F486304

General Info

Members Datasets Scaffolds Average Seq Length
940 419 915 287

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100091044|Ga0070683_1000910441
Length 278
Sequence MIRGFGLGLRPEHYRDFAQGAAAVDWLEILTENYLVPGGKPLDYLDRIRARYPVAMHGVSLSIAGESLDPEYLKQLEALARRVQPAWISDHLCWTGVGGRNLHDLLPIPFTAEALRHVAGRVGRVQDRLRRPLVLENVSSYVRMAEDEMTEWEFLRELVRRSGCELLLDVNNVYVNAVNHRFDARAFIDALPPQAIRQIHLAGHTDNGDHLVDTHDSPVCEAVWELYEHAVARFGPVPTMIERDDAIPPLAELVSELDIARRRAERALRSRTADALAA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2511231031 Pseudomonas sp. GM16 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
7 2791355199
8 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
9 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
10 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
11 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
12 2904699407
13 2906610324
14 2909042592 Labrys sp. LIt4 Isolate Nodule
15 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
16 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
17 2922425934
18 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
134 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
220 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
221 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
222 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
223 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
224 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
225 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
226 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
231 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
232 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
233 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
234 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
235 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
236 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
237 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
238 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
239 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
244 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
254 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
255 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
256 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
269 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
270 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
271 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
287 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
288 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
305 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
318 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
362 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
363 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
364 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
375 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
376 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
377 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
378 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
385 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
386 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
389 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
390 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
391 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
392 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
393 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
394 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
395 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
396 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
397 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
398 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
399 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
400 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
401 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
402 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
403 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
404 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
407 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
408 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
411 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
412 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
413 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
414 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
415 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
416 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
417 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
418 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
419 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 0
Isolates 2.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.47
Nodule 1.6
Rhizoplane 5.74
Rhizosphere 84.57
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4107868 2162886012 Bacteria 1120
2 JGI24737J22298_10066822 3300001990 Bacteria 1076
3 JGI24748J21848_1003601 3300002074 Bacteria 1771
4 JGI24751J29686_10011764 3300002459 Bacteria 1805
5 JGI25406J46586_10000168 3300003203 Bacteria 29130
6 JGI25406J46586_10015153 3300003203 Bacteria 3258
7 JGI25153J46596_10005034 3300003215 Bacteria 6990
8 rootH1_10148202 3300003323 Bacteria 3457
9 JGI25404J52841_10003367 3300003659 Bacteria 3152
10 Ga0065165_1005839 3300005262 Bacteria 6705
11 Ga0065715_10149744 3300005293 Bacteria 1743
12 Ga0070658_10007026 3300005327 Bacteria 9088
13 Ga0070658_10074612 3300005327 Bacteria 2782
14 Ga0070676_10000177 3300005328 Bacteria 26323
15 Ga0070676_10006855 3300005328 Bacteria 6100
16 Ga0070676_10183365 3300005328 Bacteria 1362
17 Ga0070683_100003236 3300005329 Bacteria 13150
18 Ga0070683_100091044 3300005329 Bacteria 2864
19 Ga0070683_100098872 3300005329 Bacteria 2746
20 Ga0070690_100000161 3300005330 Bacteria 34386
21 Ga0070690_100020167 3300005330 Bacteria 4058
22 Ga0070690_100251059 3300005330 Unclassified 1251
23 Ga0070690_100259359 3300005330 Bacteria 1232
24 Ga0070670_100017668 3300005331 Bacteria 6120
25 Ga0070670_100034365 3300005331 Bacteria 4362
26 Ga0070677_10011383 3300005333 Bacteria 3067
27 Ga0070677_10047505 3300005333 Bacteria 1721
28 Ga0068869_100001688 3300005334 Bacteria 13183
29 Ga0068869_100004961 3300005334 Bacteria 8328
30 Ga0068869_100075691 3300005334 Bacteria 2501
31 Ga0068869_100239963 3300005334 Bacteria 1444
32 Ga0068869_100387811 3300005334 Bacteria 1146
33 Ga0070666_10000673 3300005335 Bacteria 20665
34 Ga0070666_10028516 3300005335 Bacteria 3664
35 Ga0070666_10035673 3300005335 Bacteria 3298
36 Ga0070680_100071083 3300005336 Bacteria 2859
37 Ga0070680_100078816 3300005336 Bacteria 2714
38 Ga0070680_100171282 3300005336 Bacteria 1827
39 Ga0070682_100065884 3300005337 Bacteria 2303
40 Ga0068868_100005707 3300005338 Bacteria 8760
41 Ga0068868_100017937 3300005338 Bacteria 5281
42 Ga0068868_100098697 3300005338 Bacteria 2362
43 Ga0068868_100153156 3300005338 Bacteria 1900
44 Ga0070660_100000841 3300005339 Bacteria 20418
45 Ga0070660_100483122 3300005339 Bacteria 1029
46 Ga0070660_100512165 3300005339 Bacteria 999
47 Ga0070689_100000709 3300005340 Bacteria 20276
48 Ga0070689_100016859 3300005340 Bacteria 5354
49 Ga0070689_100269226 3300005340 Bacteria 1410
50 Ga0070691_10146074 3300005341 Bacteria 1209
51 Ga0070687_100000011 3300005343 Bacteria 57981
52 Ga0070687_100034677 3300005343 Bacteria 2500
53 Ga0070687_100039822 3300005343 Bacteria 2364
54 Ga0070661_100001135 3300005344 Bacteria 18731
55 Ga0070661_100006263 3300005344 Bacteria 8212
56 Ga0070661_100077201 3300005344 Bacteria 2455
57 Ga0070661_100105908 3300005344 Bacteria 2097
58 Ga0070692_10132575 3300005345 Bacteria 1402
59 Ga0070668_100005064 3300005347 Bacteria 9755
60 Ga0070668_100293763 3300005347 Unclassified 1361
61 Ga0070668_100551171 3300005347 Bacteria 1003
62 Ga0070669_100006355 3300005353 Bacteria 8515
63 Ga0070669_100014101 3300005353 Bacteria 5685
64 Ga0070675_100000821 3300005354 Bacteria 21914
65 Ga0070675_100002151 3300005354 Bacteria 14581
66 Ga0070675_100170775 3300005354 Bacteria 1875
67 Ga0070675_100314828 3300005354 Bacteria 1381
68 Ga0070671_100001021 3300005355 Bacteria 20588
69 Ga0070674_100002542 3300005356 Bacteria 10102
70 Ga0070674_100003166 3300005356 Bacteria 9171
71 Ga0070674_100182181 3300005356 Bacteria 1610
72 Ga0070674_100302054 3300005356 Bacteria 1276
73 Ga0070673_100003576 3300005364 Bacteria 9706
74 Ga0070673_100005261 3300005364 Bacteria 8263
75 Ga0070688_100001830 3300005365 Bacteria 10681
76 Ga0070688_100332909 3300005365 Unclassified 1106
77 Ga0070659_100000150 3300005366 Bacteria 53214
78 Ga0070659_100378629 3300005366 Bacteria 1192
79 Ga0070667_100005396 3300005367 Bacteria 10681
80 Ga0070667_100115137 3300005367 Bacteria 2335
81 Ga0070709_10071872 3300005434 Bacteria 2235
82 Ga0070714_100435311 3300005435 Bacteria 1244
83 Ga0070713_100217617 3300005436 Bacteria 1732
84 Ga0070701_10002949 3300005438 Bacteria 6643
85 Ga0070701_10035114 3300005438 Bacteria 2517
86 Ga0070711_100062091 3300005439 Bacteria 2603
87 Ga0070705_100000387 3300005440 Bacteria 25625
88 Ga0070694_100182487 3300005444 Bacteria 1553
89 Ga0070694_100345984 3300005444 Bacteria 1151
90 Ga0070663_100000694 3300005455 Bacteria 18126
91 Ga0070663_100013602 3300005455 Bacteria 5194
92 Ga0070663_100056093 3300005455 Bacteria 2821
93 Ga0070663_100065062 3300005455 Bacteria 2637
94 Ga0070663_100097899 3300005455 Bacteria 2184
95 Ga0070663_100159847 3300005455 Bacteria 1733
96 Ga0070663_100161774 3300005455 Bacteria 1723
97 Ga0070663_100222666 3300005455 Bacteria 1482
98 Ga0070678_100022351 3300005456 Bacteria 4190
99 Ga0070678_100024393 3300005456 Unclassified 4048
100 Ga0070678_100042538 3300005456 Bacteria 3230
101 Ga0070678_100153543 3300005456 Bacteria 1857
102 Ga0070678_100485616 3300005456 Bacteria 1088
103 Ga0070678_100585302 3300005456 Bacteria 994
104 Ga0070662_100000201 3300005457 Bacteria 35043
105 Ga0070662_100015950 3300005457 Bacteria 5039
106 Ga0070662_100022033 3300005457 Bacteria 4357
107 Ga0070681_10030752 3300005458 Bacteria 5388
108 Ga0070681_10237815 3300005458 Bacteria 1735
109 Ga0068867_100000832 3300005459 Bacteria 20752
110 Ga0068867_100156807 3300005459 Bacteria 1792
111 Ga0070685_10003362 3300005466 Bacteria 8138
112 Ga0070685_10044247 3300005466 Bacteria 2548
113 Ga0070706_100256463 3300005467 Bacteria 1633
114 Ga0070707_100423860 3300005468 Bacteria 1291
115 Ga0070699_100036589 3300005518 Bacteria 4247
116 Ga0070699_100079053 3300005518 Bacteria 2864
117 Ga0070699_100192435 3300005518 Bacteria 1812
118 Ga0070679_100022047 3300005530 Bacteria 6222
119 Ga0070679_100068280 3300005530 Bacteria 3546
120 Ga0070684_100036825 3300005535 Bacteria 4194
121 Ga0068853_100005121 3300005539 Bacteria 10244
122 Ga0068853_100358276 3300005539 Bacteria 1358
123 Ga0068853_100435278 3300005539 Bacteria 1232
124 Ga0070672_100003813 3300005543 Bacteria 9815
125 Ga0070672_100010911 3300005543 Bacteria 6321
126 Ga0070672_100045754 3300005543 Bacteria 3388
127 Ga0070686_100001626 3300005544 Bacteria 12566
128 Ga0070686_100082537 3300005544 Bacteria 2132
129 Ga0070686_100246696 3300005544 Bacteria 1302
130 Ga0070695_100046693 3300005545 Bacteria 2763
131 Ga0070695_100055370 3300005545 Bacteria 2556
132 Ga0070696_100067161 3300005546 Bacteria 2516
133 Ga0070693_100017104 3300005547 Bacteria 3764
134 Ga0070693_100027832 3300005547 Bacteria 3068
135 Ga0070693_100027871 3300005547 Bacteria 3066
136 Ga0070693_100031872 3300005547 Bacteria 2893
137 Ga0070693_100068195 3300005547 Bacteria 2087
138 Ga0070693_100112553 3300005547 Bacteria 1677
139 Ga0070665_100020348 3300005548 Bacteria 6665
140 Ga0070665_100023807 3300005548 Bacteria 6169
141 Ga0070665_100032508 3300005548 Bacteria 5251
142 Ga0070665_100177036 3300005548 Bacteria 2134
143 Ga0070665_100488953 3300005548 Bacteria 1242
144 Ga0070665_100641719 3300005548 Bacteria 1075
145 Ga0070704_100048327 3300005549 Bacteria 2978
146 Ga0068855_100007063 3300005563 Bacteria 13618
147 Ga0068855_100013690 3300005563 Bacteria 9782
148 Ga0068855_100019007 3300005563 Bacteria 8261
149 Ga0068855_100054408 3300005563 Bacteria 4704
150 Ga0068855_100061422 3300005563 Bacteria 4391
151 Ga0068855_100119768 3300005563 Bacteria 3013
152 Ga0068855_100184199 3300005563 Bacteria 2359
153 Ga0070664_100000409 3300005564 Bacteria 31980
154 Ga0070664_100011714 3300005564 Bacteria 7117
155 Ga0070664_100031009 3300005564 Bacteria 4464
156 Ga0070664_100124158 3300005564 Bacteria 2263
157 Ga0068857_100000045 3300005577 Bacteria 68428
158 Ga0068857_100019250 3300005577 Bacteria 5993
159 Ga0068857_100165300 3300005577 Bacteria 2009
160 Ga0068857_100264293 3300005577 Bacteria 1580
161 Ga0068854_100000943 3300005578 Bacteria 17491
162 Ga0068854_100004958 3300005578 Bacteria 8390
163 Ga0068854_100377213 3300005578 Bacteria 1168
164 Ga0068856_100000969 3300005614 Bacteria 30619
165 Ga0068856_100070577 3300005614 Bacteria 3456
166 Ga0068856_100110301 3300005614 Bacteria 2748
167 Ga0068856_100331805 3300005614 Bacteria 1539
168 Ga0070702_100074559 3300005615 Bacteria 2014
169 Ga0070702_100087054 3300005615 Bacteria 1886
170 Ga0070702_100107814 3300005615 Bacteria 1721
171 Ga0070702_100188045 3300005615 Bacteria 1357
172 Ga0070702_100322842 3300005615 Bacteria 1077
173 Ga0068852_100010493 3300005616 Bacteria 6926
174 Ga0068852_100022851 3300005616 Bacteria 5023
175 Ga0068852_100073144 3300005616 Bacteria 3015
176 Ga0068852_100287366 3300005616 Bacteria 1587
177 Ga0068852_100740716 3300005616 Bacteria 995
178 Ga0068852_100745225 3300005616 Bacteria 991
179 Ga0068859_100002138 3300005617 Bacteria 20097
180 Ga0068859_100006419 3300005617 Bacteria 11933
181 Ga0068859_100187733 3300005617 Bacteria 2151
182 Ga0068864_100001397 3300005618 Bacteria 19994
183 Ga0068864_100034925 3300005618 Bacteria 4279
184 Ga0068864_100092449 3300005618 Bacteria 2670
185 Ga0068866_10001396 3300005718 Bacteria 10405
186 Ga0068866_10067040 3300005718 Bacteria 1883
187 Ga0068861_100000449 3300005719 Bacteria 23927
188 Ga0068861_100059201 3300005719 Bacteria 2932
189 Ga0068861_100200551 3300005719 Bacteria 1674
190 Ga0068851_10002385 3300005834 Bacteria 8252
191 Ga0068870_10000840 3300005840 Bacteria 11962
192 Ga0068870_10159417 3300005840 Bacteria 1336
193 Ga0068863_100004325 3300005841 Bacteria 14003
194 Ga0068863_100216746 3300005841 Bacteria 1843
195 Ga0068858_100002574 3300005842 Bacteria 18264
196 Ga0068858_100020070 3300005842 Bacteria 6250
197 Ga0068858_100042918 3300005842 Bacteria 4193
198 Ga0068858_100053290 3300005842 Bacteria 3742
199 Ga0068858_100356005 3300005842 Bacteria 1402
200 Ga0068860_100006384 3300005843 Bacteria 11834
201 Ga0068860_100068705 3300005843 Bacteria 3367
202 Ga0068860_100160156 3300005843 Bacteria 2170
203 Ga0068860_100194817 3300005843 Bacteria 1962
204 Ga0068860_100205880 3300005843 Bacteria 1908
205 Ga0068860_100397843 3300005843 Bacteria 1362
206 Ga0068862_100003062 3300005844 Bacteria 14570
207 Ga0068862_100135682 3300005844 Bacteria 2180
208 Ga0081455_10001565 3300005937 Bacteria 28095
209 Ga0081455_10004842 3300005937 Bacteria 14942
210 Ga0081455_10005486 3300005937 Bacteria 13905
211 Ga0081455_10023977 3300005937 Bacteria 5662
212 Ga0081455_10025617 3300005937 Bacteria 5440
213 Ga0081455_10109038 3300005937 Bacteria 2204
214 Ga0081538_10051765 3300005981 Bacteria 2461
215 Ga0081540_1000076 3300005983 Bacteria 106701
216 Ga0081540_1000083 3300005983 Bacteria 100350
217 Ga0081540_1000780 3300005983 Bacteria 29224
218 Ga0081540_1001934 3300005983 Bacteria 17349
219 Ga0081540_1002260 3300005983 Bacteria 15841
220 Ga0081540_1004844 3300005983 Bacteria 10142
221 Ga0081540_1006350 3300005983 Bacteria 8632
222 Ga0081540_1006556 3300005983 Bacteria 8453
223 Ga0081540_1042269 3300005983 Bacteria 2352
224 Ga0081539_10000040 3300005985 Bacteria 292753
225 Ga0081539_10002516 3300005985 Bacteria 25625
226 Ga0081539_10052497 3300005985 Bacteria 2289
227 Ga0075365_10065664 3300006038 Bacteria 2432
228 Ga0075365_10107719 3300006038 Bacteria 1913
229 Ga0075368_10012932 3300006042 Bacteria 3059
230 Ga0075363_100213502 3300006048 Bacteria 1104
231 Ga0070716_100313125 3300006173 Bacteria 1097
232 Ga0070712_100017293 3300006175 Bacteria 4666
233 Ga0075369_10012643 3300006186 Bacteria 3335
234 Ga0075366_10193729 3300006195 Bacteria 1235
235 Ga0097621_100013398 3300006237 Bacteria 6113
236 Ga0097621_100059494 3300006237 Bacteria 3128
237 Ga0097621_100124098 3300006237 Bacteria 2192
238 Ga0068871_100002264 3300006358 Bacteria 13084
239 Ga0075428_100181146 3300006844 Bacteria 2280
240 Ga0075428_100211480 3300006844 Bacteria 2096
241 Ga0075430_100048637 3300006846 Bacteria 3581
242 Ga0075431_100166626 3300006847 Bacteria 2265
243 Ga0075433_10423792 3300006852 Bacteria 1174
244 Ga0075434_100150993 3300006871 Bacteria 2343
245 Ga0075434_100282382 3300006871 Bacteria 1679
246 Ga0075434_100308820 3300006871 Bacteria 1602
247 Ga0068865_100000468 3300006881 Bacteria 22582
248 Ga0068865_100006360 3300006881 Bacteria 7199
249 Ga0068865_100009816 3300006881 Bacteria 5945
250 Ga0068865_100127092 3300006881 Bacteria 1904
251 Ga0068865_100391653 3300006881 Unclassified 1136
252 Ga0097620_100002138 3300006931 Bacteria 20097
253 Ga0097620_100006418 3300006931 Bacteria 11933
254 Ga0097620_100187745 3300006931 Bacteria 2151
255 Ga0099794_10002060 3300007265 Bacteria 7292
256 Ga0099795_10105581 3300007788 Bacteria 1110
257 Ga0105240_10000911 3300009093 Bacteria 52804
258 Ga0105240_10007148 3300009093 Bacteria 16262
259 Ga0105240_10040900 3300009093 Bacteria 5923
260 Ga0105240_10043796 3300009093 Bacteria 5691
261 Ga0105240_10348608 3300009093 Bacteria 1680
262 Ga0111539_10005949 3300009094 Bacteria 15752
263 Ga0111539_10034475 3300009094 Bacteria 6137
264 Ga0111539_10233241 3300009094 Bacteria 2143
265 Ga0111539_10292188 3300009094 Bacteria 1896
266 Ga0105245_10000110 3300009098 Bacteria 79654
267 Ga0105245_10048588 3300009098 Bacteria 3796
268 Ga0105245_10341805 3300009098 Bacteria 1480
269 Ga0105247_10000779 3300009101 Bacteria 24470
270 Ga0105247_10085085 3300009101 Bacteria 1999
271 Ga0105247_10292969 3300009101 Bacteria 1126
272 Ga0114129_10079787 3300009147 Bacteria 4550
273 Ga0114129_10337361 3300009147 Bacteria 2000
274 Ga0105243_10001825 3300009148 Bacteria 18221
275 Ga0105243_10331838 3300009148 Bacteria 1389
276 Ga0105241_10000441 3300009174 Bacteria 31255
277 Ga0105241_10016275 3300009174 Bacteria 5450
278 Ga0105241_10045394 3300009174 Bacteria 3334
279 Ga0105241_10245421 3300009174 Bacteria 1516
280 Ga0105242_10003699 3300009176 Bacteria 11905
281 Ga0105242_10007991 3300009176 Bacteria 8149
282 Ga0105242_10016771 3300009176 Bacteria 5700
283 Ga0105242_10084280 3300009176 Bacteria 2663
284 Ga0105248_10007983 3300009177 Bacteria 11625
285 Ga0105248_10008973 3300009177 Bacteria 10995
286 Ga0105248_10132530 3300009177 Bacteria 2812
287 Ga0105248_10356813 3300009177 Bacteria 1646
288 Ga0105237_10004354 3300009545 Bacteria 16406
289 Ga0105237_10016097 3300009545 Bacteria 7778
290 Ga0105237_10034338 3300009545 Bacteria 5136
291 Ga0105237_10038469 3300009545 Bacteria 4830
292 Ga0105237_10152385 3300009545 Bacteria 2308
293 Ga0105237_10548970 3300009545 Bacteria 1162
294 Ga0105237_10610675 3300009545 Bacteria 1097
295 Ga0105238_10000246 3300009551 Bacteria 60435
296 Ga0105238_10037628 3300009551 Bacteria 4918
297 Ga0105238_10045861 3300009551 Bacteria 4415
298 Ga0105238_10057078 3300009551 Bacteria 3915
299 Ga0105238_10218265 3300009551 Bacteria 1883
300 Ga0105238_10678085 3300009551 Bacteria 1042
301 Ga0105249_10001617 3300009553 Bacteria 19729
302 Ga0105249_10005056 3300009553 Bacteria 11362
303 Ga0105249_10056577 3300009553 Bacteria 3591
304 Ga0105249_10381216 3300009553 Bacteria 1436
305 Ga0105239_10025154 3300010375 Bacteria 6557
306 Ga0105239_10039281 3300010375 Bacteria 5185
307 Ga0105239_10039841 3300010375 Bacteria 5147
308 Ga0105239_10080411 3300010375 Bacteria 3586
309 Ga0105239_10137433 3300010375 Bacteria 2721
310 Ga0105239_10286555 3300010375 Bacteria 1855
311 Ga0105239_10287340 3300010375 Bacteria 1852
312 Ga0105246_10042417 3300011119 Bacteria 3081
313 Ga0105246_10079100 3300011119 Bacteria 2337
314 Ga0157335_1000837 3300012492 Bacteria 1536
315 Ga0157326_1008196 3300012513 Bacteria 1137
316 Ga0157373_10004358 3300013100 Bacteria 10661
317 Ga0157373_10327913 3300013100 Bacteria 1090
318 Ga0157371_10006096 3300013102 Bacteria 10026
319 Ga0157371_10150770 3300013102 Bacteria 1658
320 Ga0157370_10011316 3300013104 Bacteria 9350
321 Ga0157370_10062592 3300013104 Bacteria 3528
322 Ga0157369_10012527 3300013105 Bacteria 9620
323 Ga0157369_10177141 3300013105 Bacteria 2244
324 Ga0157374_10000113 3300013296 Bacteria 74057
325 Ga0157374_10011568 3300013296 Bacteria 7649
326 Ga0157374_10058276 3300013296 Bacteria 3608
327 Ga0157374_10081673 3300013296 Bacteria 3067
328 Ga0157374_10366504 3300013296 Bacteria 1433
329 Ga0157378_10011085 3300013297 Bacteria 7889
330 Ga0157378_10026784 3300013297 Bacteria 5084
331 Ga0157378_10034001 3300013297 Bacteria 4509
332 Ga0157378_10094564 3300013297 Bacteria 2721
333 Ga0157378_10348838 3300013297 Bacteria 1445
334 Ga0163162_10000617 3300013306 Bacteria 33010
335 Ga0163162_10064022 3300013306 Bacteria 3722
336 Ga0163162_10179442 3300013306 Bacteria 2243
337 Ga0163162_10388730 3300013306 Bacteria 1528
338 Ga0163162_10576566 3300013306 Unclassified 1252
339 Ga0157372_10007152 3300013307 Bacteria 11880
340 Ga0157372_10050625 3300013307 Bacteria 4620
341 Ga0157372_10333153 3300013307 Bacteria 1768
342 Ga0157375_10001209 3300013308 Bacteria 22296
343 Ga0157375_10001227 3300013308 Bacteria 22128
344 Ga0157375_10007526 3300013308 Bacteria 9522
345 Ga0157375_10013332 3300013308 Bacteria 7310
346 Ga0157375_10077771 3300013308 Bacteria 3349
347 Ga0157375_10206394 3300013308 Bacteria 2121
348 Ga0163163_10013878 3300014325 Bacteria 7389
349 Ga0163163_10032740 3300014325 Bacteria 5022
350 Ga0163163_10049458 3300014325 Bacteria 4138
351 Ga0163163_10063508 3300014325 Bacteria 3662
352 Ga0157380_10029092 3300014326 Bacteria 4222
353 Ga0157380_10085162 3300014326 Bacteria 2593
354 Ga0157380_10110506 3300014326 Bacteria 2309
355 Ga0157380_10116556 3300014326 Bacteria 2255
356 Ga0157380_10186199 3300014326 Bacteria 1829
357 Ga0157377_10000265 3300014745 Bacteria 25633
358 Ga0157379_10000775 3300014968 Bacteria 25977
359 Ga0157379_10024010 3300014968 Bacteria 5411
360 Ga0157379_10073293 3300014968 Bacteria 3064
361 Ga0157379_10355004 3300014968 Bacteria 1343
362 Ga0157379_10439438 3300014968 Bacteria 1203
363 Ga0157376_10001710 3300014969 Bacteria 14602
364 Ga0157376_10016754 3300014969 Bacteria 5573
365 Ga0157376_10113593 3300014969 Bacteria 2388
366 Ga0209758_1006284 3300025297 Bacteria 8631
367 Ga0209758_1006935 3300025297 Bacteria 7901
368 Ga0207697_10000147 3300025315 Bacteria 34455
369 Ga0207656_10000871 3300025321 Bacteria 9831
370 Ga0207655_1017118 3300025728 Bacteria 3925
371 Ga0207682_10011662 3300025893 Bacteria 3435
372 Ga0207692_10046815 3300025898 Bacteria 2170
373 Ga0207642_10061668 3300025899 Bacteria 1745
374 Ga0207642_10320096 3300025899 Bacteria 905
375 Ga0207710_10016717 3300025900 Bacteria 3106
376 Ga0207688_10000086 3300025901 Bacteria 35591
377 Ga0207688_10009671 3300025901 Bacteria 5248
378 Ga0207680_10004502 3300025903 Bacteria 6609
379 Ga0207680_10064647 3300025903 Bacteria 2244
380 Ga0207680_10138589 3300025903 Bacteria 1611
381 Ga0207647_10002419 3300025904 Bacteria 14154
382 Ga0207647_10138492 3300025904 Bacteria 1427
383 Ga0207645_10000006 3300025907 Bacteria 197563
384 Ga0207645_10010075 3300025907 Bacteria 6507
385 Ga0207645_10023160 3300025907 Bacteria 4037
386 Ga0207643_10000019 3300025908 Bacteria 112372
387 Ga0207643_10074115 3300025908 Bacteria 1963
388 Ga0207705_10007653 3300025909 Bacteria 7940
389 Ga0207654_10001653 3300025911 Bacteria 11647
390 Ga0207654_10071490 3300025911 Bacteria 2063
391 Ga0207654_10295373 3300025911 Bacteria 1100
392 Ga0207707_10025800 3300025912 Bacteria 5140
393 Ga0207707_10305510 3300025912 Bacteria 1375
394 Ga0207695_10004251 3300025913 Bacteria 19672
395 Ga0207695_10040274 3300025913 Bacteria 5013
396 Ga0207695_10113566 3300025913 Bacteria 2685
397 Ga0207671_10007024 3300025914 Bacteria 9865
398 Ga0207671_10190124 3300025914 Bacteria 1601
399 Ga0207671_10216966 3300025914 Bacteria 1498
400 Ga0207693_10085746 3300025915 Bacteria 2467
401 Ga0207660_10054655 3300025917 Bacteria 2851
402 Ga0207662_10000002 3300025918 Bacteria 164937
403 Ga0207662_10008870 3300025918 Bacteria 5517
404 Ga0207662_10060786 3300025918 Bacteria 2267
405 Ga0207657_10000007 3300025919 Bacteria 205196
406 Ga0207657_10410742 3300025919 Bacteria 1064
407 Ga0207649_10002537 3300025920 Bacteria 10170
408 Ga0207649_10002680 3300025920 Bacteria 9868
409 Ga0207649_10008104 3300025920 Bacteria 5717
410 Ga0207652_10176872 3300025921 Bacteria 1916
411 Ga0207652_10289641 3300025921 Bacteria 1477
412 Ga0207646_10131038 3300025922 Bacteria 2257
413 Ga0207681_10001798 3300025923 Bacteria 13769
414 Ga0207681_10151091 3300025923 Bacteria 1740
415 Ga0207681_10349804 3300025923 Bacteria 1183
416 Ga0207694_10024306 3300025924 Bacteria 4600
417 Ga0207650_10000109 3300025925 Bacteria 108728
418 Ga0207650_10104192 3300025925 Bacteria 2188
419 Ga0207659_10001567 3300025926 Bacteria 13570
420 Ga0207659_10031235 3300025926 Bacteria 3644
421 Ga0207659_10124561 3300025926 Bacteria 1980
422 Ga0207687_10004863 3300025927 Bacteria 8931
423 Ga0207687_10091805 3300025927 Bacteria 2216
424 Ga0207687_10136303 3300025927 Bacteria 1857
425 Ga0207644_10000618 3300025931 Bacteria 22661
426 Ga0207690_10063101 3300025932 Bacteria 2525
427 Ga0207690_10236481 3300025932 Bacteria 1405
428 Ga0207706_10000066 3300025933 Bacteria 108138
429 Ga0207706_10002627 3300025933 Bacteria 17502
430 Ga0207706_10008600 3300025933 Bacteria 9406
431 Ga0207706_10013775 3300025933 Bacteria 7338
432 Ga0207706_10314679 3300025933 Unclassified 1363
433 Ga0207686_10003515 3300025934 Bacteria 8412
434 Ga0207686_10017329 3300025934 Unclassified 4057
435 Ga0207709_10008078 3300025935 Bacteria 5829
436 Ga0207709_10245453 3300025935 Bacteria 1305
437 Ga0207709_10319731 3300025935 Bacteria 1161
438 Ga0207709_10442794 3300025935 Bacteria 1002
439 Ga0207670_10004848 3300025936 Bacteria 7308
440 Ga0207670_10043926 3300025936 Bacteria 2954
441 Ga0207670_10054504 3300025936 Bacteria 2698
442 Ga0207669_10000286 3300025937 Bacteria 23124
443 Ga0207669_10004441 3300025937 Bacteria 6173
444 Ga0207669_10025214 3300025937 Bacteria 3209
445 Ga0207669_10029792 3300025937 Bacteria 3024
446 Ga0207669_10197430 3300025937 Bacteria 1457
447 Ga0207669_10288491 3300025937 Bacteria 1241
448 Ga0207704_10001245 3300025938 Bacteria 11361
449 Ga0207704_10018911 3300025938 Bacteria 3607
450 Ga0207704_10048601 3300025938 Unclassified 2545
451 Ga0207704_10097094 3300025938 Bacteria 1953
452 Ga0207704_10471942 3300025938 Bacteria 1005
453 Ga0207665_10009471 3300025939 Bacteria 6394
454 Ga0207691_10000628 3300025940 Bacteria 34907
455 Ga0207691_10026799 3300025940 Bacteria 5409
456 Ga0207691_10031739 3300025940 Bacteria 4929
457 Ga0207691_10599668 3300025940 Bacteria 932
458 Ga0207711_10000065 3300025941 Bacteria 119677
459 Ga0207711_10001337 3300025941 Bacteria 23334
460 Ga0207711_10023085 3300025941 Bacteria 5209
461 Ga0207711_10041147 3300025941 Bacteria 3935
462 Ga0207711_10204698 3300025941 Bacteria 1802
463 Ga0207689_10000070 3300025942 Bacteria 82939
464 Ga0207689_10005212 3300025942 Bacteria 11665
465 Ga0207689_10024310 3300025942 Bacteria 5084
466 Ga0207661_10051220 3300025944 Bacteria 3293
467 Ga0207661_10086145 3300025944 Bacteria 2606
468 Ga0207679_10000192 3300025945 Bacteria 49117
469 Ga0207679_10002439 3300025945 Bacteria 11459
470 Ga0207679_10023667 3300025945 Bacteria 4203
471 Ga0207679_10043202 3300025945 Bacteria 3244
472 Ga0207679_10270026 3300025945 Bacteria 1454
473 Ga0207667_10000244 3300025949 Bacteria 76441
474 Ga0207667_10006665 3300025949 Bacteria 13960
475 Ga0207667_10168344 3300025949 Bacteria 2252
476 Ga0207651_10002235 3300025960 Bacteria 9178
477 Ga0207651_10005114 3300025960 Bacteria 6697
478 Ga0207712_10000421 3300025961 Bacteria 36297
479 Ga0207712_10006564 3300025961 Bacteria 7341
480 Ga0207712_10046748 3300025961 Bacteria 3002
481 Ga0207712_10091256 3300025961 Bacteria 2244
482 Ga0207668_10040849 3300025972 Bacteria 3132
483 Ga0207668_10242019 3300025972 Bacteria 1460
484 Ga0207668_10358634 3300025972 Bacteria 1221
485 Ga0207640_10000169 3300025981 Bacteria 47286
486 Ga0207640_10002086 3300025981 Bacteria 10764
487 Ga0207658_10010070 3300025986 Bacteria 6421
488 Ga0207658_10026952 3300025986 Bacteria 4033
489 Ga0207658_10130696 3300025986 Bacteria 2017
490 Ga0207658_10291383 3300025986 Bacteria 1403
491 Ga0207677_10000187 3300026023 Bacteria 49830
492 Ga0207677_10008792 3300026023 Bacteria 5658
493 Ga0207677_10306387 3300026023 Bacteria 1314
494 Ga0207703_10000102 3300026035 Bacteria 100318
495 Ga0207703_10005716 3300026035 Bacteria 9975
496 Ga0207703_10018789 3300026035 Bacteria 5397
497 Ga0207703_10053526 3300026035 Bacteria 3280
498 Ga0207703_10406349 3300026035 Bacteria 1264
499 Ga0207703_10416604 3300026035 Bacteria 1249
500 Ga0207703_10451457 3300026035 Bacteria 1201
501 Ga0207639_10002412 3300026041 Bacteria 12553
502 Ga0207639_10168687 3300026041 Bacteria 1851
503 Ga0207678_10001138 3300026067 Bacteria 24371
504 Ga0207678_10014007 3300026067 Bacteria 7050
505 Ga0207678_10029116 3300026067 Bacteria 4820
506 Ga0207678_10122751 3300026067 Bacteria 2216
507 Ga0207678_10229069 3300026067 Bacteria 1591
508 Ga0207708_10014035 3300026075 Bacteria 5985
509 Ga0207708_10544529 3300026075 Archaea 978
510 Ga0207702_10058029 3300026078 Bacteria 3292
511 Ga0207702_10102076 3300026078 Bacteria 2534
512 Ga0207702_10166680 3300026078 Bacteria 2016
513 Ga0207702_10267828 3300026078 Bacteria 1611
514 Ga0207641_10024778 3300026088 Bacteria 4945
515 Ga0207641_10108912 3300026088 Bacteria 2453
516 Ga0207641_10168360 3300026088 Bacteria 1998
517 Ga0207648_10000099 3300026089 Bacteria 82716
518 Ga0207648_10001481 3300026089 Bacteria 25831
519 Ga0207648_10328994 3300026089 Bacteria 1374
520 Ga0207648_10425335 3300026089 Bacteria 1206
521 Ga0207676_10003294 3300026095 Bacteria 11475
522 Ga0207676_10090503 3300026095 Bacteria 2511
523 Ga0207674_10000030 3300026116 Bacteria 145695
524 Ga0207674_10009990 3300026116 Bacteria 10802
525 Ga0207674_10020542 3300026116 Bacteria 7132
526 Ga0207674_10100456 3300026116 Bacteria 2874
527 Ga0207675_100000007 3300026118 Bacteria 187048
528 Ga0207675_100092540 3300026118 Bacteria 2844
529 Ga0207675_100207607 3300026118 Bacteria 1883
530 Ga0207683_10000688 3300026121 Bacteria 30991
531 Ga0207683_10008652 3300026121 Bacteria 8704
532 Ga0207683_10028448 3300026121 Bacteria 4832
533 Ga0207683_10063460 3300026121 Bacteria 3254
534 Ga0207683_10116730 3300026121 Bacteria 2393
535 Ga0207683_10218267 3300026121 Bacteria 1737
536 Ga0207683_10271848 3300026121 Bacteria 1548
537 Ga0207698_10063176 3300026142 Bacteria 2896
538 Ga0207698_10097833 3300026142 Bacteria 2423
539 Ga0207698_10242596 3300026142 Bacteria 1643
540 Ga0209588_1031900 3300027671 Bacteria 1687
541 Ga0209998_10011711 3300027717 Bacteria 1818
542 Ga0207428_10012161 3300027907 Bacteria 7573
543 Ga0265356_1002334 3300028017 Bacteria 2553
544 Ga0268266_10000397 3300028379 Bacteria 65954
545 Ga0268266_10002092 3300028379 Bacteria 22080
546 Ga0268266_10011766 3300028379 Bacteria 7587
547 Ga0268266_10051335 3300028379 Bacteria 3539
548 Ga0268266_10136923 3300028379 Bacteria 2194
549 Ga0268265_10041140 3300028380 Bacteria 3417
550 Ga0268265_10173213 3300028380 Bacteria 1846
551 Ga0268265_10187328 3300028380 Bacteria 1784
552 Ga0268265_10357673 3300028380 Bacteria 1335
553 Ga0268265_10436587 3300028380 Bacteria 1219
554 Ga0268264_10000804 3300028381 Bacteria 33856
555 Ga0268264_10007291 3300028381 Bacteria 9252
556 Ga0268264_10016086 3300028381 Bacteria 6129
557 Ga0268264_10287733 3300028381 Bacteria 1542
558 Ga0265337_1012313 3300028556 Bacteria 2912
559 Ga0265326_10019538 3300028558 Bacteria 1945
560 Ga0265319_1008249 3300028563 Bacteria 4585
561 Ga0265334_10003965 3300028573 Bacteria 6660
562 Ga0265318_10007905 3300028577 Bacteria 4775
563 Ga0265323_10000311 3300028653 Bacteria 28078
564 Ga0265322_10004519 3300028654 Bacteria 4137
565 Ga0265336_10000074 3300028666 Bacteria 82727
566 Ga0307517_10000085 3300028786 Bacteria 131200
567 Ga0307517_10074853 3300028786 Bacteria 2979
568 Ga0307515_10059363 3300028794 Bacteria 5483
569 Ga0265338_10000137 3300028800 Bacteria 135705
570 Ga0265324_10000684 3300029957 Bacteria 22772
571 Ga0307512_10038614 3300030522 Bacteria 4014
572 Ga0265332_10001022 3300031238 Bacteria 16531
573 Ga0265328_10000061 3300031239 Bacteria 63197
574 Ga0265328_10000305 3300031239 Bacteria 22931
575 Ga0265328_10016966 3300031239 Bacteria 2826
576 Ga0265328_10127456 3300031239 Bacteria 951
577 Ga0265320_10025025 3300031240 Bacteria 3145
578 Ga0265329_10005533 3300031242 Bacteria 5096
579 Ga0265329_10007066 3300031242 Bacteria 4379
580 Ga0265340_10111001 3300031247 Bacteria 1268
581 Ga0265331_10001445 3300031250 Bacteria 17455
582 Ga0265331_10001600 3300031250 Bacteria 16533
583 Ga0265327_10013516 3300031251 Bacteria 5418
584 Ga0265327_10016623 3300031251 Bacteria 4662
585 Ga0265316_10001750 3300031344 Bacteria 22990
586 Ga0265316_10003254 3300031344 Bacteria 16504
587 Ga0307513_10034291 3300031456 Bacteria 5697
588 Ga0307509_10003945 3300031507 Bacteria 21884
589 Ga0307509_10291622 3300031507 Bacteria 1386
590 Ga0307508_10267428 3300031616 Bacteria 1304
591 Ga0307514_10056229 3300031649 Bacteria 3021
592 Ga0316575_10065222 3300031665 Bacteria 1458
593 Ga0265314_10003069 3300031711 Bacteria 16462
594 Ga0265342_10117254 3300031712 Bacteria 1502
595 Ga0316576_10019077 3300031727 Bacteria 4695
596 Ga0307516_10285369 3300031730 Bacteria 1331
597 Ga0307405_10200013 3300031731 Bacteria 1450
598 Ga0307518_10086710 3300031838 Bacteria 2256
599 Ga0307406_10083326 3300031901 Bacteria 2132
600 Ga0307406_10192287 3300031901 Bacteria 1495
601 Ga0307406_10226588 3300031901 Bacteria 1393
602 Ga0307414_10372349 3300032004 Bacteria 1232
603 Ga0307415_100160411 3300032126 Bacteria 1742
604 Ga0307510_10000779 3300033180 Bacteria 32991
605 Ga0307510_10007951 3300033180 Bacteria 12621
606 Ga0307510_10011080 3300033180 Bacteria 10717
607 Ga0373930_0003689 3300034816 Bacteria 2449
608 Ga0316574_0000392 3300035398 Bacteria 17117
609 Ga0316574_0048385 3300035398 Bacteria 2640
610 Ga0373931_0014394 3300035691 Bacteria 3865
611 Ga0373931_0066820 3300035691 Bacteria 1952
612 Ga0373931_0084598 3300035691 Bacteria 1757
613 Ga0373927_0018763 3300035695 Bacteria 4538
614 Ga0373927_0038026 3300035695 Bacteria 3126
615 Ga0373927_0136066 3300035695 Bacteria 1606
616 Ga0373927_0172204 3300035695 Bacteria 1419
617 Ga0373947_0001290 3300035725 Bacteria 15432
618 Ga0373947_0348930 3300035725 Bacteria 993
619 Ga0373937_0146484 3300036401 Bacteria 2211
620 Ga0316582_0047808 3300036647 Bacteria 2703
621 Ga0395898_0039339 3300037466 Bacteria 4681
622 Ga0395898_0131235 3300037466 Bacteria 2399
623 Ga0395905_0029346 3300037471 Bacteria 5182
624 Ga0316581_0013616 3300037588 Bacteria 2308
625 Ga0395901_0067826 3300038443 Bacteria 3716
626 Ga0400487_40084 3300039110 Bacteria 6241
627 Ga0436363_0046265 3300039450 Bacteria 1015
628 Ga0439465_0099112 3300041413 Bacteria 1005
629 Ga0451793_1474675 3300041452 Bacteria 958
630 Ga0439448_0016450 3300042005 Bacteria 2251
631 Ga0439459_0010244 3300042438 Bacteria 1632
632 Ga0451577_0006026 3300042876 Bacteria 12205
633 Ga0451577_0037073 3300042876 Bacteria 4389
634 Ga0451577_0067510 3300042876 Bacteria 3189
635 Ga0451577_0084294 3300042876 Bacteria 2836
636 Ga0466972_0000303 3300044658 Bacteria 29316
637 Ga0466972_0011092 3300044658 Bacteria 4522
638 Ga0453683_0010984 3300044673 Bacteria 5987
639 Ga0453683_0062673 3300044673 Bacteria 2324
640 Ga0453683_0062726 3300044673 Bacteria 2323
641 Ga0453683_0319146 3300044673 Bacteria 995
642 Ga0466965_0046472 3300044683 Bacteria 2149
643 Ga0466966_0001947 3300044684 Bacteria 13360
644 Ga0466966_0008904 3300044684 Bacteria 6649
645 Ga0466961_0028359 3300044693 Bacteria 3599
646 Ga0466964_0004069 3300044706 Bacteria 5380
647 Ga0453684_0006586 3300044712 Bacteria 21968
648 Ga0453684_0006667 3300044712 Bacteria 21798
649 Ga0453684_0010078 3300044712 Bacteria 16238
650 Ga0453684_0084806 3300044712 Bacteria 3939
651 Ga0453684_0092451 3300044712 Bacteria 3729
652 Ga0453684_0115171 3300044712 Bacteria 3257
653 Ga0453684_0848870 3300044712 Bacteria 981
654 Ga0466971_0016619 3300044719 Bacteria 3250
655 Ga0466970_0025629 3300044765 Bacteria 3088
656 Ga0466970_0026243 3300044765 Bacteria 3053
657 Ga0466957_0114111 3300044842 Bacteria 1716
658 Ga0466960_0079810 3300044901 Bacteria 1646
659 Ga0466959_0000006 3300045049 Bacteria 192678
660 Ga0451576_0002250 3300045051 Bacteria 29531
661 Ga0451576_0059005 3300045051 Bacteria 4007
662 Ga0466958_0020205 3300045836 Bacteria 3883
663 Ga0466958_0179957 3300045836 Bacteria 1341
664 Ga0495617_002531 3300046452 Bacteria 7222
665 Ga0495627_000264 3300046453 Bacteria 53754
666 Ga0495592_0000477 3300046454 Bacteria 29375
667 Ga0495603_0001659 3300046455 Bacteria 13046
668 Ga0495603_0004325 3300046455 Bacteria 8473
669 Ga0495629_0015731 3300046459 Bacteria 5431
670 Ga0495629_0244840 3300046459 Bacteria 1234
671 Ga0495638_0032968 3300046460 Bacteria 3314
672 Ga0495638_0146501 3300046460 Bacteria 1373
673 Ga0495651_0161867 3300046462 Bacteria 1602
674 Ga0495580_0011691 3300046472 Bacteria 6784
675 Ga0495580_0123323 3300046472 Bacteria 1798
676 Ga0495582_0003787 3300046473 Bacteria 8521
677 Ga0495582_0042988 3300046473 Bacteria 2488
678 Ga0495639_0009431 3300046475 Bacteria 4187
679 Ga0495639_0058898 3300046475 Bacteria 1758
680 Ga0495585_0023997 3300046492 Bacteria 3498
681 Ga0495585_0113881 3300046492 Bacteria 1436
682 Ga0495594_0062838 3300046499 Bacteria 2056
683 Ga0495594_0101364 3300046499 Bacteria 1620
684 Ga0495596_0005892 3300046500 Bacteria 5723
685 Ga0495606_0003543 3300046507 Bacteria 16488
686 Ga0495616_0002509 3300046513 Bacteria 12138
687 Ga0495631_0072644 3300046518 Bacteria 1486
688 Ga0495632_0000326 3300046519 Bacteria 45910
689 Ga0495637_0000299 3300046520 Bacteria 38328
690 Ga0495637_0000636 3300046520 Bacteria 24606
691 Ga0495648_0001787 3300046524 Bacteria 20689
692 Ga0495652_0287261 3300046529 Bacteria 1202
693 Ga0495622_0008847 3300046557 Bacteria 4662
694 Ga0495633_0152413 3300046558 Bacteria 1067
695 Ga0495656_0062004 3300046615 Bacteria 1634
696 Ga0495656_0076095 3300046615 Bacteria 1503
697 Ga0495668_0005067 3300046616 Bacteria 9069
698 Ga0495625_0004643 3300046660 Bacteria 12900
699 Ga0495625_0034589 3300046660 Bacteria 3728
700 Ga0495625_0184301 3300046660 Bacteria 1386
701 Ga0495625_0244662 3300046660 Bacteria 1166
702 Ga0495661_0002717 3300046665 Bacteria 13485
703 Ga0495661_0026583 3300046665 Bacteria 3727
704 Ga0495646_0257242 3300046680 Bacteria 934
705 Ga0495647_0069054 3300046681 Bacteria 1411
706 Ga0495669_0003990 3300046684 Bacteria 6074
707 Ga0495613_0001486 3300046689 Bacteria 17866
708 Ga0495670_0124107 3300046691 Bacteria 1343
709 Ga0495671_0090522 3300046692 Bacteria 1497
710 Ga0495649_0151045 3300046694 Bacteria 1220
711 Ga0495581_0040886 3300047315 Bacteria 2682
712 Ga0495672_0008975 3300047320 Bacteria 7300
713 Ga0495672_0097545 3300047320 Bacteria 1600
714 Ga0495672_0191705 3300047320 Bacteria 1027
715 Ga0495683_0010558 3300047323 Bacteria 4873
716 Ga0495677_0015067 3300047445 Bacteria 2810
717 Ga0495681_0000238 3300047470 Bacteria 45615
718 Ga0495686_0001767 3300047472 Bacteria 22109
719 Ga0495686_0136371 3300047472 Bacteria 1451
720 Ga0495593_0000446 3300047673 Bacteria 23131
721 Ga0495593_0092444 3300047673 Bacteria 1557
722 Ga0495614_0119755 3300048089 Bacteria 1160
723 Ga0496100_0005795 3300048903 Bacteria 6681
724 Ga0496100_0025224 3300048903 Bacteria 3634
725 Ga0496101_0010103 3300048904 Bacteria 6224
726 Ga0496101_0019033 3300048904 Bacteria 4679
727 Ga0496102_0011856 3300048905 Bacteria 7524
728 Ga0496102_0201977 3300048905 Bacteria 1874
729 Ga0496102_0254822 3300048905 Bacteria 1654
730 Ga0496103_0140383 3300048906 Bacteria 1545
731 Ga0496104_0015566 3300048907 Bacteria 6891
732 Ga0496104_0022192 3300048907 Bacteria 5830
733 Ga0496104_0186947 3300048907 Bacteria 1982
734 Ga0496105_0026038 3300048908 Bacteria 4767
735 Ga0496105_0029578 3300048908 Bacteria 4484
736 Ga0496106_0005656 3300048909 Bacteria 9248
737 Ga0496106_0013363 3300048909 Bacteria 6061
738 Ga0496106_0032016 3300048909 Bacteria 3919
739 Ga0496106_0119673 3300048909 Bacteria 2057
740 Ga0496106_0230865 3300048909 Bacteria 1477
741 Ga0496107_0032512 3300048910 Bacteria 3729
742 Ga0496107_0036371 3300048910 Bacteria 3532
743 Ga0496107_0051625 3300048910 Bacteria 2966
744 Ga0496108_0008883 3300048911 Bacteria 8146
745 Ga0496108_0035589 3300048911 Bacteria 4140
746 Ga0496108_0051166 3300048911 Bacteria 3460
747 Ga0496108_0070341 3300048911 Unclassified 2953
748 Ga0496109_0003474 3300048912 Bacteria 13156
749 Ga0496109_0035502 3300048912 Unclassified 4498
750 Ga0496109_0144708 3300048912 Bacteria 2223
751 Ga0496109_0243037 3300048912 Bacteria 1694
752 Ga0496110_0013188 3300048913 Bacteria 6824
753 Ga0496110_0117190 3300048913 Bacteria 2398
754 Ga0496110_0157635 3300048913 Bacteria 2057
755 Ga0496110_0203112 3300048913 Bacteria 1801
756 Ga0496111_0135494 3300048914 Bacteria 1824
757 Ga0496111_0291033 3300048914 Bacteria 1211
758 Ga0496112_0000055 3300048915 Bacteria 78086
759 Ga0496112_0009509 3300048915 Bacteria 8765
760 Ga0496112_0065158 3300048915 Unclassified 3595
761 Ga0496112_0294394 3300048915 Bacteria 1569
762 Ga0496112_0360210 3300048915 Bacteria 1396
763 Ga0496112_0399392 3300048915 Bacteria 1314
764 Ga0496112_0400274 3300048915 Bacteria 1313
765 Ga0496113_0051065 3300048916 Bacteria 3085
766 Ga0496113_0053156 3300048916 Bacteria 3028
767 Ga0496113_0074739 3300048916 Bacteria 2584
768 Ga0496113_0175206 3300048916 Bacteria 1699
769 Ga0496114_0001073 3300048917 Bacteria 20576
770 Ga0496114_0002928 3300048917 Bacteria 13087
771 Ga0496114_0060355 3300048917 Bacteria 3169
772 Ga0496114_0138873 3300048917 Bacteria 2103
773 Ga0496115_0005146 3300048918 Bacteria 9513
774 Ga0496115_0043332 3300048918 Bacteria 3589
775 Ga0496115_0316692 3300048918 Bacteria 1277
776 Ga0496116_0000761 3300048919 Bacteria 40895
777 Ga0496119_0086096 3300048922 Bacteria 1797
778 Ga0496121_0035863 3300048924 Bacteria 4432
779 Ga0496121_0078506 3300048924 Bacteria 2624
780 Ga0496125_0091688 3300048928 Bacteria 2275
781 Ga0496126_0018245 3300048929 Bacteria 6960
782 Ga0496126_0060848 3300048929 Bacteria 3394
783 Ga0496126_0061650 3300048929 Bacteria 3368
784 Ga0496126_0466137 3300048929 Bacteria 1014
785 Ga0501032_0097298 3300049569 Bacteria 1951
786 Ga0501036_0029531 3300049572 Bacteria 4631
787 Ga0501036_0058510 3300049572 Bacteria 3265
788 Ga0501036_0118227 3300049572 Bacteria 2238
789 Ga0501036_0392298 3300049572 Bacteria 1158
790 Ga0501037_0330602 3300049573 Bacteria 1054
791 Ga0501038_0222595 3300049574 Bacteria 1505
792 Ga0501039_0030209 3300049575 Bacteria 4177
793 Ga0501039_0044907 3300049575 Bacteria 3413
794 Ga0501039_0149845 3300049575 Bacteria 1833
795 Ga0501040_0018011 3300049576 Bacteria 4689
796 Ga0501040_0033501 3300049576 Bacteria 3480
797 Ga0501040_0069117 3300049576 Bacteria 2436
798 Ga0501041_0007187 3300049577 Bacteria 6533
799 Ga0501041_0019329 3300049577 Bacteria 4068
800 Ga0501041_0025566 3300049577 Bacteria 3549
801 Ga0501041_0031889 3300049577 Bacteria 3185
802 Ga0501041_0145102 3300049577 Bacteria 1481
803 Ga0501042_0046538 3300049578 Bacteria 3093
804 Ga0501042_0132874 3300049578 Bacteria 1794
805 Ga0501042_0145685 3300049578 Bacteria 1707
806 Ga0501042_0172787 3300049578 Bacteria 1559
807 Ga0501042_0221612 3300049578 Bacteria 1364
808 Ga0501043_0237949 3300049579 Bacteria 1405
809 Ga0501046_0173529 3300049580 Bacteria 1616
810 Ga0501046_0191132 3300049580 Bacteria 1527
811 Ga0501046_0201033 3300049580 Bacteria 1483
812 Ga0501047_0168663 3300049581 Bacteria 2059
813 Ga0501047_0194677 3300049581 Bacteria 1890
814 Ga0501048_0060023 3300049582 Bacteria 2695
815 Ga0501048_0061338 3300049582 Bacteria 2663
816 Ga0501067_0094161 3300049583 Bacteria 1663
817 Ga0501068_0077716 3300049584 Bacteria 2033
818 Ga0501071_0006808 3300049587 Bacteria 7445
819 Ga0501071_0016153 3300049587 Bacteria 5131
820 Ga0501071_0101966 3300049587 Bacteria 2116
821 Ga0501072_0055865 3300049588 Bacteria 3111
822 Ga0501072_0081665 3300049588 Bacteria 2562
823 Ga0501072_0094188 3300049588 Bacteria 2379
824 Ga0501074_0029568 3300049590 Bacteria 3969
825 Ga0501075_0018748 3300049591 Bacteria 5014
826 Ga0501075_0023911 3300049591 Bacteria 4475
827 Ga0501075_0072805 3300049591 Bacteria 2598
828 Ga0501075_0110772 3300049591 Bacteria 2087
829 Ga0501075_0175378 3300049591 Bacteria 1636
830 Ga0501076_0086089 3300049592 Bacteria 2525
831 Ga0501076_0132128 3300049592 Bacteria 2024
832 Ga0501076_0135960 3300049592 Bacteria 1995
833 Ga0501076_0281549 3300049592 Bacteria 1362
834 Ga0501077_0017078 3300049593 Bacteria 4577
835 Ga0501077_0052003 3300049593 Bacteria 2602
836 Ga0501077_0065354 3300049593 Bacteria 2307
837 Ga0501077_0166473 3300049593 Bacteria 1400
838 Ga0501079_0099138 3300049741 Bacteria 2258
839 Ga0501079_0201737 3300049741 Bacteria 1553
840 Ga0501079_0221742 3300049741 Bacteria 1477
841 Ga0501079_0467667 3300049741 Bacteria 991
842 Ga0501081_0019985 3300049743 Bacteria 4463
843 Ga0501081_0042249 3300049743 Bacteria 3123
844 Ga0501083_0076336 3300049744 Bacteria 2224
845 Ga0501035_0083881 3300049822 Bacteria 2811
846 Ga0501045_0018756 3300049824 Bacteria 4924
847 Ga0501045_0020480 3300049824 Bacteria 4725
848 Ga0501045_0032303 3300049824 Bacteria 3793
849 Ga0501045_0046763 3300049824 Bacteria 3151
850 Ga0501045_0082546 3300049824 Bacteria 2370
851 Ga0501045_0210803 3300049824 Bacteria 1447
852 Ga0501045_0246539 3300049824 Bacteria 1330
853 nmdc:mga03683_75246_c1 3300050489 Bacteria 1449
854 nmdc:mga03n38_81441_c1 3300050490 Bacteria 1522
855 nmdc:mga06z11_58418_c1 3300050494 Bacteria 2001
856 nmdc:mga04h51_46251_c1 3300050495 Bacteria 1442
857 nmdc:mga07m45_138574_c1 3300050496 Bacteria 1409
858 nmdc:mga05p37_114611_c1 3300050507 Bacteria 3313
859 nmdc:mga05p37_386924_c1 3300050507 Bacteria 1637
860 nmdc:mga0qj67_61672_c1 3300050509 Bacteria 2977
861 nmdc:mga06r32_219083_c1 3300050510 Bacteria 1891
862 nmdc:mga06r32_264328_c1 3300050510 Bacteria 1708
863 nmdc:mga08y16_121135_c1 3300050511 Bacteria 2722
864 nmdc:mga08y16_1696_c1 3300050511 Bacteria 22329
865 nmdc:mga08y16_20259_c1 3300050511 Bacteria 7019
866 nmdc:mga08y16_380809_c1 3300050511 Bacteria 1119
867 nmdc:mga0n895_142481_c1 3300050512 Bacteria 2426
868 nmdc:mga0n895_163658_c1 3300050512 Bacteria 2256
869 nmdc:mga0n895_396533_c1 3300050512 Bacteria 1396
870 nmdc:mga0sz30_17755_c1 3300050516 Bacteria 2841
871 nmdc:mga0sz30_99433_c1 3300050516 Bacteria 1270
872 Ga0495601_0008374 3300053077 Bacteria 6110
873 Ga0495655_0000348 3300053083 Bacteria 8127
874 Ga0495619_0003178 3300053085 Bacteria 10644
875 Ga0500644_0029153 3300053088 Bacteria 1733
876 Ga0500566_0064629 3300053094 Bacteria 2065
877 Ga0500641_0048888 3300053096 Bacteria 1733
878 Ga0500650_0041975 3300053098 Bacteria 2113
879 Ga0500554_001083 3300053102 Bacteria 5288
880 Ga0500562_019336 3300053108 Bacteria 1762
881 Ga0500595_000726 3300053119 Bacteria 19589
882 Ga0500595_010273 3300053119 Bacteria 3726
883 Ga0500652_114312 3300053131 Bacteria 1128
884 Ga0500559_0033238 3300053136 Bacteria 2220
885 Ga0500568_0026140 3300053139 Bacteria 2452
886 Ga0500568_0037166 3300053139 Bacteria 1977
887 Ga0500568_0040551 3300053139 Bacteria 1873
888 Ga0500603_006267 3300053150 Bacteria 2582
889 Ga0500604_0052160 3300053151 Bacteria 1265
890 Ga0500616_0000028 3300053153 Bacteria 435722
891 Ga0500616_0000964 3300053153 Bacteria 31200
892 Ga0500616_0081393 3300053153 Bacteria 1626
893 Ga0500619_002865 3300053154 Bacteria 3415
894 Ga0500622_0006697 3300053156 Bacteria 6639
895 Ga0500627_0082835 3300053158 Bacteria 1431
896 Ga0500638_008459 3300053162 Bacteria 4389
897 Ga0500636_0066934 3300053177 Bacteria 2088
898 Ga0500637_0000084 3300053178 Bacteria 33745
899 Ga0501084_0011524 3300054114 Bacteria 7322
900 Ga0501084_0078234 3300054114 Bacteria 2772
901 Ga0501084_0175213 3300054114 Bacteria 1810
902 Ga0501084_0272944 3300054114 Bacteria 1428
903 Ga0501084_0386602 3300054114 Bacteria 1182
904 Ga0500661_000602 3300055283 Bacteria 6739
905 Ga0501082_0029246 3300060353 Bacteria 4745
906 Ga0501082_0049411 3300060353 Bacteria 3627
907 Ga0501082_0061696 3300060353 Bacteria 3227
908 Ga0501082_0126941 3300060353 Bacteria 2212
909 Ga0501082_0169902 3300060353 Bacteria 1895
910 Ga0466962_0002323 3300061719 Bacteria 9011
911 Ga0530510_0015111 3300061734 Bacteria 5453
912 Ga0530510_0026282 3300061734 Bacteria 4166
913 Ga0530510_0097764 3300061734 Bacteria 2146
914 Ga0530510_0139829 3300061734 Bacteria 1783
915 Ga0530510_0244270 3300061734 Bacteria 1337

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0072805 Ga0501075_0072805_1304_2152 248
2 3300049572 Ga0501036_0029531 Ga0501036_0029531_186_1034 256
3 3300049577 Ga0501041_0145102 Ga0501041_0145102_119_967 256
4 3300049824 Ga0501045_0082546 Ga0501045_0082546_420_1268 256
5 3300049581 Ga0501047_0194677 Ga0501047_0194677_359_1165 263
6 3300044712 Ga0453684_0084806 Ga0453684_0084806_2730_3611 264
7 3300012492 Ga0157335_1000837 Ga0157335_10008372 267
8 3300003323 rootH1_10148202 rootH1_101482025 268
9 3300005262 Ga0065165_1005839 Ga0065165_10058397 268
10 3300005563 Ga0068855_100054408 Ga0068855_1000544084 268
11 3300013104 Ga0157370_10011316 Ga0157370_100113166 268
12 3300025949 Ga0207667_10006665 Ga0207667_1000666510 268
13 3300048918 Ga0496115_0316692 Ga0496115_0316692_141_1088 268
14 3300005563 Ga0068855_100007063 Ga0068855_1000070636 269
15 3300005578 Ga0068854_100000943 Ga0068854_1000009436 269
16 3300009093 Ga0105240_10007148 Ga0105240_1000714813 269
17 3300025913 Ga0207695_10004251 Ga0207695_1000425113 269
18 3300025949 Ga0207667_10000244 Ga0207667_1000024460 269
19 3300025981 Ga0207640_10000169 Ga0207640_1000016914 269
20 3300044658 Ga0466972_0011092 Ga0466972_0011092_3070_3894 269
21 3300044684 Ga0466966_0001947 Ga0466966_0001947_11039_11911 269
22 3300044684 Ga0466966_0008904 Ga0466966_0008904_901_1725 269
23 3300044693 Ga0466961_0028359 Ga0466961_0028359_81_953 269
24 3300044719 Ga0466971_0016619 Ga0466971_0016619_595_1419 269
25 3300044765 Ga0466970_0025629 Ga0466970_0025629_1937_2761 269
26 3300044765 Ga0466970_0026243 Ga0466970_0026243_1832_2704 269
27 3300044842 Ga0466957_0114111 Ga0466957_0114111_62_886 269
28 3300045049 Ga0466959_0000006 Ga0466959_0000006_147645_148517 269
29 3300045836 Ga0466958_0020205 Ga0466958_0020205_2330_3202 269
30 3300045836 Ga0466958_0179957 Ga0466958_0179957_147_971 269
31 3300061719 Ga0466962_0002323 Ga0466962_0002323_7003_7827 269
32 3300044706 Ga0466964_0004069 Ga0466964_0004069_1835_2695 270
33 3300044901 Ga0466960_0079810 Ga0466960_0079810_273_1133 270
34 3300030522 Ga0307512_10038614 Ga0307512_100386143 271
35 3300031507 Ga0307509_10003945 Ga0307509_1000394514 271
36 3300031649 Ga0307514_10056229 Ga0307514_100562292 271
37 3300031838 Ga0307518_10086710 Ga0307518_100867102 271
38 3300033180 Ga0307510_10000779 Ga0307510_1000077930 271
39 3300044658 Ga0466972_0000303 Ga0466972_0000303_1380_2210 271
40 3300044683 Ga0466965_0046472 Ga0466965_0046472_128_958 271
41 3300046454 Ga0495592_0000477 Ga0495592_0000477_9882_10709 271
42 3300048914 Ga0496111_0291033 Ga0496111_0291033_327_1196 271
43 3300048915 Ga0496112_0399392 Ga0496112_0399392_13_846 271
44 3300053131 Ga0500652_114312 Ga0500652_114312_286_1101 271
45 3300053154 Ga0500619_002865 Ga0500619_002865_2441_3268 271
46 3300053177 Ga0500636_0066934 Ga0500636_0066934_522_1337 271
47 3300003203 JGI25406J46586_10000168 JGI25406J46586_100001687 272
48 3300005329 Ga0070683_100091044 Ga0070683_1000910441 272
49 3300005344 Ga0070661_100077201 Ga0070661_1000772013 272
50 3300005535 Ga0070684_100036825 Ga0070684_1000368256 272
51 3300005539 Ga0068853_100358276 Ga0068853_1003582762 272
52 3300005614 Ga0068856_100070577 Ga0068856_1000705774 272
53 3300005616 Ga0068852_100073144 Ga0068852_1000731441 272
54 3300005985 Ga0081539_10000040 Ga0081539_1000004078 272
55 3300009174 Ga0105241_10016275 Ga0105241_100162757 272
56 3300009551 Ga0105238_10045861 Ga0105238_100458615 272
57 3300013105 Ga0157369_10177141 Ga0157369_101771412 272
58 3300013307 Ga0157372_10050625 Ga0157372_100506252 272
59 3300025912 Ga0207707_10305510 Ga0207707_103055102 272
60 3300026041 Ga0207639_10168687 Ga0207639_101686872 272
61 3300026142 Ga0207698_10242596 Ga0207698_102425962 272
62 3300048915 Ga0496112_0000055 Ga0496112_0000055_36972_37862 272
63 iso_pu_bacteria 2511231031 2511412531 272
64 iso_pu_bacteria 8002060224 8002061099 272
65 iso_pu_bacteria 8056569372 8056570726 272
66 3300003203 JGI25406J46586_10015153 JGI25406J46586_100151533 273
67 3300005330 Ga0070690_100251059 Ga0070690_1002510591 273
68 3300005334 Ga0068869_100075691 Ga0068869_1000756912 273
69 3300005334 Ga0068869_100387811 Ga0068869_1003878112 273
70 3300005338 Ga0068868_100153156 Ga0068868_1001531561 273
71 3300005340 Ga0070689_100016859 Ga0070689_1000168596 273
72 3300005345 Ga0070692_10132575 Ga0070692_101325752 273
73 3300005354 Ga0070675_100314828 Ga0070675_1003148282 273
74 3300005356 Ga0070674_100182181 Ga0070674_1001821812 273
75 3300005434 Ga0070709_10071872 Ga0070709_100718721 273
76 3300005435 Ga0070714_100435311 Ga0070714_1004353112 273
77 3300005439 Ga0070711_100062091 Ga0070711_1000620913 273
78 3300005456 Ga0070678_100585302 Ga0070678_1005853021 273
79 3300005457 Ga0070662_100015950 Ga0070662_1000159507 273
80 3300005459 Ga0068867_100156807 Ga0068867_1001568074 273
81 3300005467 Ga0070706_100256463 Ga0070706_1002564632 273
82 3300005530 Ga0070679_100068280 Ga0070679_1000682803 273
83 3300005547 Ga0070693_100017104 Ga0070693_1000171042 273
84 3300005547 Ga0070693_100068195 Ga0070693_1000681951 273
85 3300005563 Ga0068855_100119768 Ga0068855_1001197682 273
86 3300005564 Ga0070664_100124158 Ga0070664_1001241582 273
87 3300005577 Ga0068857_100165300 Ga0068857_1001653002 273
88 3300005616 Ga0068852_100740716 Ga0068852_1007407161 273
89 3300005617 Ga0068859_100187733 Ga0068859_1001877332 273
90 3300005718 Ga0068866_10067040 Ga0068866_100670402 273
91 3300005842 Ga0068858_100020070 Ga0068858_1000200702 273
92 3300005843 Ga0068860_100160156 Ga0068860_1001601564 273
93 3300005843 Ga0068860_100205880 Ga0068860_1002058802 273
94 3300005937 Ga0081455_10001565 Ga0081455_1000156515 273
95 3300005937 Ga0081455_10023977 Ga0081455_100239776 273
96 3300005983 Ga0081540_1001934 Ga0081540_100193412 273
97 3300005983 Ga0081540_1006556 Ga0081540_10065563 273
98 3300005985 Ga0081539_10002516 Ga0081539_1000251612 273
99 3300006038 Ga0075365_10065664 Ga0075365_100656643 273
100 3300006042 Ga0075368_10012932 Ga0075368_100129323 273
101 3300006173 Ga0070716_100313125 Ga0070716_1003131252 273
102 3300006175 Ga0070712_100017293 Ga0070712_1000172931 273
103 3300006237 Ga0097621_100124098 Ga0097621_1001240985 273
104 3300006871 Ga0075434_100308820 Ga0075434_1003088202 273
105 3300006881 Ga0068865_100391653 Ga0068865_1003916532 273
106 3300006931 Ga0097620_100187745 Ga0097620_1001877452 273
107 3300009093 Ga0105240_10043796 Ga0105240_100437967 273
108 3300009093 Ga0105240_10348608 Ga0105240_103486082 273
109 3300009094 Ga0111539_10233241 Ga0111539_102332412 273
110 3300009176 Ga0105242_10007991 Ga0105242_100079917 273
111 3300009176 Ga0105242_10016771 Ga0105242_100167718 273
112 3300009176 Ga0105242_10084280 Ga0105242_100842802 273
113 3300009177 Ga0105248_10007983 Ga0105248_100079835 273
114 3300009177 Ga0105248_10356813 Ga0105248_103568132 273
115 3300009545 Ga0105237_10034338 Ga0105237_100343385 273
116 3300009545 Ga0105237_10038469 Ga0105237_100384694 273
117 3300009545 Ga0105237_10548970 Ga0105237_105489702 273
118 3300009551 Ga0105238_10037628 Ga0105238_100376285 273
119 3300009551 Ga0105238_10057078 Ga0105238_100570786 273
120 3300009551 Ga0105238_10678085 Ga0105238_106780851 273
121 3300009553 Ga0105249_10381216 Ga0105249_103812162 273
122 3300010375 Ga0105239_10137433 Ga0105239_101374333 273
123 3300010375 Ga0105239_10286555 Ga0105239_102865552 273
124 3300011119 Ga0105246_10079100 Ga0105246_100791003 273
125 3300013296 Ga0157374_10366504 Ga0157374_103665041 273
126 3300013297 Ga0157378_10094564 Ga0157378_100945643 273
127 3300013306 Ga0163162_10064022 Ga0163162_100640222 273
128 3300013306 Ga0163162_10388730 Ga0163162_103887302 273
129 3300013308 Ga0157375_10077771 Ga0157375_100777713 273
130 3300013308 Ga0157375_10206394 Ga0157375_102063942 273
131 3300014325 Ga0163163_10049458 Ga0163163_100494585 273
132 3300014325 Ga0163163_10063508 Ga0163163_100635084 273
133 3300014326 Ga0157380_10110506 Ga0157380_101105062 273
134 3300014968 Ga0157379_10439438 Ga0157379_104394382 273
135 3300025728 Ga0207655_1017118 Ga0207655_10171183 273
136 3300025898 Ga0207692_10046815 Ga0207692_100468152 273
137 3300025899 Ga0207642_10061668 Ga0207642_100616682 273
138 3300025911 Ga0207654_10295373 Ga0207654_102953732 273
139 3300025913 Ga0207695_10040274 Ga0207695_100402742 273
140 3300025914 Ga0207671_10216966 Ga0207671_102169662 273
141 3300025915 Ga0207693_10085746 Ga0207693_100857462 273
142 3300025921 Ga0207652_10289641 Ga0207652_102896412 273
143 3300025924 Ga0207694_10024306 Ga0207694_100243064 273
144 3300025933 Ga0207706_10002627 Ga0207706_1000262719 273
145 3300025933 Ga0207706_10314679 Ga0207706_103146792 273
146 3300025934 Ga0207686_10017329 Ga0207686_100173295 273
147 3300025937 Ga0207669_10197430 Ga0207669_101974303 273
148 3300025937 Ga0207669_10288491 Ga0207669_102884912 273
149 3300025938 Ga0207704_10048601 Ga0207704_100486013 273
150 3300025938 Ga0207704_10471942 Ga0207704_104719422 273
151 3300025939 Ga0207665_10009471 Ga0207665_100094714 273
152 3300025941 Ga0207711_10023085 Ga0207711_100230856 273
153 3300025941 Ga0207711_10204698 Ga0207711_102046982 273
154 3300025942 Ga0207689_10024310 Ga0207689_100243103 273
155 3300025945 Ga0207679_10270026 Ga0207679_102700262 273
156 3300026035 Ga0207703_10018789 Ga0207703_100187895 273
157 3300026035 Ga0207703_10416604 Ga0207703_104166042 273
158 3300026067 Ga0207678_10122751 Ga0207678_101227512 273
159 3300026089 Ga0207648_10328994 Ga0207648_103289941 273
160 3300026089 Ga0207648_10425335 Ga0207648_104253352 273
161 3300026116 Ga0207674_10009990 Ga0207674_1000999012 273
162 3300026121 Ga0207683_10116730 Ga0207683_101167301 273
163 3300026121 Ga0207683_10218267 Ga0207683_102182672 273
164 3300027671 Ga0209588_1031900 Ga0209588_10319002 273
165 3300028017 Ga0265356_1002334 Ga0265356_10023344 273
166 3300028379 Ga0268266_10136923 Ga0268266_101369233 273
167 3300028380 Ga0268265_10173213 Ga0268265_101732133 273
168 3300031239 Ga0265328_10000061 Ga0265328_1000006154 273
169 3300031239 Ga0265328_10000305 Ga0265328_1000030513 273
170 3300031239 Ga0265328_10127456 Ga0265328_101274561 273
171 3300031242 Ga0265329_10005533 Ga0265329_100055332 273
172 3300031250 Ga0265331_10001445 Ga0265331_1000144511 273
173 3300031251 Ga0265327_10013516 Ga0265327_100135162 273
174 3300031344 Ga0265316_10001750 Ga0265316_1000175013 273
175 3300031616 Ga0307508_10267428 Ga0307508_102674282 273
176 3300031712 Ga0265342_10117254 Ga0265342_101172542 273
177 3300035691 Ga0373931_0066820 Ga0373931_0066820_333_1172 273
178 3300037466 Ga0395898_0039339 Ga0395898_0039339_2675_3508 273
179 3300044673 Ga0453683_0010984 Ga0453683_0010984_4207_5046 273
180 3300044712 Ga0453684_0115171 Ga0453684_0115171_1601_2440 273
181 3300046452 Ga0495617_002531 Ga0495617_002531_3733_4578 273
182 3300046453 Ga0495627_000264 Ga0495627_000264_16516_17361 273
183 3300046462 Ga0495651_0161867 Ga0495651_0161867_222_1124 273
184 3300046500 Ga0495596_0005892 Ga0495596_0005892_1517_2362 273
185 3300046513 Ga0495616_0002509 Ga0495616_0002509_3613_4458 273
186 3300046519 Ga0495632_0000326 Ga0495632_0000326_16694_17539 273
187 3300046520 Ga0495637_0000299 Ga0495637_0000299_16527_17372 273
188 3300046520 Ga0495637_0000636 Ga0495637_0000636_3433_4278 273
189 3300046524 Ga0495648_0001787 Ga0495648_0001787_17566_18411 273
190 3300046615 Ga0495656_0076095 Ga0495656_0076095_527_1417 273
191 3300046616 Ga0495668_0005067 Ga0495668_0005067_5688_6533 273
192 3300046660 Ga0495625_0004643 Ga0495625_0004643_1082_1927 273
193 3300046660 Ga0495625_0034589 Ga0495625_0034589_1176_2021 273
194 3300046665 Ga0495661_0002717 Ga0495661_0002717_7162_8007 273
195 3300046665 Ga0495661_0026583 Ga0495661_0026583_909_1754 273
196 3300046680 Ga0495646_0257242 Ga0495646_0257242_35_880 273
197 3300047320 Ga0495672_0008975 Ga0495672_0008975_1519_2364 273
198 3300047320 Ga0495672_0191705 Ga0495672_0191705_29_880 273
199 3300047323 Ga0495683_0010558 Ga0495683_0010558_1066_1911 273
200 3300047470 Ga0495681_0000238 Ga0495681_0000238_15123_15968 273
201 3300047472 Ga0495686_0001767 Ga0495686_0001767_903_1748 273
202 3300048913 Ga0496110_0157635 Ga0496110_0157635_794_1693 273
203 3300048915 Ga0496112_0400274 Ga0496112_0400274_63_950 273
204 3300048919 Ga0496116_0000761 Ga0496116_0000761_20129_20974 273
205 3300048922 Ga0496119_0086096 Ga0496119_0086096_440_1342 273
206 3300048928 Ga0496125_0091688 Ga0496125_0091688_919_1821 273
207 3300048929 Ga0496126_0060848 Ga0496126_0060848_1306_2208 273
208 3300048929 Ga0496126_0466137 Ga0496126_0466137_100_1002 273
209 3300049577 Ga0501041_0025566 Ga0501041_0025566_1227_2078 273
210 3300049581 Ga0501047_0168663 Ga0501047_0168663_454_1305 273
211 3300049582 Ga0501048_0060023 Ga0501048_0060023_1740_2591 273
212 3300049591 Ga0501075_0023911 Ga0501075_0023911_1672_2523 273
213 3300049593 Ga0501077_0052003 Ga0501077_0052003_829_1680 273
214 3300050510 nmdc:mga06r32_219083_c1 nmdc:mga06r32_219083_c1_27_878 273
215 3300050512 nmdc:mga0n895_163658_c1 nmdc:mga0n895_163658_c1_234_1124 273
216 3300053083 Ga0495655_0000348 Ga0495655_0000348_1801_2655 273
217 3300053098 Ga0500650_0041975 Ga0500650_0041975_339_1190 273
218 3300053108 Ga0500562_019336 Ga0500562_019336_339_1190 273
219 3300053139 Ga0500568_0026140 Ga0500568_0026140_796_1647 273
220 3300053139 Ga0500568_0037166 Ga0500568_0037166_521_1372 273
221 3300053139 Ga0500568_0040551 Ga0500568_0040551_141_992 273
222 3300053151 Ga0500604_0052160 Ga0500604_0052160_94_945 273
223 3300053156 Ga0500622_0006697 Ga0500622_0006697_3069_3920 273
224 iso_pu_bacteria 2909042592 2909044149 273
225 iso_pu_bacteria 2928531327 2928535604 273
226 3300003215 JGI25153J46596_10005034 JGI25153J46596_100050345 274
227 3300005328 Ga0070676_10183365 Ga0070676_101833652 274
228 3300005330 Ga0070690_100020167 Ga0070690_1000201674 274
229 3300005334 Ga0068869_100239963 Ga0068869_1002399631 274
230 3300005336 Ga0070680_100078816 Ga0070680_1000788163 274
231 3300005338 Ga0068868_100098697 Ga0068868_1000986973 274
232 3300005339 Ga0070660_100512165 Ga0070660_1005121651 274
233 3300005340 Ga0070689_100269226 Ga0070689_1002692262 274
234 3300005341 Ga0070691_10146074 Ga0070691_101460741 274
235 3300005343 Ga0070687_100034677 Ga0070687_1000346772 274
236 3300005347 Ga0070668_100551171 Ga0070668_1005511711 274
237 3300005356 Ga0070674_100302054 Ga0070674_1003020542 274
238 3300005366 Ga0070659_100378629 Ga0070659_1003786291 274
239 3300005367 Ga0070667_100115137 Ga0070667_1001151372 274
240 3300005438 Ga0070701_10035114 Ga0070701_100351142 274
241 3300005444 Ga0070694_100345984 Ga0070694_1003459841 274
242 3300005455 Ga0070663_100013602 Ga0070663_1000136025 274
243 3300005455 Ga0070663_100056093 Ga0070663_1000560933 274
244 3300005455 Ga0070663_100065062 Ga0070663_1000650623 274
245 3300005455 Ga0070663_100097899 Ga0070663_1000978992 274
246 3300005455 Ga0070663_100159847 Ga0070663_1001598472 274
247 3300005455 Ga0070663_100222666 Ga0070663_1002226661 274
248 3300005456 Ga0070678_100042538 Ga0070678_1000425382 274
249 3300005456 Ga0070678_100153543 Ga0070678_1001535431 274
250 3300005518 Ga0070699_100079053 Ga0070699_1000790533 274
251 3300005543 Ga0070672_100045754 Ga0070672_1000457543 274
252 3300005544 Ga0070686_100082537 Ga0070686_1000825372 274
253 3300005544 Ga0070686_100246696 Ga0070686_1002466962 274
254 3300005545 Ga0070695_100046693 Ga0070695_1000466932 274
255 3300005547 Ga0070693_100031872 Ga0070693_1000318723 274
256 3300005547 Ga0070693_100112553 Ga0070693_1001125532 274
257 3300005548 Ga0070665_100023807 Ga0070665_1000238074 274
258 3300005548 Ga0070665_100032508 Ga0070665_1000325083 274
259 3300005548 Ga0070665_100488953 Ga0070665_1004889532 274
260 3300005548 Ga0070665_100641719 Ga0070665_1006417191 274
261 3300005563 Ga0068855_100184199 Ga0068855_1001841994 274
262 3300005578 Ga0068854_100377213 Ga0068854_1003772131 274
263 3300005614 Ga0068856_100110301 Ga0068856_1001103014 274
264 3300005615 Ga0070702_100087054 Ga0070702_1000870542 274
265 3300005615 Ga0070702_100107814 Ga0070702_1001078142 274
266 3300005615 Ga0070702_100188045 Ga0070702_1001880452 274
267 3300005615 Ga0070702_100322842 Ga0070702_1003228421 274
268 3300005616 Ga0068852_100287366 Ga0068852_1002873662 274
269 3300005618 Ga0068864_100092449 Ga0068864_1000924494 274
270 3300005719 Ga0068861_100200551 Ga0068861_1002005513 274
271 3300005840 Ga0068870_10159417 Ga0068870_101594172 274
272 3300005841 Ga0068863_100216746 Ga0068863_1002167462 274
273 3300005842 Ga0068858_100053290 Ga0068858_1000532904 274
274 3300005842 Ga0068858_100356005 Ga0068858_1003560052 274
275 3300005843 Ga0068860_100068705 Ga0068860_1000687053 274
276 3300005843 Ga0068860_100194817 Ga0068860_1001948174 274
277 3300005843 Ga0068860_100397843 Ga0068860_1003978432 274
278 3300005844 Ga0068862_100135682 Ga0068862_1001356823 274
279 3300005937 Ga0081455_10004842 Ga0081455_1000484213 274
280 3300005937 Ga0081455_10005486 Ga0081455_100054867 274
281 3300005937 Ga0081455_10025617 Ga0081455_100256173 274
282 3300005981 Ga0081538_10051765 Ga0081538_100517652 274
283 3300005983 Ga0081540_1002260 Ga0081540_100226010 274
284 3300005983 Ga0081540_1004844 Ga0081540_10048442 274
285 3300005983 Ga0081540_1006350 Ga0081540_10063508 274
286 3300005983 Ga0081540_1042269 Ga0081540_10422694 274
287 3300005985 Ga0081539_10052497 Ga0081539_100524973 274
288 3300006048 Ga0075363_100213502 Ga0075363_1002135022 274
289 3300006186 Ga0075369_10012643 Ga0075369_100126434 274
290 3300006195 Ga0075366_10193729 Ga0075366_101937292 274
291 3300006237 Ga0097621_100059494 Ga0097621_1000594942 274
292 3300006844 Ga0075428_100181146 Ga0075428_1001811463 274
293 3300006844 Ga0075428_100211480 Ga0075428_1002114802 274
294 3300006846 Ga0075430_100048637 Ga0075430_1000486374 274
295 3300006847 Ga0075431_100166626 Ga0075431_1001666262 274
296 3300006871 Ga0075434_100150993 Ga0075434_1001509933 274
297 3300006881 Ga0068865_100009816 Ga0068865_1000098164 274
298 3300006881 Ga0068865_100127092 Ga0068865_1001270922 274
299 3300007788 Ga0099795_10105581 Ga0099795_101055812 274
300 3300009098 Ga0105245_10048588 Ga0105245_100485882 274
301 3300009098 Ga0105245_10341805 Ga0105245_103418052 274
302 3300009101 Ga0105247_10085085 Ga0105247_100850852 274
303 3300009101 Ga0105247_10292969 Ga0105247_102929691 274
304 3300009147 Ga0114129_10079787 Ga0114129_100797875 274
305 3300009148 Ga0105243_10331838 Ga0105243_103318381 274
306 3300009174 Ga0105241_10045394 Ga0105241_100453944 274
307 3300009174 Ga0105241_10245421 Ga0105241_102454212 274
308 3300009177 Ga0105248_10132530 Ga0105248_101325304 274
309 3300009545 Ga0105237_10610675 Ga0105237_106106751 274
310 3300009551 Ga0105238_10218265 Ga0105238_102182652 274
311 3300009553 Ga0105249_10056577 Ga0105249_100565774 274
312 3300010375 Ga0105239_10287340 Ga0105239_102873402 274
313 3300012513 Ga0157326_1008196 Ga0157326_10081961 274
314 3300013100 Ga0157373_10327913 Ga0157373_103279131 274
315 3300013296 Ga0157374_10081673 Ga0157374_100816732 274
316 3300013297 Ga0157378_10034001 Ga0157378_100340012 274
317 3300013297 Ga0157378_10348838 Ga0157378_103488382 274
318 3300013306 Ga0163162_10179442 Ga0163162_101794422 274
319 3300013307 Ga0157372_10333153 Ga0157372_103331532 274
320 3300013308 Ga0157375_10007526 Ga0157375_100075264 274
321 3300014325 Ga0163163_10032740 Ga0163163_100327404 274
322 3300014326 Ga0157380_10085162 Ga0157380_100851622 274
323 3300014326 Ga0157380_10116556 Ga0157380_101165562 274
324 3300014326 Ga0157380_10186199 Ga0157380_101861992 274
325 3300014968 Ga0157379_10024010 Ga0157379_100240105 274
326 3300014969 Ga0157376_10016754 Ga0157376_100167543 274
327 3300025297 Ga0209758_1006284 Ga0209758_10062844 274
328 3300025297 Ga0209758_1006935 Ga0209758_10069352 274
329 3300025899 Ga0207642_10320096 Ga0207642_103200961 274
330 3300025901 Ga0207688_10009671 Ga0207688_100096712 274
331 3300025903 Ga0207680_10138589 Ga0207680_101385892 274
332 3300025904 Ga0207647_10138492 Ga0207647_101384922 274
333 3300025907 Ga0207645_10023160 Ga0207645_100231602 274
334 3300025908 Ga0207643_10074115 Ga0207643_100741152 274
335 3300025911 Ga0207654_10071490 Ga0207654_100714902 274
336 3300025918 Ga0207662_10008870 Ga0207662_100088705 274
337 3300025927 Ga0207687_10091805 Ga0207687_100918053 274
338 3300025927 Ga0207687_10136303 Ga0207687_101363032 274
339 3300025933 Ga0207706_10013775 Ga0207706_100137752 274
340 3300025935 Ga0207709_10245453 Ga0207709_102454532 274
341 3300025935 Ga0207709_10319731 Ga0207709_103197312 274
342 3300025936 Ga0207670_10043926 Ga0207670_100439264 274
343 3300025937 Ga0207669_10025214 Ga0207669_100252143 274
344 3300025938 Ga0207704_10097094 Ga0207704_100970943 274
345 3300025940 Ga0207691_10031739 Ga0207691_100317394 274
346 3300025940 Ga0207691_10599668 Ga0207691_105996681 274
347 3300025941 Ga0207711_10041147 Ga0207711_100411472 274
348 3300025949 Ga0207667_10168344 Ga0207667_101683442 274
349 3300025961 Ga0207712_10046748 Ga0207712_100467484 274
350 3300025961 Ga0207712_10091256 Ga0207712_100912563 274
351 3300025972 Ga0207668_10242019 Ga0207668_102420192 274
352 3300025986 Ga0207658_10130696 Ga0207658_101306963 274
353 3300026023 Ga0207677_10306387 Ga0207677_103063872 274
354 3300026035 Ga0207703_10053526 Ga0207703_100535264 274
355 3300026035 Ga0207703_10406349 Ga0207703_104063492 274
356 3300026067 Ga0207678_10029116 Ga0207678_100291164 274
357 3300026075 Ga0207708_10014035 Ga0207708_100140355 274
358 3300026078 Ga0207702_10102076 Ga0207702_101020764 274
359 3300026078 Ga0207702_10166680 Ga0207702_101666802 274
360 3300026088 Ga0207641_10168360 Ga0207641_101683602 274
361 3300026095 Ga0207676_10090503 Ga0207676_100905034 274
362 3300026118 Ga0207675_100207607 Ga0207675_1002076072 274
363 3300026121 Ga0207683_10028448 Ga0207683_100284484 274
364 3300026121 Ga0207683_10271848 Ga0207683_102718482 274
365 3300028379 Ga0268266_10011766 Ga0268266_100117663 274
366 3300028379 Ga0268266_10051335 Ga0268266_100513354 274
367 3300028380 Ga0268265_10187328 Ga0268265_101873282 274
368 3300028380 Ga0268265_10357673 Ga0268265_103576732 274
369 3300028381 Ga0268264_10287733 Ga0268264_102877332 274
370 3300028786 Ga0307517_10074853 Ga0307517_100748533 274
371 3300031665 Ga0316575_10065222 Ga0316575_100652221 274
372 3300031731 Ga0307405_10200013 Ga0307405_102000132 274
373 3300031901 Ga0307406_10083326 Ga0307406_100833262 274
374 3300031901 Ga0307406_10192287 Ga0307406_101922872 274
375 3300031901 Ga0307406_10226588 Ga0307406_102265882 274
376 3300032004 Ga0307414_10372349 Ga0307414_103723491 274
377 3300032126 Ga0307415_100160411 Ga0307415_1001604113 274
378 3300033180 Ga0307510_10011080 Ga0307510_100110807 274
379 3300035398 Ga0316574_0048385 Ga0316574_0048385_795_1706 274
380 3300035695 Ga0373927_0038026 Ga0373927_0038026_1841_2740 274
381 3300036647 Ga0316582_0047808 Ga0316582_0047808_540_1394 274
382 3300037466 Ga0395898_0131235 Ga0395898_0131235_763_1668 274
383 3300037471 Ga0395905_0029346 Ga0395905_0029346_3392_4285 274
384 3300037588 Ga0316581_0013616 Ga0316581_0013616_946_1824 274
385 3300038443 Ga0395901_0067826 Ga0395901_0067826_1255_2148 274
386 3300041413 Ga0439465_0099112 Ga0439465_0099112_58_960 274
387 3300041452 Ga0451793_1474675 Ga0451793_1474675_11_886 274
388 3300042876 Ga0451577_0084294 Ga0451577_0084294_1410_2258 274
389 3300046455 Ga0495603_0004325 Ga0495603_0004325_5593_6498 274
390 3300046459 Ga0495629_0244840 Ga0495629_0244840_307_1200 274
391 3300046460 Ga0495638_0032968 Ga0495638_0032968_1087_1992 274
392 3300046460 Ga0495638_0146501 Ga0495638_0146501_120_1076 274
393 3300046475 Ga0495639_0058898 Ga0495639_0058898_586_1491 274
394 3300046492 Ga0495585_0023997 Ga0495585_0023997_1633_2538 274
395 3300046492 Ga0495585_0113881 Ga0495585_0113881_195_1100 274
396 3300046507 Ga0495606_0003543 Ga0495606_0003543_27_974 274
397 3300046518 Ga0495631_0072644 Ga0495631_0072644_213_1106 274
398 3300046558 Ga0495633_0152413 Ga0495633_0152413_72_977 274
399 3300046615 Ga0495656_0062004 Ga0495656_0062004_634_1539 274
400 3300046660 Ga0495625_0184301 Ga0495625_0184301_65_958 274
401 3300046684 Ga0495669_0003990 Ga0495669_0003990_1970_2872 274
402 3300046691 Ga0495670_0124107 Ga0495670_0124107_469_1329 274
403 3300046692 Ga0495671_0090522 Ga0495671_0090522_291_1196 274
404 3300046694 Ga0495649_0151045 Ga0495649_0151045_205_1098 274
405 3300047445 Ga0495677_0015067 Ga0495677_0015067_517_1419 274
406 3300047472 Ga0495686_0136371 Ga0495686_0136371_232_1122 274
407 3300047673 Ga0495593_0092444 Ga0495593_0092444_359_1252 274
408 3300048903 Ga0496100_0025224 Ga0496100_0025224_385_1239 274
409 3300048905 Ga0496102_0201977 Ga0496102_0201977_743_1591 274
410 3300048905 Ga0496102_0254822 Ga0496102_0254822_196_1047 274
411 3300048907 Ga0496104_0015566 Ga0496104_0015566_2868_3722 274
412 3300048909 Ga0496106_0032016 Ga0496106_0032016_635_1489 274
413 3300048909 Ga0496106_0119673 Ga0496106_0119673_46_897 274
414 3300048909 Ga0496106_0230865 Ga0496106_0230865_523_1455 274
415 3300048910 Ga0496107_0036371 Ga0496107_0036371_2460_3365 274
416 3300048911 Ga0496108_0008883 Ga0496108_0008883_6247_7179 274
417 3300048911 Ga0496108_0035589 Ga0496108_0035589_2141_2995 274
418 3300048912 Ga0496109_0003474 Ga0496109_0003474_1341_2195 274
419 3300048912 Ga0496109_0144708 Ga0496109_0144708_269_1123 274
420 3300048913 Ga0496110_0117190 Ga0496110_0117190_184_1038 274
421 3300048914 Ga0496111_0135494 Ga0496111_0135494_340_1191 274
422 3300048915 Ga0496112_0009509 Ga0496112_0009509_2112_2966 274
423 3300048915 Ga0496112_0360210 Ga0496112_0360210_273_1205 274
424 3300048916 Ga0496113_0053156 Ga0496113_0053156_1379_2233 274
425 3300048916 Ga0496113_0074739 Ga0496113_0074739_1338_2270 274
426 3300048917 Ga0496114_0001073 Ga0496114_0001073_6368_7222 274
427 3300048918 Ga0496115_0043332 Ga0496115_0043332_1496_2407 274
428 3300048924 Ga0496121_0035863 Ga0496121_0035863_2533_3465 274
429 3300048924 Ga0496121_0078506 Ga0496121_0078506_1009_1857 274
430 3300048929 Ga0496126_0018245 Ga0496126_0018245_4391_5284 274
431 3300049569 Ga0501032_0097298 Ga0501032_0097298_117_971 274
432 3300049572 Ga0501036_0058510 Ga0501036_0058510_1637_2491 274
433 3300049572 Ga0501036_0118227 Ga0501036_0118227_1352_2206 274
434 3300049572 Ga0501036_0392298 Ga0501036_0392298_272_1123 274
435 3300049573 Ga0501037_0330602 Ga0501037_0330602_12_866 274
436 3300049574 Ga0501038_0222595 Ga0501038_0222595_236_1090 274
437 3300049575 Ga0501039_0044907 Ga0501039_0044907_908_1762 274
438 3300049575 Ga0501039_0149845 Ga0501039_0149845_100_951 274
439 3300049576 Ga0501040_0018011 Ga0501040_0018011_1084_1935 274
440 3300049576 Ga0501040_0069117 Ga0501040_0069117_761_1624 274
441 3300049577 Ga0501041_0007187 Ga0501041_0007187_573_1436 274
442 3300049577 Ga0501041_0019329 Ga0501041_0019329_1975_2826 274
443 3300049577 Ga0501041_0031889 Ga0501041_0031889_476_1330 274
444 3300049578 Ga0501042_0132874 Ga0501042_0132874_273_1124 274
445 3300049578 Ga0501042_0145685 Ga0501042_0145685_121_984 274
446 3300049578 Ga0501042_0172787 Ga0501042_0172787_394_1242 274
447 3300049578 Ga0501042_0221612 Ga0501042_0221612_345_1247 274
448 3300049579 Ga0501043_0237949 Ga0501043_0237949_162_1013 274
449 3300049580 Ga0501046_0173529 Ga0501046_0173529_37_900 274
450 3300049580 Ga0501046_0191132 Ga0501046_0191132_263_1117 274
451 3300049580 Ga0501046_0201033 Ga0501046_0201033_583_1434 274
452 3300049583 Ga0501067_0094161 Ga0501067_0094161_716_1648 274
453 3300049584 Ga0501068_0077716 Ga0501068_0077716_816_1670 274
454 3300049587 Ga0501071_0006808 Ga0501071_0006808_1060_1914 274
455 3300049587 Ga0501071_0101966 Ga0501071_0101966_1234_2097 274
456 3300049588 Ga0501072_0055865 Ga0501072_0055865_1390_2253 274
457 3300049588 Ga0501072_0081665 Ga0501072_0081665_926_1777 274
458 3300049588 Ga0501072_0094188 Ga0501072_0094188_299_1153 274
459 3300049590 Ga0501074_0029568 Ga0501074_0029568_1242_2105 274
460 3300049591 Ga0501075_0110772 Ga0501075_0110772_636_1487 274
461 3300049591 Ga0501075_0175378 Ga0501075_0175378_372_1226 274
462 3300049592 Ga0501076_0132128 Ga0501076_0132128_469_1374 274
463 3300049592 Ga0501076_0135960 Ga0501076_0135960_257_1111 274
464 3300049592 Ga0501076_0281549 Ga0501076_0281549_121_972 274
465 3300049593 Ga0501077_0017078 Ga0501077_0017078_2623_3477 274
466 3300049593 Ga0501077_0065354 Ga0501077_0065354_789_1643 274
467 3300049593 Ga0501077_0166473 Ga0501077_0166473_468_1319 274
468 3300049741 Ga0501079_0201737 Ga0501079_0201737_116_979 274
469 3300049741 Ga0501079_0221742 Ga0501079_0221742_526_1380 274
470 3300049741 Ga0501079_0467667 Ga0501079_0467667_71_922 274
471 3300049743 Ga0501081_0042249 Ga0501081_0042249_1678_2532 274
472 3300049744 Ga0501083_0076336 Ga0501083_0076336_541_1395 274
473 3300049822 Ga0501035_0083881 Ga0501035_0083881_210_1073 274
474 3300049824 Ga0501045_0018756 Ga0501045_0018756_680_1543 274
475 3300049824 Ga0501045_0032303 Ga0501045_0032303_1500_2354 274
476 3300049824 Ga0501045_0046763 Ga0501045_0046763_800_1651 274
477 3300049824 Ga0501045_0210803 Ga0501045_0210803_462_1316 274
478 3300049824 Ga0501045_0246539 Ga0501045_0246539_30_881 274
479 3300050489 nmdc:mga03683_75246_c1 nmdc:mga03683_75246_c1_176_1081 274
480 3300050490 nmdc:mga03n38_81441_c1 nmdc:mga03n38_81441_c1_516_1421 274
481 3300050494 nmdc:mga06z11_58418_c1 nmdc:mga06z11_58418_c1_963_1868 274
482 3300050495 nmdc:mga04h51_46251_c1 nmdc:mga04h51_46251_c1_476_1381 274
483 3300050496 nmdc:mga07m45_138574_c1 nmdc:mga07m45_138574_c1_45_950 274
484 3300050507 nmdc:mga05p37_114611_c1 nmdc:mga05p37_114611_c1_654_1562 274
485 3300050507 nmdc:mga05p37_386924_c1 nmdc:mga05p37_386924_c1_473_1327 274
486 3300050509 nmdc:mga0qj67_61672_c1 nmdc:mga0qj67_61672_c1_1259_2113 274
487 3300050510 nmdc:mga06r32_264328_c1 nmdc:mga06r32_264328_c1_369_1223 274
488 3300050511 nmdc:mga08y16_121135_c1 nmdc:mga08y16_121135_c1_1107_1961 274
489 3300050512 nmdc:mga0n895_396533_c1 nmdc:mga0n895_396533_c1_192_1124 274
490 3300050516 nmdc:mga0sz30_17755_c1 nmdc:mga0sz30_17755_c1_1330_2238 274
491 3300050516 nmdc:mga0sz30_99433_c1 nmdc:mga0sz30_99433_c1_173_1078 274
492 3300053077 Ga0495601_0008374 Ga0495601_0008374_1559_2413 274
493 3300053096 Ga0500641_0048888 Ga0500641_0048888_316_1233 274
494 3300053119 Ga0500595_010273 Ga0500595_010273_1524_2417 274
495 3300053158 Ga0500627_0082835 Ga0500627_0082835_191_1096 274
496 3300054114 Ga0501084_0078234 Ga0501084_0078234_868_1722 274
497 3300054114 Ga0501084_0175213 Ga0501084_0175213_719_1582 274
498 3300054114 Ga0501084_0272944 Ga0501084_0272944_161_1012 274
499 3300054114 Ga0501084_0386602 Ga0501084_0386602_44_895 274
500 3300060353 Ga0501082_0029246 Ga0501082_0029246_1613_2476 274
501 3300060353 Ga0501082_0049411 Ga0501082_0049411_803_1654 274
502 3300060353 Ga0501082_0126941 Ga0501082_0126941_1012_1866 274
503 3300060353 Ga0501082_0169902 Ga0501082_0169902_78_932 274
504 3300061734 Ga0530510_0015111 Ga0530510_0015111_1995_2846 274
505 3300061734 Ga0530510_0026282 Ga0530510_0026282_1632_2486 274
506 3300061734 Ga0530510_0097764 Ga0530510_0097764_842_1705 274
507 3300061734 Ga0530510_0139829 Ga0530510_0139829_50_901 274
508 3300061734 Ga0530510_0244270 Ga0530510_0244270_14_916 274
509 iso_pu_bacteria 2513237101 2513697397 274
510 iso_pu_bacteria 2524023228 2524534453 274
511 iso_pu_bacteria 2721755755 2723843112 274
512 iso_pu_bacteria 2791355197 2793071181 274
513 iso_pu_bacteria 2791355199 2793079481 274
514 iso_pu_bacteria 2874604998 2874612556 274
515 iso_pu_bacteria 2876808645 2876813749 274
516 iso_pu_bacteria 2879110137 2879118002 274
517 iso_pu_bacteria 2889033259 2889033587 274
518 iso_pu_bacteria 2904699407 2904705749 274
519 iso_pu_bacteria 2906610324 2906611430 274
520 iso_pu_bacteria 2922361189 2922366957 274
521 iso_pu_bacteria 2922386360 2922390266 274
522 iso_pu_bacteria 2922425934 2922427928 274
523 iso_pu_bacteria 8006964411 8006966492 274
524 iso_pu_bacteria 8006984368 8006989318 274
525 iso_pu_bacteria 8006994254 8006997802 274
526 iso_pu_bacteria 8019555841 8019559510 274
527 iso_pu_bacteria 8019565922 8019569613 274
528 iso_pu_bacteria 8056673599 8056674837 274
529 3300005327 Ga0070658_10074612 Ga0070658_100746123 275
530 3300005328 Ga0070676_10006855 Ga0070676_100068555 275
531 3300005330 Ga0070690_100259359 Ga0070690_1002593592 275
532 3300005331 Ga0070670_100017668 Ga0070670_1000176686 275
533 3300005333 Ga0070677_10047505 Ga0070677_100475051 275
534 3300005334 Ga0068869_100004961 Ga0068869_1000049614 275
535 3300005335 Ga0070666_10028516 Ga0070666_100285163 275
536 3300005335 Ga0070666_10035673 Ga0070666_100356733 275
537 3300005336 Ga0070680_100171282 Ga0070680_1001712822 275
538 3300005338 Ga0068868_100005707 Ga0068868_1000057075 275
539 3300005339 Ga0070660_100483122 Ga0070660_1004831221 275
540 3300005343 Ga0070687_100039822 Ga0070687_1000398222 275
541 3300005344 Ga0070661_100105908 Ga0070661_1001059083 275
542 3300005347 Ga0070668_100293763 Ga0070668_1002937632 275
543 3300005353 Ga0070669_100006355 Ga0070669_1000063555 275
544 3300005354 Ga0070675_100000821 Ga0070675_1000008215 275
545 3300005354 Ga0070675_100170775 Ga0070675_1001707752 275
546 3300005356 Ga0070674_100002542 Ga0070674_1000025426 275
547 3300005364 Ga0070673_100003576 Ga0070673_1000035765 275
548 3300005365 Ga0070688_100332909 Ga0070688_1003329092 275
549 3300005436 Ga0070713_100217617 Ga0070713_1002176172 275
550 3300005444 Ga0070694_100182487 Ga0070694_1001824872 275
551 3300005455 Ga0070663_100161774 Ga0070663_1001617742 275
552 3300005456 Ga0070678_100022351 Ga0070678_1000223513 275
553 3300005456 Ga0070678_100485616 Ga0070678_1004856161 275
554 3300005457 Ga0070662_100022033 Ga0070662_1000220334 275
555 3300005458 Ga0070681_10030752 Ga0070681_100307523 275
556 3300005466 Ga0070685_10044247 Ga0070685_100442472 275
557 3300005518 Ga0070699_100192435 Ga0070699_1001924351 275
558 3300005530 Ga0070679_100022047 Ga0070679_1000220477 275
559 3300005539 Ga0068853_100435278 Ga0068853_1004352781 275
560 3300005543 Ga0070672_100010911 Ga0070672_1000109114 275
561 3300005547 Ga0070693_100027871 Ga0070693_1000278713 275
562 3300005548 Ga0070665_100177036 Ga0070665_1001770362 275
563 3300005563 Ga0068855_100019007 Ga0068855_1000190073 275
564 3300005563 Ga0068855_100061422 Ga0068855_1000614225 275
565 3300005564 Ga0070664_100011714 Ga0070664_1000117144 275
566 3300005577 Ga0068857_100264293 Ga0068857_1002642932 275
567 3300005614 Ga0068856_100331805 Ga0068856_1003318052 275
568 3300005616 Ga0068852_100010493 Ga0068852_1000104936 275
569 3300005616 Ga0068852_100745225 Ga0068852_1007452251 275
570 3300005617 Ga0068859_100002138 Ga0068859_1000021382 275
571 3300005618 Ga0068864_100034925 Ga0068864_1000349254 275
572 3300005719 Ga0068861_100059201 Ga0068861_1000592012 275
573 3300005842 Ga0068858_100002574 Ga0068858_10000257418 275
574 3300005937 Ga0081455_10109038 Ga0081455_101090382 275
575 3300005983 Ga0081540_1000780 Ga0081540_10007808 275
576 3300006038 Ga0075365_10107719 Ga0075365_101077191 275
577 3300006237 Ga0097621_100013398 Ga0097621_1000133986 275
578 3300006852 Ga0075433_10423792 Ga0075433_104237921 275
579 3300006871 Ga0075434_100282382 Ga0075434_1002823822 275
580 3300006881 Ga0068865_100006360 Ga0068865_1000063605 275
581 3300006931 Ga0097620_100002138 Ga0097620_1000021382 275
582 3300007265 Ga0099794_10002060 Ga0099794_100020602 275
583 3300009093 Ga0105240_10040900 Ga0105240_100409005 275
584 3300009094 Ga0111539_10005949 Ga0111539_100059495 275
585 3300009094 Ga0111539_10034475 Ga0111539_100344753 275
586 3300009147 Ga0114129_10337361 Ga0114129_103373612 275
587 3300009545 Ga0105237_10016097 Ga0105237_100160974 275
588 3300009545 Ga0105237_10152385 Ga0105237_101523852 275
589 3300009553 Ga0105249_10005056 Ga0105249_100050567 275
590 3300010375 Ga0105239_10025154 Ga0105239_100251542 275
591 3300010375 Ga0105239_10039281 Ga0105239_100392814 275
592 3300010375 Ga0105239_10039841 Ga0105239_100398413 275
593 3300011119 Ga0105246_10042417 Ga0105246_100424174 275
594 3300013102 Ga0157371_10150770 Ga0157371_101507702 275
595 3300013104 Ga0157370_10062592 Ga0157370_100625923 275
596 3300013296 Ga0157374_10011568 Ga0157374_100115683 275
597 3300013296 Ga0157374_10058276 Ga0157374_100582764 275
598 3300013297 Ga0157378_10026784 Ga0157378_100267845 275
599 3300013306 Ga0163162_10576566 Ga0163162_105765662 275
600 3300013308 Ga0157375_10001227 Ga0157375_100012276 275
601 3300013308 Ga0157375_10013332 Ga0157375_100133327 275
602 3300014325 Ga0163163_10013878 Ga0163163_100138783 275
603 3300014326 Ga0157380_10029092 Ga0157380_100290926 275
604 3300014968 Ga0157379_10073293 Ga0157379_100732932 275
605 3300014968 Ga0157379_10355004 Ga0157379_103550042 275
606 3300014969 Ga0157376_10113593 Ga0157376_101135933 275
607 3300025903 Ga0207680_10064647 Ga0207680_100646473 275
608 3300025907 Ga0207645_10010075 Ga0207645_100100756 275
609 3300025912 Ga0207707_10025800 Ga0207707_100258004 275
610 3300025914 Ga0207671_10190124 Ga0207671_101901242 275
611 3300025917 Ga0207660_10054655 Ga0207660_100546554 275
612 3300025918 Ga0207662_10060786 Ga0207662_100607862 275
613 3300025919 Ga0207657_10410742 Ga0207657_104107421 275
614 3300025920 Ga0207649_10008104 Ga0207649_100081044 275
615 3300025921 Ga0207652_10176872 Ga0207652_101768722 275
616 3300025923 Ga0207681_10151091 Ga0207681_101510912 275
617 3300025923 Ga0207681_10349804 Ga0207681_103498042 275
618 3300025925 Ga0207650_10104192 Ga0207650_101041923 275
619 3300025926 Ga0207659_10001567 Ga0207659_1000156712 275
620 3300025926 Ga0207659_10124561 Ga0207659_101245613 275
621 3300025932 Ga0207690_10236481 Ga0207690_102364813 275
622 3300025933 Ga0207706_10008600 Ga0207706_100086003 275
623 3300025935 Ga0207709_10442794 Ga0207709_104427941 275
624 3300025936 Ga0207670_10004848 Ga0207670_100048482 275
625 3300025937 Ga0207669_10004441 Ga0207669_100044412 275
626 3300025937 Ga0207669_10029792 Ga0207669_100297923 275
627 3300025938 Ga0207704_10001245 Ga0207704_100012457 275
628 3300025940 Ga0207691_10026799 Ga0207691_100267993 275
629 3300025941 Ga0207711_10001337 Ga0207711_1000133718 275
630 3300025942 Ga0207689_10005212 Ga0207689_1000521210 275
631 3300025945 Ga0207679_10023667 Ga0207679_100236672 275
632 3300025945 Ga0207679_10043202 Ga0207679_100432024 275
633 3300025960 Ga0207651_10002235 Ga0207651_100022355 275
634 3300025961 Ga0207712_10006564 Ga0207712_100065646 275
635 3300025972 Ga0207668_10358634 Ga0207668_103586342 275
636 3300025986 Ga0207658_10010070 Ga0207658_100100703 275
637 3300025986 Ga0207658_10291383 Ga0207658_102913832 275
638 3300026023 Ga0207677_10008792 Ga0207677_100087925 275
639 3300026035 Ga0207703_10005716 Ga0207703_100057164 275
640 3300026035 Ga0207703_10451457 Ga0207703_104514572 275
641 3300026067 Ga0207678_10014007 Ga0207678_100140075 275
642 3300026067 Ga0207678_10229069 Ga0207678_102290691 275
643 3300026078 Ga0207702_10267828 Ga0207702_102678282 275
644 3300026088 Ga0207641_10108912 Ga0207641_101089122 275
645 3300026089 Ga0207648_10001481 Ga0207648_1000148110 275
646 3300026116 Ga0207674_10100456 Ga0207674_101004564 275
647 3300026118 Ga0207675_100092540 Ga0207675_1000925403 275
648 3300026121 Ga0207683_10008652 Ga0207683_100086523 275
649 3300026121 Ga0207683_10063460 Ga0207683_100634602 275
650 3300026142 Ga0207698_10097833 Ga0207698_100978332 275
651 3300027717 Ga0209998_10011711 Ga0209998_100117112 275
652 3300027907 Ga0207428_10012161 Ga0207428_100121615 275
653 3300028379 Ga0268266_10002092 Ga0268266_1000209218 275
654 3300028380 Ga0268265_10436587 Ga0268265_104365872 275
655 3300028381 Ga0268264_10007291 Ga0268264_100072918 275
656 3300028381 Ga0268264_10016086 Ga0268264_100160865 275
657 3300028556 Ga0265337_1012313 Ga0265337_10123132 275
658 3300028558 Ga0265326_10019538 Ga0265326_100195382 275
659 3300028563 Ga0265319_1008249 Ga0265319_10082493 275
660 3300028573 Ga0265334_10003965 Ga0265334_100039653 275
661 3300028577 Ga0265318_10007905 Ga0265318_100079053 275
662 3300028653 Ga0265323_10000311 Ga0265323_100003113 275
663 3300028654 Ga0265322_10004519 Ga0265322_100045192 275
664 3300028666 Ga0265336_10000074 Ga0265336_1000007455 275
665 3300028786 Ga0307517_10000085 Ga0307517_1000008568 275
666 3300028794 Ga0307515_10059363 Ga0307515_100593634 275
667 3300028800 Ga0265338_10000137 Ga0265338_1000013795 275
668 3300029957 Ga0265324_10000684 Ga0265324_1000068429 275
669 3300031456 Ga0307513_10034291 Ga0307513_100342914 275
670 3300031507 Ga0307509_10291622 Ga0307509_102916222 275
671 3300031727 Ga0316576_10019077 Ga0316576_100190773 275
672 3300031730 Ga0307516_10285369 Ga0307516_102853692 275
673 3300033180 Ga0307510_10007951 Ga0307510_100079516 275
674 3300034816 Ga0373930_0003689 Ga0373930_0003689_276_1196 275
675 3300035398 Ga0316574_0000392 Ga0316574_0000392_1379_2248 275
676 3300035691 Ga0373931_0014394 Ga0373931_0014394_1112_2032 275
677 3300035695 Ga0373927_0018763 Ga0373927_0018763_1117_2001 275
678 3300035695 Ga0373927_0136066 Ga0373927_0136066_666_1586 275
679 3300035695 Ga0373927_0172204 Ga0373927_0172204_160_1068 275
680 3300035725 Ga0373947_0001290 Ga0373947_0001290_3143_4027 275
681 3300036401 Ga0373937_0146484 Ga0373937_0146484_226_1110 275
682 3300039110 Ga0400487_40084 Ga0400487_40084_2126_2995 275
683 3300042876 Ga0451577_0006026 Ga0451577_0006026_228_1079 275
684 3300042876 Ga0451577_0037073 Ga0451577_0037073_2401_3252 275
685 3300044673 Ga0453683_0062673 Ga0453683_0062673_854_1705 275
686 3300044673 Ga0453683_0062726 Ga0453683_0062726_854_1705 275
687 3300044673 Ga0453683_0319146 Ga0453683_0319146_124_975 275
688 3300044712 Ga0453684_0006586 Ga0453684_0006586_12259_13110 275
689 3300044712 Ga0453684_0006667 Ga0453684_0006667_1489_2340 275
690 3300044712 Ga0453684_0010078 Ga0453684_0010078_6183_7034 275
691 3300044712 Ga0453684_0848870 Ga0453684_0848870_62_913 275
692 3300045051 Ga0451576_0002250 Ga0451576_0002250_12059_12910 275
693 3300046455 Ga0495603_0001659 Ga0495603_0001659_8712_9596 275
694 3300046459 Ga0495629_0015731 Ga0495629_0015731_3868_4752 275
695 3300046472 Ga0495580_0011691 Ga0495580_0011691_2231_3115 275
696 3300046473 Ga0495582_0003787 Ga0495582_0003787_3643_4527 275
697 3300046473 Ga0495582_0042988 Ga0495582_0042988_830_1798 275
698 3300046475 Ga0495639_0009431 Ga0495639_0009431_1017_1901 275
699 3300046499 Ga0495594_0062838 Ga0495594_0062838_1086_1970 275
700 3300046499 Ga0495594_0101364 Ga0495594_0101364_190_1158 275
701 3300046529 Ga0495652_0287261 Ga0495652_0287261_227_1177 275
702 3300046557 Ga0495622_0008847 Ga0495622_0008847_1505_2389 275
703 3300046660 Ga0495625_0244662 Ga0495625_0244662_13_957 275
704 3300046681 Ga0495647_0069054 Ga0495647_0069054_131_1015 275
705 3300046689 Ga0495613_0001486 Ga0495613_0001486_15338_16222 275
706 3300047315 Ga0495581_0040886 Ga0495581_0040886_1606_2490 275
707 3300047320 Ga0495672_0097545 Ga0495672_0097545_170_1108 275
708 3300047673 Ga0495593_0000446 Ga0495593_0000446_3365_4249 275
709 3300048089 Ga0495614_0119755 Ga0495614_0119755_83_1000 275
710 3300048903 Ga0496100_0005795 Ga0496100_0005795_2612_3520 275
711 3300048904 Ga0496101_0010103 Ga0496101_0010103_322_1230 275
712 3300048906 Ga0496103_0140383 Ga0496103_0140383_402_1322 275
713 3300048907 Ga0496104_0022192 Ga0496104_0022192_2760_3668 275
714 3300048907 Ga0496104_0186947 Ga0496104_0186947_963_1883 275
715 3300048908 Ga0496105_0026038 Ga0496105_0026038_183_1103 275
716 3300048908 Ga0496105_0029578 Ga0496105_0029578_2341_3249 275
717 3300048909 Ga0496106_0013363 Ga0496106_0013363_2735_3643 275
718 3300048910 Ga0496107_0032512 Ga0496107_0032512_2274_3182 275
719 3300048910 Ga0496107_0051625 Ga0496107_0051625_1132_2052 275
720 3300048911 Ga0496108_0051166 Ga0496108_0051166_654_1562 275
721 3300048912 Ga0496109_0243037 Ga0496109_0243037_353_1261 275
722 3300048913 Ga0496110_0013188 Ga0496110_0013188_4771_5691 275
723 3300048913 Ga0496110_0203112 Ga0496110_0203112_125_1030 275
724 3300048915 Ga0496112_0294394 Ga0496112_0294394_105_932 275
725 3300048916 Ga0496113_0175206 Ga0496113_0175206_138_1058 275
726 3300048917 Ga0496114_0002928 Ga0496114_0002928_11852_12760 275
727 3300048917 Ga0496114_0060355 Ga0496114_0060355_2147_3067 275
728 3300048917 Ga0496114_0138873 Ga0496114_0138873_615_1520 275
729 3300048918 Ga0496115_0005146 Ga0496115_0005146_6085_6993 275
730 3300048929 Ga0496126_0061650 Ga0496126_0061650_1511_2413 275
731 3300049575 Ga0501039_0030209 Ga0501039_0030209_3190_4116 275
732 3300049576 Ga0501040_0033501 Ga0501040_0033501_1285_2211 275
733 3300049578 Ga0501042_0046538 Ga0501042_0046538_1079_2005 275
734 3300049582 Ga0501048_0061338 Ga0501048_0061338_176_1102 275
735 3300049587 Ga0501071_0016153 Ga0501071_0016153_526_1452 275
736 3300049591 Ga0501075_0018748 Ga0501075_0018748_3528_4454 275
737 3300049592 Ga0501076_0086089 Ga0501076_0086089_602_1528 275
738 3300049741 Ga0501079_0099138 Ga0501079_0099138_1218_2144 275
739 3300049743 Ga0501081_0019985 Ga0501081_0019985_1692_2618 275
740 3300049824 Ga0501045_0020480 Ga0501045_0020480_3035_3961 275
741 3300050511 nmdc:mga08y16_1696_c1 nmdc:mga08y16_1696_c1_17194_18039 275
742 3300050511 nmdc:mga08y16_20259_c1 nmdc:mga08y16_20259_c1_5714_6556 275
743 3300050512 nmdc:mga0n895_142481_c1 nmdc:mga0n895_142481_c1_306_1151 275
744 3300053085 Ga0495619_0003178 Ga0495619_0003178_3361_4245 275
745 3300053088 Ga0500644_0029153 Ga0500644_0029153_402_1367 275
746 3300053094 Ga0500566_0064629 Ga0500566_0064629_876_1784 275
747 3300053102 Ga0500554_001083 Ga0500554_001083_601_1509 275
748 3300053119 Ga0500595_000726 Ga0500595_000726_852_1760 275
749 3300053136 Ga0500559_0033238 Ga0500559_0033238_871_1779 275
750 3300053150 Ga0500603_006267 Ga0500603_006267_737_1645 275
751 3300053153 Ga0500616_0000028 Ga0500616_0000028_87456_88421 275
752 3300053153 Ga0500616_0000964 Ga0500616_0000964_27761_28651 275
753 3300053162 Ga0500638_008459 Ga0500638_008459_145_1053 275
754 3300053178 Ga0500637_0000084 Ga0500637_0000084_27601_28509 275
755 3300054114 Ga0501084_0011524 Ga0501084_0011524_1575_2501 275
756 3300055283 Ga0500661_000602 Ga0500661_000602_939_1847 275
757 3300060353 Ga0501082_0061696 Ga0501082_0061696_1974_2900 275
758 2162886012 MBSR1b_contig_4107868 MBSR1b_0260.00008480 276
759 3300001990 JGI24737J22298_10066822 JGI24737J22298_100668222 276
760 3300002074 JGI24748J21848_1003601 JGI24748J21848_10036012 276
761 3300002459 JGI24751J29686_10011764 JGI24751J29686_100117641 276
762 3300003659 JGI25404J52841_10003367 JGI25404J52841_100033673 276
763 3300005293 Ga0065715_10149744 Ga0065715_101497442 276
764 3300005327 Ga0070658_10007026 Ga0070658_100070267 276
765 3300005328 Ga0070676_10000177 Ga0070676_100001779 276
766 3300005329 Ga0070683_100003236 Ga0070683_1000032365 276
767 3300005329 Ga0070683_100098872 Ga0070683_1000988722 276
768 3300005330 Ga0070690_100000161 Ga0070690_10000016117 276
769 3300005331 Ga0070670_100034365 Ga0070670_1000343653 276
770 3300005333 Ga0070677_10011383 Ga0070677_100113833 276
771 3300005334 Ga0068869_100001688 Ga0068869_1000016886 276
772 3300005335 Ga0070666_10000673 Ga0070666_1000067318 276
773 3300005336 Ga0070680_100071083 Ga0070680_1000710834 276
774 3300005337 Ga0070682_100065884 Ga0070682_1000658842 276
775 3300005338 Ga0068868_100017937 Ga0068868_1000179374 276
776 3300005339 Ga0070660_100000841 Ga0070660_1000008413 276
777 3300005340 Ga0070689_100000709 Ga0070689_1000007097 276
778 3300005343 Ga0070687_100000011 Ga0070687_10000001141 276
779 3300005344 Ga0070661_100001135 Ga0070661_1000011353 276
780 3300005344 Ga0070661_100006263 Ga0070661_1000062636 276
781 3300005347 Ga0070668_100005064 Ga0070668_1000050648 276
782 3300005353 Ga0070669_100014101 Ga0070669_1000141015 276
783 3300005354 Ga0070675_100002151 Ga0070675_1000021519 276
784 3300005355 Ga0070671_100001021 Ga0070671_10000102118 276
785 3300005356 Ga0070674_100003166 Ga0070674_1000031663 276
786 3300005364 Ga0070673_100005261 Ga0070673_1000052616 276
787 3300005365 Ga0070688_100001830 Ga0070688_1000018307 276
788 3300005366 Ga0070659_100000150 Ga0070659_1000001503 276
789 3300005367 Ga0070667_100005396 Ga0070667_1000053967 276
790 3300005438 Ga0070701_10002949 Ga0070701_100029494 276
791 3300005440 Ga0070705_100000387 Ga0070705_10000038722 276
792 3300005455 Ga0070663_100000694 Ga0070663_10000069410 276
793 3300005456 Ga0070678_100024393 Ga0070678_1000243933 276
794 3300005457 Ga0070662_100000201 Ga0070662_1000002016 276
795 3300005458 Ga0070681_10237815 Ga0070681_102378151 276
796 3300005459 Ga0068867_100000832 Ga0068867_10000083215 276
797 3300005466 Ga0070685_10003362 Ga0070685_100033622 276
798 3300005468 Ga0070707_100423860 Ga0070707_1004238602 276
799 3300005518 Ga0070699_100036589 Ga0070699_1000365892 276
800 3300005539 Ga0068853_100005121 Ga0068853_1000051215 276
801 3300005543 Ga0070672_100003813 Ga0070672_1000038134 276
802 3300005544 Ga0070686_100001626 Ga0070686_10000162611 276
803 3300005545 Ga0070695_100055370 Ga0070695_1000553703 276
804 3300005546 Ga0070696_100067161 Ga0070696_1000671612 276
805 3300005547 Ga0070693_100027832 Ga0070693_1000278324 276
806 3300005548 Ga0070665_100020348 Ga0070665_1000203485 276
807 3300005549 Ga0070704_100048327 Ga0070704_1000483274 276
808 3300005563 Ga0068855_100013690 Ga0068855_1000136903 276
809 3300005564 Ga0070664_100000409 Ga0070664_10000040917 276
810 3300005564 Ga0070664_100031009 Ga0070664_1000310093 276
811 3300005577 Ga0068857_100000045 Ga0068857_10000004544 276
812 3300005577 Ga0068857_100019250 Ga0068857_1000192508 276
813 3300005578 Ga0068854_100004958 Ga0068854_1000049583 276
814 3300005614 Ga0068856_100000969 Ga0068856_10000096914 276
815 3300005615 Ga0070702_100074559 Ga0070702_1000745593 276
816 3300005616 Ga0068852_100022851 Ga0068852_1000228515 276
817 3300005617 Ga0068859_100006419 Ga0068859_1000064199 276
818 3300005618 Ga0068864_100001397 Ga0068864_10000139717 276
819 3300005718 Ga0068866_10001396 Ga0068866_100013963 276
820 3300005719 Ga0068861_100000449 Ga0068861_10000044917 276
821 3300005834 Ga0068851_10002385 Ga0068851_100023856 276
822 3300005840 Ga0068870_10000840 Ga0068870_100008406 276
823 3300005841 Ga0068863_100004325 Ga0068863_1000043259 276
824 3300005842 Ga0068858_100042918 Ga0068858_1000429181 276
825 3300005843 Ga0068860_100006384 Ga0068860_1000063846 276
826 3300005844 Ga0068862_100003062 Ga0068862_1000030629 276
827 3300005983 Ga0081540_1000076 Ga0081540_100007630 276
828 3300005983 Ga0081540_1000083 Ga0081540_100008375 276
829 3300006358 Ga0068871_100002264 Ga0068871_10000226410 276
830 3300006881 Ga0068865_100000468 Ga0068865_10000046819 276
831 3300006931 Ga0097620_100006418 Ga0097620_1000064186 276
832 3300009093 Ga0105240_10000911 Ga0105240_1000091123 276
833 3300009094 Ga0111539_10292188 Ga0111539_102921882 276
834 3300009098 Ga0105245_10000110 Ga0105245_100001106 276
835 3300009101 Ga0105247_10000779 Ga0105247_1000077919 276
836 3300009148 Ga0105243_10001825 Ga0105243_1000182517 276
837 3300009174 Ga0105241_10000441 Ga0105241_1000044116 276
838 3300009176 Ga0105242_10003699 Ga0105242_100036998 276
839 3300009177 Ga0105248_10008973 Ga0105248_100089735 276
840 3300009545 Ga0105237_10004354 Ga0105237_1000435417 276
841 3300009551 Ga0105238_10000246 Ga0105238_1000024617 276
842 3300009553 Ga0105249_10001617 Ga0105249_100016177 276
843 3300010375 Ga0105239_10080411 Ga0105239_100804113 276
844 3300013100 Ga0157373_10004358 Ga0157373_100043585 276
845 3300013102 Ga0157371_10006096 Ga0157371_100060968 276
846 3300013105 Ga0157369_10012527 Ga0157369_100125278 276
847 3300013296 Ga0157374_10000113 Ga0157374_1000011368 276
848 3300013297 Ga0157378_10011085 Ga0157378_100110856 276
849 3300013306 Ga0163162_10000617 Ga0163162_100006173 276
850 3300013307 Ga0157372_10007152 Ga0157372_100071528 276
851 3300013308 Ga0157375_10001209 Ga0157375_100012093 276
852 3300014745 Ga0157377_10000265 Ga0157377_1000026520 276
853 3300014968 Ga0157379_10000775 Ga0157379_100007753 276
854 3300014969 Ga0157376_10001710 Ga0157376_100017103 276
855 3300025315 Ga0207697_10000147 Ga0207697_1000014719 276
856 3300025321 Ga0207656_10000871 Ga0207656_100008715 276
857 3300025893 Ga0207682_10011662 Ga0207682_100116624 276
858 3300025900 Ga0207710_10016717 Ga0207710_100167172 276
859 3300025901 Ga0207688_10000086 Ga0207688_1000008619 276
860 3300025903 Ga0207680_10004502 Ga0207680_100045028 276
861 3300025904 Ga0207647_10002419 Ga0207647_1000241912 276
862 3300025907 Ga0207645_10000006 Ga0207645_1000000676 276
863 3300025908 Ga0207643_10000019 Ga0207643_100000199 276
864 3300025909 Ga0207705_10007653 Ga0207705_100076536 276
865 3300025911 Ga0207654_10001653 Ga0207654_1000165313 276
866 3300025913 Ga0207695_10113566 Ga0207695_101135663 276
867 3300025914 Ga0207671_10007024 Ga0207671_100070242 276
868 3300025918 Ga0207662_10000002 Ga0207662_10000002103 276
869 3300025919 Ga0207657_10000007 Ga0207657_10000007103 276
870 3300025920 Ga0207649_10002537 Ga0207649_100025377 276
871 3300025920 Ga0207649_10002680 Ga0207649_100026807 276
872 3300025922 Ga0207646_10131038 Ga0207646_101310382 276
873 3300025923 Ga0207681_10001798 Ga0207681_100017984 276
874 3300025925 Ga0207650_10000109 Ga0207650_1000010946 276
875 3300025926 Ga0207659_10031235 Ga0207659_100312353 276
876 3300025927 Ga0207687_10004863 Ga0207687_100048636 276
877 3300025931 Ga0207644_10000618 Ga0207644_1000061817 276
878 3300025932 Ga0207690_10063101 Ga0207690_100631012 276
879 3300025933 Ga0207706_10000066 Ga0207706_1000006620 276
880 3300025934 Ga0207686_10003515 Ga0207686_1000351510 276
881 3300025935 Ga0207709_10008078 Ga0207709_100080785 276
882 3300025936 Ga0207670_10054504 Ga0207670_100545043 276
883 3300025937 Ga0207669_10000286 Ga0207669_1000028620 276
884 3300025938 Ga0207704_10018911 Ga0207704_100189113 276
885 3300025940 Ga0207691_10000628 Ga0207691_100006282 276
886 3300025941 Ga0207711_10000065 Ga0207711_100000653 276
887 3300025942 Ga0207689_10000070 Ga0207689_100000702 276
888 3300025944 Ga0207661_10051220 Ga0207661_100512203 276
889 3300025944 Ga0207661_10086145 Ga0207661_100861453 276
890 3300025945 Ga0207679_10000192 Ga0207679_100001923 276
891 3300025945 Ga0207679_10002439 Ga0207679_100024397 276
892 3300025960 Ga0207651_10005114 Ga0207651_100051143 276
893 3300025961 Ga0207712_10000421 Ga0207712_100004218 276
894 3300025972 Ga0207668_10040849 Ga0207668_100408493 276
895 3300025981 Ga0207640_10002086 Ga0207640_100020868 276
896 3300025986 Ga0207658_10026952 Ga0207658_100269523 276
897 3300026023 Ga0207677_10000187 Ga0207677_100001874 276
898 3300026035 Ga0207703_10000102 Ga0207703_1000010276 276
899 3300026041 Ga0207639_10002412 Ga0207639_100024128 276
900 3300026067 Ga0207678_10001138 Ga0207678_1000113826 276
901 3300026075 Ga0207708_10544529 Ga0207708_105445291 276
902 3300026078 Ga0207702_10058029 Ga0207702_100580293 276
903 3300026088 Ga0207641_10024778 Ga0207641_100247784 276
904 3300026089 Ga0207648_10000099 Ga0207648_1000009974 276
905 3300026095 Ga0207676_10003294 Ga0207676_100032945 276
906 3300026116 Ga0207674_10000030 Ga0207674_1000003089 276
907 3300026116 Ga0207674_10020542 Ga0207674_100205426 276
908 3300026118 Ga0207675_100000007 Ga0207675_10000000789 276
909 3300026121 Ga0207683_10000688 Ga0207683_1000068834 276
910 3300026142 Ga0207698_10063176 Ga0207698_100631763 276
911 3300028379 Ga0268266_10000397 Ga0268266_1000039717 276
912 3300028380 Ga0268265_10041140 Ga0268265_100411403 276
913 3300028381 Ga0268264_10000804 Ga0268264_1000080420 276
914 3300031238 Ga0265332_10001022 Ga0265332_100010225 276
915 3300031239 Ga0265328_10016966 Ga0265328_100169661 276
916 3300031240 Ga0265320_10025025 Ga0265320_100250253 276
917 3300031242 Ga0265329_10007066 Ga0265329_100070663 276
918 3300031247 Ga0265340_10111001 Ga0265340_101110012 276
919 3300031250 Ga0265331_10001600 Ga0265331_1000160014 276
920 3300031251 Ga0265327_10016623 Ga0265327_100166232 276
921 3300031344 Ga0265316_10003254 Ga0265316_100032545 276
922 3300031711 Ga0265314_10003069 Ga0265314_1000306914 276
923 3300035691 Ga0373931_0084598 Ga0373931_0084598_791_1621 276
924 3300035725 Ga0373947_0348930 Ga0373947_0348930_106_939 276
925 3300039450 Ga0436363_0046265 Ga0436363_0046265_98_928 276
926 3300042005 Ga0439448_0016450 Ga0439448_0016450_786_1616 276
927 3300042438 Ga0439459_0010244 Ga0439459_0010244_18_848 276
928 3300042876 Ga0451577_0067510 Ga0451577_0067510_971_1801 276
929 3300044712 Ga0453684_0092451 Ga0453684_0092451_1441_2337 276
930 3300045051 Ga0451576_0059005 Ga0451576_0059005_1138_1968 276
931 3300046472 Ga0495580_0123323 Ga0495580_0123323_629_1462 276
932 3300048904 Ga0496101_0019033 Ga0496101_0019033_662_1492 276
933 3300048905 Ga0496102_0011856 Ga0496102_0011856_1001_1831 276
934 3300048909 Ga0496106_0005656 Ga0496106_0005656_870_1700 276
935 3300048911 Ga0496108_0070341 Ga0496108_0070341_1986_2816 276
936 3300048912 Ga0496109_0035502 Ga0496109_0035502_2010_2840 276
937 3300048915 Ga0496112_0065158 Ga0496112_0065158_1989_2819 276
938 3300048916 Ga0496113_0051065 Ga0496113_0051065_1773_2603 276
939 3300050511 nmdc:mga08y16_380809_c1 nmdc:mga08y16_380809_c1_145_975 276
940 3300053153 Ga0500616_0081393 Ga0500616_0081393_304_1209 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05114

DUF692

Protein of unknown function (DUF692)

4

265

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.9185 5 274
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.8804 5 274
7tcx-assembly1.cif.gz_A methanobactin biosynthetic protein complex of mbnb and mbnc from methylosinus trichosporium ob3b at 2.21 angstrom resolution 0.8421 6 266
7tcw-assembly2.cif.gz_B methanobactin biosynthetic protein complex of mbnb and mbnc from methylosinus trichosporium ob3b, h210s mutant 0.8415 6 266
7fc0-assembly1.cif.gz_B reconstitution of mbnabc complex from rugamonas rubra atcc-43154 (groupiii) 0.8379 6 266
ID Description Score Start End Superfamily
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9226 3 274 3.20.20.150
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8938 3 274 3.20.20.150
af_P9WQ13_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6832 7 267 3.20.20.150
af_P9WQ13_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6739 7 267 3.20.20.150
af_P50525_6_280_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6596 12 266 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A535A888-F1-model_v4 DUF692 domain-containing protein 0.9912 197 275
AF-A0A534I5P5-F1-model_v4 UPF0276 protein E6K21_11310 0.9867 3 274
AF-A0A2H5ZIT0-F1-model_v4 UPF0276 protein HRbin30_00920 0.9858 2 275
AF-A0A1A8XYK4-F1-model_v4 Uncharacterized protein 0.9846 163 275
AF-A0A2Z3KPT7-F1-model_v4 deleted 0.9836 3 275

Feature Viewer

pLDDT pTM Quality
91.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map