009011 3300042005 Bacteria 2934
599 Ga0439455_0019004 3300042012 Bacteria 1616
600 Ga0439455_0020883 3300042012 Unclassified 1556
601 Ga0439458_0086836 3300042157 Bacteria 802
602 Ga0439459_0012960 3300042438 Bacteria 1493
603 Ga0439464_0002224 3300042439 Bacteria 4749
604 Ga0451577_0009451 3300042876 Bacteria 9388
605 Ga0451577_0012361 3300042876 Bacteria 8015
606 Ga0451577_0056879 3300042876 Bacteria 3488
607 Ga0451577_0428341 3300042876 Bacteria 1201
608 Ga0451577_0473804 3300042876 Bacteria 1137
609 Ga0439440_0108366 3300042993 Bacteria 762
610 Ga0453683_0037750 3300044673 Bacteria 3038
611 Ga0453684_0073068 3300044712 Bacteria 4326
612 Ga0453684_0101813 3300044712 Unclassified 3513
613 Ga0453684_0703299 3300044712 Bacteria 1098
614 Ga0453684_0797419 3300044712 Bacteria 1019
615 Ga0451576_0017221 3300045051 Bacteria 7948
616 Ga0451576_0023457 3300045051 Bacteria 6679
617 Ga0451576_0024938 3300045051 Bacteria 6452
618 Ga0451576_0176633 3300045051 Bacteria 2229
619 Ga0451576_0179161 3300045051 Bacteria 2213
620 Ga0451576_0304129 3300045051 Unclassified 1668
621 Ga0451576_0685697 3300045051 Bacteria 1076
622 Ga0451576_0991665 3300045051 Bacteria 880
623 Ga0451576_1197066 3300045051 Bacteria 793
624 Ga0451576_1297684 3300045051 Bacteria 759
625 Ga0495580_0001207 3300046472 Bacteria 22745
626 Ga0495580_0004677 3300046472 Bacteria 11479
627 Ga0495580_0010780 3300046472 Bacteria 7099
628 Ga0495580_0335090 3300046472 Bacteria 1027
629 Ga0495580_0368641 3300046472 Bacteria 971
630 Ga0495584_0220617 3300046491 Bacteria 964
631 Ga0495594_0020757 3300046499 Bacteria 3502
632 Ga0495656_0216105 3300046615 Unclassified 957
633 Ga0495659_0073168 3300046664 Bacteria 1288
634 Ga0495658_0770757 3300046683 Bacteria 616
635 Ga0495669_0076402 3300046684 Unclassified 1533
636 Ga0495669_0445186 3300046684 Bacteria 629
637 Ga0495670_0244918 3300046691 Bacteria 955
638 Ga0495636_0011896 3300047318 Bacteria 3448
639 Ga0496102_0064353 3300048905 Bacteria 3359
640 Ga0496102_0065144 3300048905 Bacteria 3339
641 Ga0496104_0213573 3300048907 Bacteria 1841
642 Ga0496104_0361093 3300048907 Unclassified 1365
643 Ga0496105_0932002 3300048908 Unclassified 653
644 Ga0496106_0021548 3300048909 Bacteria 4786
645 Ga0496106_0358269 3300048909 Bacteria 1172
646 Ga0496107_0549765 3300048910 Bacteria 855
647 Ga0496112_0132512 3300048915 Bacteria 2463
648 Ga0496117_0109075 3300048920 Bacteria 1729
649 Ga0496117_0197372 3300048920 Bacteria 1140
650 Ga0496118_0098363 3300048921 Bacteria 1987
651 Ga0496121_0000430 3300048924 Bacteria 82460
652 Ga0496121_0002278 3300048924 Bacteria 29851
653 Ga0496121_0144076 3300048924 Bacteria 1763
654 Ga0501031_0227111 3300049568 Unclassified 1215
655 Ga0501031_0368448 3300049568 Bacteria 930
656 Ga0501031_0398171 3300049568 Unclassified 891
657 Ga0501032_0016172 3300049569 Bacteria 5250
658 Ga0501032_0095916 3300049569 Bacteria 1966
659 Ga0501033_0101533 3300049570 Bacteria 2098
660 Ga0501033_0101645 3300049570 Bacteria 2097
661 Ga0501033_0187517 3300049570 Unclassified 1481
662 Ga0501034_0577509 3300049571 Unclassified 1031
663 Ga0501036_0038579 3300049572 Bacteria 4043
664 Ga0501036_0084753 3300049572 Unclassified 2679
665 Ga0501036_0158070 3300049572 Bacteria 1911
666 Ga0501036_0275058 3300049572 Bacteria 1410
667 Ga0501036_0440288 3300049572 Unclassified 1086
668 Ga0501036_0987017 3300049572 Unclassified 690
669 Ga0501037_0045057 3300049573 Bacteria 3238
670 Ga0501037_0047461 3300049573 Bacteria 3147
671 Ga0501038_0053638 3300049574 Bacteria 3470
672 Ga0501038_0059039 3300049574 Bacteria 3287
673 Ga0501038_0283912 3300049574 Unclassified 1302
674 Ga0501038_0750782 3300049574 Bacteria 728
675 Ga0501039_0128383 3300049575 Bacteria 1989
676 Ga0501039_0132666 3300049575 Bacteria 1955
677 Ga0501039_0737542 3300049575 Unclassified 769
678 Ga0501040_0001982 3300049576 Bacteria 13201
679 Ga0501040_0024722 3300049576 Bacteria 4033
680 Ga0501040_0058584 3300049576 Bacteria 2645
681 Ga0501040_0231663 3300049576 Bacteria 1315
682 Ga0501040_0463969 3300049576 Bacteria 912
683 Ga0501040_0662906 3300049576 Bacteria 754
684 Ga0501040_0697913 3300049576 Unclassified 734
685 Ga0501041_0010994 3300049577 Bacteria 5344
686 Ga0501041_0267676 3300049577 Unclassified 1075
687 Ga0501042_0007810 3300049578 Bacteria 7030
688 Ga0501042_0066372 3300049578 Bacteria 2579
689 Ga0501042_0070864 3300049578 Bacteria 2494
690 Ga0501042_0095081 3300049578 Bacteria 2140
691 Ga0501042_0241775 3300049578 Unclassified 1302
692 Ga0501042_0420492 3300049578 Unclassified 968
693 Ga0501042_0486119 3300049578 Unclassified 896
694 Ga0501043_0011980 3300049579 Bacteria 6784
695 Ga0501043_0066858 3300049579 Bacteria 2823
696 Ga0501043_0611521 3300049579 Bacteria 804
697 Ga0501046_0009495 3300049580 Bacteria 8405
698 Ga0501046_0152707 3300049580 Bacteria 1741
699 Ga0501046_0238257 3300049580 Unclassified 1343
700 Ga0501046_0256518 3300049580 Unclassified 1286
701 Ga0501046_0851809 3300049580 Unclassified 637
702 Ga0501047_0169163 3300049581 Unclassified 2055
703 Ga0501048_0605348 3300049582 Bacteria 787
704 Ga0501048_1094094 3300049582 Bacteria 573
705 Ga0501068_0014188 3300049584 Unclassified 4550
706 Ga0501068_0049838 3300049584 Bacteria 2530
707 Ga0501068_0153763 3300049584 Unclassified 1447
708 Ga0501068_0195957 3300049584 Bacteria 1281
709 Ga0501068_0377064 3300049584 Bacteria 913
710 Ga0501069_0230676 3300049585 Bacteria 1077
711 Ga0501070_0017134 3300049586 Bacteria 6080
712 Ga0501071_0344228 3300049587 Bacteria 1134
713 Ga0501071_0367589 3300049587 Bacteria 1096
714 Ga0501071_0376801 3300049587 Bacteria 1082
715 Ga0501071_0550587 3300049587 Bacteria 886
716 Ga0501071_0552428 3300049587 Unclassified 884
717 Ga0501071_0962108 3300049587 Bacteria 659
718 Ga0501072_0030312 3300049588 Bacteria 4230
719 Ga0501072_0041657 3300049588 Bacteria 3608
720 Ga0501072_0083194 3300049588 Unclassified 2537
721 Ga0501072_0181939 3300049588 Unclassified 1677
722 Ga0501072_0293209 3300049588 Unclassified 1293
723 Ga0501072_0338959 3300049588 Bacteria 1194
724 Ga0501072_0429507 3300049588 Bacteria 1047
725 Ga0501072_0804161 3300049588 Bacteria 736
726 Ga0501073_0067235 3300049589 Bacteria 2498
727 Ga0501073_0612758 3300049589 Unclassified 752
728 Ga0501073_1090340 3300049589 Bacteria 549
729 Ga0501074_0002117 3300049590 Bacteria 13714
730 Ga0501074_0009550 3300049590 Bacteria 7045
731 Ga0501074_0035025 3300049590 Bacteria 3638
732 Ga0501075_0004974 3300049591 Bacteria 9065
733 Ga0501075_0019228 3300049591 Bacteria 4953
734 Ga0501075_0068760 3300049591 Bacteria 2676
735 Ga0501075_0106259 3300049591 Bacteria 2134
736 Ga0501075_0133125 3300049591 Bacteria 1894
737 Ga0501075_0510221 3300049591 Bacteria 917
738 Ga0501076_0022605 3300049592 Bacteria 4834
739 Ga0501076_0053305 3300049592 Bacteria 3205
740 Ga0501076_0063606 3300049592 Bacteria 2940
741 Ga0501076_0358165 3300049592 Bacteria 1198
742 Ga0501076_0483273 3300049592 Bacteria 1020
743 Ga0501076_0565617 3300049592 Bacteria 938
744 Ga0501076_0807125 3300049592 Bacteria 774
745 Ga0501076_0852907 3300049592 Bacteria 751
746 Ga0501076_0907176 3300049592 Unclassified 726
747 Ga0501076_0961380 3300049592 Bacteria 704
748 Ga0501077_0006466 3300049593 Bacteria 7193
749 Ga0501077_0021397 3300049593 Bacteria 4092
750 Ga0501077_0022849 3300049593 Bacteria 3963
751 Ga0501077_0075484 3300049593 Bacteria 2135
752 Ga0501077_0087361 3300049593 Bacteria 1976
753 Ga0501077_0091515 3300049593 Bacteria 1927
754 Ga0501077_0106373 3300049593 Bacteria 1778
755 Ga0501077_0127584 3300049593 Bacteria 1612
756 Ga0501077_0206723 3300049593 Bacteria 1247
757 Ga0501077_0210938 3300049593 Unclassified 1234
758 Ga0501079_0035033 3300049741 Bacteria 3862
759 Ga0501079_0047343 3300049741 Bacteria 3317
760 Ga0501079_0071636 3300049741 Bacteria 2678
761 Ga0501079_0237604 3300049741 Unclassified 1423
762 Ga0501079_0385934 3300049741 Unclassified 1098
763 Ga0501079_0524792 3300049741 Bacteria 931
764 Ga0501079_0747879 3300049741 Unclassified 769
765 Ga0501079_1153390 3300049741 Bacteria 610
766 Ga0501080_0020720 3300049742 Bacteria 6091
767 Ga0501080_0276372 3300049742 Bacteria 1528
768 Ga0501081_0002082 3300049743 Bacteria 12486
769 Ga0501081_0003624 3300049743 Bacteria 9884
770 Ga0501081_0008158 3300049743 Bacteria 6797
771 Ga0501081_0022821 3300049743 Bacteria 4189
772 Ga0501081_0038357 3300049743 Bacteria 3273
773 Ga0501081_0135486 3300049743 Bacteria 1763
774 Ga0501081_0135859 3300049743 Unclassified 1760
775 Ga0501081_0240198 3300049743 Unclassified 1321
776 Ga0501081_0268233 3300049743 Bacteria 1248
777 Ga0501081_0304890 3300049743 Bacteria 1168
778 Ga0501081_0436468 3300049743 Bacteria 972
779 Ga0501081_0455201 3300049743 Bacteria 951
780 Ga0501081_0498605 3300049743 Bacteria 907
781 Ga0501081_0574039 3300049743 Unclassified 843
782 Ga0501081_0697597 3300049743 Unclassified 762
783 Ga0501083_0002379 3300049744 Bacteria 12878
784 Ga0501083_0016181 3300049744 Bacteria 5222
785 Ga0501083_0065498 3300049744 Bacteria 2420
786 Ga0501083_0100367 3300049744 Bacteria 1909
787 Ga0501083_0224680 3300049744 Unclassified 1223
788 Ga0501035_0015418 3300049822 Bacteria 7050
789 Ga0501035_0202571 3300049822 Bacteria 1701
790 Ga0501035_1005054 3300049822 Bacteria 656
791 Ga0501044_0000121 3300049823 Bacteria 93902
792 Ga0501044_0009312 3300049823 Bacteria 10716
793 Ga0501045_0000998 3300049824 Bacteria 18589
794 Ga0501045_0015358 3300049824 Bacteria 5436
795 Ga0501045_0018759 3300049824 Bacteria 4924
796 Ga0501045_0160548 3300049824 Bacteria 1673
797 Ga0501045_0217455 3300049824 Unclassified 1423
798 Ga0501045_0264455 3300049824 Unclassified 1280
799 Ga0501045_0520429 3300049824 Unclassified 883
800 Ga0501045_0541002 3300049824 Bacteria 864
801 Ga0501045_0629557 3300049824 Bacteria 793
802 Ga0501045_0724879 3300049824 Unclassified 733
803 nmdc:mga05p37_1053355_c1 3300050507 Bacteria 858
804 nmdc:mga05p37_1087355_c1 3300050507 Unclassified 839
805 nmdc:mga05p37_1239306_c1 3300050507 Bacteria 767
806 nmdc:mga05p37_1447_c1 3300050507 Bacteria 27609
807 nmdc:mga05p37_1453785_c1 3300050507 Unclassified 686
808 nmdc:mga05p37_165552_c1 3300050507 Unclassified 2699
809 nmdc:mga05p37_1713740_c1 3300050507 Unclassified 612
810 nmdc:mga05p37_173543_c1 3300050507 Bacteria 2628
811 nmdc:mga05p37_26490_c1 3300050507 Bacteria 7052
812 nmdc:mga05p37_279370_c1 3300050507 Unclassified 1992
813 nmdc:mga05p37_32437_c1 3300050507 Bacteria 6387
814 nmdc:mga05p37_32456_c1 3300050507 Bacteria 6385
815 nmdc:mga05p37_328086_c1 3300050507 Unclassified 1809
816 nmdc:mga05p37_388525_c1 3300050507 Bacteria 1633
817 nmdc:mga05p37_399654_c1 3300050507 Unclassified 1605
818 nmdc:mga05p37_4034_c1 3300050507 Bacteria 17155
819 nmdc:mga05p37_404716_c1 3300050507 Bacteria 1593
820 nmdc:mga05p37_415226_c1 3300050507 Unclassified 1568
821 nmdc:mga05p37_52253_c1 3300050507 Bacteria 5025
822 nmdc:mga05p37_628967_c1 3300050507 Bacteria 1206
823 nmdc:mga05p37_633658_c1 3300050507 Bacteria 1201
824 nmdc:mga05p37_67090_c1 3300050507 Bacteria 4414
825 nmdc:mga05p37_68146_c1 3300050507 Bacteria 4377
826 nmdc:mga05p37_702_c1 3300050507 Bacteria 37071
827 nmdc:mga05p37_938824_c1 3300050507 Bacteria 927
828 nmdc:mga05p37_98891_c1 3300050507 Bacteria 3594
829 nmdc:mga09592_127724_c1 3300050508 Bacteria 2186
830 nmdc:mga09592_30955_c1 3300050508 Archaea 4456
831 nmdc:mga09592_324884_c1 3300050508 Bacteria 1333
832 nmdc:mga09592_351263_c1 3300050508 Bacteria 1276
833 nmdc:mga09592_448901_c1 3300050508 Bacteria 1113
834 nmdc:mga09592_50504_c1 3300050508 Bacteria 3508
835 nmdc:mga09592_6073_c1 3300050508 Bacteria 9844
836 nmdc:mga09592_64281_c1 3300050508 Bacteria 3106
837 nmdc:mga09592_711441_c1 3300050508 Bacteria 854
838 nmdc:mga09592_774126_c1 3300050508 Unclassified 813
839 nmdc:mga09592_82262_c1 3300050508 Bacteria 2744
840 nmdc:mga09592_856738_c1 3300050508 Bacteria 766
841 nmdc:mga09592_9034_c1 3300050508 Bacteria 5322
842 nmdc:mga09592_917271_c1 3300050508 Unclassified 736
843 nmdc:mga09592_976620_c1 3300050508 Bacteria 709
844 nmdc:mga0qj67_503823_c1 3300050509 Unclassified 973
845 nmdc:mga0qj67_683630_c1 3300050509 Unclassified 817
846 nmdc:mga0qj67_6981_c1 3300050509 Bacteria 8317
847 nmdc:mga0qj67_729772_c1 3300050509 Bacteria 787
848 nmdc:mga0qj67_7532_c1 3300050509 Bacteria 8043
849 nmdc:mga0qj67_92821_c1 3300050509 Bacteria 2427
850 nmdc:mga0qj67_98912_c1 3300050509 Bacteria 2350
851 nmdc:mga06r32_1052242_c1 3300050510 Unclassified 765
852 nmdc:mga06r32_112856_c1 3300050510 Bacteria 2675
853 nmdc:mga06r32_155934_c1 3300050510 Bacteria 2265
854 nmdc:mga06r32_196063_c1 3300050510 Bacteria 2007
855 nmdc:mga06r32_309363_c1 3300050510 Bacteria 1566
856 nmdc:mga06r32_33788_c1 3300050510 Bacteria 4819
857 nmdc:mga06r32_4707_c1 3300050510 Bacteria 12267
858 nmdc:mga06r32_871821_c1 3300050510 Unclassified 858
859 nmdc:mga08y16_1106_c1 3300050511 Bacteria 5765
860 nmdc:mga08y16_19058_c1 3300050511 Bacteria 7229
861 nmdc:mga08y16_19072_c1 3300050511 Bacteria 7226
862 nmdc:mga08y16_337312_c1 3300050511 Bacteria 1550
863 nmdc:mga08y16_36954_c1 3300050511 Bacteria 5129
864 nmdc:mga08y16_382488_c1 3300050511 Unclassified 1443
865 nmdc:mga0n895_11260_c1 3300050512 Bacteria 7968
866 nmdc:mga0n895_1275819_c1 3300050512 Unclassified 706
867 nmdc:mga0n895_13403_c1 3300050512 Bacteria 7393
868 nmdc:mga0n895_17372_c1 3300050512 Bacteria 6630
869 nmdc:mga0n895_186_c1 3300050512 Bacteria 38327
870 nmdc:mga0n895_209879_c1 3300050512 Unclassified 1978
871 nmdc:mga0n895_22584_c1 3300050512 Bacteria 5901
872 nmdc:mga0n895_241132_c1 3300050512 Unclassified 1835
873 nmdc:mga0n895_287244_c1 3300050512 Unclassified 1668
874 nmdc:mga0n895_308962_c1 3300050512 Bacteria 1603
875 nmdc:mga0n895_386948_c1 3300050512 Unclassified 1415
876 nmdc:mga0n895_436907_c1 3300050512 Unclassified 1322
877 nmdc:mga0n895_452584_c1 3300050512 Bacteria 1296
878 nmdc:mga0n895_5330_c1 3300050512 Bacteria 10714
879 nmdc:mga0n895_5865_c1 3300050512 Bacteria 10322
880 nmdc:mga0n895_688210_c1 3300050512 Bacteria 1019
881 nmdc:mga0rr50_121958_c1 3300050513 Unclassified 2076
882 nmdc:mga0rr50_13486_c1 3300050513 Bacteria 5322
883 nmdc:mga0rr50_224656_c1 3300050513 Bacteria 1552
884 nmdc:mga0rr50_458468_c1 3300050513 Bacteria 1081
885 nmdc:mga0rr50_55930_c1 3300050513 Bacteria 2946
886 nmdc:mga0rr50_629_c1 3300050513 Bacteria 18926
887 nmdc:mga0rr50_7815_c1 3300050513 Bacteria 6628
888 nmdc:mga0rr50_91183_c1 3300050513 Bacteria 2373
889 nmdc:mga0rr50_99206_c1 3300050513 Unclassified 2285
890 nmdc:mga08x19_315205_c1 3300050514 Bacteria 1088
891 nmdc:mga08x19_379302_c1 3300050514 Bacteria 990
892 nmdc:mga08x19_44987_c1 3300050514 Unclassified 2820
893 nmdc:mga08x19_55183_c1 3300050514 Bacteria 2560
894 nmdc:mga08x19_65730_c1 3300050514 Bacteria 2356
895 nmdc:mga08x19_90121_c1 3300050514 Unclassified 2023
896 nmdc:mga0a205_12965_c1 3300050515 Bacteria 7736
897 nmdc:mga0a205_135357_c1 3300050515 Bacteria 2364
898 nmdc:mga0a205_17686_c1 3300050515 Bacteria 6691
899 nmdc:mga0a205_182897_c1 3300050515 Bacteria 1990
900 nmdc:mga0a205_206867_c1 3300050515 Unclassified 1852
901 nmdc:mga0a205_215435_c1 3300050515 Bacteria 1130
902 nmdc:mga0a205_216785_c1 3300050515 Unclassified 1801
903 nmdc:mga0a205_233741_c1 3300050515 Unclassified 1721
904 nmdc:mga0a205_245503_c1 3300050515 Bacteria 1671
905 nmdc:mga0a205_250874_c1 3300050515 Bacteria 1649
906 nmdc:mga0a205_259375_c1 3300050515 Bacteria 1616
907 nmdc:mga0a205_2643_c1 3300050515 Bacteria 15831
908 nmdc:mga0a205_265783_c1 3300050515 Unclassified 1593
909 nmdc:mga0a205_289770_c1 3300050515 Bacteria 1512
910 nmdc:mga0a205_358159_c1 3300050515 Bacteria 1326
911 nmdc:mga0a205_4159_c1 3300050515 Bacteria 12967
912 nmdc:mga0a205_49373_c1 3300050515 Bacteria 4062
913 nmdc:mga0a205_523029_c1 3300050515 Bacteria 1043
914 nmdc:mga0a205_564550_c1 3300050515 Bacteria 993
915 nmdc:mga0a205_83386_c1 3300050515 Bacteria 3087
916 Ga0501084_0014517 3300054114 Bacteria 6530
917 Ga0501084_0033887 3300054114 Bacteria 4271
918 Ga0501084_0098523 3300054114 Bacteria 2455
919 Ga0501084_0187345 3300054114 Unclassified 1746
920 Ga0501084_0257768 3300054114 Bacteria 1472
921 Ga0501084_0279110 3300054114 Unclassified 1411
922 Ga0501084_0290440 3300054114 Bacteria 1381
923 Ga0501084_0321313 3300054114 Unclassified 1307
924 Ga0501084_0425833 3300054114 Bacteria 1122
925 Ga0501084_0879269 3300054114 Bacteria 754
926 Ga0590074_024727 3300059423 Bacteria 1045
927 Ga0590075_011669 3300059424 Bacteria 2127
928 Ga0590077_065822 3300059426 Bacteria 824
929 Ga0501082_0001040 3300060353 Bacteria 24529
930 Ga0501082_0002202 3300060353 Bacteria 17048
931 Ga0501082_0005588 3300060353 Bacteria 10923
932 Ga0501082_0347057 3300060353 Bacteria 1294
933 Ga0501082_0350813 3300060353 Bacteria 1286
934 Ga0501082_0388015 3300060353 Unclassified 1218
935 Ga0501082_0656002 3300060353 Bacteria 918
936 Ga0501082_1379990 3300060353 Unclassified 615
937 Ga0501082_1441790 3300060353 Unclassified 601
938 Ga0530510_0000244 3300061734 Bacteria 34085
939 Ga0530510_0005130 3300061734 Bacteria 9036
940 Ga0530510_0005522 3300061734 Bacteria 8757
941 Ga0530510_0029517 3300061734 Bacteria 3937
942 Ga0530510_0033237 3300061734 Bacteria 3714
943 Ga0530510_0126761 3300061734 Bacteria 1877
944 Ga0530510_0132295 3300061734 Bacteria 1836
945 Ga0530510_0156915 3300061734 Bacteria 1682
946 Ga0530510_0203231 3300061734 Bacteria 1472
947 Ga0530510_0244514 3300061734 Unclassified 1336
948 Ga0530510_0278875 3300061734 Bacteria 1248
949 Ga0530510_0313006 3300061734 Unclassified 1176

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0197372 Ga0496117_0197372_14_484 156
2 3300049592 Ga0501076_0358165 Ga0501076_0358165_22_492 156
3 3300006844 Ga0075428_100107212 Ga0075428_1001072124 165
4 3300006847 Ga0075431_100030953 Ga0075431_1000309533 165
5 3300009147 Ga0114129_10459194 Ga0114129_104591942 165
6 3300009148 Ga0105243_11050988 Ga0105243_110509882 165
7 3300026118 Ga0207675_100311563 Ga0207675_1003115632 165
8 3300028380 Ga0268265_10943130 Ga0268265_109431301 165
9 3300050507 nmdc:mga05p37_938824_c1 nmdc:mga05p37_938824_c1_355_855 165
10 3300050508 nmdc:mga09592_976620_c1 nmdc:mga09592_976620_c1_94_594 165
11 3300050510 nmdc:mga06r32_309363_c1 nmdc:mga06r32_309363_c1_538_1038 165
12 3300005328 Ga0070676_10538316 Ga0070676_105383161 166
13 3300005334 Ga0068869_100930135 Ga0068869_1009301351 166
14 3300005336 Ga0070680_100112247 Ga0070680_1001122472 166
15 3300005336 Ga0070680_100543002 Ga0070680_1005430021 166
16 3300005340 Ga0070689_100831178 Ga0070689_1008311782 166
17 3300005343 Ga0070687_100704490 Ga0070687_1007044901 166
18 3300005345 Ga0070692_10074287 Ga0070692_100742872 166
19 3300005353 Ga0070669_100341484 Ga0070669_1003414841 166
20 3300005365 Ga0070688_100203874 Ga0070688_1002038742 166
21 3300005406 Ga0070703_10314664 Ga0070703_103146641 166
22 3300005441 Ga0070700_100083907 Ga0070700_1000839071 166
23 3300005444 Ga0070694_100037649 Ga0070694_1000376492 166
24 3300005445 Ga0070708_100517177 Ga0070708_1005171771 166
25 3300005445 Ga0070708_100612254 Ga0070708_1006122542 166
26 3300005457 Ga0070662_100794346 Ga0070662_1007943461 166
27 3300005458 Ga0070681_10088095 Ga0070681_100880952 166
28 3300005459 Ga0068867_101617145 Ga0068867_1016171451 166
29 3300005467 Ga0070706_100078854 Ga0070706_1000788542 166
30 3300005468 Ga0070707_100012568 Ga0070707_1000125688 166
31 3300005468 Ga0070707_100044774 Ga0070707_1000447745 166
32 3300005468 Ga0070707_100295571 Ga0070707_1002955712 166
33 3300005471 Ga0070698_100225757 Ga0070698_1002257572 166
34 3300005471 Ga0070698_100461172 Ga0070698_1004611721 166
35 3300005536 Ga0070697_100493491 Ga0070697_1004934912 166
36 3300005539 Ga0068853_101096397 Ga0068853_1010963971 166
37 3300005544 Ga0070686_100975918 Ga0070686_1009759181 166
38 3300005545 Ga0070695_100591417 Ga0070695_1005914172 166
39 3300005549 Ga0070704_100029417 Ga0070704_1000294172 166
40 3300005549 Ga0070704_100143886 Ga0070704_1001438861 166
41 3300005549 Ga0070704_101485724 Ga0070704_1014857241 166
42 3300005564 Ga0070664_100311373 Ga0070664_1003113732 166
43 3300005578 Ga0068854_100524511 Ga0068854_1005245111 166
44 3300005615 Ga0070702_100324020 Ga0070702_1003240202 166
45 3300005617 Ga0068859_100077917 Ga0068859_1000779173 166
46 3300005617 Ga0068859_100093820 Ga0068859_1000938204 166
47 3300005617 Ga0068859_100564167 Ga0068859_1005641673 166
48 3300005617 Ga0068859_101061443 Ga0068859_1010614432 166
49 3300005842 Ga0068858_100539806 Ga0068858_1005398062 166
50 3300005842 Ga0068858_101499448 Ga0068858_1014994481 166
51 3300005843 Ga0068860_100053786 Ga0068860_1000537862 166
52 3300005843 Ga0068860_100097112 Ga0068860_1000971121 166
53 3300005843 Ga0068860_100613804 Ga0068860_1006138042 166
54 3300005844 Ga0068862_100054120 Ga0068862_1000541201 166
55 3300005937 Ga0081455_10732229 Ga0081455_107322291 166
56 3300006844 Ga0075428_100001459 Ga0075428_10000145913 166
57 3300006844 Ga0075428_100016688 Ga0075428_1000166885 166
58 3300006844 Ga0075428_100326128 Ga0075428_1003261282 166
59 3300006846 Ga0075430_100000265 Ga0075430_10000026517 166
60 3300006846 Ga0075430_100000518 Ga0075430_10000051831 166
61 3300006847 Ga0075431_100024626 Ga0075431_1000246267 166
62 3300006847 Ga0075431_100034401 Ga0075431_1000344012 166
63 3300006847 Ga0075431_100834320 Ga0075431_1008343202 166
64 3300006847 Ga0075431_100881309 Ga0075431_1008813092 166
65 3300006852 Ga0075433_10054017 Ga0075433_100540172 166
66 3300006852 Ga0075433_10154481 Ga0075433_101544813 166
67 3300006871 Ga0075434_100116580 Ga0075434_1001165803 166
68 3300006880 Ga0075429_100000257 Ga0075429_10000025723 166
69 3300006880 Ga0075429_100042390 Ga0075429_1000423903 166
70 3300006880 Ga0075429_100066555 Ga0075429_1000665553 166
71 3300006880 Ga0075429_100377517 Ga0075429_1003775172 166
72 3300006881 Ga0068865_100086641 Ga0068865_1000866411 166
73 3300006881 Ga0068865_100088638 Ga0068865_1000886382 166
74 3300006931 Ga0097620_100077920 Ga0097620_1000779201 166
75 3300006931 Ga0097620_100093819 Ga0097620_1000938191 166
76 3300006931 Ga0097620_100564147 Ga0097620_1005641473 166
77 3300006931 Ga0097620_101061445 Ga0097620_1010614451 166
78 3300009094 Ga0111539_10000087 Ga0111539_1000008786 166
79 3300009094 Ga0111539_11218090 Ga0111539_112180902 166
80 3300009098 Ga0105245_11233719 Ga0105245_112337192 166
81 3300009101 Ga0105247_10137139 Ga0105247_101371391 166
82 3300009147 Ga0114129_10002580 Ga0114129_1000258018 166
83 3300009147 Ga0114129_10059946 Ga0114129_100599467 166
84 3300009147 Ga0114129_10260112 Ga0114129_102601123 166
85 3300009147 Ga0114129_10402041 Ga0114129_104020412 166
86 3300009148 Ga0105243_10459975 Ga0105243_104599753 166
87 3300009174 Ga0105241_10260419 Ga0105241_102604191 166
88 3300009176 Ga0105242_10160873 Ga0105242_101608732 166
89 3300009177 Ga0105248_10066182 Ga0105248_100661825 166
90 3300009177 Ga0105248_11439177 Ga0105248_114391771 166
91 3300009177 Ga0105248_11769831 Ga0105248_117698311 166
92 3300009553 Ga0105249_10030373 Ga0105249_100303736 166
93 3300009553 Ga0105249_10579430 Ga0105249_105794302 166
94 3300010375 Ga0105239_11308034 Ga0105239_113080342 166
95 3300013297 Ga0157378_10043485 Ga0157378_100434853 166
96 3300013306 Ga0163162_10740029 Ga0163162_107400291 166
97 3300013308 Ga0157375_10059324 Ga0157375_100593243 166
98 3300014325 Ga0163163_10732465 Ga0163163_107324652 166
99 3300014745 Ga0157377_10943226 Ga0157377_109432261 166
100 3300025900 Ga0207710_10036217 Ga0207710_100362173 166
101 3300025904 Ga0207647_10600638 Ga0207647_106006381 166
102 3300025910 Ga0207684_10430176 Ga0207684_104301762 166
103 3300025911 Ga0207654_10013245 Ga0207654_100132454 166
104 3300025912 Ga0207707_10329878 Ga0207707_103298782 166
105 3300025917 Ga0207660_10102098 Ga0207660_101020983 166
106 3300025917 Ga0207660_10757954 Ga0207660_107579541 166
107 3300025922 Ga0207646_10144459 Ga0207646_101444593 166
108 3300025922 Ga0207646_10171813 Ga0207646_101718132 166
109 3300025922 Ga0207646_10236418 Ga0207646_102364182 166
110 3300025923 Ga0207681_10053693 Ga0207681_100536935 166
111 3300025923 Ga0207681_10077173 Ga0207681_100771733 166
112 3300025933 Ga0207706_10071839 Ga0207706_100718391 166
113 3300025933 Ga0207706_10242355 Ga0207706_102423552 166
114 3300025934 Ga0207686_10046606 Ga0207686_100466063 166
115 3300025935 Ga0207709_10023792 Ga0207709_100237923 166
116 3300025935 Ga0207709_10782524 Ga0207709_107825242 166
117 3300025936 Ga0207670_11121844 Ga0207670_111218441 166
118 3300025938 Ga0207704_10117713 Ga0207704_101177133 166
119 3300025942 Ga0207689_11442885 Ga0207689_114428851 166
120 3300025945 Ga0207679_10522503 Ga0207679_105225032 166
121 3300025960 Ga0207651_11568805 Ga0207651_115688051 166
122 3300025961 Ga0207712_10622700 Ga0207712_106227001 166
123 3300025981 Ga0207640_10388856 Ga0207640_103888562 166
124 3300025986 Ga0207658_10914200 Ga0207658_109142001 166
125 3300026035 Ga0207703_10664820 Ga0207703_106648201 166
126 3300026075 Ga0207708_11045164 Ga0207708_110451641 166
127 3300026088 Ga0207641_10887703 Ga0207641_108877031 166
128 3300026088 Ga0207641_11246449 Ga0207641_112464491 166
129 3300026089 Ga0207648_10933345 Ga0207648_109333451 166
130 3300026095 Ga0207676_10148474 Ga0207676_101484741 166
131 3300026116 Ga0207674_11817683 Ga0207674_118176831 166
132 3300026118 Ga0207675_100059884 Ga0207675_1000598841 166
133 3300026118 Ga0207675_100136389 Ga0207675_1001363893 166
134 3300027717 Ga0209998_10011841 Ga0209998_100118411 166
135 3300027907 Ga0207428_10000355 Ga0207428_1000035532 166
136 3300027907 Ga0207428_10036317 Ga0207428_100363172 166
137 3300028380 Ga0268265_10123390 Ga0268265_101233903 166
138 3300028381 Ga0268264_10773906 Ga0268264_107739061 166
139 3300031548 Ga0307408_100134251 Ga0307408_1001342512 166
140 3300031731 Ga0307405_11134522 Ga0307405_111345221 166
141 3300031901 Ga0307406_10674915 Ga0307406_106749152 166
142 3300031903 Ga0307407_11256149 Ga0307407_112561491 166
143 3300031911 Ga0307412_10196725 Ga0307412_101967252 166
144 3300032002 Ga0307416_100017844 Ga0307416_1000178442 166
145 3300032005 Ga0307411_10027915 Ga0307411_100279152 166
146 3300035090 Ga0373949_0034624 Ga0373949_0034624_622_1149 166
147 3300035091 Ga0373951_0117698 Ga0373951_0117698_86_613 166
148 3300035112 Ga0373932_0066228 Ga0373932_0066228_449_976 166
149 3300035241 Ga0373961_0045720 Ga0373961_0045720_575_1102 166
150 3300035691 Ga0373931_0013793 Ga0373931_0013793_1741_2268 166
151 3300037312 Ga0395899_0039623 Ga0395899_0039623_485_985 166
152 3300037418 Ga0395900_0006760 Ga0395900_0006760_9402_9902 166
153 3300037466 Ga0395898_0022166 Ga0395898_0022166_86_586 166
154 3300038443 Ga0395901_0016644 Ga0395901_0016644_4364_4864 166
155 3300038996 Ga0242420_039512 Ga0242420_039512_116_616 166
156 3300042876 Ga0451577_0012361 Ga0451577_0012361_4888_5388 166
157 3300042876 Ga0451577_0473804 Ga0451577_0473804_21_548 166
158 3300044673 Ga0453683_0037750 Ga0453683_0037750_43_543 166
159 3300044712 Ga0453684_0101813 Ga0453684_0101813_1676_2176 166
160 3300045051 Ga0451576_0024938 Ga0451576_0024938_5774_6274 166
161 3300045051 Ga0451576_0176633 Ga0451576_0176633_1503_2003 166
162 3300045051 Ga0451576_0304129 Ga0451576_0304129_57_557 166
163 3300046491 Ga0495584_0220617 Ga0495584_0220617_226_726 166
164 3300046499 Ga0495594_0020757 Ga0495594_0020757_1779_2279 166
165 3300046615 Ga0495656_0216105 Ga0495656_0216105_142_642 166
166 3300046664 Ga0495659_0073168 Ga0495659_0073168_537_1037 166
167 3300046684 Ga0495669_0076402 Ga0495669_0076402_424_924 166
168 3300048905 Ga0496102_0064353 Ga0496102_0064353_510_1037 166
169 3300048910 Ga0496107_0549765 Ga0496107_0549765_93_620 166
170 3300049576 Ga0501040_0463969 Ga0501040_0463969_366_866 166
171 3300049584 Ga0501068_0377064 Ga0501068_0377064_80_580 166
172 3300049588 Ga0501072_0338959 Ga0501072_0338959_132_632 166
173 3300049588 Ga0501072_0429507 Ga0501072_0429507_310_810 166
174 3300049591 Ga0501075_0133125 Ga0501075_0133125_119_619 166
175 3300049592 Ga0501076_0053305 Ga0501076_0053305_1774_2274 166
176 3300049592 Ga0501076_0852907 Ga0501076_0852907_19_519 166
177 3300049593 Ga0501077_0087361 Ga0501077_0087361_1291_1791 166
178 3300049741 Ga0501079_0071636 Ga0501079_0071636_1452_1952 166
179 3300049741 Ga0501079_0385934 Ga0501079_0385934_494_994 166
180 3300049742 Ga0501080_0276372 Ga0501080_0276372_113_613 166
181 3300049824 Ga0501045_0629557 Ga0501045_0629557_122_622 166
182 3300050507 nmdc:mga05p37_1053355_c1 nmdc:mga05p37_1053355_c1_169_669 166
183 3300050507 nmdc:mga05p37_173543_c1 nmdc:mga05p37_173543_c1_1571_2071 166
184 3300050507 nmdc:mga05p37_328086_c1 nmdc:mga05p37_328086_c1_765_1265 166
185 3300050508 nmdc:mga09592_127724_c1 nmdc:mga09592_127724_c1_1356_1856 166
186 3300050508 nmdc:mga09592_351263_c1 nmdc:mga09592_351263_c1_557_1057 166
187 3300050508 nmdc:mga09592_6073_c1 nmdc:mga09592_6073_c1_2397_2897 166
188 3300050508 nmdc:mga09592_64281_c1 nmdc:mga09592_64281_c1_2412_2912 166
189 3300050509 nmdc:mga0qj67_6981_c1 nmdc:mga0qj67_6981_c1_4201_4701 166
190 3300050509 nmdc:mga0qj67_7532_c1 nmdc:mga0qj67_7532_c1_588_1088 166
191 3300050510 nmdc:mga06r32_33788_c1 nmdc:mga06r32_33788_c1_3612_4112 166
192 3300050510 nmdc:mga06r32_4707_c1 nmdc:mga06r32_4707_c1_621_1121 166
193 3300050510 nmdc:mga06r32_871821_c1 nmdc:mga06r32_871821_c1_203_703 166
194 3300050511 nmdc:mga08y16_19058_c1 nmdc:mga08y16_19058_c1_6100_6600 166
195 3300050511 nmdc:mga08y16_19072_c1 nmdc:mga08y16_19072_c1_4153_4680 166
196 3300050512 nmdc:mga0n895_1275819_c1 nmdc:mga0n895_1275819_c1_171_671 166
197 3300050512 nmdc:mga0n895_287244_c1 nmdc:mga0n895_287244_c1_113_613 166
198 3300050515 nmdc:mga0a205_12965_c1 nmdc:mga0a205_12965_c1_6110_6610 166
199 3300050515 nmdc:mga0a205_259375_c1 nmdc:mga0a205_259375_c1_293_793 166
200 3300054114 Ga0501084_0098523 Ga0501084_0098523_544_1044 166
201 3300054114 Ga0501084_0257768 Ga0501084_0257768_480_980 166
202 3300059423 Ga0590074_024727 Ga0590074_024727_490_990 166
203 3300060353 Ga0501082_0347057 Ga0501082_0347057_376_876 166
204 3300061734 Ga0530510_0278875 Ga0530510_0278875_590_1090 166
205 3300003203 JGI25406J46586_10102921 JGI25406J46586_101029212 167
206 3300003347 JGI26128J50194_1007436 JGI26128J50194_10074361 167
207 3300003911 JGI25405J52794_10000633 JGI25405J52794_100006332 167
208 3300004798 Ga0058859_10044750 Ga0058859_100447502 167
209 3300004798 Ga0058859_11819114 Ga0058859_118191142 167
210 3300004801 Ga0058860_11187877 Ga0058860_111878771 167
211 3300004801 Ga0058860_12238848 Ga0058860_122388481 167
212 3300005290 Ga0065712_10037114 Ga0065712_100371141 167
213 3300005293 Ga0065715_10118079 Ga0065715_101180792 167
214 3300005295 Ga0065707_10023398 Ga0065707_100233982 167
215 3300005295 Ga0065707_10194343 Ga0065707_101943431 167
216 3300005295 Ga0065707_10364960 Ga0065707_103649601 167
217 3300005328 Ga0070676_10000227 Ga0070676_1000022723 167
218 3300005329 Ga0070683_100133327 Ga0070683_1001333272 167
219 3300005330 Ga0070690_100900598 Ga0070690_1009005981 167
220 3300005331 Ga0070670_100004572 Ga0070670_1000045722 167
221 3300005334 Ga0068869_100005890 Ga0068869_1000058902 167
222 3300005334 Ga0068869_100037331 Ga0068869_1000373311 167
223 3300005334 Ga0068869_100386964 Ga0068869_1003869641 167
224 3300005336 Ga0070680_100006965 Ga0070680_1000069659 167
225 3300005336 Ga0070680_100460330 Ga0070680_1004603302 167
226 3300005337 Ga0070682_100001390 Ga0070682_1000013909 167
227 3300005338 Ga0068868_100116790 Ga0068868_1001167902 167
228 3300005339 Ga0070660_100004277 Ga0070660_1000042772 167
229 3300005340 Ga0070689_101665050 Ga0070689_1016650501 167
230 3300005341 Ga0070691_10010815 Ga0070691_100108152 167
231 3300005341 Ga0070691_10062295 Ga0070691_100622952 167
232 3300005341 Ga0070691_10130076 Ga0070691_101300762 167
233 3300005344 Ga0070661_100000341 Ga0070661_10000034135 167
234 3300005345 Ga0070692_10141121 Ga0070692_101411212 167
235 3300005347 Ga0070668_100434182 Ga0070668_1004341822 167
236 3300005347 Ga0070668_100723291 Ga0070668_1007232912 167
237 3300005353 Ga0070669_100229391 Ga0070669_1002293912 167
238 3300005353 Ga0070669_100668224 Ga0070669_1006682242 167
239 3300005354 Ga0070675_100373392 Ga0070675_1003733921 167
240 3300005354 Ga0070675_100774459 Ga0070675_1007744592 167
241 3300005355 Ga0070671_100294112 Ga0070671_1002941122 167
242 3300005364 Ga0070673_100020228 Ga0070673_1000202283 167
243 3300005364 Ga0070673_100572645 Ga0070673_1005726452 167
244 3300005366 Ga0070659_100006955 Ga0070659_1000069552 167
245 3300005406 Ga0070703_10001000 Ga0070703_100010005 167
246 3300005406 Ga0070703_10064800 Ga0070703_100648001 167
247 3300005406 Ga0070703_10340909 Ga0070703_103409091 167
248 3300005434 Ga0070709_10141820 Ga0070709_101418202 167
249 3300005439 Ga0070711_100358979 Ga0070711_1003589792 167
250 3300005440 Ga0070705_100000347 Ga0070705_10000034719 167
251 3300005440 Ga0070705_100017997 Ga0070705_1000179973 167
252 3300005440 Ga0070705_100847235 Ga0070705_1008472351 167
253 3300005441 Ga0070700_100060137 Ga0070700_1000601371 167
254 3300005441 Ga0070700_101012223 Ga0070700_1010122231 167
255 3300005444 Ga0070694_100002904 Ga0070694_10000290410 167
256 3300005444 Ga0070694_100003572 Ga0070694_1000035726 167
257 3300005444 Ga0070694_100007439 Ga0070694_1000074396 167
258 3300005444 Ga0070694_100127919 Ga0070694_1001279192 167
259 3300005444 Ga0070694_100245565 Ga0070694_1002455651 167
260 3300005445 Ga0070708_100033790 Ga0070708_1000337902 167
261 3300005445 Ga0070708_100086698 Ga0070708_1000866985 167
262 3300005445 Ga0070708_100104594 Ga0070708_1001045942 167
263 3300005445 Ga0070708_100241513 Ga0070708_1002415133 167
264 3300005445 Ga0070708_100318338 Ga0070708_1003183382 167
265 3300005445 Ga0070708_100373423 Ga0070708_1003734232 167
266 3300005445 Ga0070708_100470603 Ga0070708_1004706032 167
267 3300005445 Ga0070708_100527874 Ga0070708_1005278742 167
268 3300005445 Ga0070708_100591943 Ga0070708_1005919432 167
269 3300005445 Ga0070708_100741436 Ga0070708_1007414361 167
270 3300005455 Ga0070663_100008299 Ga0070663_1000082995 167
271 3300005457 Ga0070662_100012635 Ga0070662_1000126357 167
272 3300005459 Ga0068867_100000705 Ga0068867_10000070513 167
273 3300005459 Ga0068867_100275717 Ga0068867_1002757172 167
274 3300005467 Ga0070706_100007224 Ga0070706_1000072245 167
275 3300005467 Ga0070706_100028050 Ga0070706_1000280503 167
276 3300005467 Ga0070706_100041629 Ga0070706_1000416295 167
277 3300005467 Ga0070706_100090178 Ga0070706_1000901784 167
278 3300005467 Ga0070706_100120234 Ga0070706_1001202342 167
279 3300005467 Ga0070706_100191966 Ga0070706_1001919662 167
280 3300005467 Ga0070706_100233485 Ga0070706_1002334853 167
281 3300005467 Ga0070706_100349212 Ga0070706_1003492122 167
282 3300005467 Ga0070706_100406410 Ga0070706_1004064102 167
283 3300005467 Ga0070706_100422637 Ga0070706_1004226371 167
284 3300005467 Ga0070706_100437952 Ga0070706_1004379522 167
285 3300005467 Ga0070706_100682525 Ga0070706_1006825251 167
286 3300005467 Ga0070706_101102139 Ga0070706_1011021391 167
287 3300005468 Ga0070707_100011125 Ga0070707_10001112510 167
288 3300005468 Ga0070707_100026589 Ga0070707_1000265896 167
289 3300005468 Ga0070707_100070831 Ga0070707_1000708314 167
290 3300005468 Ga0070707_100184283 Ga0070707_1001842833 167
291 3300005468 Ga0070707_100187722 Ga0070707_1001877222 167
292 3300005468 Ga0070707_100205073 Ga0070707_1002050732 167
293 3300005468 Ga0070707_100297083 Ga0070707_1002970832 167
294 3300005468 Ga0070707_100298518 Ga0070707_1002985181 167
295 3300005471 Ga0070698_100002225 Ga0070698_10000222518 167
296 3300005471 Ga0070698_100040581 Ga0070698_1000405812 167
297 3300005471 Ga0070698_100046645 Ga0070698_1000466452 167
298 3300005471 Ga0070698_100233285 Ga0070698_1002332852 167
299 3300005471 Ga0070698_100276167 Ga0070698_1002761672 167
300 3300005471 Ga0070698_101319174 Ga0070698_1013191741 167
301 3300005518 Ga0070699_100001487 Ga0070699_10000148716 167
302 3300005518 Ga0070699_100018486 Ga0070699_1000184862 167
303 3300005518 Ga0070699_100028870 Ga0070699_1000288704 167
304 3300005518 Ga0070699_100042645 Ga0070699_1000426453 167
305 3300005518 Ga0070699_100069410 Ga0070699_1000694104 167
306 3300005518 Ga0070699_100092422 Ga0070699_1000924223 167
307 3300005518 Ga0070699_100213010 Ga0070699_1002130103 167
308 3300005518 Ga0070699_100273996 Ga0070699_1002739961 167
309 3300005518 Ga0070699_100619971 Ga0070699_1006199712 167
310 3300005518 Ga0070699_100677074 Ga0070699_1006770742 167
311 3300005518 Ga0070699_101178143 Ga0070699_1011781431 167
312 3300005530 Ga0070679_100000403 Ga0070679_1000004039 167
313 3300005536 Ga0070697_100013678 Ga0070697_1000136787 167
314 3300005536 Ga0070697_100028606 Ga0070697_1000286063 167
315 3300005536 Ga0070697_100079707 Ga0070697_1000797073 167
316 3300005536 Ga0070697_100085044 Ga0070697_1000850441 167
317 3300005536 Ga0070697_100151863 Ga0070697_1001518633 167
318 3300005536 Ga0070697_100500812 Ga0070697_1005008122 167
319 3300005539 Ga0068853_100000808 Ga0068853_1000008087 167
320 3300005543 Ga0070672_100070427 Ga0070672_1000704272 167
321 3300005544 Ga0070686_100468145 Ga0070686_1004681452 167
322 3300005545 Ga0070695_100000668 Ga0070695_1000006687 167
323 3300005545 Ga0070695_100008983 Ga0070695_1000089832 167
324 3300005545 Ga0070695_100009584 Ga0070695_1000095841 167
325 3300005545 Ga0070695_100867704 Ga0070695_1008677042 167
326 3300005545 Ga0070695_100917213 Ga0070695_1009172131 167
327 3300005546 Ga0070696_100012891 Ga0070696_1000128912 167
328 3300005546 Ga0070696_100451077 Ga0070696_1004510771 167
329 3300005546 Ga0070696_100497160 Ga0070696_1004971602 167
330 3300005547 Ga0070693_100000573 Ga0070693_10000057311 167
331 3300005547 Ga0070693_100021567 Ga0070693_1000215672 167
332 3300005548 Ga0070665_101231130 Ga0070665_1012311301 167
333 3300005549 Ga0070704_100000240 Ga0070704_10000024023 167
334 3300005549 Ga0070704_100023353 Ga0070704_1000233534 167
335 3300005549 Ga0070704_100235121 Ga0070704_1002351212 167
336 3300005549 Ga0070704_100825338 Ga0070704_1008253382 167
337 3300005563 Ga0068855_100000462 Ga0068855_10000046221 167
338 3300005563 Ga0068855_100002144 Ga0068855_10000214414 167
339 3300005564 Ga0070664_100004277 Ga0070664_1000042772 167
340 3300005564 Ga0070664_100174798 Ga0070664_1001747982 167
341 3300005564 Ga0070664_100884194 Ga0070664_1008841942 167
342 3300005577 Ga0068857_100071998 Ga0068857_1000719982 167
343 3300005578 Ga0068854_100001177 Ga0068854_1000011777 167
344 3300005614 Ga0068856_100004303 Ga0068856_1000043037 167
345 3300005617 Ga0068859_100001671 Ga0068859_1000016715 167
346 3300005618 Ga0068864_100002356 Ga0068864_1000023569 167
347 3300005718 Ga0068866_10113107 Ga0068866_101131072 167
348 3300005719 Ga0068861_100587778 Ga0068861_1005877782 167
349 3300005840 Ga0068870_10005065 Ga0068870_100050655 167
350 3300005841 Ga0068863_100077234 Ga0068863_1000772345 167
351 3300005842 Ga0068858_100073295 Ga0068858_1000732954 167
352 3300005842 Ga0068858_100385137 Ga0068858_1003851373 167
353 3300005843 Ga0068860_100009627 Ga0068860_1000096278 167
354 3300005843 Ga0068860_100078873 Ga0068860_1000788732 167
355 3300005843 Ga0068860_100085048 Ga0068860_1000850482 167
356 3300005843 Ga0068860_100134506 Ga0068860_1001345062 167
357 3300005843 Ga0068860_100375440 Ga0068860_1003754403 167
358 3300005844 Ga0068862_100002540 Ga0068862_1000025409 167
359 3300005844 Ga0068862_100020403 Ga0068862_1000204032 167
360 3300005844 Ga0068862_100577507 Ga0068862_1005775072 167
361 3300005844 Ga0068862_100998971 Ga0068862_1009989712 167
362 3300005937 Ga0081455_10000074 Ga0081455_1000007479 167
363 3300005937 Ga0081455_10000513 Ga0081455_1000051321 167
364 3300005937 Ga0081455_10022703 Ga0081455_100227032 167
365 3300005937 Ga0081455_10201906 Ga0081455_102019063 167
366 3300005937 Ga0081455_10240170 Ga0081455_102401701 167
367 3300005981 Ga0081538_10003140 Ga0081538_100031407 167
368 3300005981 Ga0081538_10035876 Ga0081538_100358762 167
369 3300005981 Ga0081538_10041626 Ga0081538_100416263 167
370 3300005983 Ga0081540_1005469 Ga0081540_10054699 167
371 3300005983 Ga0081540_1035939 Ga0081540_10359392 167
372 3300005983 Ga0081540_1036282 Ga0081540_10362823 167
373 3300005985 Ga0081539_10000020 Ga0081539_10000020291 167
374 3300005985 Ga0081539_10047008 Ga0081539_100470082 167
375 3300006058 Ga0075432_10115468 Ga0075432_101154682 167
376 3300006173 Ga0070716_100051328 Ga0070716_1000513282 167
377 3300006175 Ga0070712_100104061 Ga0070712_1001040613 167
378 3300006844 Ga0075428_100015960 Ga0075428_1000159607 167
379 3300006844 Ga0075428_100244021 Ga0075428_1002440213 167
380 3300006844 Ga0075428_100368191 Ga0075428_1003681912 167
381 3300006844 Ga0075428_100511381 Ga0075428_1005113812 167
382 3300006844 Ga0075428_100613521 Ga0075428_1006135212 167
383 3300006844 Ga0075428_100891427 Ga0075428_1008914272 167
384 3300006846 Ga0075430_100034771 Ga0075430_1000347715 167
385 3300006846 Ga0075430_100111568 Ga0075430_1001115684 167
386 3300006846 Ga0075430_100117403 Ga0075430_1001174033 167
387 3300006846 Ga0075430_100120148 Ga0075430_1001201483 167
388 3300006846 Ga0075430_100264947 Ga0075430_1002649472 167
389 3300006846 Ga0075430_100430637 Ga0075430_1004306372 167
390 3300006846 Ga0075430_100798270 Ga0075430_1007982701 167
391 3300006847 Ga0075431_100000115 Ga0075431_10000011557 167
392 3300006847 Ga0075431_100020362 Ga0075431_1000203622 167
393 3300006847 Ga0075431_100098904 Ga0075431_1000989042 167
394 3300006847 Ga0075431_100163197 Ga0075431_1001631973 167
395 3300006847 Ga0075431_100172684 Ga0075431_1001726842 167
396 3300006847 Ga0075431_100291566 Ga0075431_1002915662 167
397 3300006847 Ga0075431_100314368 Ga0075431_1003143682 167
398 3300006847 Ga0075431_100697601 Ga0075431_1006976011 167
399 3300006847 Ga0075431_101618479 Ga0075431_1016184791 167
400 3300006852 Ga0075433_10000462 Ga0075433_1000046219 167
401 3300006852 Ga0075433_10001928 Ga0075433_1000192811 167
402 3300006852 Ga0075433_10037250 Ga0075433_100372502 167
403 3300006852 Ga0075433_10041549 Ga0075433_100415494 167
404 3300006852 Ga0075433_10058168 Ga0075433_100581682 167
405 3300006852 Ga0075433_10067115 Ga0075433_100671153 167
406 3300006852 Ga0075433_10068278 Ga0075433_100682781 167
407 3300006852 Ga0075433_10172063 Ga0075433_101720632 167
408 3300006852 Ga0075433_10274364 Ga0075433_102743641 167
409 3300006852 Ga0075433_10295839 Ga0075433_102958392 167
410 3300006852 Ga0075433_10341060 Ga0075433_103410602 167
411 3300006852 Ga0075433_10341629 Ga0075433_103416292 167
412 3300006852 Ga0075433_10388788 Ga0075433_103887882 167
413 3300006871 Ga0075434_100000880 Ga0075434_1000008802 167
414 3300006871 Ga0075434_100002605 Ga0075434_1000026058 167
415 3300006871 Ga0075434_100005294 Ga0075434_1000052942 167
416 3300006871 Ga0075434_100010708 Ga0075434_1000107085 167
417 3300006871 Ga0075434_100026351 Ga0075434_1000263515 167
418 3300006871 Ga0075434_100038572 Ga0075434_1000385726 167
419 3300006871 Ga0075434_100116631 Ga0075434_1001166312 167
420 3300006871 Ga0075434_100236991 Ga0075434_1002369912 167
421 3300006871 Ga0075434_100280435 Ga0075434_1002804353 167
422 3300006871 Ga0075434_100322835 Ga0075434_1003228352 167
423 3300006871 Ga0075434_100435398 Ga0075434_1004353982 167
424 3300006871 Ga0075434_100437179 Ga0075434_1004371792 167
425 3300006880 Ga0075429_100002523 Ga0075429_10000252317 167
426 3300006880 Ga0075429_100027319 Ga0075429_1000273194 167
427 3300006880 Ga0075429_100072893 Ga0075429_1000728932 167
428 3300006880 Ga0075429_100078120 Ga0075429_1000781203 167
429 3300006880 Ga0075429_100093860 Ga0075429_1000938602 167
430 3300006880 Ga0075429_100376775 Ga0075429_1003767752 167
431 3300006880 Ga0075429_100612457 Ga0075429_1006124572 167
432 3300006880 Ga0075429_101137491 Ga0075429_1011374912 167
433 3300006914 Ga0075436_100000794 Ga0075436_1000007946 167
434 3300006914 Ga0075436_100005532 Ga0075436_1000055323 167
435 3300006914 Ga0075436_100058249 Ga0075436_1000582493 167
436 3300006914 Ga0075436_100060188 Ga0075436_1000601882 167
437 3300006914 Ga0075436_100096216 Ga0075436_1000962162 167
438 3300006914 Ga0075436_100319259 Ga0075436_1003192592 167
439 3300006914 Ga0075436_100380285 Ga0075436_1003802852 167
440 3300006914 Ga0075436_100445207 Ga0075436_1004452072 167
441 3300006914 Ga0075436_100497099 Ga0075436_1004970991 167
442 3300006931 Ga0097620_100001671 Ga0097620_1000016715 167
443 3300007076 Ga0075435_100010303 Ga0075435_1000103032 167
444 3300007076 Ga0075435_100010787 Ga0075435_1000107871 167
445 3300007076 Ga0075435_100019559 Ga0075435_1000195594 167
446 3300007076 Ga0075435_100021280 Ga0075435_1000212805 167
447 3300007076 Ga0075435_100091275 Ga0075435_1000912752 167
448 3300007076 Ga0075435_100322851 Ga0075435_1003228512 167
449 3300007076 Ga0075435_100431366 Ga0075435_1004313661 167
450 3300007076 Ga0075435_101091586 Ga0075435_1010915861 167
451 3300007076 Ga0075435_101377075 Ga0075435_1013770751 167
452 3300007265 Ga0099794_10000632 Ga0099794_100006326 167
453 3300007265 Ga0099794_10003812 Ga0099794_100038125 167
454 3300007265 Ga0099794_10245584 Ga0099794_102455842 167
455 3300009093 Ga0105240_10011436 Ga0105240_100114367 167
456 3300009094 Ga0111539_10028267 Ga0111539_100282678 167
457 3300009094 Ga0111539_10066793 Ga0111539_100667931 167
458 3300009094 Ga0111539_10149740 Ga0111539_101497403 167
459 3300009094 Ga0111539_11668044 Ga0111539_116680442 167
460 3300009098 Ga0105245_10055259 Ga0105245_100552594 167
461 3300009147 Ga0114129_10000579 Ga0114129_1000057912 167
462 3300009147 Ga0114129_10000660 Ga0114129_1000066026 167
463 3300009147 Ga0114129_10001117 Ga0114129_1000111712 167
464 3300009147 Ga0114129_10007096 Ga0114129_100070964 167
465 3300009147 Ga0114129_10010852 Ga0114129_1001085212 167
466 3300009147 Ga0114129_10012554 Ga0114129_100125542 167
467 3300009147 Ga0114129_10013814 Ga0114129_100138148 167
468 3300009147 Ga0114129_10022323 Ga0114129_100223237 167
469 3300009147 Ga0114129_10045709 Ga0114129_100457097 167
470 3300009147 Ga0114129_10058855 Ga0114129_100588557 167
471 3300009147 Ga0114129_10078113 Ga0114129_100781132 167
472 3300009147 Ga0114129_10130394 Ga0114129_101303944 167
473 3300009147 Ga0114129_10165946 Ga0114129_101659462 167
474 3300009147 Ga0114129_10422144 Ga0114129_104221442 167
475 3300009147 Ga0114129_10556449 Ga0114129_105564492 167
476 3300009147 Ga0114129_10639158 Ga0114129_106391581 167
477 3300009147 Ga0114129_10641260 Ga0114129_106412602 167
478 3300009147 Ga0114129_10768755 Ga0114129_107687552 167
479 3300009147 Ga0114129_10803680 Ga0114129_108036801 167
480 3300009147 Ga0114129_11289411 Ga0114129_112894111 167
481 3300009147 Ga0114129_12406158 Ga0114129_124061581 167
482 3300009148 Ga0105243_10143648 Ga0105243_101436482 167
483 3300009148 Ga0105243_10301041 Ga0105243_103010412 167
484 3300009174 Ga0105241_10000334 Ga0105241_1000033412 167
485 3300009174 Ga0105241_10071938 Ga0105241_100719382 167
486 3300009176 Ga0105242_10409516 Ga0105242_104095162 167
487 3300009545 Ga0105237_10004494 Ga0105237_100044942 167
488 3300009545 Ga0105237_10388258 Ga0105237_103882582 167
489 3300009551 Ga0105238_10047700 Ga0105238_100477004 167
490 3300009551 Ga0105238_10244327 Ga0105238_102443272 167
491 3300009553 Ga0105249_10169675 Ga0105249_101696754 167
492 3300009553 Ga0105249_10443414 Ga0105249_104434142 167
493 3300010375 Ga0105239_10001412 Ga0105239_1000141222 167
494 3300010375 Ga0105239_10053250 Ga0105239_100532505 167
495 3300011119 Ga0105246_10026943 Ga0105246_100269432 167
496 3300013100 Ga0157373_10000379 Ga0157373_1000037927 167
497 3300013102 Ga0157371_10039298 Ga0157371_100392982 167
498 3300013104 Ga0157370_10323644 Ga0157370_103236442 167
499 3300013105 Ga0157369_10081128 Ga0157369_100811281 167
500 3300013297 Ga0157378_10057421 Ga0157378_100574212 167
501 3300013306 Ga0163162_10124639 Ga0163162_101246395 167
502 3300013306 Ga0163162_10188421 Ga0163162_101884212 167
503 3300013306 Ga0163162_10775534 Ga0163162_107755342 167
504 3300013306 Ga0163162_10830298 Ga0163162_108302982 167
505 3300013307 Ga0157372_10000135 Ga0157372_1000013532 167
506 3300013308 Ga0157375_10278348 Ga0157375_102783482 167
507 3300013308 Ga0157375_10706441 Ga0157375_107064411 167
508 3300013308 Ga0157375_10782746 Ga0157375_107827462 167
509 3300013308 Ga0157375_10832000 Ga0157375_108320003 167
510 3300014325 Ga0163163_10366456 Ga0163163_103664561 167
511 3300014326 Ga0157380_10948723 Ga0157380_109487232 167
512 3300014968 Ga0157379_10942539 Ga0157379_109425392 167
513 3300025885 Ga0207653_10000475 Ga0207653_1000047511 167
514 3300025885 Ga0207653_10014279 Ga0207653_100142793 167
515 3300025893 Ga0207682_10183446 Ga0207682_101834462 167
516 3300025899 Ga0207642_10612783 Ga0207642_106127832 167
517 3300025901 Ga0207688_10005719 Ga0207688_100057192 167
518 3300025906 Ga0207699_11213662 Ga0207699_112136621 167
519 3300025907 Ga0207645_10000075 Ga0207645_1000007514 167
520 3300025908 Ga0207643_10001707 Ga0207643_100017079 167
521 3300025910 Ga0207684_10002659 Ga0207684_100026597 167
522 3300025910 Ga0207684_10004127 Ga0207684_100041279 167
523 3300025910 Ga0207684_10012194 Ga0207684_100121945 167
524 3300025910 Ga0207684_10019452 Ga0207684_100194521 167
525 3300025910 Ga0207684_10046737 Ga0207684_100467373 167
526 3300025910 Ga0207684_10114982 Ga0207684_101149821 167
527 3300025910 Ga0207684_10223533 Ga0207684_102235332 167
528 3300025910 Ga0207684_10263126 Ga0207684_102631262 167
529 3300025910 Ga0207684_10271758 Ga0207684_102717582 167
530 3300025910 Ga0207684_10432701 Ga0207684_104327012 167
531 3300025910 Ga0207684_10623159 Ga0207684_106231591 167
532 3300025910 Ga0207684_10918797 Ga0207684_109187971 167
533 3300025910 Ga0207684_11356425 Ga0207684_113564251 167
534 3300025911 Ga0207654_10001071 Ga0207654_100010714 167
535 3300025911 Ga0207654_10395359 Ga0207654_103953592 167
536 3300025912 Ga0207707_10000135 Ga0207707_1000013528 167
537 3300025913 Ga0207695_10043920 Ga0207695_100439202 167
538 3300025914 Ga0207671_10004038 Ga0207671_100040382 167
539 3300025915 Ga0207693_10037917 Ga0207693_100379176 167
540 3300025915 Ga0207693_10331980 Ga0207693_103319802 167
541 3300025917 Ga0207660_10000688 Ga0207660_100006889 167
542 3300025919 Ga0207657_10000037 Ga0207657_1000003784 167
543 3300025920 Ga0207649_10001481 Ga0207649_100014812 167
544 3300025921 Ga0207652_10002292 Ga0207652_1000229211 167
545 3300025922 Ga0207646_10004177 Ga0207646_100041779 167
546 3300025922 Ga0207646_10052068 Ga0207646_100520683 167
547 3300025922 Ga0207646_10061177 Ga0207646_100611773 167
548 3300025922 Ga0207646_10110405 Ga0207646_101104053 167
549 3300025922 Ga0207646_10236028 Ga0207646_102360282 167
550 3300025922 Ga0207646_10340384 Ga0207646_103403842 167
551 3300025923 Ga0207681_10023557 Ga0207681_100235572 167
552 3300025923 Ga0207681_10197471 Ga0207681_101974713 167
553 3300025923 Ga0207681_10371651 Ga0207681_103716512 167
554 3300025924 Ga0207694_10026132 Ga0207694_100261324 167
555 3300025925 Ga0207650_10012455 Ga0207650_100124552 167
556 3300025925 Ga0207650_10653235 Ga0207650_106532351 167
557 3300025927 Ga0207687_10541448 Ga0207687_105414482 167
558 3300025931 Ga0207644_10901903 Ga0207644_109019031 167
559 3300025932 Ga0207690_10000562 Ga0207690_100005626 167
560 3300025933 Ga0207706_10011250 Ga0207706_100112507 167
561 3300025935 Ga0207709_10046732 Ga0207709_100467324 167
562 3300025935 Ga0207709_10084208 Ga0207709_100842082 167
563 3300025935 Ga0207709_10918305 Ga0207709_109183051 167
564 3300025939 Ga0207665_10000576 Ga0207665_1000057616 167
565 3300025940 Ga0207691_10124866 Ga0207691_101248661 167
566 3300025942 Ga0207689_10000029 Ga0207689_1000002958 167
567 3300025942 Ga0207689_10015346 Ga0207689_100153462 167
568 3300025942 Ga0207689_10827499 Ga0207689_108274992 167
569 3300025945 Ga0207679_10003224 Ga0207679_100032243 167
570 3300025949 Ga0207667_10000652 Ga0207667_1000065226 167
571 3300025949 Ga0207667_10039416 Ga0207667_100394162 167
572 3300025961 Ga0207712_10195752 Ga0207712_101957522 167
573 3300025961 Ga0207712_10210273 Ga0207712_102102732 167
574 3300025972 Ga0207668_10161578 Ga0207668_101615783 167
575 3300025972 Ga0207668_10822658 Ga0207668_108226582 167
576 3300025972 Ga0207668_10976694 Ga0207668_109766941 167
577 3300025981 Ga0207640_10008161 Ga0207640_100081612 167
578 3300025986 Ga0207658_10494166 Ga0207658_104941661 167
579 3300026023 Ga0207677_10378040 Ga0207677_103780402 167
580 3300026035 Ga0207703_10049558 Ga0207703_100495581 167
581 3300026041 Ga0207639_10002456 Ga0207639_100024563 167
582 3300026041 Ga0207639_11573387 Ga0207639_115733871 167
583 3300026067 Ga0207678_10017042 Ga0207678_100170423 167
584 3300026078 Ga0207702_10014520 Ga0207702_100145204 167
585 3300026088 Ga0207641_10065290 Ga0207641_100652903 167
586 3300026088 Ga0207641_10336511 Ga0207641_103365112 167
587 3300026088 Ga0207641_10391033 Ga0207641_103910332 167
588 3300026089 Ga0207648_10000552 Ga0207648_1000055221 167
589 3300026089 Ga0207648_10239374 Ga0207648_102393742 167
590 3300026095 Ga0207676_10030650 Ga0207676_100306502 167
591 3300026116 Ga0207674_10000306 Ga0207674_1000030643 167
592 3300026118 Ga0207675_100370393 Ga0207675_1003703931 167
593 3300026118 Ga0207675_101174561 Ga0207675_1011745612 167
594 3300026118 Ga0207675_101943093 Ga0207675_1019430931 167
595 3300026142 Ga0207698_10653220 Ga0207698_106532202 167
596 3300027360 Ga0209969_1019686 Ga0209969_10196861 167
597 3300027364 Ga0209967_1019363 Ga0209967_10193632 167
598 3300027378 Ga0209981_1010822 Ga0209981_10108222 167
599 3300027395 Ga0209996_1002549 Ga0209996_10025491 167
600 3300027424 Ga0209984_1013550 Ga0209984_10135502 167
601 3300027471 Ga0209995_1000572 Ga0209995_10005725 167
602 3300027543 Ga0209999_1003314 Ga0209999_10033142 167
603 3300027552 Ga0209982_1003328 Ga0209982_10033282 167
604 3300027617 Ga0210002_1052629 Ga0210002_10526291 167
605 3300027665 Ga0209983_1003456 Ga0209983_10034562 167
606 3300027671 Ga0209588_1011038 Ga0209588_10110383 167
607 3300027671 Ga0209588_1011602 Ga0209588_10116022 167
608 3300027682 Ga0209971_1000008 Ga0209971_100000890 167
609 3300027695 Ga0209966_1000187 Ga0209966_100018715 167
610 3300027717 Ga0209998_10000016 Ga0209998_1000001612 167
611 3300027717 Ga0209998_10112186 Ga0209998_101121861 167
612 3300027876 Ga0209974_10001677 Ga0209974_100016777 167
613 3300027907 Ga0207428_10000168 Ga0207428_1000016833 167
614 3300027907 Ga0207428_10034267 Ga0207428_100342674 167
615 3300027907 Ga0207428_10057266 Ga0207428_100572663 167
616 3300028379 Ga0268266_10907194 Ga0268266_109071942 167
617 3300028380 Ga0268265_10006105 Ga0268265_100061057 167
618 3300028380 Ga0268265_10045245 Ga0268265_100452453 167
619 3300028380 Ga0268265_10207679 Ga0268265_102076791 167
620 3300028380 Ga0268265_11335589 Ga0268265_113355892 167
621 3300028381 Ga0268264_10029733 Ga0268264_100297334 167
622 3300028381 Ga0268264_10101170 Ga0268264_101011703 167
623 3300028381 Ga0268264_10235077 Ga0268264_102350772 167
624 3300028381 Ga0268264_10355789 Ga0268264_103557891 167
625 3300028381 Ga0268264_10688324 Ga0268264_106883242 167
626 3300028381 Ga0268264_12388443 Ga0268264_123884431 167
627 3300031249 Ga0265339_10000272 Ga0265339_100002726 167
628 3300031250 Ga0265331_10015837 Ga0265331_100158373 167
629 3300031250 Ga0265331_10064532 Ga0265331_100645322 167
630 3300031251 Ga0265327_10034314 Ga0265327_100343142 167
631 3300031711 Ga0265314_10001254 Ga0265314_1000125422 167
632 3300031712 Ga0265342_10005494 Ga0265342_100054949 167
633 3300031903 Ga0307407_10450038 Ga0307407_104500382 167
634 3300032004 Ga0307414_11262789 Ga0307414_112627891 167
635 3300035088 Ga0373940_0001428 Ga0373940_0001428_1838_2341 167
636 3300035088 Ga0373940_0038110 Ga0373940_0038110_101_604 167
637 3300035088 Ga0373940_0255079 Ga0373940_0255079_33_536 167
638 3300035090 Ga0373949_0060558 Ga0373949_0060558_122_625 167
639 3300035090 Ga0373949_0087502 Ga0373949_0087502_304_807 167
640 3300035091 Ga0373951_0003456 Ga0373951_0003456_150_653 167
641 3300035091 Ga0373951_0067232 Ga0373951_0067232_386_889 167
642 3300035112 Ga0373932_0036242 Ga0373932_0036242_635_1138 167
643 3300035114 Ga0373939_0029981 Ga0373939_0029981_491_994 167
644 3300035115 Ga0373941_0048262 Ga0373941_0048262_658_1161 167
645 3300035115 Ga0373941_0090214 Ga0373941_0090214_429_932 167
646 3300035121 Ga0373960_0194574 Ga0373960_0194574_105_608 167
647 3300035241 Ga0373961_0126002 Ga0373961_0126002_288_791 167
648 3300037466 Ga0395898_0479204 Ga0395898_0479204_237_740 167
649 3300038443 Ga0395901_0030735 Ga0395901_0030735_3570_4073 167
650 3300038996 Ga0242420_012045 Ga0242420_012045_922_1425 167
651 3300042005 Ga0439448_0002671 Ga0439448_0002671_1667_2170 167
652 3300042005 Ga0439448_0009011 Ga0439448_0009011_2227_2730 167
653 3300042012 Ga0439455_0019004 Ga0439455_0019004_666_1169 167
654 3300042012 Ga0439455_0020883 Ga0439455_0020883_790_1293 167
655 3300042157 Ga0439458_0086836 Ga0439458_0086836_64_567 167
656 3300042438 Ga0439459_0012960 Ga0439459_0012960_886_1389 167
657 3300042439 Ga0439464_0002224 Ga0439464_0002224_2304_2807 167
658 3300042876 Ga0451577_0009451 Ga0451577_0009451_151_654 167
659 3300042876 Ga0451577_0056879 Ga0451577_0056879_1994_2497 167
660 3300042876 Ga0451577_0428341 Ga0451577_0428341_342_845 167
661 3300042993 Ga0439440_0108366 Ga0439440_0108366_102_605 167
662 3300044712 Ga0453684_0073068 Ga0453684_0073068_3493_3996 167
663 3300044712 Ga0453684_0703299 Ga0453684_0703299_255_758 167
664 3300044712 Ga0453684_0797419 Ga0453684_0797419_250_753 167
665 3300045051 Ga0451576_0017221 Ga0451576_0017221_4361_4864 167
666 3300045051 Ga0451576_0023457 Ga0451576_0023457_1864_2367 167
667 3300045051 Ga0451576_0179161 Ga0451576_0179161_775_1278 167
668 3300045051 Ga0451576_0685697 Ga0451576_0685697_533_1036 167
669 3300045051 Ga0451576_0991665 Ga0451576_0991665_361_864 167
670 3300045051 Ga0451576_1197066 Ga0451576_1197066_74_577 167
671 3300045051 Ga0451576_1297684 Ga0451576_1297684_43_546 167
672 3300046472 Ga0495580_0001207 Ga0495580_0001207_11134_11637 167
673 3300046472 Ga0495580_0004677 Ga0495580_0004677_5730_6233 167
674 3300046472 Ga0495580_0010780 Ga0495580_0010780_6418_6921 167
675 3300046472 Ga0495580_0335090 Ga0495580_0335090_440_943 167
676 3300046472 Ga0495580_0368641 Ga0495580_0368641_154_657 167
677 3300046683 Ga0495658_0770757 Ga0495658_0770757_38_541 167
678 3300046684 Ga0495669_0445186 Ga0495669_0445186_85_588 167
679 3300046691 Ga0495670_0244918 Ga0495670_0244918_302_805 167
680 3300047318 Ga0495636_0011896 Ga0495636_0011896_1628_2131 167
681 3300048905 Ga0496102_0065144 Ga0496102_0065144_22_525 167
682 3300048907 Ga0496104_0213573 Ga0496104_0213573_1164_1736 167
683 3300048907 Ga0496104_0361093 Ga0496104_0361093_823_1326 167
684 3300048908 Ga0496105_0932002 Ga0496105_0932002_32_604 167
685 3300048909 Ga0496106_0021548 Ga0496106_0021548_3480_3983 167
686 3300048909 Ga0496106_0358269 Ga0496106_0358269_363_866 167
687 3300048915 Ga0496112_0132512 Ga0496112_0132512_1733_2236 167
688 3300048920 Ga0496117_0109075 Ga0496117_0109075_1188_1691 167
689 3300048921 Ga0496118_0098363 Ga0496118_0098363_1469_1972 167
690 3300048924 Ga0496121_0000430 Ga0496121_0000430_53004_53507 167
691 3300048924 Ga0496121_0002278 Ga0496121_0002278_17250_17753 167
692 3300048924 Ga0496121_0144076 Ga0496121_0144076_289_852 167
693 3300049568 Ga0501031_0227111 Ga0501031_0227111_419_922 167
694 3300049568 Ga0501031_0368448 Ga0501031_0368448_339_842 167
695 3300049568 Ga0501031_0398171 Ga0501031_0398171_12_515 167
696 3300049569 Ga0501032_0016172 Ga0501032_0016172_841_1344 167
697 3300049569 Ga0501032_0095916 Ga0501032_0095916_1278_1781 167
698 3300049570 Ga0501033_0101533 Ga0501033_0101533_691_1194 167
699 3300049570 Ga0501033_0101645 Ga0501033_0101645_342_845 167
700 3300049570 Ga0501033_0187517 Ga0501033_0187517_642_1145 167
701 3300049571 Ga0501034_0577509 Ga0501034_0577509_346_849 167
702 3300049572 Ga0501036_0038579 Ga0501036_0038579_3299_3802 167
703 3300049572 Ga0501036_0084753 Ga0501036_0084753_671_1174 167
704 3300049572 Ga0501036_0158070 Ga0501036_0158070_1113_1616 167
705 3300049572 Ga0501036_0275058 Ga0501036_0275058_69_572 167
706 3300049572 Ga0501036_0440288 Ga0501036_0440288_79_690 167
707 3300049572 Ga0501036_0987017 Ga0501036_0987017_152_655 167
708 3300049573 Ga0501037_0045057 Ga0501037_0045057_566_1069 167
709 3300049573 Ga0501037_0047461 Ga0501037_0047461_449_952 167
710 3300049574 Ga0501038_0053638 Ga0501038_0053638_2689_3192 167
711 3300049574 Ga0501038_0059039 Ga0501038_0059039_2595_3098 167
712 3300049574 Ga0501038_0283912 Ga0501038_0283912_110_613 167
713 3300049574 Ga0501038_0750782 Ga0501038_0750782_154_657 167
714 3300049575 Ga0501039_0128383 Ga0501039_0128383_832_1335 167
715 3300049575 Ga0501039_0132666 Ga0501039_0132666_1312_1815 167
716 3300049575 Ga0501039_0737542 Ga0501039_0737542_157_660 167
717 3300049576 Ga0501040_0001982 Ga0501040_0001982_5125_5628 167
718 3300049576 Ga0501040_0024722 Ga0501040_0024722_461_964 167
719 3300049576 Ga0501040_0058584 Ga0501040_0058584_1780_2394 167
720 3300049576 Ga0501040_0231663 Ga0501040_0231663_220_723 167
721 3300049576 Ga0501040_0662906 Ga0501040_0662906_80_583 167
722 3300049576 Ga0501040_0697913 Ga0501040_0697913_193_696 167
723 3300049577 Ga0501041_0010994 Ga0501041_0010994_2240_2743 167
724 3300049577 Ga0501041_0267676 Ga0501041_0267676_154_657 167
725 3300049578 Ga0501042_0007810 Ga0501042_0007810_6464_6967 167
726 3300049578 Ga0501042_0066372 Ga0501042_0066372_2009_2512 167
727 3300049578 Ga0501042_0070864 Ga0501042_0070864_1797_2300 167
728 3300049578 Ga0501042_0095081 Ga0501042_0095081_827_1330 167
729 3300049578 Ga0501042_0241775 Ga0501042_0241775_690_1193 167
730 3300049578 Ga0501042_0420492 Ga0501042_0420492_102_605 167
731 3300049578 Ga0501042_0486119 Ga0501042_0486119_234_737 167
732 3300049579 Ga0501043_0011980 Ga0501043_0011980_1568_2071 167
733 3300049579 Ga0501043_0066858 Ga0501043_0066858_1228_1731 167
734 3300049579 Ga0501043_0611521 Ga0501043_0611521_282_785 167
735 3300049580 Ga0501046_0009495 Ga0501046_0009495_7542_8045 167
736 3300049580 Ga0501046_0152707 Ga0501046_0152707_602_1105 167
737 3300049580 Ga0501046_0238257 Ga0501046_0238257_28_531 167
738 3300049580 Ga0501046_0256518 Ga0501046_0256518_286_852 167
739 3300049580 Ga0501046_0851809 Ga0501046_0851809_32_535 167
740 3300049581 Ga0501047_0169163 Ga0501047_0169163_1534_2037 167
741 3300049582 Ga0501048_0605348 Ga0501048_0605348_122_625 167
742 3300049582 Ga0501048_1094094 Ga0501048_1094094_13_516 167
743 3300049584 Ga0501068_0014188 Ga0501068_0014188_4019_4522 167
744 3300049584 Ga0501068_0049838 Ga0501068_0049838_1332_1835 167
745 3300049584 Ga0501068_0153763 Ga0501068_0153763_833_1336 167
746 3300049584 Ga0501068_0195957 Ga0501068_0195957_172_675 167
747 3300049585 Ga0501069_0230676 Ga0501069_0230676_323_826 167
748 3300049586 Ga0501070_0017134 Ga0501070_0017134_3616_4119 167
749 3300049587 Ga0501071_0344228 Ga0501071_0344228_460_963 167
750 3300049587 Ga0501071_0367589 Ga0501071_0367589_479_982 167
751 3300049587 Ga0501071_0376801 Ga0501071_0376801_297_896 167
752 3300049587 Ga0501071_0550587 Ga0501071_0550587_210_713 167
753 3300049587 Ga0501071_0552428 Ga0501071_0552428_195_698 167
754 3300049587 Ga0501071_0962108 Ga0501071_0962108_141_644 167
755 3300049588 Ga0501072_0030312 Ga0501072_0030312_2634_3137 167
756 3300049588 Ga0501072_0041657 Ga0501072_0041657_1899_2465 167
757 3300049588 Ga0501072_0083194 Ga0501072_0083194_413_916 167
758 3300049588 Ga0501072_0181939 Ga0501072_0181939_988_1491 167
759 3300049588 Ga0501072_0293209 Ga0501072_0293209_324_845 167
760 3300049588 Ga0501072_0804161 Ga0501072_0804161_187_690 167
761 3300049589 Ga0501073_0067235 Ga0501073_0067235_1621_2124 167
762 3300049589 Ga0501073_0612758 Ga0501073_0612758_147_650 167
763 3300049589 Ga0501073_1090340 Ga0501073_1090340_17_520 167
764 3300049590 Ga0501074_0002117 Ga0501074_0002117_6727_7230 167
765 3300049590 Ga0501074_0009550 Ga0501074_0009550_5476_5979 167
766 3300049590 Ga0501074_0035025 Ga0501074_0035025_1626_2129 167
767 3300049591 Ga0501075_0004974 Ga0501075_0004974_8475_8978 167
768 3300049591 Ga0501075_0019228 Ga0501075_0019228_717_1220 167
769 3300049591 Ga0501075_0068760 Ga0501075_0068760_1499_2110 167
770 3300049591 Ga0501075_0106259 Ga0501075_0106259_471_974 167
771 3300049591 Ga0501075_0510221 Ga0501075_0510221_115_618 167
772 3300049592 Ga0501076_0022605 Ga0501076_0022605_2795_3394 167
773 3300049592 Ga0501076_0063606 Ga0501076_0063606_2271_2882 167
774 3300049592 Ga0501076_0483273 Ga0501076_0483273_404_907 167
775 3300049592 Ga0501076_0565617 Ga0501076_0565617_222_725 167
776 3300049592 Ga0501076_0807125 Ga0501076_0807125_176_679 167
777 3300049592 Ga0501076_0907176 Ga0501076_0907176_160_663 167
778 3300049592 Ga0501076_0961380 Ga0501076_0961380_17_520 167
779 3300049593 Ga0501077_0006466 Ga0501077_0006466_1353_1856 167
780 3300049593 Ga0501077_0021397 Ga0501077_0021397_2516_3115 167
781 3300049593 Ga0501077_0022849 Ga0501077_0022849_3079_3582 167
782 3300049593 Ga0501077_0075484 Ga0501077_0075484_1255_1758 167
783 3300049593 Ga0501077_0091515 Ga0501077_0091515_1142_1645 167
784 3300049593 Ga0501077_0106373 Ga0501077_0106373_953_1456 167
785 3300049593 Ga0501077_0127584 Ga0501077_0127584_1000_1503 167
786 3300049593 Ga0501077_0206723 Ga0501077_0206723_487_990 167
787 3300049593 Ga0501077_0210938 Ga0501077_0210938_658_1161 167
788 3300049741 Ga0501079_0035033 Ga0501079_0035033_1047_1550 167
789 3300049741 Ga0501079_0047343 Ga0501079_0047343_103_606 167
790 3300049741 Ga0501079_0237604 Ga0501079_0237604_20_619 167
791 3300049741 Ga0501079_0524792 Ga0501079_0524792_188_754 167
792 3300049741 Ga0501079_0747879 Ga0501079_0747879_157_660 167
793 3300049741 Ga0501079_1153390 Ga0501079_1153390_80_583 167
794 3300049742 Ga0501080_0020720 Ga0501080_0020720_4286_4789 167
795 3300049743 Ga0501081_0002082 Ga0501081_0002082_3985_4488 167
796 3300049743 Ga0501081_0003624 Ga0501081_0003624_2356_2859 167
797 3300049743 Ga0501081_0008158 Ga0501081_0008158_2998_3501 167
798 3300049743 Ga0501081_0022821 Ga0501081_0022821_1203_1706 167
799 3300049743 Ga0501081_0038357 Ga0501081_0038357_485_1051 167
800 3300049743 Ga0501081_0135486 Ga0501081_0135486_1183_1686 167
801 3300049743 Ga0501081_0135859 Ga0501081_0135859_323_934 167
802 3300049743 Ga0501081_0240198 Ga0501081_0240198_211_714 167
803 3300049743 Ga0501081_0268233 Ga0501081_0268233_698_1201 167
804 3300049743 Ga0501081_0304890 Ga0501081_0304890_304_807 167
805 3300049743 Ga0501081_0436468 Ga0501081_0436468_172_675 167
806 3300049743 Ga0501081_0455201 Ga0501081_0455201_142_645 167
807 3300049743 Ga0501081_0498605 Ga0501081_0498605_65_568 167
808 3300049743 Ga0501081_0574039 Ga0501081_0574039_40_543 167
809 3300049743 Ga0501081_0697597 Ga0501081_0697597_246_749 167
810 3300049744 Ga0501083_0002379 Ga0501083_0002379_424_927 167
811 3300049744 Ga0501083_0016181 Ga0501083_0016181_2475_2978 167
812 3300049744 Ga0501083_0065498 Ga0501083_0065498_10_513 167
813 3300049744 Ga0501083_0100367 Ga0501083_0100367_434_937 167
814 3300049744 Ga0501083_0224680 Ga0501083_0224680_678_1181 167
815 3300049822 Ga0501035_0015418 Ga0501035_0015418_1059_1562 167
816 3300049822 Ga0501035_0202571 Ga0501035_0202571_49_552 167
817 3300049822 Ga0501035_1005054 Ga0501035_1005054_73_576 167
818 3300049823 Ga0501044_0000121 Ga0501044_0000121_64327_64830 167
819 3300049823 Ga0501044_0009312 Ga0501044_0009312_6180_6683 167
820 3300049824 Ga0501045_0000998 Ga0501045_0000998_8903_9406 167
821 3300049824 Ga0501045_0015358 Ga0501045_0015358_318_821 167
822 3300049824 Ga0501045_0018759 Ga0501045_0018759_2055_2558 167
823 3300049824 Ga0501045_0160548 Ga0501045_0160548_420_923 167
824 3300049824 Ga0501045_0217455 Ga0501045_0217455_294_797 167
825 3300049824 Ga0501045_0264455 Ga0501045_0264455_110_613 167
826 3300049824 Ga0501045_0520429 Ga0501045_0520429_207_710 167
827 3300049824 Ga0501045_0541002 Ga0501045_0541002_213_779 167
828 3300049824 Ga0501045_0724879 Ga0501045_0724879_109_612 167
829 3300050507 nmdc:mga05p37_1087355_c1 nmdc:mga05p37_1087355_c1_226_729 167
830 3300050507 nmdc:mga05p37_1239306_c1 nmdc:mga05p37_1239306_c1_85_588 167
831 3300050507 nmdc:mga05p37_1447_c1 nmdc:mga05p37_1447_c1_1264_1770 167
832 3300050507 nmdc:mga05p37_1453785_c1 nmdc:mga05p37_1453785_c1_106_609 167
833 3300050507 nmdc:mga05p37_165552_c1 nmdc:mga05p37_165552_c1_1234_1737 167
834 3300050507 nmdc:mga05p37_1713740_c1 nmdc:mga05p37_1713740_c1_15_518 167
835 3300050507 nmdc:mga05p37_26490_c1 nmdc:mga05p37_26490_c1_1417_1920 167
836 3300050507 nmdc:mga05p37_279370_c1 nmdc:mga05p37_279370_c1_721_1224 167
837 3300050507 nmdc:mga05p37_32437_c1 nmdc:mga05p37_32437_c1_4321_4914 167
838 3300050507 nmdc:mga05p37_32456_c1 nmdc:mga05p37_32456_c1_5742_6245 167
839 3300050507 nmdc:mga05p37_388525_c1 nmdc:mga05p37_388525_c1_467_970 167
840 3300050507 nmdc:mga05p37_399654_c1 nmdc:mga05p37_399654_c1_1029_1532 167
841 3300050507 nmdc:mga05p37_4034_c1 nmdc:mga05p37_4034_c1_1929_2432 167
842 3300050507 nmdc:mga05p37_404716_c1 nmdc:mga05p37_404716_c1_404_907 167
843 3300050507 nmdc:mga05p37_415226_c1 nmdc:mga05p37_415226_c1_665_1168 167
844 3300050507 nmdc:mga05p37_52253_c1 nmdc:mga05p37_52253_c1_4496_4999 167
845 3300050507 nmdc:mga05p37_628967_c1 nmdc:mga05p37_628967_c1_222_728 167
846 3300050507 nmdc:mga05p37_633658_c1 nmdc:mga05p37_633658_c1_561_1064 167
847 3300050507 nmdc:mga05p37_67090_c1 nmdc:mga05p37_67090_c1_1775_2278 167
848 3300050507 nmdc:mga05p37_68146_c1 nmdc:mga05p37_68146_c1_3233_3739 167
849 3300050507 nmdc:mga05p37_702_c1 nmdc:mga05p37_702_c1_28148_28654 167
850 3300050507 nmdc:mga05p37_98891_c1 nmdc:mga05p37_98891_c1_2401_2904 167
851 3300050508 nmdc:mga09592_30955_c1 nmdc:mga09592_30955_c1_1967_2470 167
852 3300050508 nmdc:mga09592_324884_c1 nmdc:mga09592_324884_c1_523_1026 167
853 3300050508 nmdc:mga09592_448901_c1 nmdc:mga09592_448901_c1_175_678 167
854 3300050508 nmdc:mga09592_50504_c1 nmdc:mga09592_50504_c1_140_643 167
855 3300050508 nmdc:mga09592_711441_c1 nmdc:mga09592_711441_c1_331_837 167
856 3300050508 nmdc:mga09592_774126_c1 nmdc:mga09592_774126_c1_35_538 167
857 3300050508 nmdc:mga09592_82262_c1 nmdc:mga09592_82262_c1_1997_2590 167
858 3300050508 nmdc:mga09592_856738_c1 nmdc:mga09592_856738_c1_86_589 167
859 3300050508 nmdc:mga09592_9034_c1 nmdc:mga09592_9034_c1_1759_2265 167
860 3300050508 nmdc:mga09592_917271_c1 nmdc:mga09592_917271_c1_54_557 167
861 3300050509 nmdc:mga0qj67_503823_c1 nmdc:mga0qj67_503823_c1_72_578 167
862 3300050509 nmdc:mga0qj67_683630_c1 nmdc:mga0qj67_683630_c1_119_622 167
863 3300050509 nmdc:mga0qj67_729772_c1 nmdc:mga0qj67_729772_c1_145_648 167
864 3300050509 nmdc:mga0qj67_92821_c1 nmdc:mga0qj67_92821_c1_1238_1741 167
865 3300050509 nmdc:mga0qj67_98912_c1 nmdc:mga0qj67_98912_c1_1445_1948 167
866 3300050510 nmdc:mga06r32_1052242_c1 nmdc:mga06r32_1052242_c1_229_732 167
867 3300050510 nmdc:mga06r32_112856_c1 nmdc:mga06r32_112856_c1_273_779 167
868 3300050510 nmdc:mga06r32_155934_c1 nmdc:mga06r32_155934_c1_1484_1987 167
869 3300050510 nmdc:mga06r32_196063_c1 nmdc:mga06r32_196063_c1_568_1071 167
870 3300050511 nmdc:mga08y16_1106_c1 nmdc:mga08y16_1106_c1_4950_5453 167
871 3300050511 nmdc:mga08y16_337312_c1 nmdc:mga08y16_337312_c1_526_1029 167
872 3300050511 nmdc:mga08y16_36954_c1 nmdc:mga08y16_36954_c1_3746_4249 167
873 3300050511 nmdc:mga08y16_382488_c1 nmdc:mga08y16_382488_c1_674_1177 167
874 3300050512 nmdc:mga0n895_11260_c1 nmdc:mga0n895_11260_c1_4251_4754 167
875 3300050512 nmdc:mga0n895_13403_c1 nmdc:mga0n895_13403_c1_4116_4709 167
876 3300050512 nmdc:mga0n895_17372_c1 nmdc:mga0n895_17372_c1_3050_3553 167
877 3300050512 nmdc:mga0n895_186_c1 nmdc:mga0n895_186_c1_21047_21553 167
878 3300050512 nmdc:mga0n895_209879_c1 nmdc:mga0n895_209879_c1_1106_1609 167
879 3300050512 nmdc:mga0n895_22584_c1 nmdc:mga0n895_22584_c1_4307_4810 167
880 3300050512 nmdc:mga0n895_241132_c1 nmdc:mga0n895_241132_c1_868_1371 167
881 3300050512 nmdc:mga0n895_308962_c1 nmdc:mga0n895_308962_c1_866_1369 167
882 3300050512 nmdc:mga0n895_386948_c1 nmdc:mga0n895_386948_c1_569_1072 167
883 3300050512 nmdc:mga0n895_436907_c1 nmdc:mga0n895_436907_c1_604_1107 167
884 3300050512 nmdc:mga0n895_452584_c1 nmdc:mga0n895_452584_c1_290_793 167
885 3300050512 nmdc:mga0n895_5330_c1 nmdc:mga0n895_5330_c1_1378_1881 167
886 3300050512 nmdc:mga0n895_5865_c1 nmdc:mga0n895_5865_c1_3606_4109 167
887 3300050512 nmdc:mga0n895_688210_c1 nmdc:mga0n895_688210_c1_470_973 167
888 3300050513 nmdc:mga0rr50_121958_c1 nmdc:mga0rr50_121958_c1_1159_1662 167
889 3300050513 nmdc:mga0rr50_13486_c1 nmdc:mga0rr50_13486_c1_3608_4111 167
890 3300050513 nmdc:mga0rr50_224656_c1 nmdc:mga0rr50_224656_c1_555_1058 167
891 3300050513 nmdc:mga0rr50_458468_c1 nmdc:mga0rr50_458468_c1_112_615 167
892 3300050513 nmdc:mga0rr50_55930_c1 nmdc:mga0rr50_55930_c1_2009_2512 167
893 3300050513 nmdc:mga0rr50_629_c1 nmdc:mga0rr50_629_c1_10498_11004 167
894 3300050513 nmdc:mga0rr50_7815_c1 nmdc:mga0rr50_7815_c1_670_1263 167
895 3300050513 nmdc:mga0rr50_91183_c1 nmdc:mga0rr50_91183_c1_47_550 167
896 3300050513 nmdc:mga0rr50_99206_c1 nmdc:mga0rr50_99206_c1_1205_1708 167
897 3300050514 nmdc:mga08x19_315205_c1 nmdc:mga08x19_315205_c1_398_901 167
898 3300050514 nmdc:mga08x19_379302_c1 nmdc:mga08x19_379302_c1_314_817 167
899 3300050514 nmdc:mga08x19_44987_c1 nmdc:mga08x19_44987_c1_991_1494 167
900 3300050514 nmdc:mga08x19_55183_c1 nmdc:mga08x19_55183_c1_1109_1612 167
901 3300050514 nmdc:mga08x19_65730_c1 nmdc:mga08x19_65730_c1_303_806 167
902 3300050514 nmdc:mga08x19_90121_c1 nmdc:mga08x19_90121_c1_868_1371 167
903 3300050515 nmdc:mga0a205_135357_c1 nmdc:mga0a205_135357_c1_1521_2024 167
904 3300050515 nmdc:mga0a205_17686_c1 nmdc:mga0a205_17686_c1_4449_5042 167
905 3300050515 nmdc:mga0a205_182897_c1 nmdc:mga0a205_182897_c1_937_1440 167
906 3300050515 nmdc:mga0a205_206867_c1 nmdc:mga0a205_206867_c1_272_775 167
907 3300050515 nmdc:mga0a205_215435_c1 nmdc:mga0a205_215435_c1_104_607 167
908 3300050515 nmdc:mga0a205_216785_c1 nmdc:mga0a205_216785_c1_788_1291 167
909 3300050515 nmdc:mga0a205_233741_c1 nmdc:mga0a205_233741_c1_518_1021 167
910 3300050515 nmdc:mga0a205_245503_c1 nmdc:mga0a205_245503_c1_103_606 167
911 3300050515 nmdc:mga0a205_250874_c1 nmdc:mga0a205_250874_c1_343_846 167
912 3300050515 nmdc:mga0a205_2643_c1 nmdc:mga0a205_2643_c1_12616_13119 167
913 3300050515 nmdc:mga0a205_265783_c1 nmdc:mga0a205_265783_c1_997_1500 167
914 3300050515 nmdc:mga0a205_289770_c1 nmdc:mga0a205_289770_c1_477_980 167
915 3300050515 nmdc:mga0a205_358159_c1 nmdc:mga0a205_358159_c1_306_809 167
916 3300050515 nmdc:mga0a205_4159_c1 nmdc:mga0a205_4159_c1_355_861 167
917 3300050515 nmdc:mga0a205_49373_c1 nmdc:mga0a205_49373_c1_1583_2086 167
918 3300050515 nmdc:mga0a205_523029_c1 nmdc:mga0a205_523029_c1_292_795 167
919 3300050515 nmdc:mga0a205_564550_c1 nmdc:mga0a205_564550_c1_150_653 167
920 3300050515 nmdc:mga0a205_83386_c1 nmdc:mga0a205_83386_c1_1369_1875 167
921 3300054114 Ga0501084_0014517 Ga0501084_0014517_6000_6503 167
922 3300054114 Ga0501084_0033887 Ga0501084_0033887_3079_3582 167
923 3300054114 Ga0501084_0187345 Ga0501084_0187345_1091_1594 167
924 3300054114 Ga0501084_0279110 Ga0501084_0279110_696_1199 167
925 3300054114 Ga0501084_0290440 Ga0501084_0290440_341_844 167
926 3300054114 Ga0501084_0321313 Ga0501084_0321313_711_1214 167
927 3300054114 Ga0501084_0425833 Ga0501084_0425833_169_735 167
928 3300054114 Ga0501084_0879269 Ga0501084_0879269_23_526 167
929 3300059424 Ga0590075_011669 Ga0590075_011669_1087_1590 167
930 3300059426 Ga0590077_065822 Ga0590077_065822_224_727 167
931 3300060353 Ga0501082_0001040 Ga0501082_0001040_10744_11247 167
932 3300060353 Ga0501082_0002202 Ga0501082_0002202_6253_6756 167
933 3300060353 Ga0501082_0005588 Ga0501082_0005588_5604_6107 167
934 3300060353 Ga0501082_0350813 Ga0501082_0350813_162_665 167
935 3300060353 Ga0501082_0388015 Ga0501082_0388015_606_1109 167
936 3300060353 Ga0501082_0656002 Ga0501082_0656002_371_901 167
937 3300060353 Ga0501082_1379990 Ga0501082_1379990_28_531 167
938 3300060353 Ga0501082_1441790 Ga0501082_1441790_40_543 167
939 3300061734 Ga0530510_0000244 Ga0530510_0000244_16155_16658 167
940 3300061734 Ga0530510_0005130 Ga0530510_0005130_5001_5504 167
941 3300061734 Ga0530510_0005522 Ga0530510_0005522_1805_2308 167
942 3300061734 Ga0530510_0029517 Ga0530510_0029517_766_1269 167
943 3300061734 Ga0530510_0033237 Ga0530510_0033237_2279_2782 167
944 3300061734 Ga0530510_0126761 Ga0530510_0126761_663_1166 167
945 3300061734 Ga0530510_0132295 Ga0530510_0132295_1068_1571 167
946 3300061734 Ga0530510_0156915 Ga0530510_0156915_982_1548 167
947 3300061734 Ga0530510_0203231 Ga0530510_0203231_896_1399 167
948 3300061734 Ga0530510_0244514 Ga0530510_0244514_133_636 167
949 3300061734 Ga0530510_0313006 Ga0530510_0313006_568_1071 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

33

180

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zoe-assembly1.cif.gz_A crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.8669 15 142
3zoh-assembly1.cif.gz_D crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound 1-cyclohex-2-enone 0.862 14 143
3zoe-assembly1.cif.gz_B crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.845 14 148
1wgb-assembly1.cif.gz_A crystal structure of a probable flavoprotein from thermus thermophilus hb8 0.8442 1 167
1wgb-assembly1.cif.gz_A crystal structure of a probable flavoprotein from thermus thermophilus hb8 0.8392 1 167
ID Description Score Start End Superfamily
af_O53254_5_167_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8499 15 159 2.30.110.10
2r0xA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8476 11 144 2.30.110.10
1wgbA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8457 2 154 2.30.110.10
3zoeB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.845 14 148 2.30.110.10
1i0sA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8348 15 154 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A354Q5M7-F1-model_v4 Flavin reductase 0.9636 18 167 GO:0010181
GO:0042602
AF-A0A353LU56-F1-model_v4 Flavin reductase 0.9606 61 167 GO:0010181
GO:0016646
AF-A0A537QTR8-F1-model_v4 Flavin reductase family protein 0.9585 44 167 GO:0010181
GO:0042602
AF-A0A2D8PIH3-F1-model_v4 Flavin reductase 0.9559 18 142 GO:0010181
GO:0042602
AF-A0A354Q5M7-F1-model_v4 Flavin reductase 0.9512 18 167 GO:0010181
GO:0042602

Feature Viewer

pLDDT pTM Quality
94.18 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map