F486281
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 939 | 383 | 939 | 62 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10944981|Ga0075433_109449813 |
| Length | 68 |
| Sequence | VDRLRRLGASIRRNIDEAWSELKKVSWPTVLQTRNLTVLVFAVSFGIGVFITFFDSIFLNAVKFLSNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 124 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 223 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 226 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 240 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 241 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 242 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 243 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 245 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 246 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 247 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 248 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 249 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 250 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 251 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 252 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 253 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 254 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 255 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 294 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 295 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 296 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 327 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 328 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 330 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 331 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 332 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 333 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 337 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 338 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 345 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 346 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 347 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 348 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 353 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 367 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 368 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 369 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.49 |
| Metatranscriptomes | 3.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 7.14 |
| Rhizosphere | 92.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1060694 | 3300001976 | Bacteria | 522 |
| 2 | JGI24747J21853_1033409 | 3300001978 | Bacteria | 594 |
| 3 | JGI24743J22301_10055653 | 3300001991 | Bacteria | 810 |
| 4 | JGI24738J21930_10125194 | 3300002075 | Bacteria | 560 |
| 5 | JGI24749J21850_1056825 | 3300002076 | Bacteria | 590 |
| 6 | JGI24744J21845_10077481 | 3300002077 | Bacteria | 607 |
| 7 | JGI24033J26618_1036890 | 3300002155 | Bacteria | 672 |
| 8 | JGI24034J26672_10052766 | 3300002239 | Bacteria | 702 |
| 9 | JGI24751J29686_10008660 | 3300002459 | Bacteria | 2084 |
| 10 | JGI24751J29686_10013331 | 3300002459 | Bacteria | 1696 |
| 11 | JGI25406J46586_10009666 | 3300003203 | Bacteria | 4312 |
| 12 | Ga0058859_10030995 | 3300004798 | Bacteria | 1123 |
| 13 | Ga0058859_11829737 | 3300004798 | Bacteria | 2189 |
| 14 | Ga0058861_12053711 | 3300004800 | Bacteria | 600 |
| 15 | Ga0058860_10027684 | 3300004801 | Bacteria | 887 |
| 16 | Ga0058860_10072498 | 3300004801 | Bacteria | 2469 |
| 17 | Ga0058862_10027267 | 3300004803 | Bacteria | 872 |
| 18 | Ga0065704_10372827 | 3300005289 | Bacteria | 783 |
| 19 | Ga0065712_10401795 | 3300005290 | Bacteria | 730 |
| 20 | Ga0065712_10470215 | 3300005290 | Bacteria | 671 |
| 21 | Ga0065715_10635613 | 3300005293 | Bacteria | 687 |
| 22 | Ga0065707_10879597 | 3300005295 | Bacteria | 527 |
| 23 | Ga0070676_10934862 | 3300005328 | Bacteria | 647 |
| 24 | Ga0070683_100507299 | 3300005329 | Bacteria | 1152 |
| 25 | Ga0070683_100736430 | 3300005329 | Bacteria | 944 |
| 26 | Ga0070683_101674936 | 3300005329 | Bacteria | 612 |
| 27 | Ga0070690_100162217 | 3300005330 | Bacteria | 1532 |
| 28 | Ga0070690_100326368 | 3300005330 | Bacteria | 1107 |
| 29 | Ga0070690_100518175 | 3300005330 | Bacteria | 894 |
| 30 | Ga0070690_100838012 | 3300005330 | Bacteria | 715 |
| 31 | Ga0070670_100669920 | 3300005331 | Bacteria | 932 |
| 32 | Ga0070670_100741920 | 3300005331 | Bacteria | 884 |
| 33 | Ga0070670_101323924 | 3300005331 | Bacteria | 660 |
| 34 | Ga0068869_100840343 | 3300005334 | Bacteria | 791 |
| 35 | Ga0068869_101146566 | 3300005334 | Bacteria | 681 |
| 36 | Ga0068869_101365169 | 3300005334 | Bacteria | 626 |
| 37 | Ga0070666_10084589 | 3300005335 | Bacteria | 2171 |
| 38 | Ga0070666_10262112 | 3300005335 | Bacteria | 1225 |
| 39 | Ga0070666_10599745 | 3300005335 | Bacteria | 803 |
| 40 | Ga0070666_11458733 | 3300005335 | Bacteria | 512 |
| 41 | Ga0070680_100020531 | 3300005336 | Bacteria | 5243 |
| 42 | Ga0070680_100321120 | 3300005336 | Bacteria | 1314 |
| 43 | Ga0070680_100576128 | 3300005336 | Bacteria | 965 |
| 44 | Ga0070680_100580712 | 3300005336 | Bacteria | 961 |
| 45 | Ga0070680_100682548 | 3300005336 | Bacteria | 883 |
| 46 | Ga0070680_101458830 | 3300005336 | Bacteria | 593 |
| 47 | Ga0070682_100641078 | 3300005337 | Bacteria | 844 |
| 48 | Ga0070682_100805663 | 3300005337 | Bacteria | 763 |
| 49 | Ga0068868_100325958 | 3300005338 | Bacteria | 1309 |
| 50 | Ga0068868_100349188 | 3300005338 | Bacteria | 1266 |
| 51 | Ga0068868_101244518 | 3300005338 | Bacteria | 690 |
| 52 | Ga0068868_101630724 | 3300005338 | Bacteria | 606 |
| 53 | Ga0068868_102089699 | 3300005338 | Bacteria | 539 |
| 54 | Ga0070689_100304847 | 3300005340 | Bacteria | 1326 |
| 55 | Ga0070689_100493916 | 3300005340 | Bacteria | 1047 |
| 56 | Ga0070689_100541992 | 3300005340 | Bacteria | 1001 |
| 57 | Ga0070689_100917548 | 3300005340 | Bacteria | 776 |
| 58 | Ga0070691_10273603 | 3300005341 | Bacteria | 913 |
| 59 | Ga0070691_10299909 | 3300005341 | Bacteria | 877 |
| 60 | Ga0070691_10350481 | 3300005341 | Bacteria | 820 |
| 61 | Ga0070691_10407414 | 3300005341 | Bacteria | 767 |
| 62 | Ga0070687_100221259 | 3300005343 | Bacteria | 1159 |
| 63 | Ga0070687_100394638 | 3300005343 | Bacteria | 905 |
| 64 | Ga0070687_100641959 | 3300005343 | Bacteria | 735 |
| 65 | Ga0070661_100569102 | 3300005344 | Bacteria | 913 |
| 66 | Ga0070692_10232284 | 3300005345 | Bacteria | 1095 |
| 67 | Ga0070692_10459666 | 3300005345 | Bacteria | 816 |
| 68 | Ga0070692_10943177 | 3300005345 | Bacteria | 600 |
| 69 | Ga0070668_100302628 | 3300005347 | Bacteria | 1341 |
| 70 | Ga0070669_101174249 | 3300005353 | Bacteria | 662 |
| 71 | Ga0070669_101916647 | 3300005353 | Bacteria | 518 |
| 72 | Ga0070669_101924034 | 3300005353 | Bacteria | 517 |
| 73 | Ga0070675_100471991 | 3300005354 | Bacteria | 1127 |
| 74 | Ga0070675_100894687 | 3300005354 | Bacteria | 813 |
| 75 | Ga0070675_101344378 | 3300005354 | Bacteria | 659 |
| 76 | Ga0070675_101519746 | 3300005354 | Bacteria | 618 |
| 77 | Ga0070671_100071958 | 3300005355 | Bacteria | 2886 |
| 78 | Ga0070674_100103993 | 3300005356 | Bacteria | 2074 |
| 79 | Ga0070674_100628650 | 3300005356 | Bacteria | 910 |
| 80 | Ga0070674_101320877 | 3300005356 | Bacteria | 644 |
| 81 | Ga0070673_100076409 | 3300005364 | Bacteria | 2704 |
| 82 | Ga0070673_100839966 | 3300005364 | Bacteria | 849 |
| 83 | Ga0070688_100362033 | 3300005365 | Bacteria | 1064 |
| 84 | Ga0070688_100480838 | 3300005365 | Bacteria | 934 |
| 85 | Ga0070659_100642432 | 3300005366 | Bacteria | 914 |
| 86 | Ga0070659_100729270 | 3300005366 | Bacteria | 858 |
| 87 | Ga0070667_100075769 | 3300005367 | Bacteria | 2872 |
| 88 | Ga0070667_100259161 | 3300005367 | Bacteria | 1556 |
| 89 | Ga0070667_100329789 | 3300005367 | Bacteria | 1378 |
| 90 | Ga0070667_100556519 | 3300005367 | Bacteria | 1054 |
| 91 | Ga0070703_10186047 | 3300005406 | Bacteria | 805 |
| 92 | Ga0070713_101648358 | 3300005436 | Bacteria | 623 |
| 93 | Ga0070710_11343549 | 3300005437 | Bacteria | 533 |
| 94 | Ga0070701_10024455 | 3300005438 | Bacteria | 2922 |
| 95 | Ga0070701_10054367 | 3300005438 | Bacteria | 2087 |
| 96 | Ga0070701_10489370 | 3300005438 | Bacteria | 796 |
| 97 | Ga0070711_100677549 | 3300005439 | Bacteria | 866 |
| 98 | Ga0070705_100028430 | 3300005440 | Bacteria | 3062 |
| 99 | Ga0070705_100280402 | 3300005440 | Bacteria | 1184 |
| 100 | Ga0070705_101054690 | 3300005440 | Bacteria | 663 |
| 101 | Ga0070705_101740219 | 3300005440 | Bacteria | 527 |
| 102 | Ga0070700_100036116 | 3300005441 | Bacteria | 2995 |
| 103 | Ga0070700_100732067 | 3300005441 | Bacteria | 789 |
| 104 | Ga0070700_100773600 | 3300005441 | Bacteria | 770 |
| 105 | Ga0070700_100796730 | 3300005441 | Bacteria | 760 |
| 106 | Ga0070700_100883108 | 3300005441 | Bacteria | 727 |
| 107 | Ga0070700_101261422 | 3300005441 | Bacteria | 619 |
| 108 | Ga0070700_101992676 | 3300005441 | Bacteria | 503 |
| 109 | Ga0070694_100607329 | 3300005444 | Bacteria | 881 |
| 110 | Ga0070694_100678039 | 3300005444 | Bacteria | 836 |
| 111 | Ga0070694_100794457 | 3300005444 | Bacteria | 775 |
| 112 | Ga0070694_101080886 | 3300005444 | Bacteria | 668 |
| 113 | Ga0070694_101422324 | 3300005444 | Bacteria | 585 |
| 114 | Ga0070708_100021693 | 3300005445 | Bacteria | 5437 |
| 115 | Ga0070708_100083016 | 3300005445 | Bacteria | 2903 |
| 116 | Ga0070708_100173962 | 3300005445 | Bacteria | 2011 |
| 117 | Ga0070708_100342283 | 3300005445 | Bacteria | 1409 |
| 118 | Ga0070708_100941451 | 3300005445 | Bacteria | 810 |
| 119 | Ga0070708_101091673 | 3300005445 | Bacteria | 747 |
| 120 | Ga0070708_101173597 | 3300005445 | Bacteria | 718 |
| 121 | Ga0070663_100004558 | 3300005455 | Bacteria | 8167 |
| 122 | Ga0070663_100504094 | 3300005455 | Bacteria | 1005 |
| 123 | Ga0070663_100995753 | 3300005455 | Bacteria | 728 |
| 124 | Ga0070678_100159402 | 3300005456 | Bacteria | 1826 |
| 125 | Ga0070678_100765070 | 3300005456 | Bacteria | 874 |
| 126 | Ga0070678_102065119 | 3300005456 | Bacteria | 540 |
| 127 | Ga0070662_101509288 | 3300005457 | Bacteria | 579 |
| 128 | Ga0070681_10283178 | 3300005458 | Bacteria | 1568 |
| 129 | Ga0070681_11076664 | 3300005458 | Bacteria | 724 |
| 130 | Ga0068867_100260956 | 3300005459 | Bacteria | 1412 |
| 131 | Ga0068867_101750357 | 3300005459 | Bacteria | 583 |
| 132 | Ga0068867_102087865 | 3300005459 | Bacteria | 537 |
| 133 | Ga0068867_102343798 | 3300005459 | Bacteria | 508 |
| 134 | Ga0070685_10336638 | 3300005466 | Bacteria | 1028 |
| 135 | Ga0070685_10438397 | 3300005466 | Bacteria | 912 |
| 136 | Ga0070685_10618241 | 3300005466 | Bacteria | 781 |
| 137 | Ga0070706_100040516 | 3300005467 | Bacteria | 4300 |
| 138 | Ga0070706_100484590 | 3300005467 | Bacteria | 1150 |
| 139 | Ga0070706_100902145 | 3300005467 | Bacteria | 816 |
| 140 | Ga0070706_101628946 | 3300005467 | Bacteria | 589 |
| 141 | Ga0070707_100098692 | 3300005468 | Bacteria | 2829 |
| 142 | Ga0070707_100291996 | 3300005468 | Bacteria | 1584 |
| 143 | Ga0070707_101085172 | 3300005468 | Bacteria | 766 |
| 144 | Ga0070707_101436453 | 3300005468 | Bacteria | 656 |
| 145 | Ga0070707_101628786 | 3300005468 | Bacteria | 612 |
| 146 | Ga0070707_102323121 | 3300005468 | Bacteria | 503 |
| 147 | Ga0070698_100045715 | 3300005471 | Bacteria | 4480 |
| 148 | Ga0070698_100084781 | 3300005471 | Bacteria | 3156 |
| 149 | Ga0070698_100128772 | 3300005471 | Bacteria | 2487 |
| 150 | Ga0070698_100920159 | 3300005471 | Bacteria | 820 |
| 151 | Ga0070698_100926067 | 3300005471 | Bacteria | 817 |
| 152 | Ga0070698_100993079 | 3300005471 | Bacteria | 786 |
| 153 | Ga0070698_101065374 | 3300005471 | Bacteria | 756 |
| 154 | Ga0070698_101118251 | 3300005471 | Bacteria | 736 |
| 155 | Ga0070698_101356538 | 3300005471 | Bacteria | 662 |
| 156 | Ga0070698_101814622 | 3300005471 | Bacteria | 563 |
| 157 | Ga0070699_100077369 | 3300005518 | Bacteria | 2896 |
| 158 | Ga0070699_100181167 | 3300005518 | Bacteria | 1869 |
| 159 | Ga0070699_100773320 | 3300005518 | Bacteria | 878 |
| 160 | Ga0070699_100855497 | 3300005518 | Bacteria | 833 |
| 161 | Ga0070699_100875053 | 3300005518 | Bacteria | 823 |
| 162 | Ga0070699_101092972 | 3300005518 | Bacteria | 731 |
| 163 | Ga0070699_101445732 | 3300005518 | Bacteria | 630 |
| 164 | Ga0070699_101794379 | 3300005518 | Bacteria | 561 |
| 165 | Ga0070699_102051599 | 3300005518 | Bacteria | 522 |
| 166 | Ga0070679_100562028 | 3300005530 | Bacteria | 1084 |
| 167 | Ga0070679_101089076 | 3300005530 | Bacteria | 744 |
| 168 | Ga0070679_101767495 | 3300005530 | Bacteria | 567 |
| 169 | Ga0070679_102106117 | 3300005530 | Bacteria | 513 |
| 170 | Ga0070684_100182697 | 3300005535 | Bacteria | 1907 |
| 171 | Ga0070684_100320665 | 3300005535 | Bacteria | 1423 |
| 172 | Ga0070684_100754584 | 3300005535 | Bacteria | 908 |
| 173 | Ga0070684_101589770 | 3300005535 | Bacteria | 617 |
| 174 | Ga0070697_100012567 | 3300005536 | Bacteria | 6633 |
| 175 | Ga0070697_100081282 | 3300005536 | Bacteria | 2670 |
| 176 | Ga0070697_100105328 | 3300005536 | Bacteria | 2346 |
| 177 | Ga0070697_100184681 | 3300005536 | Bacteria | 1768 |
| 178 | Ga0070697_100481821 | 3300005536 | Bacteria | 1083 |
| 179 | Ga0070697_100723975 | 3300005536 | Bacteria | 878 |
| 180 | Ga0070697_101123849 | 3300005536 | Bacteria | 699 |
| 181 | Ga0070697_101429689 | 3300005536 | Bacteria | 618 |
| 182 | Ga0070697_101653937 | 3300005536 | Bacteria | 573 |
| 183 | Ga0068853_101848543 | 3300005539 | Bacteria | 585 |
| 184 | Ga0070672_101958419 | 3300005543 | Bacteria | 527 |
| 185 | Ga0070686_100117462 | 3300005544 | Bacteria | 1821 |
| 186 | Ga0070686_100240245 | 3300005544 | Bacteria | 1318 |
| 187 | Ga0070686_100521042 | 3300005544 | Bacteria | 925 |
| 188 | Ga0070686_100829016 | 3300005544 | Bacteria | 747 |
| 189 | Ga0070686_101232466 | 3300005544 | Bacteria | 622 |
| 190 | Ga0070686_101609910 | 3300005544 | Bacteria | 550 |
| 191 | Ga0070686_101666956 | 3300005544 | Bacteria | 541 |
| 192 | Ga0070695_100039268 | 3300005545 | Bacteria | 2991 |
| 193 | Ga0070695_100080457 | 3300005545 | Bacteria | 2153 |
| 194 | Ga0070695_100395406 | 3300005545 | Bacteria | 1046 |
| 195 | Ga0070695_100482640 | 3300005545 | Bacteria | 955 |
| 196 | Ga0070695_101218731 | 3300005545 | Bacteria | 619 |
| 197 | Ga0070696_100048649 | 3300005546 | Bacteria | 2943 |
| 198 | Ga0070696_100275622 | 3300005546 | Bacteria | 1280 |
| 199 | Ga0070696_100296747 | 3300005546 | Bacteria | 1236 |
| 200 | Ga0070696_100367818 | 3300005546 | Bacteria | 1117 |
| 201 | Ga0070696_100752543 | 3300005546 | Bacteria | 798 |
| 202 | Ga0070696_100811911 | 3300005546 | Bacteria | 770 |
| 203 | Ga0070696_101222000 | 3300005546 | Bacteria | 635 |
| 204 | Ga0070696_101650052 | 3300005546 | Bacteria | 552 |
| 205 | Ga0070696_101790118 | 3300005546 | Bacteria | 530 |
| 206 | Ga0070693_100448998 | 3300005547 | Bacteria | 904 |
| 207 | Ga0070693_100992972 | 3300005547 | Bacteria | 635 |
| 208 | Ga0070693_101400411 | 3300005547 | Bacteria | 543 |
| 209 | Ga0070704_100202396 | 3300005549 | Bacteria | 1603 |
| 210 | Ga0070704_100338901 | 3300005549 | Bacteria | 1265 |
| 211 | Ga0070704_100439002 | 3300005549 | Bacteria | 1121 |
| 212 | Ga0070704_100842662 | 3300005549 | Bacteria | 821 |
| 213 | Ga0070704_101833780 | 3300005549 | Bacteria | 561 |
| 214 | Ga0070704_101979963 | 3300005549 | Bacteria | 540 |
| 215 | Ga0070704_102071092 | 3300005549 | Bacteria | 528 |
| 216 | Ga0068855_101000371 | 3300005563 | Bacteria | 878 |
| 217 | Ga0070664_100705157 | 3300005564 | Bacteria | 940 |
| 218 | Ga0070664_100724302 | 3300005564 | Bacteria | 928 |
| 219 | Ga0068857_100137897 | 3300005577 | Bacteria | 2203 |
| 220 | Ga0068857_100298521 | 3300005577 | Bacteria | 1485 |
| 221 | Ga0068857_100487636 | 3300005577 | Bacteria | 1155 |
| 222 | Ga0068857_100773477 | 3300005577 | Bacteria | 915 |
| 223 | Ga0068857_101146947 | 3300005577 | Bacteria | 751 |
| 224 | Ga0068854_101023035 | 3300005578 | Bacteria | 732 |
| 225 | Ga0068854_101618104 | 3300005578 | Bacteria | 590 |
| 226 | Ga0068854_101708474 | 3300005578 | Bacteria | 575 |
| 227 | Ga0068854_101956811 | 3300005578 | Bacteria | 540 |
| 228 | Ga0068856_100307662 | 3300005614 | Bacteria | 1602 |
| 229 | Ga0068856_101835619 | 3300005614 | Bacteria | 618 |
| 230 | Ga0068856_102722090 | 3300005614 | Bacteria | 500 |
| 231 | Ga0070702_100086340 | 3300005615 | Bacteria | 1892 |
| 232 | Ga0070702_100366736 | 3300005615 | Bacteria | 1019 |
| 233 | Ga0070702_100421618 | 3300005615 | Bacteria | 960 |
| 234 | Ga0070702_100539905 | 3300005615 | Bacteria | 863 |
| 235 | Ga0070702_101783717 | 3300005615 | Bacteria | 513 |
| 236 | Ga0068852_100217744 | 3300005616 | Bacteria | 1814 |
| 237 | Ga0068852_100866168 | 3300005616 | Bacteria | 919 |
| 238 | Ga0068859_100551157 | 3300005617 | Bacteria | 1247 |
| 239 | Ga0068859_101456537 | 3300005617 | Bacteria | 756 |
| 240 | Ga0068864_100118277 | 3300005618 | Bacteria | 2366 |
| 241 | Ga0068864_100457461 | 3300005618 | Bacteria | 1221 |
| 242 | Ga0068866_10279534 | 3300005718 | Bacteria | 1034 |
| 243 | Ga0068866_11338054 | 3300005718 | Bacteria | 522 |
| 244 | Ga0068861_100043615 | 3300005719 | Bacteria | 3368 |
| 245 | Ga0068861_100485872 | 3300005719 | Bacteria | 1113 |
| 246 | Ga0068861_100724626 | 3300005719 | Bacteria | 926 |
| 247 | Ga0068861_101021100 | 3300005719 | Bacteria | 791 |
| 248 | Ga0068861_101044093 | 3300005719 | Bacteria | 782 |
| 249 | Ga0068861_101214951 | 3300005719 | Bacteria | 729 |
| 250 | Ga0068851_10264226 | 3300005834 | Bacteria | 980 |
| 251 | Ga0068870_10219194 | 3300005840 | Bacteria | 1163 |
| 252 | Ga0068870_10735801 | 3300005840 | Bacteria | 684 |
| 253 | Ga0068863_100982498 | 3300005841 | Bacteria | 847 |
| 254 | Ga0068863_101413859 | 3300005841 | Bacteria | 703 |
| 255 | Ga0068858_100027244 | 3300005842 | Bacteria | 5310 |
| 256 | Ga0068858_100477059 | 3300005842 | Bacteria | 1204 |
| 257 | Ga0068858_101075074 | 3300005842 | Bacteria | 789 |
| 258 | Ga0068858_101514665 | 3300005842 | Bacteria | 661 |
| 259 | Ga0068860_100024658 | 3300005843 | Bacteria | 5808 |
| 260 | Ga0068860_100531553 | 3300005843 | Bacteria | 1176 |
| 261 | Ga0068862_101281327 | 3300005844 | Bacteria | 734 |
| 262 | Ga0081539_10002087 | 3300005985 | Bacteria | 29854 |
| 263 | Ga0081539_10318578 | 3300005985 | Bacteria | 662 |
| 264 | Ga0075365_10279193 | 3300006038 | Bacteria | 1175 |
| 265 | Ga0075364_10962093 | 3300006051 | Bacteria | 581 |
| 266 | Ga0075432_10037946 | 3300006058 | Bacteria | 1677 |
| 267 | Ga0070715_10558793 | 3300006163 | Bacteria | 665 |
| 268 | Ga0070716_100263972 | 3300006173 | Bacteria | 1179 |
| 269 | Ga0070716_101271664 | 3300006173 | Bacteria | 594 |
| 270 | Ga0070716_101721500 | 3300006173 | Bacteria | 517 |
| 271 | Ga0070712_100981020 | 3300006175 | Bacteria | 731 |
| 272 | Ga0097621_100150529 | 3300006237 | Bacteria | 1995 |
| 273 | Ga0097621_100361892 | 3300006237 | Bacteria | 1292 |
| 274 | Ga0097621_100807415 | 3300006237 | Bacteria | 869 |
| 275 | Ga0097621_102328181 | 3300006237 | Bacteria | 512 |
| 276 | Ga0068871_100103647 | 3300006358 | Bacteria | 2385 |
| 277 | Ga0068871_100434328 | 3300006358 | Bacteria | 1174 |
| 278 | Ga0068871_100896880 | 3300006358 | Bacteria | 821 |
| 279 | Ga0075428_100731357 | 3300006844 | Bacteria | 1053 |
| 280 | Ga0075428_101943549 | 3300006844 | Bacteria | 611 |
| 281 | Ga0075431_100254993 | 3300006847 | Bacteria | 1781 |
| 282 | Ga0075433_10019795 | 3300006852 | Bacteria | 5616 |
| 283 | Ga0075433_10163918 | 3300006852 | Bacteria | 1978 |
| 284 | Ga0075433_10271267 | 3300006852 | Bacteria | 1503 |
| 285 | Ga0075433_10944981 | 3300006852 | Bacteria | 752 |
| 286 | Ga0075434_100807010 | 3300006871 | Bacteria | 954 |
| 287 | Ga0075434_101116554 | 3300006871 | Bacteria | 801 |
| 288 | Ga0068865_100159465 | 3300006881 | Bacteria | 1719 |
| 289 | Ga0068865_100226429 | 3300006881 | Bacteria | 1464 |
| 290 | Ga0068865_100288295 | 3300006881 | Bacteria | 1309 |
| 291 | Ga0068865_100575930 | 3300006881 | Bacteria | 948 |
| 292 | Ga0068865_101826023 | 3300006881 | Bacteria | 550 |
| 293 | Ga0075436_100122500 | 3300006914 | Bacteria | 1820 |
| 294 | Ga0097620_100551131 | 3300006931 | Bacteria | 1247 |
| 295 | Ga0097620_101456521 | 3300006931 | Bacteria | 756 |
| 296 | Ga0075435_100232450 | 3300007076 | Bacteria | 1567 |
| 297 | Ga0075435_100463524 | 3300007076 | Bacteria | 1093 |
| 298 | Ga0075435_100522835 | 3300007076 | Bacteria | 1026 |
| 299 | Ga0075435_100659383 | 3300007076 | Bacteria | 908 |
| 300 | Ga0075435_100756312 | 3300007076 | Bacteria | 845 |
| 301 | Ga0099795_10303707 | 3300007788 | Bacteria | 702 |
| 302 | Ga0105251_10066999 | 3300009011 | Bacteria | 1678 |
| 303 | Ga0105244_10186311 | 3300009036 | Bacteria | 983 |
| 304 | Ga0105250_10605431 | 3300009092 | Bacteria | 508 |
| 305 | Ga0105240_11120153 | 3300009093 | Bacteria | 837 |
| 306 | Ga0105240_11173332 | 3300009093 | Bacteria | 814 |
| 307 | Ga0111539_10628948 | 3300009094 | Bacteria | 1250 |
| 308 | Ga0111539_11331570 | 3300009094 | Bacteria | 833 |
| 309 | Ga0111539_11404096 | 3300009094 | Bacteria | 810 |
| 310 | Ga0111539_12267385 | 3300009094 | Bacteria | 630 |
| 311 | Ga0105245_10220019 | 3300009098 | Bacteria | 1832 |
| 312 | Ga0105245_10746505 | 3300009098 | Bacteria | 1014 |
| 313 | Ga0105245_10755149 | 3300009098 | Bacteria | 1009 |
| 314 | Ga0105245_11166052 | 3300009098 | Bacteria | 818 |
| 315 | Ga0105245_11570092 | 3300009098 | Bacteria | 710 |
| 316 | Ga0105245_13253944 | 3300009098 | Bacteria | 503 |
| 317 | Ga0105247_10170111 | 3300009101 | Bacteria | 1448 |
| 318 | Ga0105247_10861632 | 3300009101 | Bacteria | 696 |
| 319 | Ga0105247_11201884 | 3300009101 | Bacteria | 604 |
| 320 | Ga0105247_11692624 | 3300009101 | Bacteria | 523 |
| 321 | Ga0114129_10181666 | 3300009147 | Bacteria | 2862 |
| 322 | Ga0114129_11118621 | 3300009147 | Bacteria | 985 |
| 323 | Ga0114129_11611101 | 3300009147 | Bacteria | 794 |
| 324 | Ga0114129_12174935 | 3300009147 | Bacteria | 668 |
| 325 | Ga0105243_10585040 | 3300009148 | Bacteria | 1072 |
| 326 | Ga0105243_10637014 | 3300009148 | Bacteria | 1031 |
| 327 | Ga0105243_10781936 | 3300009148 | Bacteria | 939 |
| 328 | Ga0105243_10789027 | 3300009148 | Bacteria | 935 |
| 329 | Ga0105243_11139061 | 3300009148 | Bacteria | 790 |
| 330 | Ga0105243_11924829 | 3300009148 | Bacteria | 624 |
| 331 | Ga0105243_12518553 | 3300009148 | Bacteria | 554 |
| 332 | Ga0105243_12597863 | 3300009148 | Bacteria | 546 |
| 333 | Ga0105241_10558779 | 3300009174 | Bacteria | 1029 |
| 334 | Ga0105241_12571318 | 3300009174 | Bacteria | 511 |
| 335 | Ga0105242_10245777 | 3300009176 | Bacteria | 1610 |
| 336 | Ga0105242_10297351 | 3300009176 | Bacteria | 1472 |
| 337 | Ga0105242_10463114 | 3300009176 | Bacteria | 1198 |
| 338 | Ga0105242_10839274 | 3300009176 | Bacteria | 913 |
| 339 | Ga0105242_11050225 | 3300009176 | Bacteria | 826 |
| 340 | Ga0105242_11318241 | 3300009176 | Bacteria | 746 |
| 341 | Ga0105248_10041220 | 3300009177 | Bacteria | 5176 |
| 342 | Ga0105248_10784244 | 3300009177 | Bacteria | 1075 |
| 343 | Ga0105248_11178129 | 3300009177 | Bacteria | 866 |
| 344 | Ga0105248_11510176 | 3300009177 | Bacteria | 761 |
| 345 | Ga0105248_12261881 | 3300009177 | Bacteria | 619 |
| 346 | Ga0105248_13313266 | 3300009177 | Bacteria | 512 |
| 347 | Ga0105237_10611139 | 3300009545 | Bacteria | 1097 |
| 348 | Ga0105237_10966472 | 3300009545 | Bacteria | 859 |
| 349 | Ga0105238_10328716 | 3300009551 | Bacteria | 1515 |
| 350 | Ga0105238_10825244 | 3300009551 | Bacteria | 943 |
| 351 | Ga0105238_11131346 | 3300009551 | Bacteria | 806 |
| 352 | Ga0105249_10019204 | 3300009553 | Bacteria | 6095 |
| 353 | Ga0105249_10492138 | 3300009553 | Bacteria | 1270 |
| 354 | Ga0105249_11308605 | 3300009553 | Bacteria | 796 |
| 355 | Ga0105249_11369838 | 3300009553 | Bacteria | 779 |
| 356 | Ga0105249_11885749 | 3300009553 | Bacteria | 670 |
| 357 | Ga0105249_12278481 | 3300009553 | Bacteria | 614 |
| 358 | Ga0105249_12829331 | 3300009553 | Bacteria | 557 |
| 359 | Ga0105249_13079667 | 3300009553 | Bacteria | 536 |
| 360 | Ga0105239_10319281 | 3300010375 | Bacteria | 1751 |
| 361 | Ga0105239_11173510 | 3300010375 | Bacteria | 885 |
| 362 | Ga0105239_12166299 | 3300010375 | Bacteria | 646 |
| 363 | Ga0105239_12265214 | 3300010375 | Bacteria | 632 |
| 364 | Ga0105239_12812473 | 3300010375 | Bacteria | 568 |
| 365 | Ga0105246_10041027 | 3300011119 | Bacteria | 3127 |
| 366 | Ga0105246_10329895 | 3300011119 | Bacteria | 1243 |
| 367 | Ga0105246_10942752 | 3300011119 | Bacteria | 777 |
| 368 | Ga0105246_10968939 | 3300011119 | Bacteria | 768 |
| 369 | Ga0105246_11456342 | 3300011119 | Bacteria | 641 |
| 370 | Ga0105246_12110491 | 3300011119 | Bacteria | 546 |
| 371 | Ga0157343_1007894 | 3300012488 | Bacteria | 753 |
| 372 | Ga0157323_1004802 | 3300012495 | Bacteria | 880 |
| 373 | Ga0157371_10337438 | 3300013102 | Bacteria | 1096 |
| 374 | Ga0157370_11061661 | 3300013104 | Bacteria | 732 |
| 375 | Ga0157374_10155022 | 3300013296 | Bacteria | 2229 |
| 376 | Ga0157374_10265742 | 3300013296 | Bacteria | 1691 |
| 377 | Ga0157374_10728428 | 3300013296 | Bacteria | 1006 |
| 378 | Ga0157378_10015276 | 3300013297 | Bacteria | 6724 |
| 379 | Ga0157378_10913110 | 3300013297 | Bacteria | 909 |
| 380 | Ga0157378_11259696 | 3300013297 | Bacteria | 780 |
| 381 | Ga0157378_11553276 | 3300013297 | Bacteria | 707 |
| 382 | Ga0163162_10088800 | 3300013306 | Bacteria | 3170 |
| 383 | Ga0163162_11255603 | 3300013306 | Bacteria | 841 |
| 384 | Ga0163162_11783920 | 3300013306 | Bacteria | 703 |
| 385 | Ga0163162_12848112 | 3300013306 | Bacteria | 557 |
| 386 | Ga0163162_13123335 | 3300013306 | Bacteria | 532 |
| 387 | Ga0157372_10800022 | 3300013307 | Bacteria | 1095 |
| 388 | Ga0157372_11560230 | 3300013307 | Bacteria | 760 |
| 389 | Ga0157375_10912092 | 3300013308 | Bacteria | 1022 |
| 390 | Ga0157375_11151575 | 3300013308 | Bacteria | 909 |
| 391 | Ga0157375_13454274 | 3300013308 | Bacteria | 526 |
| 392 | Ga0157375_13675404 | 3300013308 | Bacteria | 510 |
| 393 | Ga0163163_10259786 | 3300014325 | Bacteria | 1788 |
| 394 | Ga0163163_10526117 | 3300014325 | Bacteria | 1245 |
| 395 | Ga0163163_10743049 | 3300014325 | Bacteria | 1044 |
| 396 | Ga0163163_11444496 | 3300014325 | Bacteria | 749 |
| 397 | Ga0163163_11756174 | 3300014325 | Bacteria | 681 |
| 398 | Ga0163163_11812411 | 3300014325 | Bacteria | 670 |
| 399 | Ga0163163_12069663 | 3300014325 | Bacteria | 629 |
| 400 | Ga0163163_13043396 | 3300014325 | Bacteria | 523 |
| 401 | Ga0157380_10012801 | 3300014326 | Bacteria | 6096 |
| 402 | Ga0157380_11037451 | 3300014326 | Bacteria | 856 |
| 403 | Ga0157380_11040742 | 3300014326 | Bacteria | 854 |
| 404 | Ga0157380_11514832 | 3300014326 | Bacteria | 724 |
| 405 | Ga0157380_12996746 | 3300014326 | Bacteria | 538 |
| 406 | Ga0157380_13364968 | 3300014326 | Bacteria | 511 |
| 407 | Ga0157377_10076167 | 3300014745 | Bacteria | 1950 |
| 408 | Ga0157377_10417560 | 3300014745 | Bacteria | 918 |
| 409 | Ga0157377_10483225 | 3300014745 | Bacteria | 862 |
| 410 | Ga0157379_10549666 | 3300014968 | Bacteria | 1074 |
| 411 | Ga0157379_11122397 | 3300014968 | Bacteria | 754 |
| 412 | Ga0157379_11441509 | 3300014968 | Bacteria | 668 |
| 413 | Ga0157379_11449126 | 3300014968 | Bacteria | 667 |
| 414 | Ga0157376_10148277 | 3300014969 | Bacteria | 2113 |
| 415 | Ga0157376_11024663 | 3300014969 | Bacteria | 849 |
| 416 | Ga0157376_11898288 | 3300014969 | Bacteria | 632 |
| 417 | Ga0163161_10605041 | 3300017792 | Bacteria | 904 |
| 418 | Ga0163161_10623128 | 3300017792 | Bacteria | 892 |
| 419 | Ga0163161_10735802 | 3300017792 | Bacteria | 824 |
| 420 | Ga0206356_10505645 | 3300020070 | Bacteria | 746 |
| 421 | Ga0206352_11256669 | 3300020078 | Bacteria | 501 |
| 422 | Ga0206354_10678292 | 3300020081 | Bacteria | 527 |
| 423 | Ga0207697_10103881 | 3300025315 | Bacteria | 1213 |
| 424 | Ga0207656_10221892 | 3300025321 | Bacteria | 919 |
| 425 | Ga0207713_1061982 | 3300025735 | Bacteria | 1420 |
| 426 | Ga0207653_10063012 | 3300025885 | Bacteria | 1254 |
| 427 | Ga0207653_10158204 | 3300025885 | Bacteria | 837 |
| 428 | Ga0207653_10346741 | 3300025885 | Bacteria | 580 |
| 429 | Ga0207692_11071524 | 3300025898 | Bacteria | 533 |
| 430 | Ga0207710_10551947 | 3300025900 | Bacteria | 600 |
| 431 | Ga0207688_10728680 | 3300025901 | Bacteria | 627 |
| 432 | Ga0207688_10794965 | 3300025901 | Bacteria | 599 |
| 433 | Ga0207680_10238277 | 3300025903 | Bacteria | 1253 |
| 434 | Ga0207680_10345252 | 3300025903 | Bacteria | 1045 |
| 435 | Ga0207647_10022808 | 3300025904 | Bacteria | 4152 |
| 436 | Ga0207685_10132869 | 3300025905 | Bacteria | 1107 |
| 437 | Ga0207645_10140018 | 3300025907 | Bacteria | 1576 |
| 438 | Ga0207645_10472654 | 3300025907 | Bacteria | 847 |
| 439 | Ga0207643_10391655 | 3300025908 | Bacteria | 877 |
| 440 | Ga0207684_10023984 | 3300025910 | Bacteria | 5205 |
| 441 | Ga0207684_10393037 | 3300025910 | Bacteria | 1192 |
| 442 | Ga0207707_10224487 | 3300025912 | Bacteria | 1635 |
| 443 | Ga0207707_10290941 | 3300025912 | Bacteria | 1413 |
| 444 | Ga0207695_10853129 | 3300025913 | Bacteria | 791 |
| 445 | Ga0207671_10281017 | 3300025914 | Bacteria | 1313 |
| 446 | Ga0207693_10691971 | 3300025915 | Bacteria | 790 |
| 447 | Ga0207660_10000002 | 3300025917 | Bacteria | 883566 |
| 448 | Ga0207662_10451250 | 3300025918 | Bacteria | 879 |
| 449 | Ga0207662_10551726 | 3300025918 | Bacteria | 798 |
| 450 | Ga0207657_10381984 | 3300025919 | Bacteria | 1109 |
| 451 | Ga0207649_10417978 | 3300025920 | Bacteria | 1006 |
| 452 | Ga0207649_11343857 | 3300025920 | Bacteria | 565 |
| 453 | Ga0207652_11691138 | 3300025921 | Bacteria | 537 |
| 454 | Ga0207646_10004216 | 3300025922 | Bacteria | 15739 |
| 455 | Ga0207646_10344489 | 3300025922 | Bacteria | 1346 |
| 456 | Ga0207646_10430443 | 3300025922 | Bacteria | 1191 |
| 457 | Ga0207646_10669247 | 3300025922 | Bacteria | 929 |
| 458 | Ga0207646_11308692 | 3300025922 | Bacteria | 633 |
| 459 | Ga0207650_10856254 | 3300025925 | Bacteria | 771 |
| 460 | Ga0207659_10608607 | 3300025926 | Bacteria | 932 |
| 461 | Ga0207659_11055178 | 3300025926 | Bacteria | 699 |
| 462 | Ga0207687_10046120 | 3300025927 | Bacteria | 3016 |
| 463 | Ga0207687_10205866 | 3300025927 | Bacteria | 1541 |
| 464 | Ga0207687_10245227 | 3300025927 | Bacteria | 1422 |
| 465 | Ga0207687_10541964 | 3300025927 | Bacteria | 975 |
| 466 | Ga0207687_10665427 | 3300025927 | Bacteria | 882 |
| 467 | Ga0207644_10066480 | 3300025931 | Bacteria | 2625 |
| 468 | Ga0207644_10855190 | 3300025931 | Bacteria | 762 |
| 469 | Ga0207644_11103092 | 3300025931 | Unclassified | 667 |
| 470 | Ga0207690_10050244 | 3300025932 | Bacteria | 2783 |
| 471 | Ga0207690_11293243 | 3300025932 | Bacteria | 609 |
| 472 | Ga0207706_10046490 | 3300025933 | Bacteria | 3842 |
| 473 | Ga0207706_11053782 | 3300025933 | Bacteria | 681 |
| 474 | Ga0207686_10341698 | 3300025934 | Bacteria | 1124 |
| 475 | Ga0207686_10657768 | 3300025934 | Bacteria | 829 |
| 476 | Ga0207686_10663648 | 3300025934 | Bacteria | 826 |
| 477 | Ga0207709_10010646 | 3300025935 | Bacteria | 5066 |
| 478 | Ga0207709_10080062 | 3300025935 | Bacteria | 2102 |
| 479 | Ga0207709_10969481 | 3300025935 | Bacteria | 694 |
| 480 | Ga0207670_10754289 | 3300025936 | Bacteria | 808 |
| 481 | Ga0207670_11314009 | 3300025936 | Bacteria | 613 |
| 482 | Ga0207669_10005197 | 3300025937 | Bacteria | 5815 |
| 483 | Ga0207669_10022441 | 3300025937 | Bacteria | 3353 |
| 484 | Ga0207669_10737737 | 3300025937 | Bacteria | 812 |
| 485 | Ga0207669_10850612 | 3300025937 | Bacteria | 759 |
| 486 | Ga0207704_10153708 | 3300025938 | Bacteria | 1627 |
| 487 | Ga0207704_10533180 | 3300025938 | Bacteria | 951 |
| 488 | Ga0207704_10825826 | 3300025938 | Bacteria | 775 |
| 489 | Ga0207665_10412618 | 3300025939 | Bacteria | 1030 |
| 490 | Ga0207665_11414374 | 3300025939 | Bacteria | 554 |
| 491 | Ga0207691_11758036 | 3300025940 | Bacteria | 501 |
| 492 | Ga0207711_10059034 | 3300025941 | Bacteria | 3302 |
| 493 | Ga0207711_10408907 | 3300025941 | Bacteria | 1261 |
| 494 | Ga0207689_10662255 | 3300025942 | Bacteria | 880 |
| 495 | Ga0207689_10948874 | 3300025942 | Bacteria | 726 |
| 496 | Ga0207661_10212042 | 3300025944 | Bacteria | 1707 |
| 497 | Ga0207661_10436866 | 3300025944 | Bacteria | 1190 |
| 498 | Ga0207667_10791170 | 3300025949 | Bacteria | 946 |
| 499 | Ga0207651_11479702 | 3300025960 | Bacteria | 611 |
| 500 | Ga0207712_10634298 | 3300025961 | Bacteria | 927 |
| 501 | Ga0207712_11290679 | 3300025961 | Bacteria | 652 |
| 502 | Ga0207712_11451262 | 3300025961 | Bacteria | 614 |
| 503 | Ga0207668_10856634 | 3300025972 | Bacteria | 807 |
| 504 | Ga0207640_10213275 | 3300025981 | Bacteria | 1472 |
| 505 | Ga0207640_11872801 | 3300025981 | Bacteria | 543 |
| 506 | Ga0207658_10302443 | 3300025986 | Bacteria | 1378 |
| 507 | Ga0207658_12070465 | 3300025986 | Bacteria | 517 |
| 508 | Ga0207677_10528251 | 3300026023 | Bacteria | 1025 |
| 509 | Ga0207677_10728964 | 3300026023 | Bacteria | 882 |
| 510 | Ga0207677_11417490 | 3300026023 | Bacteria | 640 |
| 511 | Ga0207703_10065297 | 3300026035 | Bacteria | 2990 |
| 512 | Ga0207703_10886928 | 3300026035 | Bacteria | 854 |
| 513 | Ga0207703_12275174 | 3300026035 | Bacteria | 518 |
| 514 | Ga0207639_10907276 | 3300026041 | Bacteria | 824 |
| 515 | Ga0207639_10971666 | 3300026041 | Bacteria | 795 |
| 516 | Ga0207678_10017028 | 3300026067 | Bacteria | 6382 |
| 517 | Ga0207678_10276342 | 3300026067 | Bacteria | 1441 |
| 518 | Ga0207678_11598135 | 3300026067 | Bacteria | 574 |
| 519 | Ga0207708_10017492 | 3300026075 | Bacteria | 5396 |
| 520 | Ga0207708_10524672 | 3300026075 | Bacteria | 996 |
| 521 | Ga0207708_10856134 | 3300026075 | Bacteria | 785 |
| 522 | Ga0207708_11777193 | 3300026075 | Bacteria | 541 |
| 523 | Ga0207702_10729756 | 3300026078 | Bacteria | 977 |
| 524 | Ga0207702_11057120 | 3300026078 | Bacteria | 805 |
| 525 | Ga0207641_11341754 | 3300026088 | Bacteria | 716 |
| 526 | Ga0207648_10799580 | 3300026089 | Bacteria | 878 |
| 527 | Ga0207676_10243897 | 3300026095 | Bacteria | 1613 |
| 528 | Ga0207676_10508450 | 3300026095 | Bacteria | 1145 |
| 529 | Ga0207676_11361056 | 3300026095 | Bacteria | 705 |
| 530 | Ga0207674_10096522 | 3300026116 | Bacteria | 2941 |
| 531 | Ga0207674_10850537 | 3300026116 | Bacteria | 880 |
| 532 | Ga0207674_11033956 | 3300026116 | Bacteria | 791 |
| 533 | Ga0207675_100573084 | 3300026118 | Bacteria | 1130 |
| 534 | Ga0207675_100822742 | 3300026118 | Bacteria | 943 |
| 535 | Ga0207675_101054815 | 3300026118 | Bacteria | 832 |
| 536 | Ga0207675_101383480 | 3300026118 | Bacteria | 724 |
| 537 | Ga0207683_10114781 | 3300026121 | Bacteria | 2414 |
| 538 | Ga0207683_10486201 | 3300026121 | Bacteria | 1140 |
| 539 | Ga0207683_10807356 | 3300026121 | Bacteria | 871 |
| 540 | Ga0207698_10020697 | 3300026142 | Bacteria | 4534 |
| 541 | Ga0209973_1020358 | 3300027252 | Bacteria | 876 |
| 542 | Ga0209984_1038469 | 3300027424 | Bacteria | 686 |
| 543 | Ga0209968_1005468 | 3300027526 | Bacteria | 1911 |
| 544 | Ga0209982_1006777 | 3300027552 | Bacteria | 1670 |
| 545 | Ga0210002_1049075 | 3300027617 | Bacteria | 726 |
| 546 | Ga0209983_1020600 | 3300027665 | Bacteria | 1375 |
| 547 | Ga0209983_1044215 | 3300027665 | Bacteria | 967 |
| 548 | Ga0209983_1050545 | 3300027665 | Bacteria | 910 |
| 549 | Ga0209971_1019669 | 3300027682 | Bacteria | 1603 |
| 550 | Ga0209971_1179172 | 3300027682 | Bacteria | 522 |
| 551 | Ga0209966_1091951 | 3300027695 | Bacteria | 680 |
| 552 | Ga0209998_10007548 | 3300027717 | Bacteria | 2257 |
| 553 | Ga0209974_10016162 | 3300027876 | Bacteria | 2478 |
| 554 | Ga0209974_10028771 | 3300027876 | Bacteria | 1840 |
| 555 | Ga0209974_10090696 | 3300027876 | Bacteria | 1060 |
| 556 | Ga0209974_10424313 | 3300027876 | Bacteria | 525 |
| 557 | Ga0209974_10429919 | 3300027876 | Bacteria | 522 |
| 558 | Ga0207428_10181308 | 3300027907 | Bacteria | 1591 |
| 559 | Ga0268264_10274106 | 3300028381 | Bacteria | 1577 |
| 560 | Ga0268264_12025853 | 3300028381 | Bacteria | 585 |
| 561 | Ga0268264_12453410 | 3300028381 | Bacteria | 527 |
| 562 | Ga0307408_100041695 | 3300031548 | Bacteria | 3255 |
| 563 | Ga0307408_101944643 | 3300031548 | Bacteria | 565 |
| 564 | Ga0307405_10476490 | 3300031731 | Bacteria | 995 |
| 565 | Ga0307413_10078953 | 3300031824 | Bacteria | 2102 |
| 566 | Ga0307413_10293782 | 3300031824 | Bacteria | 1229 |
| 567 | Ga0307413_11278474 | 3300031824 | Bacteria | 641 |
| 568 | Ga0307410_11539614 | 3300031852 | Bacteria | 586 |
| 569 | Ga0307410_11673601 | 3300031852 | Bacteria | 563 |
| 570 | Ga0307406_11402688 | 3300031901 | Bacteria | 612 |
| 571 | Ga0307407_10154985 | 3300031903 | Bacteria | 1493 |
| 572 | Ga0307412_10158459 | 3300031911 | Bacteria | 1679 |
| 573 | Ga0307409_100044842 | 3300031995 | Bacteria | 3333 |
| 574 | Ga0307409_100318090 | 3300031995 | Bacteria | 1455 |
| 575 | Ga0307409_100852074 | 3300031995 | Bacteria | 922 |
| 576 | Ga0307416_100042187 | 3300032002 | Bacteria | 3559 |
| 577 | Ga0307416_100307797 | 3300032002 | Bacteria | 1579 |
| 578 | Ga0307416_101333408 | 3300032002 | Bacteria | 823 |
| 579 | Ga0307416_102548829 | 3300032002 | Bacteria | 609 |
| 580 | Ga0307414_10782384 | 3300032004 | Bacteria | 869 |
| 581 | Ga0307414_10952636 | 3300032004 | Bacteria | 789 |
| 582 | Ga0307415_100063143 | 3300032126 | Bacteria | 2572 |
| 583 | Ga0307415_100120780 | 3300032126 | Bacteria | 1964 |
| 584 | Ga0307415_101454292 | 3300032126 | Bacteria | 654 |
| 585 | Ga0373948_0167434 | 3300034817 | Bacteria | 558 |
| 586 | Ga0373948_0201665 | 3300034817 | Bacteria | 519 |
| 587 | Ga0373950_0120545 | 3300034818 | Bacteria | 580 |
| 588 | Ga0373958_0041078 | 3300034819 | Bacteria | 946 |
| 589 | Ga0373926_0098127 | 3300035083 | Bacteria | 1094 |
| 590 | Ga0373929_0147805 | 3300035085 | Bacteria | 628 |
| 591 | Ga0373949_0049115 | 3300035090 | Bacteria | 1059 |
| 592 | Ga0373951_0233715 | 3300035091 | Bacteria | 547 |
| 593 | Ga0373932_0103774 | 3300035112 | Bacteria | 929 |
| 594 | Ga0373941_0131513 | 3300035115 | Bacteria | 902 |
| 595 | Ga0373941_0288517 | 3300035115 | Bacteria | 651 |
| 596 | Ga0373941_0392496 | 3300035115 | Bacteria | 572 |
| 597 | Ga0373960_0063732 | 3300035121 | Bacteria | 1124 |
| 598 | Ga0373960_0282269 | 3300035121 | Bacteria | 612 |
| 599 | Ga0373946_0507291 | 3300035171 | Bacteria | 619 |
| 600 | Ga0373955_0332584 | 3300035172 | Bacteria | 919 |
| 601 | Ga0373961_0235479 | 3300035241 | Bacteria | 658 |
| 602 | Ga0373962_0072589 | 3300035242 | Bacteria | 1031 |
| 603 | Ga0373931_0194604 | 3300035691 | Bacteria | 1208 |
| 604 | Ga0373931_1020186 | 3300035691 | Bacteria | 561 |
| 605 | Ga0373933_0757909 | 3300035724 | Bacteria | 639 |
| 606 | Ga0395901_0312615 | 3300038443 | Bacteria | 1627 |
| 607 | Ga0242419_005567 | 3300038698 | Bacteria | 900 |
| 608 | Ga0242420_064558 | 3300038996 | Bacteria | 735 |
| 609 | Ga0439453_0180418 | 3300041408 | Bacteria | 515 |
| 610 | Ga0439466_0041798 | 3300041411 | Bacteria | 1528 |
| 611 | Ga0451807_0415819 | 3300041486 | Bacteria | 863 |
| 612 | Ga0439431_0178426 | 3300041997 | Bacteria | 612 |
| 613 | Ga0450914_034842 | 3300042118 | Bacteria | 620 |
| 614 | Ga0450920_131719 | 3300042122 | Bacteria | 527 |
| 615 | Ga0450923_015004 | 3300042125 | Bacteria | 1443 |
| 616 | Ga0450897_034538 | 3300042128 | Bacteria | 582 |
| 617 | Ga0450906_013042 | 3300042145 | Bacteria | 1536 |
| 618 | Ga0450910_060232 | 3300042147 | Bacteria | 640 |
| 619 | Ga0450910_068298 | 3300042147 | Bacteria | 608 |
| 620 | Ga0450908_044198 | 3300042184 | Bacteria | 772 |
| 621 | Ga0450909_021128 | 3300042185 | Bacteria | 972 |
| 622 | Ga0439434_0085821 | 3300042435 | Bacteria | 1003 |
| 623 | Ga0439434_0088566 | 3300042435 | Bacteria | 988 |
| 624 | Ga0439459_0033618 | 3300042438 | Bacteria | 1057 |
| 625 | Ga0450916_073568 | 3300042530 | Bacteria | 574 |
| 626 | Ga0451577_0060452 | 3300042876 | Bacteria | 3378 |
| 627 | Ga0451577_1377332 | 3300042876 | Bacteria | 626 |
| 628 | Ga0453683_0018052 | 3300044673 | Bacteria | 4531 |
| 629 | Ga0453683_0383037 | 3300044673 | Bacteria | 905 |
| 630 | Ga0453684_0794841 | 3300044712 | Bacteria | 1021 |
| 631 | Ga0453684_1421790 | 3300044712 | Bacteria | 718 |
| 632 | Ga0451576_0040408 | 3300045051 | Bacteria | 4937 |
| 633 | Ga0466967_1874688 | 3300045976 | Bacteria | 596 |
| 634 | Ga0495603_0220251 | 3300046455 | Bacteria | 1095 |
| 635 | Ga0495582_0264675 | 3300046473 | Bacteria | 986 |
| 636 | Ga0495582_0387772 | 3300046473 | Bacteria | 805 |
| 637 | Ga0495662_0258322 | 3300046476 | Bacteria | 858 |
| 638 | Ga0495644_0073999 | 3300046523 | Bacteria | 1281 |
| 639 | Ga0495663_0086016 | 3300046525 | Bacteria | 1019 |
| 640 | Ga0495609_0313839 | 3300046538 | Bacteria | 637 |
| 641 | Ga0495656_0779253 | 3300046615 | Bacteria | 516 |
| 642 | Ga0495611_0230567 | 3300046648 | Bacteria | 861 |
| 643 | Ga0495659_0221644 | 3300046664 | Bacteria | 781 |
| 644 | Ga0495659_0293609 | 3300046664 | Bacteria | 685 |
| 645 | Ga0495647_0122158 | 3300046681 | Bacteria | 1096 |
| 646 | Ga0495658_0951817 | 3300046683 | Bacteria | 549 |
| 647 | Ga0495613_1013100 | 3300046689 | Bacteria | 533 |
| 648 | Ga0495624_0867277 | 3300046690 | Bacteria | 532 |
| 649 | Ga0495649_0236389 | 3300046694 | Bacteria | 942 |
| 650 | Ga0495676_0412536 | 3300047321 | Bacteria | 895 |
| 651 | Ga0495614_0426175 | 3300048089 | Bacteria | 626 |
| 652 | Ga0495614_0652200 | 3300048089 | Bacteria | 508 |
| 653 | Ga0496100_0891638 | 3300048903 | Bacteria | 698 |
| 654 | Ga0496101_0462519 | 3300048904 | Bacteria | 1001 |
| 655 | Ga0496101_0777076 | 3300048904 | Bacteria | 755 |
| 656 | Ga0496101_0844817 | 3300048904 | Bacteria | 721 |
| 657 | Ga0496101_0945591 | 3300048904 | Bacteria | 678 |
| 658 | Ga0496101_1414834 | 3300048904 | Bacteria | 542 |
| 659 | Ga0496102_0221210 | 3300048905 | Bacteria | 1785 |
| 660 | Ga0496102_0406039 | 3300048905 | Bacteria | 1280 |
| 661 | Ga0496102_0765094 | 3300048905 | Bacteria | 888 |
| 662 | Ga0496102_0989738 | 3300048905 | Bacteria | 761 |
| 663 | Ga0496102_1128921 | 3300048905 | Bacteria | 703 |
| 664 | Ga0496103_0011651 | 3300048906 | Bacteria | 5215 |
| 665 | Ga0496103_0511251 | 3300048906 | Bacteria | 768 |
| 666 | Ga0496103_0772581 | 3300048906 | Bacteria | 607 |
| 667 | Ga0496104_0022038 | 3300048907 | Bacteria | 5854 |
| 668 | Ga0496104_0048572 | 3300048907 | Bacteria | 4000 |
| 669 | Ga0496104_0173708 | 3300048907 | Bacteria | 2065 |
| 670 | Ga0496104_0257888 | 3300048907 | Bacteria | 1656 |
| 671 | Ga0496104_0897486 | 3300048907 | Bacteria | 791 |
| 672 | Ga0496105_0079537 | 3300048908 | Bacteria | 2707 |
| 673 | Ga0496105_0202168 | 3300048908 | Bacteria | 1621 |
| 674 | Ga0496105_0326202 | 3300048908 | Bacteria | 1229 |
| 675 | Ga0496106_0189802 | 3300048909 | Bacteria | 1633 |
| 676 | Ga0496106_0244933 | 3300048909 | Bacteria | 1432 |
| 677 | Ga0496106_0245719 | 3300048909 | Bacteria | 1430 |
| 678 | Ga0496106_0787726 | 3300048909 | Bacteria | 754 |
| 679 | Ga0496106_1055409 | 3300048909 | Bacteria | 638 |
| 680 | Ga0496107_0692959 | 3300048910 | Bacteria | 749 |
| 681 | Ga0496107_1042464 | 3300048910 | Bacteria | 592 |
| 682 | Ga0496107_1266685 | 3300048910 | Bacteria | 528 |
| 683 | Ga0496107_1270194 | 3300048910 | Bacteria | 527 |
| 684 | Ga0496108_0005881 | 3300048911 | Bacteria | 9945 |
| 685 | Ga0496108_0021720 | 3300048911 | Bacteria | 5277 |
| 686 | Ga0496108_0133733 | 3300048911 | Bacteria | 2132 |
| 687 | Ga0496108_0152665 | 3300048911 | Bacteria | 1993 |
| 688 | Ga0496109_0007365 | 3300048912 | Bacteria | 9312 |
| 689 | Ga0496109_0069348 | 3300048912 | Bacteria | 3233 |
| 690 | Ga0496109_0122176 | 3300048912 | Bacteria | 2426 |
| 691 | Ga0496109_0416989 | 3300048912 | Bacteria | 1268 |
| 692 | Ga0496109_0724174 | 3300048912 | Bacteria | 932 |
| 693 | Ga0496109_1214845 | 3300048912 | Bacteria | 690 |
| 694 | Ga0496109_1731753 | 3300048912 | Bacteria | 558 |
| 695 | Ga0496110_0032222 | 3300048913 | Bacteria | 4525 |
| 696 | Ga0496110_0032784 | 3300048913 | Bacteria | 4490 |
| 697 | Ga0496110_0411793 | 3300048913 | Bacteria | 1232 |
| 698 | Ga0496110_1577385 | 3300048913 | Bacteria | 566 |
| 699 | Ga0496111_0031782 | 3300048914 | Bacteria | 3761 |
| 700 | Ga0496111_0070108 | 3300048914 | Bacteria | 2549 |
| 701 | Ga0496111_0158088 | 3300048914 | Bacteria | 1682 |
| 702 | Ga0496111_0198587 | 3300048914 | Bacteria | 1491 |
| 703 | Ga0496111_0974252 | 3300048914 | Bacteria | 608 |
| 704 | Ga0496112_0002921 | 3300048915 | Bacteria | 13922 |
| 705 | Ga0496112_0047852 | 3300048915 | Bacteria | 4195 |
| 706 | Ga0496112_0246234 | 3300048915 | Bacteria | 1739 |
| 707 | Ga0496112_0367774 | 3300048915 | Bacteria | 1379 |
| 708 | Ga0496112_0962457 | 3300048915 | Bacteria | 774 |
| 709 | Ga0496112_1342087 | 3300048915 | Bacteria | 630 |
| 710 | Ga0496112_1715513 | 3300048915 | Bacteria | 540 |
| 711 | Ga0496113_0010238 | 3300048916 | Bacteria | 6192 |
| 712 | Ga0496113_0233291 | 3300048916 | Bacteria | 1467 |
| 713 | Ga0496113_0324452 | 3300048916 | Bacteria | 1234 |
| 714 | Ga0496113_0697451 | 3300048916 | Bacteria | 810 |
| 715 | Ga0496114_0165095 | 3300048917 | Bacteria | 1927 |
| 716 | Ga0496114_0182212 | 3300048917 | Bacteria | 1835 |
| 717 | Ga0496114_0689443 | 3300048917 | Bacteria | 896 |
| 718 | Ga0496114_0997559 | 3300048917 | Bacteria | 720 |
| 719 | Ga0501306_039538 | 3300049127 | Bacteria | 727 |
| 720 | Ga0501292_030302 | 3300049515 | Bacteria | 907 |
| 721 | Ga0501297_013444 | 3300049520 | Bacteria | 961 |
| 722 | Ga0501298_138082 | 3300049521 | Bacteria | 587 |
| 723 | Ga0501311_043854 | 3300049527 | Bacteria | 685 |
| 724 | Ga0501316_050421 | 3300049532 | Bacteria | 598 |
| 725 | Ga0501317_007952 | 3300049533 | Bacteria | 1210 |
| 726 | Ga0501318_080817 | 3300049534 | Bacteria | 526 |
| 727 | Ga0501325_008381 | 3300049541 | Bacteria | 896 |
| 728 | Ga0501325_016689 | 3300049541 | Bacteria | 736 |
| 729 | Ga0501031_0012970 | 3300049568 | Bacteria | 5439 |
| 730 | Ga0501031_0197050 | 3300049568 | Bacteria | 1314 |
| 731 | Ga0501031_0324091 | 3300049568 | Bacteria | 998 |
| 732 | Ga0501032_0110492 | 3300049569 | Bacteria | 1819 |
| 733 | Ga0501032_0183002 | 3300049569 | Bacteria | 1371 |
| 734 | Ga0501033_0568113 | 3300049570 | Bacteria | 780 |
| 735 | Ga0501033_0616993 | 3300049570 | Bacteria | 743 |
| 736 | Ga0501034_0276328 | 3300049571 | Bacteria | 1620 |
| 737 | Ga0501036_0013129 | 3300049572 | Bacteria | 6880 |
| 738 | Ga0501036_0165028 | 3300049572 | Bacteria | 1867 |
| 739 | Ga0501036_0462525 | 3300049572 | Bacteria | 1056 |
| 740 | Ga0501036_0550955 | 3300049572 | Bacteria | 958 |
| 741 | Ga0501037_0076034 | 3300049573 | Bacteria | 2438 |
| 742 | Ga0501037_0463857 | 3300049573 | Bacteria | 863 |
| 743 | Ga0501037_0685506 | 3300049573 | Bacteria | 683 |
| 744 | Ga0501038_0059905 | 3300049574 | Bacteria | 3259 |
| 745 | Ga0501038_0699934 | 3300049574 | Bacteria | 759 |
| 746 | Ga0501038_0824239 | 3300049574 | Bacteria | 688 |
| 747 | Ga0501038_0944003 | 3300049574 | Bacteria | 635 |
| 748 | Ga0501039_0069732 | 3300049575 | Bacteria | 2730 |
| 749 | Ga0501039_0511992 | 3300049575 | Bacteria | 942 |
| 750 | Ga0501039_0719628 | 3300049575 | Bacteria | 780 |
| 751 | Ga0501039_0788581 | 3300049575 | Bacteria | 741 |
| 752 | Ga0501039_1067909 | 3300049575 | Bacteria | 626 |
| 753 | Ga0501040_0011743 | 3300049576 | Bacteria | 5728 |
| 754 | Ga0501040_0141185 | 3300049576 | Bacteria | 1697 |
| 755 | Ga0501040_0161072 | 3300049576 | Bacteria | 1586 |
| 756 | Ga0501040_0225921 | 3300049576 | Bacteria | 1332 |
| 757 | Ga0501040_0387918 | 3300049576 | Bacteria | 1002 |
| 758 | Ga0501040_0813457 | 3300049576 | Bacteria | 676 |
| 759 | Ga0501041_0020309 | 3300049577 | Bacteria | 3970 |
| 760 | Ga0501041_0049911 | 3300049577 | Bacteria | 2549 |
| 761 | Ga0501041_0113853 | 3300049577 | Bacteria | 1679 |
| 762 | Ga0501041_0140295 | 3300049577 | Bacteria | 1507 |
| 763 | Ga0501041_0411664 | 3300049577 | Bacteria | 857 |
| 764 | Ga0501041_0671731 | 3300049577 | Bacteria | 662 |
| 765 | Ga0501041_1050999 | 3300049577 | Bacteria | 524 |
| 766 | Ga0501042_0074548 | 3300049578 | Bacteria | 2428 |
| 767 | Ga0501042_0522630 | 3300049578 | Bacteria | 862 |
| 768 | Ga0501042_0542931 | 3300049578 | Bacteria | 845 |
| 769 | Ga0501042_1388916 | 3300049578 | Bacteria | 512 |
| 770 | Ga0501042_1443820 | 3300049578 | Bacteria | 502 |
| 771 | Ga0501043_0831378 | 3300049579 | Bacteria | 666 |
| 772 | Ga0501043_1091685 | 3300049579 | Bacteria | 564 |
| 773 | Ga0501046_0237089 | 3300049580 | Bacteria | 1346 |
| 774 | Ga0501046_0288148 | 3300049580 | Bacteria | 1201 |
| 775 | Ga0501046_0446722 | 3300049580 | Bacteria | 930 |
| 776 | Ga0501046_0586255 | 3300049580 | Bacteria | 792 |
| 777 | Ga0501046_0620260 | 3300049580 | Bacteria | 766 |
| 778 | Ga0501048_0012332 | 3300049582 | Bacteria | 6359 |
| 779 | Ga0501048_0069814 | 3300049582 | Bacteria | 2481 |
| 780 | Ga0501048_0173849 | 3300049582 | Bacteria | 1526 |
| 781 | Ga0501048_0224285 | 3300049582 | Bacteria | 1333 |
| 782 | Ga0501048_0564750 | 3300049582 | Bacteria | 817 |
| 783 | Ga0501067_0011868 | 3300049583 | Bacteria | 4829 |
| 784 | Ga0501067_0358212 | 3300049583 | Bacteria | 813 |
| 785 | Ga0501068_0013746 | 3300049584 | Bacteria | 4612 |
| 786 | Ga0501068_0515690 | 3300049584 | Bacteria | 776 |
| 787 | Ga0501068_0861721 | 3300049584 | Bacteria | 595 |
| 788 | Ga0501068_1139883 | 3300049584 | Bacteria | 516 |
| 789 | Ga0501069_0004365 | 3300049585 | Bacteria | 7300 |
| 790 | Ga0501069_0022378 | 3300049585 | Bacteria | 3438 |
| 791 | Ga0501069_0806667 | 3300049585 | Bacteria | 569 |
| 792 | Ga0501070_0100767 | 3300049586 | Bacteria | 2389 |
| 793 | Ga0501071_0016406 | 3300049587 | Bacteria | 5092 |
| 794 | Ga0501071_0448364 | 3300049587 | Bacteria | 987 |
| 795 | Ga0501071_0855269 | 3300049587 | Bacteria | 701 |
| 796 | Ga0501071_1366397 | 3300049587 | Bacteria | 547 |
| 797 | Ga0501072_0284427 | 3300049588 | Bacteria | 1315 |
| 798 | Ga0501072_0298988 | 3300049588 | Bacteria | 1279 |
| 799 | Ga0501072_0365326 | 3300049588 | Bacteria | 1145 |
| 800 | Ga0501072_0517392 | 3300049588 | Bacteria | 943 |
| 801 | Ga0501072_0897159 | 3300049588 | Bacteria | 692 |
| 802 | Ga0501072_0899607 | 3300049588 | Bacteria | 691 |
| 803 | Ga0501072_1049087 | 3300049588 | Bacteria | 635 |
| 804 | Ga0501072_1149706 | 3300049588 | Bacteria | 603 |
| 805 | Ga0501073_0078522 | 3300049589 | Bacteria | 2297 |
| 806 | Ga0501073_0467456 | 3300049589 | Bacteria | 872 |
| 807 | Ga0501073_0521317 | 3300049589 | Bacteria | 821 |
| 808 | Ga0501074_0074160 | 3300049590 | Bacteria | 2443 |
| 809 | Ga0501074_0939660 | 3300049590 | Bacteria | 608 |
| 810 | Ga0501074_1001522 | 3300049590 | Bacteria | 587 |
| 811 | Ga0501075_0037524 | 3300049591 | Bacteria | 3620 |
| 812 | Ga0501075_0097340 | 3300049591 | Bacteria | 2233 |
| 813 | Ga0501075_0715528 | 3300049591 | Bacteria | 762 |
| 814 | Ga0501075_1304411 | 3300049591 | Bacteria | 550 |
| 815 | Ga0501075_1551587 | 3300049591 | Bacteria | 501 |
| 816 | Ga0501076_0069984 | 3300049592 | Bacteria | 2804 |
| 817 | Ga0501076_0107435 | 3300049592 | Bacteria | 2253 |
| 818 | Ga0501076_0136338 | 3300049592 | Bacteria | 1992 |
| 819 | Ga0501076_0137306 | 3300049592 | Bacteria | 1985 |
| 820 | Ga0501076_0209492 | 3300049592 | Bacteria | 1592 |
| 821 | Ga0501076_0610213 | 3300049592 | Bacteria | 900 |
| 822 | Ga0501076_1595835 | 3300049592 | Bacteria | 535 |
| 823 | Ga0501077_0058278 | 3300049593 | Bacteria | 2451 |
| 824 | Ga0501077_0209806 | 3300049593 | Bacteria | 1238 |
| 825 | Ga0501077_0792412 | 3300049593 | Bacteria | 609 |
| 826 | Ga0501199_048697 | 3300049650 | Bacteria | 567 |
| 827 | Ga0501202_064865 | 3300049652 | Bacteria | 832 |
| 828 | Ga0501208_112977 | 3300049655 | Bacteria | 593 |
| 829 | Ga0501209_056512 | 3300049656 | Bacteria | 1084 |
| 830 | Ga0501211_022121 | 3300049658 | Bacteria | 673 |
| 831 | Ga0501214_073368 | 3300049659 | Bacteria | 563 |
| 832 | Ga0501228_037647 | 3300049666 | Bacteria | 618 |
| 833 | Ga0501233_147379 | 3300049668 | Bacteria | 654 |
| 834 | Ga0501235_052929 | 3300049669 | Bacteria | 943 |
| 835 | Ga0501239_024334 | 3300049672 | Bacteria | 762 |
| 836 | Ga0501239_048475 | 3300049672 | Bacteria | 608 |
| 837 | Ga0501243_016601 | 3300049675 | Bacteria | 1189 |
| 838 | Ga0501251_057662 | 3300049681 | Bacteria | 632 |
| 839 | Ga0501261_037271 | 3300049690 | Bacteria | 755 |
| 840 | Ga0501225_0218887 | 3300049705 | Bacteria | 612 |
| 841 | Ga0501079_0033531 | 3300049741 | Bacteria | 3950 |
| 842 | Ga0501079_0050830 | 3300049741 | Bacteria | 3198 |
| 843 | Ga0501079_1466146 | 3300049741 | Bacteria | 537 |
| 844 | Ga0501080_0090497 | 3300049742 | Bacteria | 2842 |
| 845 | Ga0501080_0248500 | 3300049742 | Bacteria | 1622 |
| 846 | Ga0501080_0401276 | 3300049742 | Bacteria | 1233 |
| 847 | Ga0501081_0025332 | 3300049743 | Bacteria | 3990 |
| 848 | Ga0501081_0026245 | 3300049743 | Bacteria | 3926 |
| 849 | Ga0501081_0094214 | 3300049743 | Bacteria | 2109 |
| 850 | Ga0501081_0428909 | 3300049743 | Bacteria | 981 |
| 851 | Ga0501083_0026775 | 3300049744 | Bacteria | 3984 |
| 852 | Ga0501083_0686370 | 3300049744 | Bacteria | 666 |
| 853 | Ga0501265_036451 | 3300049762 | Bacteria | 728 |
| 854 | Ga0501271_035068 | 3300049768 | Bacteria | 634 |
| 855 | Ga0501275_034329 | 3300049772 | Bacteria | 685 |
| 856 | Ga0501280_112236 | 3300049776 | Bacteria | 533 |
| 857 | Ga0501283_096921 | 3300049779 | Bacteria | 570 |
| 858 | Ga0501035_0026873 | 3300049822 | Bacteria | 5263 |
| 859 | Ga0501044_0998968 | 3300049823 | Bacteria | 709 |
| 860 | Ga0501044_1072297 | 3300049823 | Bacteria | 676 |
| 861 | Ga0501044_1379829 | 3300049823 | Bacteria | 570 |
| 862 | Ga0501045_0096174 | 3300049824 | Bacteria | 2191 |
| 863 | Ga0501045_0103098 | 3300049824 | Bacteria | 2112 |
| 864 | Ga0501045_0163446 | 3300049824 | Bacteria | 1657 |
| 865 | Ga0501045_0179419 | 3300049824 | Bacteria | 1578 |
| 866 | Ga0501045_0289912 | 3300049824 | Bacteria | 1218 |
| 867 | Ga0501045_1050561 | 3300049824 | Bacteria | 596 |
| 868 | Ga0501045_1054204 | 3300049824 | Bacteria | 595 |
| 869 | Ga0501212_022700 | 3300049851 | Bacteria | 980 |
| 870 | nmdc:mga0yw44_337332_c1 | 3300050492 | Bacteria | 1014 |
| 871 | nmdc:mga05p37_254741_c1 | 3300050507 | Bacteria | 2104 |
| 872 | nmdc:mga05p37_609611_c1 | 3300050507 | Bacteria | 1231 |
| 873 | nmdc:mga05p37_866448_c2 | 3300050507 | Bacteria | 658 |
| 874 | nmdc:mga09592_1639545_c1 | 3300050508 | Bacteria | 520 |
| 875 | nmdc:mga06r32_84995_c1 | 3300050510 | Bacteria | 3085 |
| 876 | nmdc:mga08y16_1251634_c1 | 3300050511 | Bacteria | 711 |
| 877 | nmdc:mga08y16_65151_c1 | 3300050511 | Bacteria | 3804 |
| 878 | nmdc:mga08y16_772377_c1 | 3300050511 | Bacteria | 956 |
| 879 | nmdc:mga0n895_1943878_c1 | 3300050512 | Bacteria | 547 |
| 880 | nmdc:mga0n895_2029175_c1 | 3300050512 | Bacteria | 533 |
| 881 | nmdc:mga0n895_220821_c1 | 3300050512 | Bacteria | 1924 |
| 882 | nmdc:mga0n895_426803_c1 | 3300050512 | Bacteria | 1340 |
| 883 | nmdc:mga0rr50_1175421_c1 | 3300050513 | Bacteria | 652 |
| 884 | nmdc:mga0rr50_627379_c1 | 3300050513 | Bacteria | 917 |
| 885 | nmdc:mga0rr50_670906_c1 | 3300050513 | Bacteria | 885 |
| 886 | nmdc:mga08x19_1002929_c1 | 3300050514 | Bacteria | 593 |
| 887 | nmdc:mga08x19_157770_c1 | 3300050514 | Bacteria | 1540 |
| 888 | nmdc:mga08x19_480054_c1 | 3300050514 | Bacteria | 876 |
| 889 | nmdc:mga0a205_143170_c1 | 3300050515 | Bacteria | 2291 |
| 890 | nmdc:mga0a205_182722_c1 | 3300050515 | Bacteria | 1991 |
| 891 | nmdc:mga0a205_456320_c1 | 3300050515 | Bacteria | 1138 |
| 892 | nmdc:mga0a205_62566_c1 | 3300050515 | Bacteria | 3596 |
| 893 | Ga0495601_0183820 | 3300053077 | Bacteria | 1366 |
| 894 | Ga0495595_0469754 | 3300053084 | Bacteria | 640 |
| 895 | Ga0495619_0252467 | 3300053085 | Bacteria | 1222 |
| 896 | Ga0501084_0029119 | 3300054114 | Bacteria | 4618 |
| 897 | Ga0501084_0046030 | 3300054114 | Bacteria | 3653 |
| 898 | Ga0501084_0050245 | 3300054114 | Bacteria | 3490 |
| 899 | Ga0501084_0210828 | 3300054114 | Bacteria | 1639 |
| 900 | Ga0501084_0305614 | 3300054114 | Bacteria | 1343 |
| 901 | Ga0501084_1037797 | 3300054114 | Bacteria | 689 |
| 902 | Ga0501084_1046972 | 3300054114 | Bacteria | 685 |
| 903 | Ga0501084_1375258 | 3300054114 | Bacteria | 591 |
| 904 | Ga0501084_1738268 | 3300054114 | Bacteria | 521 |
| 905 | Ga0590071_000248 | 3300059421 | Bacteria | 15569 |
| 906 | Ga0590075_017008 | 3300059424 | Bacteria | 1790 |
| 907 | Ga0590077_003053 | 3300059426 | Bacteria | 3505 |
| 908 | Ga0587070_107059 | 3300059491 | Bacteria | 651 |
| 909 | Ga0587083_0116511 | 3300059505 | Bacteria | 685 |
| 910 | Ga0587085_015084 | 3300059506 | Bacteria | 1099 |
| 911 | Ga0587085_131928 | 3300059506 | Bacteria | 559 |
| 912 | Ga0587088_180709 | 3300059508 | Bacteria | 528 |
| 913 | Ga0587091_179412 | 3300059511 | Bacteria | 556 |
| 914 | Ga0587115_119155 | 3300059626 | Bacteria | 506 |
| 915 | Ga0587068_056768 | 3300059641 | Bacteria | 745 |
| 916 | Ga0587072_114303 | 3300059643 | Bacteria | 619 |
| 917 | Ga0587075_060704 | 3300059644 | Bacteria | 681 |
| 918 | Ga0587076_031031 | 3300059645 | Bacteria | 947 |
| 919 | Ga0587076_072166 | 3300059645 | Bacteria | 719 |
| 920 | Ga0587105_031174 | 3300059651 | Bacteria | 509 |
| 921 | Ga0587107_077363 | 3300059652 | Bacteria | 619 |
| 922 | Ga0587107_095147 | 3300059652 | Bacteria | 581 |
| 923 | Ga0587107_155323 | 3300059652 | Bacteria | 500 |
| 924 | Ga0587111_0140164 | 3300060346 | Bacteria | 640 |
| 925 | Ga0501082_0036718 | 3300060353 | Bacteria | 4221 |
| 926 | Ga0501082_0168911 | 3300060353 | Bacteria | 1901 |
| 927 | Ga0501082_0208907 | 3300060353 | Bacteria | 1698 |
| 928 | Ga0501082_0316052 | 3300060353 | Bacteria | 1360 |
| 929 | Ga0501082_0390122 | 3300060353 | Bacteria | 1215 |
| 930 | Ga0501082_0458266 | 3300060353 | Bacteria | 1114 |
| 931 | Ga0501082_0605213 | 3300060353 | Bacteria | 959 |
| 932 | Ga0501082_0749769 | 3300060353 | Bacteria | 854 |
| 933 | Ga0501082_1786186 | 3300060353 | Bacteria | 536 |
| 934 | Ga0530510_0009759 | 3300061734 | Bacteria | 6736 |
| 935 | Ga0530510_0011210 | 3300061734 | Bacteria | 6290 |
| 936 | Ga0530510_0015703 | 3300061734 | Bacteria | 5352 |
| 937 | Ga0530510_0118231 | 3300061734 | Bacteria | 1944 |
| 938 | Ga0530510_0491830 | 3300061734 | Bacteria | 930 |
| 939 | Ga0530510_1122535 | 3300061734 | Bacteria | 602 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300059505 | Ga0587083_0116511 | Ga0587083_0116511_311_520 | 49 |
| 2 | 3300048909 | Ga0496106_1055409 | Ga0496106_1055409_147_308 | 53 |
| 3 | 3300049583 | Ga0501067_0358212 | Ga0501067_0358212_556_717 | 53 |
| 4 | 3300009148 | Ga0105243_10585040 | Ga0105243_105850404 | 58 |
| 5 | 3300009553 | Ga0105249_12829331 | Ga0105249_128293312 | 58 |
| 6 | 3300013297 | Ga0157378_11259696 | Ga0157378_112596963 | 58 |
| 7 | 3300048906 | Ga0496103_0011651 | Ga0496103_0011651_419_595 | 58 |
| 8 | 3300048909 | Ga0496106_0244933 | Ga0496106_0244933_253_429 | 58 |
| 9 | 3300048910 | Ga0496107_1266685 | Ga0496107_1266685_190_366 | 58 |
| 10 | 3300004803 | Ga0058862_10027267 | Ga0058862_100272672 | 59 |
| 11 | 3300005289 | Ga0065704_10372827 | Ga0065704_103728273 | 59 |
| 12 | 3300005336 | Ga0070680_100321120 | Ga0070680_1003211202 | 59 |
| 13 | 3300005406 | Ga0070703_10186047 | Ga0070703_101860472 | 59 |
| 14 | 3300005444 | Ga0070694_100678039 | Ga0070694_1006780394 | 59 |
| 15 | 3300005471 | Ga0070698_100920159 | Ga0070698_1009201594 | 59 |
| 16 | 3300005518 | Ga0070699_101445732 | Ga0070699_1014457322 | 59 |
| 17 | 3300005530 | Ga0070679_101767495 | Ga0070679_1017674953 | 59 |
| 18 | 3300005536 | Ga0070697_101123849 | Ga0070697_1011238492 | 59 |
| 19 | 3300005545 | Ga0070695_100039268 | Ga0070695_1000392684 | 59 |
| 20 | 3300005546 | Ga0070696_100296747 | Ga0070696_1002967472 | 59 |
| 21 | 3300005549 | Ga0070704_100202396 | Ga0070704_1002023962 | 59 |
| 22 | 3300014326 | Ga0157380_11037451 | Ga0157380_110374512 | 59 |
| 23 | 3300025885 | Ga0207653_10063012 | Ga0207653_100630123 | 59 |
| 24 | 3300025910 | Ga0207684_10393037 | Ga0207684_103930372 | 59 |
| 25 | 3300025912 | Ga0207707_10290941 | Ga0207707_102909413 | 59 |
| 26 | 3300031548 | Ga0307408_101944643 | Ga0307408_1019446432 | 59 |
| 27 | 3300032126 | Ga0307415_101454292 | Ga0307415_1014542922 | 59 |
| 28 | 3300042435 | Ga0439434_0085821 | Ga0439434_0085821_597_776 | 59 |
| 29 | 3300049568 | Ga0501031_0197050 | Ga0501031_0197050_447_626 | 59 |
| 30 | 3300049569 | Ga0501032_0110492 | Ga0501032_0110492_109_288 | 59 |
| 31 | 3300049570 | Ga0501033_0568113 | Ga0501033_0568113_72_251 | 59 |
| 32 | 3300049573 | Ga0501037_0463857 | Ga0501037_0463857_414_593 | 59 |
| 33 | 3300049574 | Ga0501038_0944003 | Ga0501038_0944003_335_514 | 59 |
| 34 | 3300049575 | Ga0501039_1067909 | Ga0501039_1067909_86_265 | 59 |
| 35 | 3300049577 | Ga0501041_0411664 | Ga0501041_0411664_370_549 | 59 |
| 36 | 3300049578 | Ga0501042_0542931 | Ga0501042_0542931_354_533 | 59 |
| 37 | 3300049580 | Ga0501046_0620260 | Ga0501046_0620260_340_519 | 59 |
| 38 | 3300049582 | Ga0501048_0069814 | Ga0501048_0069814_2166_2345 | 59 |
| 39 | 3300049585 | Ga0501069_0806667 | Ga0501069_0806667_157_336 | 59 |
| 40 | 3300049587 | Ga0501071_0448364 | Ga0501071_0448364_356_535 | 59 |
| 41 | 3300049588 | Ga0501072_0517392 | Ga0501072_0517392_51_230 | 59 |
| 42 | 3300049589 | Ga0501073_0467456 | Ga0501073_0467456_505_684 | 59 |
| 43 | 3300049589 | Ga0501073_0521317 | Ga0501073_0521317_177_356 | 59 |
| 44 | 3300049591 | Ga0501075_0037524 | Ga0501075_0037524_245_424 | 59 |
| 45 | 3300049592 | Ga0501076_1595835 | Ga0501076_1595835_176_355 | 59 |
| 46 | 3300049742 | Ga0501080_0401276 | Ga0501080_0401276_436_615 | 59 |
| 47 | 3300049743 | Ga0501081_0428909 | Ga0501081_0428909_533_712 | 59 |
| 48 | 3300049823 | Ga0501044_1072297 | Ga0501044_1072297_107_286 | 59 |
| 49 | 3300049824 | Ga0501045_0096174 | Ga0501045_0096174_1548_1727 | 59 |
| 50 | 3300054114 | Ga0501084_1046972 | Ga0501084_1046972_221_400 | 59 |
| 51 | 3300054114 | Ga0501084_1375258 | Ga0501084_1375258_134_313 | 59 |
| 52 | 3300060353 | Ga0501082_0458266 | Ga0501082_0458266_590_769 | 59 |
| 53 | 3300004798 | Ga0058859_10030995 | Ga0058859_100309952 | 60 |
| 54 | 3300005290 | Ga0065712_10401795 | Ga0065712_104017953 | 60 |
| 55 | 3300005293 | Ga0065715_10635613 | Ga0065715_106356133 | 60 |
| 56 | 3300005330 | Ga0070690_100326368 | Ga0070690_1003263682 | 60 |
| 57 | 3300005338 | Ga0068868_101244518 | Ga0068868_1012445183 | 60 |
| 58 | 3300005343 | Ga0070687_100641959 | Ga0070687_1006419592 | 60 |
| 59 | 3300005367 | Ga0070667_100329789 | Ga0070667_1003297891 | 60 |
| 60 | 3300005437 | Ga0070710_11343549 | Ga0070710_113435492 | 60 |
| 61 | 3300005440 | Ga0070705_100028430 | Ga0070705_1000284303 | 60 |
| 62 | 3300005441 | Ga0070700_101261422 | Ga0070700_1012614222 | 60 |
| 63 | 3300005444 | Ga0070694_101422324 | Ga0070694_1014223242 | 60 |
| 64 | 3300005445 | Ga0070708_100021693 | Ga0070708_1000216933 | 60 |
| 65 | 3300005445 | Ga0070708_100173962 | Ga0070708_1001739623 | 60 |
| 66 | 3300005459 | Ga0068867_102087865 | Ga0068867_1020878652 | 60 |
| 67 | 3300005466 | Ga0070685_10618241 | Ga0070685_106182412 | 60 |
| 68 | 3300005467 | Ga0070706_100040516 | Ga0070706_1000405168 | 60 |
| 69 | 3300005467 | Ga0070706_100484590 | Ga0070706_1004845903 | 60 |
| 70 | 3300005468 | Ga0070707_100098692 | Ga0070707_1000986924 | 60 |
| 71 | 3300005468 | Ga0070707_100291996 | Ga0070707_1002919963 | 60 |
| 72 | 3300005471 | Ga0070698_100045715 | Ga0070698_1000457153 | 60 |
| 73 | 3300005471 | Ga0070698_100084781 | Ga0070698_1000847813 | 60 |
| 74 | 3300005471 | Ga0070698_101356538 | Ga0070698_1013565382 | 60 |
| 75 | 3300005518 | Ga0070699_100181167 | Ga0070699_1001811672 | 60 |
| 76 | 3300005518 | Ga0070699_100855497 | Ga0070699_1008554972 | 60 |
| 77 | 3300005518 | Ga0070699_101794379 | Ga0070699_1017943792 | 60 |
| 78 | 3300005518 | Ga0070699_102051599 | Ga0070699_1020515992 | 60 |
| 79 | 3300005535 | Ga0070684_101589770 | Ga0070684_1015897701 | 60 |
| 80 | 3300005536 | Ga0070697_100012567 | Ga0070697_1000125673 | 60 |
| 81 | 3300005536 | Ga0070697_100105328 | Ga0070697_1001053284 | 60 |
| 82 | 3300005536 | Ga0070697_100184681 | Ga0070697_1001846812 | 60 |
| 83 | 3300005544 | Ga0070686_100240245 | Ga0070686_1002402451 | 60 |
| 84 | 3300005545 | Ga0070695_100080457 | Ga0070695_1000804573 | 60 |
| 85 | 3300005546 | Ga0070696_101650052 | Ga0070696_1016500522 | 60 |
| 86 | 3300005549 | Ga0070704_100338901 | Ga0070704_1003389013 | 60 |
| 87 | 3300005549 | Ga0070704_100439002 | Ga0070704_1004390024 | 60 |
| 88 | 3300005614 | Ga0068856_102722090 | Ga0068856_1027220901 | 60 |
| 89 | 3300005616 | Ga0068852_100217744 | Ga0068852_1002177444 | 60 |
| 90 | 3300005718 | Ga0068866_11338054 | Ga0068866_113380541 | 60 |
| 91 | 3300005834 | Ga0068851_10264226 | Ga0068851_102642264 | 60 |
| 92 | 3300005842 | Ga0068858_101514665 | Ga0068858_1015146652 | 60 |
| 93 | 3300006163 | Ga0070715_10558793 | Ga0070715_105587933 | 60 |
| 94 | 3300006173 | Ga0070716_100263972 | Ga0070716_1002639723 | 60 |
| 95 | 3300006173 | Ga0070716_101271664 | Ga0070716_1012716642 | 60 |
| 96 | 3300006173 | Ga0070716_101721500 | Ga0070716_1017215002 | 60 |
| 97 | 3300006175 | Ga0070712_100981020 | Ga0070712_1009810201 | 60 |
| 98 | 3300006237 | Ga0097621_100807415 | Ga0097621_1008074152 | 60 |
| 99 | 3300006358 | Ga0068871_100896880 | Ga0068871_1008968801 | 60 |
| 100 | 3300006881 | Ga0068865_100226429 | Ga0068865_1002264291 | 60 |
| 101 | 3300009011 | Ga0105251_10066999 | Ga0105251_100669994 | 60 |
| 102 | 3300009093 | Ga0105240_11173332 | Ga0105240_111733322 | 60 |
| 103 | 3300009098 | Ga0105245_10746505 | Ga0105245_107465052 | 60 |
| 104 | 3300009098 | Ga0105245_11166052 | Ga0105245_111660523 | 60 |
| 105 | 3300009101 | Ga0105247_10861632 | Ga0105247_108616323 | 60 |
| 106 | 3300009101 | Ga0105247_11692624 | Ga0105247_116926242 | 60 |
| 107 | 3300009148 | Ga0105243_10637014 | Ga0105243_106370142 | 60 |
| 108 | 3300009148 | Ga0105243_12518553 | Ga0105243_125185533 | 60 |
| 109 | 3300009176 | Ga0105242_10839274 | Ga0105242_108392742 | 60 |
| 110 | 3300009177 | Ga0105248_11510176 | Ga0105248_115101764 | 60 |
| 111 | 3300009551 | Ga0105238_10825244 | Ga0105238_108252442 | 60 |
| 112 | 3300010375 | Ga0105239_12265214 | Ga0105239_122652143 | 60 |
| 113 | 3300010375 | Ga0105239_12812473 | Ga0105239_128124733 | 60 |
| 114 | 3300011119 | Ga0105246_11456342 | Ga0105246_114563423 | 60 |
| 115 | 3300013296 | Ga0157374_10265742 | Ga0157374_102657424 | 60 |
| 116 | 3300013297 | Ga0157378_10913110 | Ga0157378_109131101 | 60 |
| 117 | 3300013306 | Ga0163162_11255603 | Ga0163162_112556033 | 60 |
| 118 | 3300013306 | Ga0163162_12848112 | Ga0163162_128481122 | 60 |
| 119 | 3300013308 | Ga0157375_13454274 | Ga0157375_134542742 | 60 |
| 120 | 3300014325 | Ga0163163_10526117 | Ga0163163_105261174 | 60 |
| 121 | 3300014968 | Ga0157379_11441509 | Ga0157379_114415094 | 60 |
| 122 | 3300014968 | Ga0157379_11449126 | Ga0157379_114491262 | 60 |
| 123 | 3300014969 | Ga0157376_11024663 | Ga0157376_110246632 | 60 |
| 124 | 3300014969 | Ga0157376_11898288 | Ga0157376_118982882 | 60 |
| 125 | 3300025321 | Ga0207656_10221892 | Ga0207656_102218921 | 60 |
| 126 | 3300025898 | Ga0207692_11071524 | Ga0207692_110715242 | 60 |
| 127 | 3300025903 | Ga0207680_10238277 | Ga0207680_102382774 | 60 |
| 128 | 3300025905 | Ga0207685_10132869 | Ga0207685_101328692 | 60 |
| 129 | 3300025910 | Ga0207684_10023984 | Ga0207684_100239844 | 60 |
| 130 | 3300025913 | Ga0207695_10853129 | Ga0207695_108531292 | 60 |
| 131 | 3300025922 | Ga0207646_10004216 | Ga0207646_100042164 | 60 |
| 132 | 3300025922 | Ga0207646_10430443 | Ga0207646_104304432 | 60 |
| 133 | 3300025927 | Ga0207687_10541964 | Ga0207687_105419642 | 60 |
| 134 | 3300025927 | Ga0207687_10665427 | Ga0207687_106654272 | 60 |
| 135 | 3300025935 | Ga0207709_10969481 | Ga0207709_109694813 | 60 |
| 136 | 3300025939 | Ga0207665_10412618 | Ga0207665_104126182 | 60 |
| 137 | 3300025939 | Ga0207665_11414374 | Ga0207665_114143741 | 60 |
| 138 | 3300025941 | Ga0207711_10408907 | Ga0207711_104089072 | 60 |
| 139 | 3300026023 | Ga0207677_11417490 | Ga0207677_114174902 | 60 |
| 140 | 3300026035 | Ga0207703_12275174 | Ga0207703_122751743 | 60 |
| 141 | 3300026067 | Ga0207678_10276342 | Ga0207678_102763422 | 60 |
| 142 | 3300035083 | Ga0373926_0098127 | Ga0373926_0098127_119_301 | 60 |
| 143 | 3300035171 | Ga0373946_0507291 | Ga0373946_0507291_174_356 | 60 |
| 144 | 3300035172 | Ga0373955_0332584 | Ga0373955_0332584_245_427 | 60 |
| 145 | 3300035724 | Ga0373933_0757909 | Ga0373933_0757909_333_515 | 60 |
| 146 | 3300041997 | Ga0439431_0178426 | Ga0439431_0178426_238_420 | 60 |
| 147 | 3300046473 | Ga0495582_0264675 | Ga0495582_0264675_182_364 | 60 |
| 148 | 3300046473 | Ga0495582_0387772 | Ga0495582_0387772_423_605 | 60 |
| 149 | 3300046476 | Ga0495662_0258322 | Ga0495662_0258322_202_384 | 60 |
| 150 | 3300046523 | Ga0495644_0073999 | Ga0495644_0073999_39_221 | 60 |
| 151 | 3300046538 | Ga0495609_0313839 | Ga0495609_0313839_273_455 | 60 |
| 152 | 3300046664 | Ga0495659_0221644 | Ga0495659_0221644_94_276 | 60 |
| 153 | 3300046681 | Ga0495647_0122158 | Ga0495647_0122158_175_357 | 60 |
| 154 | 3300046683 | Ga0495658_0951817 | Ga0495658_0951817_65_247 | 60 |
| 155 | 3300046689 | Ga0495613_1013100 | Ga0495613_1013100_176_358 | 60 |
| 156 | 3300046690 | Ga0495624_0867277 | Ga0495624_0867277_126_308 | 60 |
| 157 | 3300047321 | Ga0495676_0412536 | Ga0495676_0412536_412_594 | 60 |
| 158 | 3300048089 | Ga0495614_0426175 | Ga0495614_0426175_80_262 | 60 |
| 159 | 3300048089 | Ga0495614_0652200 | Ga0495614_0652200_49_231 | 60 |
| 160 | 3300048904 | Ga0496101_0844817 | Ga0496101_0844817_324_506 | 60 |
| 161 | 3300048904 | Ga0496101_1414834 | Ga0496101_1414834_166_348 | 60 |
| 162 | 3300048905 | Ga0496102_1128921 | Ga0496102_1128921_132_314 | 60 |
| 163 | 3300048906 | Ga0496103_0511251 | Ga0496103_0511251_411_593 | 60 |
| 164 | 3300048907 | Ga0496104_0022038 | Ga0496104_0022038_1451_1633 | 60 |
| 165 | 3300048907 | Ga0496104_0048572 | Ga0496104_0048572_701_883 | 60 |
| 166 | 3300048908 | Ga0496105_0202168 | Ga0496105_0202168_1029_1211 | 60 |
| 167 | 3300048908 | Ga0496105_0326202 | Ga0496105_0326202_824_1006 | 60 |
| 168 | 3300048909 | Ga0496106_0245719 | Ga0496106_0245719_474_656 | 60 |
| 169 | 3300048910 | Ga0496107_0692959 | Ga0496107_0692959_144_326 | 60 |
| 170 | 3300048911 | Ga0496108_0005881 | Ga0496108_0005881_3592_3774 | 60 |
| 171 | 3300048911 | Ga0496108_0133733 | Ga0496108_0133733_299_481 | 60 |
| 172 | 3300048912 | Ga0496109_0007365 | Ga0496109_0007365_4340_4522 | 60 |
| 173 | 3300048912 | Ga0496109_0416989 | Ga0496109_0416989_658_840 | 60 |
| 174 | 3300048912 | Ga0496109_1731753 | Ga0496109_1731753_271_453 | 60 |
| 175 | 3300048913 | Ga0496110_0411793 | Ga0496110_0411793_688_870 | 60 |
| 176 | 3300048914 | Ga0496111_0158088 | Ga0496111_0158088_243_425 | 60 |
| 177 | 3300048914 | Ga0496111_0198587 | Ga0496111_0198587_887_1069 | 60 |
| 178 | 3300048915 | Ga0496112_0002921 | Ga0496112_0002921_8029_8211 | 60 |
| 179 | 3300048915 | Ga0496112_1342087 | Ga0496112_1342087_399_581 | 60 |
| 180 | 3300048916 | Ga0496113_0010238 | Ga0496113_0010238_4073_4255 | 60 |
| 181 | 3300048916 | Ga0496113_0697451 | Ga0496113_0697451_423_605 | 60 |
| 182 | 3300048917 | Ga0496114_0182212 | Ga0496114_0182212_1481_1663 | 60 |
| 183 | 3300048917 | Ga0496114_0997559 | Ga0496114_0997559_115_297 | 60 |
| 184 | 3300049568 | Ga0501031_0324091 | Ga0501031_0324091_621_803 | 60 |
| 185 | 3300049572 | Ga0501036_0165028 | Ga0501036_0165028_1504_1686 | 60 |
| 186 | 3300053077 | Ga0495601_0183820 | Ga0495601_0183820_801_983 | 60 |
| 187 | 3300053084 | Ga0495595_0469754 | Ga0495595_0469754_385_567 | 60 |
| 188 | 3300053085 | Ga0495619_0252467 | Ga0495619_0252467_554_736 | 60 |
| 189 | 3300059421 | Ga0590071_000248 | Ga0590071_000248_14999_15181 | 60 |
| 190 | 3300059424 | Ga0590075_017008 | Ga0590075_017008_1224_1406 | 60 |
| 191 | 3300059426 | Ga0590077_003053 | Ga0590077_003053_371_553 | 60 |
| 192 | 3300059491 | Ga0587070_107059 | Ga0587070_107059_90_272 | 60 |
| 193 | 3300059508 | Ga0587088_180709 | Ga0587088_180709_108_290 | 60 |
| 194 | 3300059511 | Ga0587091_179412 | Ga0587091_179412_285_467 | 60 |
| 195 | 3300059644 | Ga0587075_060704 | Ga0587075_060704_156_338 | 60 |
| 196 | 3300059645 | Ga0587076_072166 | Ga0587076_072166_124_306 | 60 |
| 197 | 3300003203 | JGI25406J46586_10009666 | JGI25406J46586_100096666 | 61 |
| 198 | 3300004801 | Ga0058860_10027684 | Ga0058860_100276844 | 61 |
| 199 | 3300005337 | Ga0070682_100805663 | Ga0070682_1008056632 | 61 |
| 200 | 3300005338 | Ga0068868_100349188 | Ga0068868_1003491883 | 61 |
| 201 | 3300005340 | Ga0070689_100917548 | Ga0070689_1009175481 | 61 |
| 202 | 3300005353 | Ga0070669_101916647 | Ga0070669_1019166472 | 61 |
| 203 | 3300005354 | Ga0070675_101344378 | Ga0070675_1013443781 | 61 |
| 204 | 3300005438 | Ga0070701_10054367 | Ga0070701_100543673 | 61 |
| 205 | 3300005440 | Ga0070705_100280402 | Ga0070705_1002804022 | 61 |
| 206 | 3300005441 | Ga0070700_100883108 | Ga0070700_1008831081 | 61 |
| 207 | 3300005444 | Ga0070694_100794457 | Ga0070694_1007944572 | 61 |
| 208 | 3300005455 | Ga0070663_100504094 | Ga0070663_1005040942 | 61 |
| 209 | 3300005456 | Ga0070678_102065119 | Ga0070678_1020651192 | 61 |
| 210 | 3300005468 | Ga0070707_101628786 | Ga0070707_1016287861 | 61 |
| 211 | 3300005468 | Ga0070707_102323121 | Ga0070707_1023231212 | 61 |
| 212 | 3300005471 | Ga0070698_100926067 | Ga0070698_1009260673 | 61 |
| 213 | 3300005518 | Ga0070699_101092972 | Ga0070699_1010929723 | 61 |
| 214 | 3300005536 | Ga0070697_100723975 | Ga0070697_1007239753 | 61 |
| 215 | 3300005544 | Ga0070686_101666956 | Ga0070686_1016669562 | 61 |
| 216 | 3300005545 | Ga0070695_101218731 | Ga0070695_1012187312 | 61 |
| 217 | 3300005546 | Ga0070696_100275622 | Ga0070696_1002756224 | 61 |
| 218 | 3300005547 | Ga0070693_101400411 | Ga0070693_1014004112 | 61 |
| 219 | 3300005549 | Ga0070704_101833780 | Ga0070704_1018337802 | 61 |
| 220 | 3300005563 | Ga0068855_101000371 | Ga0068855_1010003714 | 61 |
| 221 | 3300005578 | Ga0068854_101708474 | Ga0068854_1017084742 | 61 |
| 222 | 3300005615 | Ga0070702_101783717 | Ga0070702_1017837172 | 61 |
| 223 | 3300005617 | Ga0068859_101456537 | Ga0068859_1014565374 | 61 |
| 224 | 3300005718 | Ga0068866_10279534 | Ga0068866_102795341 | 61 |
| 225 | 3300005719 | Ga0068861_100724626 | Ga0068861_1007246262 | 61 |
| 226 | 3300005719 | Ga0068861_101021100 | Ga0068861_1010211002 | 61 |
| 227 | 3300005840 | Ga0068870_10735801 | Ga0068870_107358011 | 61 |
| 228 | 3300005844 | Ga0068862_101281327 | Ga0068862_1012813272 | 61 |
| 229 | 3300005985 | Ga0081539_10002087 | Ga0081539_1000208719 | 61 |
| 230 | 3300006852 | Ga0075433_10944981 | Ga0075433_109449813 | 61 |
| 231 | 3300006931 | Ga0097620_101456521 | Ga0097620_1014565214 | 61 |
| 232 | 3300007076 | Ga0075435_100522835 | Ga0075435_1005228352 | 61 |
| 233 | 3300009094 | Ga0111539_11331570 | Ga0111539_113315703 | 61 |
| 234 | 3300009148 | Ga0105243_12597863 | Ga0105243_125978632 | 61 |
| 235 | 3300009553 | Ga0105249_10492138 | Ga0105249_104921382 | 61 |
| 236 | 3300009553 | Ga0105249_11885749 | Ga0105249_118857493 | 61 |
| 237 | 3300010375 | Ga0105239_12166299 | Ga0105239_121662992 | 61 |
| 238 | 3300011119 | Ga0105246_10968939 | Ga0105246_109689392 | 61 |
| 239 | 3300014326 | Ga0157380_11040742 | Ga0157380_110407424 | 61 |
| 240 | 3300014745 | Ga0157377_10483225 | Ga0157377_104832254 | 61 |
| 241 | 3300025885 | Ga0207653_10158204 | Ga0207653_101582042 | 61 |
| 242 | 3300025922 | Ga0207646_11308692 | Ga0207646_113086923 | 61 |
| 243 | 3300025933 | Ga0207706_11053782 | Ga0207706_110537823 | 61 |
| 244 | 3300025936 | Ga0207670_10754289 | Ga0207670_107542893 | 61 |
| 245 | 3300025949 | Ga0207667_10791170 | Ga0207667_107911702 | 61 |
| 246 | 3300025981 | Ga0207640_11872801 | Ga0207640_118728012 | 61 |
| 247 | 3300026023 | Ga0207677_10728964 | Ga0207677_107289642 | 61 |
| 248 | 3300026075 | Ga0207708_10524672 | Ga0207708_105246724 | 61 |
| 249 | 3300027252 | Ga0209973_1020358 | Ga0209973_10203584 | 61 |
| 250 | 3300027552 | Ga0209982_1006777 | Ga0209982_10067772 | 61 |
| 251 | 3300027617 | Ga0210002_1049075 | Ga0210002_10490753 | 61 |
| 252 | 3300027665 | Ga0209983_1020600 | Ga0209983_10206002 | 61 |
| 253 | 3300027682 | Ga0209971_1019669 | Ga0209971_10196693 | 61 |
| 254 | 3300027876 | Ga0209974_10016162 | Ga0209974_100161624 | 61 |
| 255 | 3300027876 | Ga0209974_10429919 | Ga0209974_104299192 | 61 |
| 256 | 3300031824 | Ga0307413_10078953 | Ga0307413_100789532 | 61 |
| 257 | 3300031852 | Ga0307410_11539614 | Ga0307410_115396143 | 61 |
| 258 | 3300031995 | Ga0307409_100318090 | Ga0307409_1003180902 | 61 |
| 259 | 3300032002 | Ga0307416_101333408 | Ga0307416_1013334082 | 61 |
| 260 | 3300032004 | Ga0307414_10952636 | Ga0307414_109526362 | 61 |
| 261 | 3300038443 | Ga0395901_0312615 | Ga0395901_0312615_1043_1228 | 61 |
| 262 | 3300042530 | Ga0450916_073568 | Ga0450916_073568_351_536 | 61 |
| 263 | 3300046525 | Ga0495663_0086016 | Ga0495663_0086016_427_612 | 61 |
| 264 | 3300046615 | Ga0495656_0779253 | Ga0495656_0779253_19_204 | 61 |
| 265 | 3300046648 | Ga0495611_0230567 | Ga0495611_0230567_476_661 | 61 |
| 266 | 3300049568 | Ga0501031_0012970 | Ga0501031_0012970_5164_5349 | 61 |
| 267 | 3300049569 | Ga0501032_0183002 | Ga0501032_0183002_270_455 | 61 |
| 268 | 3300049570 | Ga0501033_0616993 | Ga0501033_0616993_203_388 | 61 |
| 269 | 3300049571 | Ga0501034_0276328 | Ga0501034_0276328_412_597 | 61 |
| 270 | 3300049572 | Ga0501036_0013129 | Ga0501036_0013129_801_986 | 61 |
| 271 | 3300049573 | Ga0501037_0076034 | Ga0501037_0076034_1070_1255 | 61 |
| 272 | 3300049574 | Ga0501038_0059905 | Ga0501038_0059905_128_313 | 61 |
| 273 | 3300049575 | Ga0501039_0069732 | Ga0501039_0069732_2078_2263 | 61 |
| 274 | 3300049576 | Ga0501040_0011743 | Ga0501040_0011743_5044_5229 | 61 |
| 275 | 3300049577 | Ga0501041_0020309 | Ga0501041_0020309_410_595 | 61 |
| 276 | 3300049578 | Ga0501042_0074548 | Ga0501042_0074548_2129_2314 | 61 |
| 277 | 3300049580 | Ga0501046_0288148 | Ga0501046_0288148_538_723 | 61 |
| 278 | 3300049582 | Ga0501048_0012332 | Ga0501048_0012332_3383_3568 | 61 |
| 279 | 3300049584 | Ga0501068_0013746 | Ga0501068_0013746_1014_1199 | 61 |
| 280 | 3300049585 | Ga0501069_0022378 | Ga0501069_0022378_2891_3076 | 61 |
| 281 | 3300049586 | Ga0501070_0100767 | Ga0501070_0100767_2091_2276 | 61 |
| 282 | 3300049587 | Ga0501071_0016406 | Ga0501071_0016406_199_384 | 61 |
| 283 | 3300049588 | Ga0501072_0365326 | Ga0501072_0365326_248_433 | 61 |
| 284 | 3300049589 | Ga0501073_0078522 | Ga0501073_0078522_2068_2253 | 61 |
| 285 | 3300049590 | Ga0501074_0074160 | Ga0501074_0074160_1932_2117 | 61 |
| 286 | 3300049591 | Ga0501075_0715528 | Ga0501075_0715528_110_295 | 61 |
| 287 | 3300049592 | Ga0501076_0107435 | Ga0501076_0107435_827_1012 | 61 |
| 288 | 3300049593 | Ga0501077_0058278 | Ga0501077_0058278_1799_1984 | 61 |
| 289 | 3300049741 | Ga0501079_0050830 | Ga0501079_0050830_495_680 | 61 |
| 290 | 3300049742 | Ga0501080_0090497 | Ga0501080_0090497_1174_1359 | 61 |
| 291 | 3300049743 | Ga0501081_0026245 | Ga0501081_0026245_3486_3671 | 61 |
| 292 | 3300049744 | Ga0501083_0026775 | Ga0501083_0026775_3597_3782 | 61 |
| 293 | 3300049822 | Ga0501035_0026873 | Ga0501035_0026873_4965_5150 | 61 |
| 294 | 3300049823 | Ga0501044_1379829 | Ga0501044_1379829_44_229 | 61 |
| 295 | 3300049824 | Ga0501045_0103098 | Ga0501045_0103098_500_685 | 61 |
| 296 | 3300050511 | nmdc:mga08y16_1251634_c1 | nmdc:mga08y16_1251634_c1_155_340 | 61 |
| 297 | 3300054114 | Ga0501084_0029119 | Ga0501084_0029119_3151_3336 | 61 |
| 298 | 3300060353 | Ga0501082_0208907 | Ga0501082_0208907_188_373 | 61 |
| 299 | 3300061734 | Ga0530510_0009759 | Ga0530510_0009759_449_634 | 61 |
| 300 | 3300005336 | Ga0070680_100682548 | Ga0070680_1006825482 | 62 |
| 301 | 3300005356 | Ga0070674_100103993 | Ga0070674_1001039934 | 62 |
| 302 | 3300005356 | Ga0070674_101320877 | Ga0070674_1013208772 | 62 |
| 303 | 3300005365 | Ga0070688_100480838 | Ga0070688_1004808381 | 62 |
| 304 | 3300005436 | Ga0070713_101648358 | Ga0070713_1016483582 | 62 |
| 305 | 3300005441 | Ga0070700_100773600 | Ga0070700_1007736004 | 62 |
| 306 | 3300005445 | Ga0070708_100342283 | Ga0070708_1003422834 | 62 |
| 307 | 3300005458 | Ga0070681_10283178 | Ga0070681_102831782 | 62 |
| 308 | 3300005466 | Ga0070685_10336638 | Ga0070685_103366384 | 62 |
| 309 | 3300005467 | Ga0070706_101628946 | Ga0070706_1016289461 | 62 |
| 310 | 3300005471 | Ga0070698_101065374 | Ga0070698_1010653741 | 62 |
| 311 | 3300005536 | Ga0070697_101653937 | Ga0070697_1016539373 | 62 |
| 312 | 3300005544 | Ga0070686_101609910 | Ga0070686_1016099102 | 62 |
| 313 | 3300005546 | Ga0070696_100367818 | Ga0070696_1003678184 | 62 |
| 314 | 3300005547 | Ga0070693_100992972 | Ga0070693_1009929722 | 62 |
| 315 | 3300005719 | Ga0068861_100043615 | Ga0068861_1000436154 | 62 |
| 316 | 3300006881 | Ga0068865_100575930 | Ga0068865_1005759304 | 62 |
| 317 | 3300006881 | Ga0068865_101826023 | Ga0068865_1018260231 | 62 |
| 318 | 3300009098 | Ga0105245_13253944 | Ga0105245_132539442 | 62 |
| 319 | 3300009148 | Ga0105243_10781936 | Ga0105243_107819362 | 62 |
| 320 | 3300009176 | Ga0105242_10297351 | Ga0105242_102973513 | 62 |
| 321 | 3300009545 | Ga0105237_10966472 | Ga0105237_109664722 | 62 |
| 322 | 3300009553 | Ga0105249_12278481 | Ga0105249_122784812 | 62 |
| 323 | 3300013296 | Ga0157374_10728428 | Ga0157374_107284283 | 62 |
| 324 | 3300014325 | Ga0163163_13043396 | Ga0163163_130433962 | 62 |
| 325 | 3300014326 | Ga0157380_11514832 | Ga0157380_115148322 | 62 |
| 326 | 3300017792 | Ga0163161_10735802 | Ga0163161_107358022 | 62 |
| 327 | 3300025912 | Ga0207707_10224487 | Ga0207707_102244872 | 62 |
| 328 | 3300025926 | Ga0207659_10608607 | Ga0207659_106086073 | 62 |
| 329 | 3300025934 | Ga0207686_10657768 | Ga0207686_106577682 | 62 |
| 330 | 3300025937 | Ga0207669_10022441 | Ga0207669_100224413 | 62 |
| 331 | 3300025937 | Ga0207669_10850612 | Ga0207669_108506122 | 62 |
| 332 | 3300025938 | Ga0207704_10153708 | Ga0207704_101537082 | 62 |
| 333 | 3300026075 | Ga0207708_11777193 | Ga0207708_117771932 | 62 |
| 334 | 3300026118 | Ga0207675_100822742 | Ga0207675_1008227422 | 62 |
| 335 | 3300027424 | Ga0209984_1038469 | Ga0209984_10384691 | 62 |
| 336 | 3300027665 | Ga0209983_1044215 | Ga0209983_10442153 | 62 |
| 337 | 3300027665 | Ga0209983_1050545 | Ga0209983_10505452 | 62 |
| 338 | 3300027682 | Ga0209971_1179172 | Ga0209971_11791722 | 62 |
| 339 | 3300027695 | Ga0209966_1091951 | Ga0209966_10919512 | 62 |
| 340 | 3300027876 | Ga0209974_10090696 | Ga0209974_100906963 | 62 |
| 341 | 3300027876 | Ga0209974_10424313 | Ga0209974_104243132 | 62 |
| 342 | 3300031995 | Ga0307409_100852074 | Ga0307409_1008520742 | 62 |
| 343 | 3300035691 | Ga0373931_1020186 | Ga0373931_1020186_210_398 | 62 |
| 344 | 3300041486 | Ga0451807_0415819 | Ga0451807_0415819_19_207 | 62 |
| 345 | 3300042118 | Ga0450914_034842 | Ga0450914_034842_151_339 | 62 |
| 346 | 3300042125 | Ga0450923_015004 | Ga0450923_015004_381_569 | 62 |
| 347 | 3300042145 | Ga0450906_013042 | Ga0450906_013042_1276_1464 | 62 |
| 348 | 3300042147 | Ga0450910_068298 | Ga0450910_068298_83_271 | 62 |
| 349 | 3300042184 | Ga0450908_044198 | Ga0450908_044198_534_722 | 62 |
| 350 | 3300046694 | Ga0495649_0236389 | Ga0495649_0236389_234_422 | 62 |
| 351 | 3300048903 | Ga0496100_0891638 | Ga0496100_0891638_71_259 | 62 |
| 352 | 3300048904 | Ga0496101_0777076 | Ga0496101_0777076_396_584 | 62 |
| 353 | 3300048907 | Ga0496104_0173708 | Ga0496104_0173708_1626_1814 | 62 |
| 354 | 3300048912 | Ga0496109_0069348 | Ga0496109_0069348_441_629 | 62 |
| 355 | 3300048913 | Ga0496110_1577385 | Ga0496110_1577385_291_482 | 62 |
| 356 | 3300048914 | Ga0496111_0070108 | Ga0496111_0070108_984_1172 | 62 |
| 357 | 3300048917 | Ga0496114_0165095 | Ga0496114_0165095_1209_1397 | 62 |
| 358 | 3300048917 | Ga0496114_0689443 | Ga0496114_0689443_371_559 | 62 |
| 359 | 3300049521 | Ga0501298_138082 | Ga0501298_138082_305_493 | 62 |
| 360 | 3300049572 | Ga0501036_0462525 | Ga0501036_0462525_52_240 | 62 |
| 361 | 3300049574 | Ga0501038_0824239 | Ga0501038_0824239_158_346 | 62 |
| 362 | 3300049575 | Ga0501039_0511992 | Ga0501039_0511992_610_798 | 62 |
| 363 | 3300049575 | Ga0501039_0788581 | Ga0501039_0788581_514_702 | 62 |
| 364 | 3300049576 | Ga0501040_0387918 | Ga0501040_0387918_320_508 | 62 |
| 365 | 3300049577 | Ga0501041_0049911 | Ga0501041_0049911_817_1005 | 62 |
| 366 | 3300049577 | Ga0501041_0671731 | Ga0501041_0671731_23_211 | 62 |
| 367 | 3300049578 | Ga0501042_1443820 | Ga0501042_1443820_84_272 | 62 |
| 368 | 3300049579 | Ga0501043_0831378 | Ga0501043_0831378_192_380 | 62 |
| 369 | 3300049580 | Ga0501046_0586255 | Ga0501046_0586255_37_225 | 62 |
| 370 | 3300049582 | Ga0501048_0173849 | Ga0501048_0173849_931_1119 | 62 |
| 371 | 3300049584 | Ga0501068_0861721 | Ga0501068_0861721_126_314 | 62 |
| 372 | 3300049587 | Ga0501071_0855269 | Ga0501071_0855269_392_580 | 62 |
| 373 | 3300049588 | Ga0501072_0298988 | Ga0501072_0298988_414_602 | 62 |
| 374 | 3300049588 | Ga0501072_0897159 | Ga0501072_0897159_290_478 | 62 |
| 375 | 3300049590 | Ga0501074_1001522 | Ga0501074_1001522_178_366 | 62 |
| 376 | 3300049592 | Ga0501076_0069984 | Ga0501076_0069984_2439_2627 | 62 |
| 377 | 3300049592 | Ga0501076_0136338 | Ga0501076_0136338_510_698 | 62 |
| 378 | 3300049705 | Ga0501225_0218887 | Ga0501225_0218887_195_383 | 62 |
| 379 | 3300049741 | Ga0501079_0033531 | Ga0501079_0033531_3031_3219 | 62 |
| 380 | 3300049743 | Ga0501081_0025332 | Ga0501081_0025332_3074_3262 | 62 |
| 381 | 3300049824 | Ga0501045_0179419 | Ga0501045_0179419_949_1137 | 62 |
| 382 | 3300049824 | Ga0501045_1054204 | Ga0501045_1054204_197_385 | 62 |
| 383 | 3300054114 | Ga0501084_0050245 | Ga0501084_0050245_211_399 | 62 |
| 384 | 3300054114 | Ga0501084_0210828 | Ga0501084_0210828_348_536 | 62 |
| 385 | 3300054114 | Ga0501084_1738268 | Ga0501084_1738268_100_288 | 62 |
| 386 | 3300059626 | Ga0587115_119155 | Ga0587115_119155_200_388 | 62 |
| 387 | 3300060353 | Ga0501082_0168911 | Ga0501082_0168911_140_328 | 62 |
| 388 | 3300060353 | Ga0501082_0749769 | Ga0501082_0749769_397_585 | 62 |
| 389 | 3300060353 | Ga0501082_1786186 | Ga0501082_1786186_119_307 | 62 |
| 390 | 3300061734 | Ga0530510_0015703 | Ga0530510_0015703_3882_4070 | 62 |
| 391 | 3300061734 | Ga0530510_0118231 | Ga0530510_0118231_1739_1927 | 62 |
| 392 | 3300061734 | Ga0530510_0491830 | Ga0530510_0491830_88_276 | 62 |
| 393 | 3300002459 | JGI24751J29686_10013331 | JGI24751J29686_100133313 | 63 |
| 394 | 3300005295 | Ga0065707_10879597 | Ga0065707_108795972 | 63 |
| 395 | 3300005329 | Ga0070683_100507299 | Ga0070683_1005072992 | 63 |
| 396 | 3300005330 | Ga0070690_100162217 | Ga0070690_1001622174 | 63 |
| 397 | 3300005334 | Ga0068869_100840343 | Ga0068869_1008403432 | 63 |
| 398 | 3300005335 | Ga0070666_10599745 | Ga0070666_105997454 | 63 |
| 399 | 3300005336 | Ga0070680_101458830 | Ga0070680_1014588302 | 63 |
| 400 | 3300005338 | Ga0068868_100325958 | Ga0068868_1003259584 | 63 |
| 401 | 3300005340 | Ga0070689_100304847 | Ga0070689_1003048472 | 63 |
| 402 | 3300005341 | Ga0070691_10350481 | Ga0070691_103504812 | 63 |
| 403 | 3300005344 | Ga0070661_100569102 | Ga0070661_1005691024 | 63 |
| 404 | 3300005354 | Ga0070675_100894687 | Ga0070675_1008946872 | 63 |
| 405 | 3300005367 | Ga0070667_100075769 | Ga0070667_1000757697 | 63 |
| 406 | 3300005438 | Ga0070701_10489370 | Ga0070701_104893702 | 63 |
| 407 | 3300005439 | Ga0070711_100677549 | Ga0070711_1006775493 | 63 |
| 408 | 3300005440 | Ga0070705_101054690 | Ga0070705_1010546903 | 63 |
| 409 | 3300005441 | Ga0070700_101992676 | Ga0070700_1019926762 | 63 |
| 410 | 3300005444 | Ga0070694_100607329 | Ga0070694_1006073292 | 63 |
| 411 | 3300005445 | Ga0070708_101091673 | Ga0070708_1010916732 | 63 |
| 412 | 3300005456 | Ga0070678_100159402 | Ga0070678_1001594022 | 63 |
| 413 | 3300005471 | Ga0070698_100993079 | Ga0070698_1009930792 | 63 |
| 414 | 3300005518 | Ga0070699_100077369 | Ga0070699_1000773693 | 63 |
| 415 | 3300005518 | Ga0070699_100773320 | Ga0070699_1007733202 | 63 |
| 416 | 3300005518 | Ga0070699_100875053 | Ga0070699_1008750532 | 63 |
| 417 | 3300005530 | Ga0070679_100562028 | Ga0070679_1005620282 | 63 |
| 418 | 3300005535 | Ga0070684_100182697 | Ga0070684_1001826973 | 63 |
| 419 | 3300005535 | Ga0070684_100320665 | Ga0070684_1003206654 | 63 |
| 420 | 3300005544 | Ga0070686_100521042 | Ga0070686_1005210424 | 63 |
| 421 | 3300005544 | Ga0070686_100829016 | Ga0070686_1008290162 | 63 |
| 422 | 3300005546 | Ga0070696_100752543 | Ga0070696_1007525434 | 63 |
| 423 | 3300005546 | Ga0070696_100811911 | Ga0070696_1008119114 | 63 |
| 424 | 3300005546 | Ga0070696_101222000 | Ga0070696_1012220001 | 63 |
| 425 | 3300005549 | Ga0070704_101979963 | Ga0070704_1019799632 | 63 |
| 426 | 3300005577 | Ga0068857_100137897 | Ga0068857_1001378972 | 63 |
| 427 | 3300005577 | Ga0068857_100298521 | Ga0068857_1002985211 | 63 |
| 428 | 3300005578 | Ga0068854_101956811 | Ga0068854_1019568111 | 63 |
| 429 | 3300005614 | Ga0068856_100307662 | Ga0068856_1003076624 | 63 |
| 430 | 3300005615 | Ga0070702_100086340 | Ga0070702_1000863404 | 63 |
| 431 | 3300005842 | Ga0068858_101075074 | Ga0068858_1010750741 | 63 |
| 432 | 3300006237 | Ga0097621_100361892 | Ga0097621_1003618924 | 63 |
| 433 | 3300006237 | Ga0097621_102328181 | Ga0097621_1023281812 | 63 |
| 434 | 3300006358 | Ga0068871_100103647 | Ga0068871_1001036475 | 63 |
| 435 | 3300007788 | Ga0099795_10303707 | Ga0099795_103037072 | 63 |
| 436 | 3300009036 | Ga0105244_10186311 | Ga0105244_101863113 | 63 |
| 437 | 3300009101 | Ga0105247_11201884 | Ga0105247_112018842 | 63 |
| 438 | 3300009148 | Ga0105243_11139061 | Ga0105243_111390612 | 63 |
| 439 | 3300009174 | Ga0105241_12571318 | Ga0105241_125713181 | 63 |
| 440 | 3300009176 | Ga0105242_10463114 | Ga0105242_104631144 | 63 |
| 441 | 3300009177 | Ga0105248_11178129 | Ga0105248_111781292 | 63 |
| 442 | 3300009177 | Ga0105248_13313266 | Ga0105248_133132662 | 63 |
| 443 | 3300009551 | Ga0105238_10328716 | Ga0105238_103287162 | 63 |
| 444 | 3300009553 | Ga0105249_11308605 | Ga0105249_113086052 | 63 |
| 445 | 3300011119 | Ga0105246_12110491 | Ga0105246_121104912 | 63 |
| 446 | 3300013104 | Ga0157370_11061661 | Ga0157370_110616612 | 63 |
| 447 | 3300013297 | Ga0157378_11553276 | Ga0157378_115532763 | 63 |
| 448 | 3300013308 | Ga0157375_11151575 | Ga0157375_111515754 | 63 |
| 449 | 3300014325 | Ga0163163_10259786 | Ga0163163_102597862 | 63 |
| 450 | 3300014325 | Ga0163163_11444496 | Ga0163163_114444963 | 63 |
| 451 | 3300014325 | Ga0163163_11756174 | Ga0163163_117561742 | 63 |
| 452 | 3300014325 | Ga0163163_11812411 | Ga0163163_118124112 | 63 |
| 453 | 3300014745 | Ga0157377_10417560 | Ga0157377_104175604 | 63 |
| 454 | 3300014969 | Ga0157376_10148277 | Ga0157376_101482772 | 63 |
| 455 | 3300020070 | Ga0206356_10505645 | Ga0206356_105056453 | 63 |
| 456 | 3300020078 | Ga0206352_11256669 | Ga0206352_112566693 | 63 |
| 457 | 3300025735 | Ga0207713_1061982 | Ga0207713_10619822 | 63 |
| 458 | 3300025901 | Ga0207688_10794965 | Ga0207688_107949652 | 63 |
| 459 | 3300025915 | Ga0207693_10691971 | Ga0207693_106919711 | 63 |
| 460 | 3300025920 | Ga0207649_10417978 | Ga0207649_104179784 | 63 |
| 461 | 3300025931 | Ga0207644_10855190 | Ga0207644_108551902 | 63 |
| 462 | 3300025934 | Ga0207686_10341698 | Ga0207686_103416984 | 63 |
| 463 | 3300025935 | Ga0207709_10080062 | Ga0207709_100800622 | 63 |
| 464 | 3300025936 | Ga0207670_11314009 | Ga0207670_113140092 | 63 |
| 465 | 3300025944 | Ga0207661_10212042 | Ga0207661_102120424 | 63 |
| 466 | 3300025961 | Ga0207712_11290679 | Ga0207712_112906792 | 63 |
| 467 | 3300025986 | Ga0207658_10302443 | Ga0207658_103024434 | 63 |
| 468 | 3300026078 | Ga0207702_11057120 | Ga0207702_110571204 | 63 |
| 469 | 3300026116 | Ga0207674_10096522 | Ga0207674_100965223 | 63 |
| 470 | 3300026121 | Ga0207683_10114781 | Ga0207683_101147812 | 63 |
| 471 | 3300027526 | Ga0209968_1005468 | Ga0209968_10054684 | 63 |
| 472 | 3300031548 | Ga0307408_100041695 | Ga0307408_1000416958 | 63 |
| 473 | 3300031731 | Ga0307405_10476490 | Ga0307405_104764902 | 63 |
| 474 | 3300031824 | Ga0307413_11278474 | Ga0307413_112784742 | 63 |
| 475 | 3300031901 | Ga0307406_11402688 | Ga0307406_114026882 | 63 |
| 476 | 3300031903 | Ga0307407_10154985 | Ga0307407_101549853 | 63 |
| 477 | 3300031911 | Ga0307412_10158459 | Ga0307412_101584594 | 63 |
| 478 | 3300031995 | Ga0307409_100044842 | Ga0307409_1000448427 | 63 |
| 479 | 3300032002 | Ga0307416_100307797 | Ga0307416_1003077972 | 63 |
| 480 | 3300032002 | Ga0307416_102548829 | Ga0307416_1025488293 | 63 |
| 481 | 3300032004 | Ga0307414_10782384 | Ga0307414_107823842 | 63 |
| 482 | 3300032126 | Ga0307415_100063143 | Ga0307415_1000631434 | 63 |
| 483 | 3300034817 | Ga0373948_0167434 | Ga0373948_0167434_106_297 | 63 |
| 484 | 3300034818 | Ga0373950_0120545 | Ga0373950_0120545_309_500 | 63 |
| 485 | 3300035085 | Ga0373929_0147805 | Ga0373929_0147805_195_386 | 63 |
| 486 | 3300035242 | Ga0373962_0072589 | Ga0373962_0072589_21_212 | 63 |
| 487 | 3300041411 | Ga0439466_0041798 | Ga0439466_0041798_351_542 | 63 |
| 488 | 3300042122 | Ga0450920_131719 | Ga0450920_131719_267_458 | 63 |
| 489 | 3300042128 | Ga0450897_034538 | Ga0450897_034538_275_466 | 63 |
| 490 | 3300042147 | Ga0450910_060232 | Ga0450910_060232_156_347 | 63 |
| 491 | 3300042185 | Ga0450909_021128 | Ga0450909_021128_82_273 | 63 |
| 492 | 3300042435 | Ga0439434_0088566 | Ga0439434_0088566_431_622 | 63 |
| 493 | 3300042876 | Ga0451577_0060452 | Ga0451577_0060452_58_249 | 63 |
| 494 | 3300042876 | Ga0451577_1377332 | Ga0451577_1377332_49_240 | 63 |
| 495 | 3300044673 | Ga0453683_0018052 | Ga0453683_0018052_1262_1453 | 63 |
| 496 | 3300044712 | Ga0453684_0794841 | Ga0453684_0794841_382_573 | 63 |
| 497 | 3300044712 | Ga0453684_1421790 | Ga0453684_1421790_138_329 | 63 |
| 498 | 3300045051 | Ga0451576_0040408 | Ga0451576_0040408_1100_1291 | 63 |
| 499 | 3300045976 | Ga0466967_1874688 | Ga0466967_1874688_202_393 | 63 |
| 500 | 3300046455 | Ga0495603_0220251 | Ga0495603_0220251_543_734 | 63 |
| 501 | 3300048904 | Ga0496101_0945591 | Ga0496101_0945591_46_237 | 63 |
| 502 | 3300048905 | Ga0496102_0221210 | Ga0496102_0221210_1481_1672 | 63 |
| 503 | 3300048905 | Ga0496102_0406039 | Ga0496102_0406039_100_291 | 63 |
| 504 | 3300048906 | Ga0496103_0772581 | Ga0496103_0772581_233_424 | 63 |
| 505 | 3300048907 | Ga0496104_0257888 | Ga0496104_0257888_1100_1291 | 63 |
| 506 | 3300048908 | Ga0496105_0079537 | Ga0496105_0079537_2048_2239 | 63 |
| 507 | 3300048910 | Ga0496107_1270194 | Ga0496107_1270194_222_413 | 63 |
| 508 | 3300048911 | Ga0496108_0021720 | Ga0496108_0021720_413_604 | 63 |
| 509 | 3300048912 | Ga0496109_0122176 | Ga0496109_0122176_1099_1290 | 63 |
| 510 | 3300048913 | Ga0496110_0032222 | Ga0496110_0032222_3937_4128 | 63 |
| 511 | 3300048914 | Ga0496111_0031782 | Ga0496111_0031782_203_394 | 63 |
| 512 | 3300048915 | Ga0496112_0367774 | Ga0496112_0367774_469_660 | 63 |
| 513 | 3300048915 | Ga0496112_0962457 | Ga0496112_0962457_168_359 | 63 |
| 514 | 3300048916 | Ga0496113_0233291 | Ga0496113_0233291_314_505 | 63 |
| 515 | 3300049515 | Ga0501292_030302 | Ga0501292_030302_639_830 | 63 |
| 516 | 3300049520 | Ga0501297_013444 | Ga0501297_013444_246_437 | 63 |
| 517 | 3300049527 | Ga0501311_043854 | Ga0501311_043854_258_449 | 63 |
| 518 | 3300049532 | Ga0501316_050421 | Ga0501316_050421_228_419 | 63 |
| 519 | 3300049541 | Ga0501325_016689 | Ga0501325_016689_379_570 | 63 |
| 520 | 3300049572 | Ga0501036_0550955 | Ga0501036_0550955_579_770 | 63 |
| 521 | 3300049573 | Ga0501037_0685506 | Ga0501037_0685506_48_239 | 63 |
| 522 | 3300049576 | Ga0501040_0141185 | Ga0501040_0141185_508_699 | 63 |
| 523 | 3300049576 | Ga0501040_0813457 | Ga0501040_0813457_335_526 | 63 |
| 524 | 3300049577 | Ga0501041_1050999 | Ga0501041_1050999_219_410 | 63 |
| 525 | 3300049578 | Ga0501042_0522630 | Ga0501042_0522630_468_659 | 63 |
| 526 | 3300049579 | Ga0501043_1091685 | Ga0501043_1091685_153_344 | 63 |
| 527 | 3300049580 | Ga0501046_0446722 | Ga0501046_0446722_607_798 | 63 |
| 528 | 3300049582 | Ga0501048_0564750 | Ga0501048_0564750_208_399 | 63 |
| 529 | 3300049584 | Ga0501068_0515690 | Ga0501068_0515690_437_628 | 63 |
| 530 | 3300049587 | Ga0501071_1366397 | Ga0501071_1366397_255_446 | 63 |
| 531 | 3300049588 | Ga0501072_0899607 | Ga0501072_0899607_42_233 | 63 |
| 532 | 3300049588 | Ga0501072_1049087 | Ga0501072_1049087_325_516 | 63 |
| 533 | 3300049588 | Ga0501072_1149706 | Ga0501072_1149706_186_377 | 63 |
| 534 | 3300049591 | Ga0501075_0097340 | Ga0501075_0097340_1114_1305 | 63 |
| 535 | 3300049591 | Ga0501075_1304411 | Ga0501075_1304411_213_404 | 63 |
| 536 | 3300049591 | Ga0501075_1551587 | Ga0501075_1551587_263_454 | 63 |
| 537 | 3300049592 | Ga0501076_0610213 | Ga0501076_0610213_652_843 | 63 |
| 538 | 3300049593 | Ga0501077_0792412 | Ga0501077_0792412_216_407 | 63 |
| 539 | 3300049650 | Ga0501199_048697 | Ga0501199_048697_19_210 | 63 |
| 540 | 3300049652 | Ga0501202_064865 | Ga0501202_064865_285_476 | 63 |
| 541 | 3300049655 | Ga0501208_112977 | Ga0501208_112977_384_575 | 63 |
| 542 | 3300049656 | Ga0501209_056512 | Ga0501209_056512_351_542 | 63 |
| 543 | 3300049658 | Ga0501211_022121 | Ga0501211_022121_215_406 | 63 |
| 544 | 3300049659 | Ga0501214_073368 | Ga0501214_073368_357_548 | 63 |
| 545 | 3300049666 | Ga0501228_037647 | Ga0501228_037647_315_506 | 63 |
| 546 | 3300049668 | Ga0501233_147379 | Ga0501233_147379_276_467 | 63 |
| 547 | 3300049669 | Ga0501235_052929 | Ga0501235_052929_599_790 | 63 |
| 548 | 3300049672 | Ga0501239_048475 | Ga0501239_048475_77_268 | 63 |
| 549 | 3300049675 | Ga0501243_016601 | Ga0501243_016601_357_548 | 63 |
| 550 | 3300049681 | Ga0501251_057662 | Ga0501251_057662_409_600 | 63 |
| 551 | 3300049690 | Ga0501261_037271 | Ga0501261_037271_320_511 | 63 |
| 552 | 3300049742 | Ga0501080_0248500 | Ga0501080_0248500_55_246 | 63 |
| 553 | 3300049744 | Ga0501083_0686370 | Ga0501083_0686370_156_347 | 63 |
| 554 | 3300049762 | Ga0501265_036451 | Ga0501265_036451_22_213 | 63 |
| 555 | 3300049768 | Ga0501271_035068 | Ga0501271_035068_297_488 | 63 |
| 556 | 3300049772 | Ga0501275_034329 | Ga0501275_034329_219_410 | 63 |
| 557 | 3300049776 | Ga0501280_112236 | Ga0501280_112236_22_213 | 63 |
| 558 | 3300049779 | Ga0501283_096921 | Ga0501283_096921_18_209 | 63 |
| 559 | 3300049824 | Ga0501045_0289912 | Ga0501045_0289912_837_1028 | 63 |
| 560 | 3300049851 | Ga0501212_022700 | Ga0501212_022700_591_782 | 63 |
| 561 | 3300054114 | Ga0501084_0305614 | Ga0501084_0305614_885_1076 | 63 |
| 562 | 3300054114 | Ga0501084_1037797 | Ga0501084_1037797_39_230 | 63 |
| 563 | 3300059506 | Ga0587085_015084 | Ga0587085_015084_48_239 | 63 |
| 564 | 3300059506 | Ga0587085_131928 | Ga0587085_131928_279_470 | 63 |
| 565 | 3300059641 | Ga0587068_056768 | Ga0587068_056768_141_332 | 63 |
| 566 | 3300059645 | Ga0587076_031031 | Ga0587076_031031_327_518 | 63 |
| 567 | 3300059651 | Ga0587105_031174 | Ga0587105_031174_44_235 | 63 |
| 568 | 3300059652 | Ga0587107_095147 | Ga0587107_095147_320_511 | 63 |
| 569 | 3300059652 | Ga0587107_155323 | Ga0587107_155323_40_231 | 63 |
| 570 | 3300060346 | Ga0587111_0140164 | Ga0587111_0140164_254_445 | 63 |
| 571 | 3300060353 | Ga0501082_0036718 | Ga0501082_0036718_684_875 | 63 |
| 572 | 3300060353 | Ga0501082_0390122 | Ga0501082_0390122_109_300 | 63 |
| 573 | 3300061734 | Ga0530510_0011210 | Ga0530510_0011210_2806_2997 | 63 |
| 574 | 3300001976 | JGI24752J21851_1060694 | JGI24752J21851_10606942 | 64 |
| 575 | 3300001978 | JGI24747J21853_1033409 | JGI24747J21853_10334091 | 64 |
| 576 | 3300001991 | JGI24743J22301_10055653 | JGI24743J22301_100556532 | 64 |
| 577 | 3300002075 | JGI24738J21930_10125194 | JGI24738J21930_101251941 | 64 |
| 578 | 3300002076 | JGI24749J21850_1056825 | JGI24749J21850_10568252 | 64 |
| 579 | 3300002077 | JGI24744J21845_10077481 | JGI24744J21845_100774812 | 64 |
| 580 | 3300002155 | JGI24033J26618_1036890 | JGI24033J26618_10368902 | 64 |
| 581 | 3300002239 | JGI24034J26672_10052766 | JGI24034J26672_100527661 | 64 |
| 582 | 3300002459 | JGI24751J29686_10008660 | JGI24751J29686_100086604 | 64 |
| 583 | 3300004798 | Ga0058859_11829737 | Ga0058859_118297374 | 64 |
| 584 | 3300004800 | Ga0058861_12053711 | Ga0058861_120537111 | 64 |
| 585 | 3300004801 | Ga0058860_10072498 | Ga0058860_100724986 | 64 |
| 586 | 3300005290 | Ga0065712_10470215 | Ga0065712_104702153 | 64 |
| 587 | 3300005328 | Ga0070676_10934862 | Ga0070676_109348621 | 64 |
| 588 | 3300005329 | Ga0070683_100736430 | Ga0070683_1007364302 | 64 |
| 589 | 3300005329 | Ga0070683_101674936 | Ga0070683_1016749361 | 64 |
| 590 | 3300005330 | Ga0070690_100518175 | Ga0070690_1005181752 | 64 |
| 591 | 3300005330 | Ga0070690_100838012 | Ga0070690_1008380124 | 64 |
| 592 | 3300005331 | Ga0070670_100669920 | Ga0070670_1006699202 | 64 |
| 593 | 3300005331 | Ga0070670_100741920 | Ga0070670_1007419202 | 64 |
| 594 | 3300005331 | Ga0070670_101323924 | Ga0070670_1013239242 | 64 |
| 595 | 3300005334 | Ga0068869_101146566 | Ga0068869_1011465661 | 64 |
| 596 | 3300005334 | Ga0068869_101365169 | Ga0068869_1013651693 | 64 |
| 597 | 3300005335 | Ga0070666_10084589 | Ga0070666_100845893 | 64 |
| 598 | 3300005335 | Ga0070666_10262112 | Ga0070666_102621123 | 64 |
| 599 | 3300005335 | Ga0070666_11458733 | Ga0070666_114587333 | 64 |
| 600 | 3300005336 | Ga0070680_100020531 | Ga0070680_1000205314 | 64 |
| 601 | 3300005336 | Ga0070680_100576128 | Ga0070680_1005761284 | 64 |
| 602 | 3300005336 | Ga0070680_100580712 | Ga0070680_1005807124 | 64 |
| 603 | 3300005337 | Ga0070682_100641078 | Ga0070682_1006410782 | 64 |
| 604 | 3300005338 | Ga0068868_101630724 | Ga0068868_1016307242 | 64 |
| 605 | 3300005338 | Ga0068868_102089699 | Ga0068868_1020896992 | 64 |
| 606 | 3300005340 | Ga0070689_100493916 | Ga0070689_1004939162 | 64 |
| 607 | 3300005340 | Ga0070689_100541992 | Ga0070689_1005419922 | 64 |
| 608 | 3300005341 | Ga0070691_10273603 | Ga0070691_102736033 | 64 |
| 609 | 3300005341 | Ga0070691_10299909 | Ga0070691_102999092 | 64 |
| 610 | 3300005341 | Ga0070691_10407414 | Ga0070691_104074143 | 64 |
| 611 | 3300005343 | Ga0070687_100221259 | Ga0070687_1002212594 | 64 |
| 612 | 3300005343 | Ga0070687_100394638 | Ga0070687_1003946383 | 64 |
| 613 | 3300005345 | Ga0070692_10232284 | Ga0070692_102322842 | 64 |
| 614 | 3300005345 | Ga0070692_10459666 | Ga0070692_104596662 | 64 |
| 615 | 3300005345 | Ga0070692_10943177 | Ga0070692_109431773 | 64 |
| 616 | 3300005347 | Ga0070668_100302628 | Ga0070668_1003026283 | 64 |
| 617 | 3300005353 | Ga0070669_101174249 | Ga0070669_1011742494 | 64 |
| 618 | 3300005353 | Ga0070669_101924034 | Ga0070669_1019240341 | 64 |
| 619 | 3300005354 | Ga0070675_100471991 | Ga0070675_1004719913 | 64 |
| 620 | 3300005354 | Ga0070675_101519746 | Ga0070675_1015197462 | 64 |
| 621 | 3300005355 | Ga0070671_100071958 | Ga0070671_1000719588 | 64 |
| 622 | 3300005356 | Ga0070674_100628650 | Ga0070674_1006286503 | 64 |
| 623 | 3300005364 | Ga0070673_100076409 | Ga0070673_1000764094 | 64 |
| 624 | 3300005364 | Ga0070673_100839966 | Ga0070673_1008399662 | 64 |
| 625 | 3300005365 | Ga0070688_100362033 | Ga0070688_1003620332 | 64 |
| 626 | 3300005366 | Ga0070659_100642432 | Ga0070659_1006424322 | 64 |
| 627 | 3300005366 | Ga0070659_100729270 | Ga0070659_1007292702 | 64 |
| 628 | 3300005367 | Ga0070667_100259161 | Ga0070667_1002591613 | 64 |
| 629 | 3300005367 | Ga0070667_100556519 | Ga0070667_1005565194 | 64 |
| 630 | 3300005438 | Ga0070701_10024455 | Ga0070701_100244553 | 64 |
| 631 | 3300005440 | Ga0070705_101740219 | Ga0070705_1017402192 | 64 |
| 632 | 3300005441 | Ga0070700_100036116 | Ga0070700_1000361165 | 64 |
| 633 | 3300005441 | Ga0070700_100732067 | Ga0070700_1007320671 | 64 |
| 634 | 3300005441 | Ga0070700_100796730 | Ga0070700_1007967301 | 64 |
| 635 | 3300005444 | Ga0070694_101080886 | Ga0070694_1010808862 | 64 |
| 636 | 3300005445 | Ga0070708_100083016 | Ga0070708_1000830164 | 64 |
| 637 | 3300005445 | Ga0070708_100941451 | Ga0070708_1009414514 | 64 |
| 638 | 3300005445 | Ga0070708_101173597 | Ga0070708_1011735972 | 64 |
| 639 | 3300005455 | Ga0070663_100004558 | Ga0070663_1000045588 | 64 |
| 640 | 3300005455 | Ga0070663_100995753 | Ga0070663_1009957534 | 64 |
| 641 | 3300005456 | Ga0070678_100765070 | Ga0070678_1007650703 | 64 |
| 642 | 3300005457 | Ga0070662_101509288 | Ga0070662_1015092882 | 64 |
| 643 | 3300005458 | Ga0070681_11076664 | Ga0070681_110766642 | 64 |
| 644 | 3300005459 | Ga0068867_100260956 | Ga0068867_1002609562 | 64 |
| 645 | 3300005459 | Ga0068867_101750357 | Ga0068867_1017503571 | 64 |
| 646 | 3300005459 | Ga0068867_102343798 | Ga0068867_1023437981 | 64 |
| 647 | 3300005466 | Ga0070685_10438397 | Ga0070685_104383972 | 64 |
| 648 | 3300005467 | Ga0070706_100902145 | Ga0070706_1009021452 | 64 |
| 649 | 3300005468 | Ga0070707_101085172 | Ga0070707_1010851723 | 64 |
| 650 | 3300005468 | Ga0070707_101436453 | Ga0070707_1014364532 | 64 |
| 651 | 3300005471 | Ga0070698_100128772 | Ga0070698_1001287724 | 64 |
| 652 | 3300005471 | Ga0070698_101118251 | Ga0070698_1011182512 | 64 |
| 653 | 3300005471 | Ga0070698_101814622 | Ga0070698_1018146222 | 64 |
| 654 | 3300005530 | Ga0070679_101089076 | Ga0070679_1010890761 | 64 |
| 655 | 3300005530 | Ga0070679_102106117 | Ga0070679_1021061172 | 64 |
| 656 | 3300005535 | Ga0070684_100754584 | Ga0070684_1007545843 | 64 |
| 657 | 3300005536 | Ga0070697_100081282 | Ga0070697_1000812824 | 64 |
| 658 | 3300005536 | Ga0070697_100481821 | Ga0070697_1004818212 | 64 |
| 659 | 3300005536 | Ga0070697_101429689 | Ga0070697_1014296891 | 64 |
| 660 | 3300005539 | Ga0068853_101848543 | Ga0068853_1018485432 | 64 |
| 661 | 3300005543 | Ga0070672_101958419 | Ga0070672_1019584191 | 64 |
| 662 | 3300005544 | Ga0070686_100117462 | Ga0070686_1001174623 | 64 |
| 663 | 3300005544 | Ga0070686_101232466 | Ga0070686_1012324664 | 64 |
| 664 | 3300005545 | Ga0070695_100395406 | Ga0070695_1003954062 | 64 |
| 665 | 3300005545 | Ga0070695_100482640 | Ga0070695_1004826404 | 64 |
| 666 | 3300005546 | Ga0070696_100048649 | Ga0070696_1000486497 | 64 |
| 667 | 3300005546 | Ga0070696_101790118 | Ga0070696_1017901182 | 64 |
| 668 | 3300005547 | Ga0070693_100448998 | Ga0070693_1004489982 | 64 |
| 669 | 3300005549 | Ga0070704_100842662 | Ga0070704_1008426624 | 64 |
| 670 | 3300005549 | Ga0070704_102071092 | Ga0070704_1020710922 | 64 |
| 671 | 3300005564 | Ga0070664_100705157 | Ga0070664_1007051574 | 64 |
| 672 | 3300005564 | Ga0070664_100724302 | Ga0070664_1007243024 | 64 |
| 673 | 3300005577 | Ga0068857_100487636 | Ga0068857_1004876364 | 64 |
| 674 | 3300005577 | Ga0068857_100773477 | Ga0068857_1007734772 | 64 |
| 675 | 3300005577 | Ga0068857_101146947 | Ga0068857_1011469473 | 64 |
| 676 | 3300005578 | Ga0068854_101023035 | Ga0068854_1010230354 | 64 |
| 677 | 3300005578 | Ga0068854_101618104 | Ga0068854_1016181042 | 64 |
| 678 | 3300005614 | Ga0068856_101835619 | Ga0068856_1018356192 | 64 |
| 679 | 3300005615 | Ga0070702_100366736 | Ga0070702_1003667362 | 64 |
| 680 | 3300005615 | Ga0070702_100421618 | Ga0070702_1004216182 | 64 |
| 681 | 3300005615 | Ga0070702_100539905 | Ga0070702_1005399054 | 64 |
| 682 | 3300005616 | Ga0068852_100866168 | Ga0068852_1008661682 | 64 |
| 683 | 3300005617 | Ga0068859_100551157 | Ga0068859_1005511574 | 64 |
| 684 | 3300005618 | Ga0068864_100118277 | Ga0068864_1001182774 | 64 |
| 685 | 3300005618 | Ga0068864_100457461 | Ga0068864_1004574614 | 64 |
| 686 | 3300005719 | Ga0068861_100485872 | Ga0068861_1004858722 | 64 |
| 687 | 3300005719 | Ga0068861_101044093 | Ga0068861_1010440932 | 64 |
| 688 | 3300005719 | Ga0068861_101214951 | Ga0068861_1012149512 | 64 |
| 689 | 3300005840 | Ga0068870_10219194 | Ga0068870_102191943 | 64 |
| 690 | 3300005841 | Ga0068863_100982498 | Ga0068863_1009824984 | 64 |
| 691 | 3300005841 | Ga0068863_101413859 | Ga0068863_1014138592 | 64 |
| 692 | 3300005842 | Ga0068858_100027244 | Ga0068858_1000272444 | 64 |
| 693 | 3300005842 | Ga0068858_100477059 | Ga0068858_1004770594 | 64 |
| 694 | 3300005843 | Ga0068860_100024658 | Ga0068860_1000246585 | 64 |
| 695 | 3300005843 | Ga0068860_100531553 | Ga0068860_1005315534 | 64 |
| 696 | 3300005985 | Ga0081539_10318578 | Ga0081539_103185782 | 64 |
| 697 | 3300006038 | Ga0075365_10279193 | Ga0075365_102791932 | 64 |
| 698 | 3300006051 | Ga0075364_10962093 | Ga0075364_109620932 | 64 |
| 699 | 3300006058 | Ga0075432_10037946 | Ga0075432_100379464 | 64 |
| 700 | 3300006237 | Ga0097621_100150529 | Ga0097621_1001505293 | 64 |
| 701 | 3300006358 | Ga0068871_100434328 | Ga0068871_1004343282 | 64 |
| 702 | 3300006844 | Ga0075428_100731357 | Ga0075428_1007313572 | 64 |
| 703 | 3300006844 | Ga0075428_101943549 | Ga0075428_1019435491 | 64 |
| 704 | 3300006847 | Ga0075431_100254993 | Ga0075431_1002549934 | 64 |
| 705 | 3300006852 | Ga0075433_10019795 | Ga0075433_100197954 | 64 |
| 706 | 3300006852 | Ga0075433_10163918 | Ga0075433_101639184 | 64 |
| 707 | 3300006852 | Ga0075433_10271267 | Ga0075433_102712672 | 64 |
| 708 | 3300006871 | Ga0075434_100807010 | Ga0075434_1008070104 | 64 |
| 709 | 3300006871 | Ga0075434_101116554 | Ga0075434_1011165544 | 64 |
| 710 | 3300006881 | Ga0068865_100159465 | Ga0068865_1001594653 | 64 |
| 711 | 3300006881 | Ga0068865_100288295 | Ga0068865_1002882954 | 64 |
| 712 | 3300006914 | Ga0075436_100122500 | Ga0075436_1001225002 | 64 |
| 713 | 3300006931 | Ga0097620_100551131 | Ga0097620_1005511314 | 64 |
| 714 | 3300007076 | Ga0075435_100232450 | Ga0075435_1002324504 | 64 |
| 715 | 3300007076 | Ga0075435_100463524 | Ga0075435_1004635244 | 64 |
| 716 | 3300007076 | Ga0075435_100659383 | Ga0075435_1006593832 | 64 |
| 717 | 3300007076 | Ga0075435_100756312 | Ga0075435_1007563122 | 64 |
| 718 | 3300009092 | Ga0105250_10605431 | Ga0105250_106054313 | 64 |
| 719 | 3300009093 | Ga0105240_11120153 | Ga0105240_111201532 | 64 |
| 720 | 3300009094 | Ga0111539_10628948 | Ga0111539_106289482 | 64 |
| 721 | 3300009094 | Ga0111539_11404096 | Ga0111539_114040962 | 64 |
| 722 | 3300009094 | Ga0111539_12267385 | Ga0111539_122673852 | 64 |
| 723 | 3300009098 | Ga0105245_10220019 | Ga0105245_102200194 | 64 |
| 724 | 3300009098 | Ga0105245_10755149 | Ga0105245_107551492 | 64 |
| 725 | 3300009098 | Ga0105245_11570092 | Ga0105245_115700922 | 64 |
| 726 | 3300009101 | Ga0105247_10170111 | Ga0105247_101701112 | 64 |
| 727 | 3300009147 | Ga0114129_10181666 | Ga0114129_101816664 | 64 |
| 728 | 3300009147 | Ga0114129_11118621 | Ga0114129_111186213 | 64 |
| 729 | 3300009147 | Ga0114129_11611101 | Ga0114129_116111013 | 64 |
| 730 | 3300009147 | Ga0114129_12174935 | Ga0114129_121749353 | 64 |
| 731 | 3300009148 | Ga0105243_10789027 | Ga0105243_107890272 | 64 |
| 732 | 3300009148 | Ga0105243_11924829 | Ga0105243_119248292 | 64 |
| 733 | 3300009174 | Ga0105241_10558779 | Ga0105241_105587792 | 64 |
| 734 | 3300009176 | Ga0105242_10245777 | Ga0105242_102457774 | 64 |
| 735 | 3300009176 | Ga0105242_11050225 | Ga0105242_110502253 | 64 |
| 736 | 3300009176 | Ga0105242_11318241 | Ga0105242_113182412 | 64 |
| 737 | 3300009177 | Ga0105248_10041220 | Ga0105248_100412207 | 64 |
| 738 | 3300009177 | Ga0105248_10784244 | Ga0105248_107842442 | 64 |
| 739 | 3300009177 | Ga0105248_12261881 | Ga0105248_122618812 | 64 |
| 740 | 3300009545 | Ga0105237_10611139 | Ga0105237_106111394 | 64 |
| 741 | 3300009551 | Ga0105238_11131346 | Ga0105238_111313462 | 64 |
| 742 | 3300009553 | Ga0105249_10019204 | Ga0105249_100192043 | 64 |
| 743 | 3300009553 | Ga0105249_11369838 | Ga0105249_113698384 | 64 |
| 744 | 3300009553 | Ga0105249_13079667 | Ga0105249_130796672 | 64 |
| 745 | 3300010375 | Ga0105239_10319281 | Ga0105239_103192814 | 64 |
| 746 | 3300010375 | Ga0105239_11173510 | Ga0105239_111735102 | 64 |
| 747 | 3300011119 | Ga0105246_10041027 | Ga0105246_100410273 | 64 |
| 748 | 3300011119 | Ga0105246_10329895 | Ga0105246_103298952 | 64 |
| 749 | 3300011119 | Ga0105246_10942752 | Ga0105246_109427523 | 64 |
| 750 | 3300012488 | Ga0157343_1007894 | Ga0157343_10078941 | 64 |
| 751 | 3300012495 | Ga0157323_1004802 | Ga0157323_10048022 | 64 |
| 752 | 3300013102 | Ga0157371_10337438 | Ga0157371_103374382 | 64 |
| 753 | 3300013296 | Ga0157374_10155022 | Ga0157374_101550222 | 64 |
| 754 | 3300013297 | Ga0157378_10015276 | Ga0157378_100152764 | 64 |
| 755 | 3300013306 | Ga0163162_10088800 | Ga0163162_100888004 | 64 |
| 756 | 3300013306 | Ga0163162_11783920 | Ga0163162_117839204 | 64 |
| 757 | 3300013306 | Ga0163162_13123335 | Ga0163162_131233353 | 64 |
| 758 | 3300013307 | Ga0157372_10800022 | Ga0157372_108000222 | 64 |
| 759 | 3300013307 | Ga0157372_11560230 | Ga0157372_115602302 | 64 |
| 760 | 3300013308 | Ga0157375_10912092 | Ga0157375_109120924 | 64 |
| 761 | 3300013308 | Ga0157375_13675404 | Ga0157375_136754042 | 64 |
| 762 | 3300014325 | Ga0163163_10743049 | Ga0163163_107430492 | 64 |
| 763 | 3300014325 | Ga0163163_12069663 | Ga0163163_120696632 | 64 |
| 764 | 3300014326 | Ga0157380_10012801 | Ga0157380_100128013 | 64 |
| 765 | 3300014326 | Ga0157380_12996746 | Ga0157380_129967462 | 64 |
| 766 | 3300014326 | Ga0157380_13364968 | Ga0157380_133649682 | 64 |
| 767 | 3300014745 | Ga0157377_10076167 | Ga0157377_100761672 | 64 |
| 768 | 3300014968 | Ga0157379_10549666 | Ga0157379_105496663 | 64 |
| 769 | 3300014968 | Ga0157379_11122397 | Ga0157379_111223972 | 64 |
| 770 | 3300017792 | Ga0163161_10605041 | Ga0163161_106050412 | 64 |
| 771 | 3300017792 | Ga0163161_10623128 | Ga0163161_106231282 | 64 |
| 772 | 3300020081 | Ga0206354_10678292 | Ga0206354_106782922 | 64 |
| 773 | 3300025315 | Ga0207697_10103881 | Ga0207697_101038813 | 64 |
| 774 | 3300025885 | Ga0207653_10346741 | Ga0207653_103467413 | 64 |
| 775 | 3300025900 | Ga0207710_10551947 | Ga0207710_105519472 | 64 |
| 776 | 3300025901 | Ga0207688_10728680 | Ga0207688_107286801 | 64 |
| 777 | 3300025903 | Ga0207680_10345252 | Ga0207680_103452524 | 64 |
| 778 | 3300025904 | Ga0207647_10022808 | Ga0207647_100228085 | 64 |
| 779 | 3300025907 | Ga0207645_10140018 | Ga0207645_101400182 | 64 |
| 780 | 3300025907 | Ga0207645_10472654 | Ga0207645_104726543 | 64 |
| 781 | 3300025908 | Ga0207643_10391655 | Ga0207643_103916554 | 64 |
| 782 | 3300025914 | Ga0207671_10281017 | Ga0207671_102810172 | 64 |
| 783 | 3300025917 | Ga0207660_10000002 | Ga0207660_10000002372 | 64 |
| 784 | 3300025918 | Ga0207662_10451250 | Ga0207662_104512504 | 64 |
| 785 | 3300025918 | Ga0207662_10551726 | Ga0207662_105517264 | 64 |
| 786 | 3300025919 | Ga0207657_10381984 | Ga0207657_103819842 | 64 |
| 787 | 3300025920 | Ga0207649_11343857 | Ga0207649_113438572 | 64 |
| 788 | 3300025921 | Ga0207652_11691138 | Ga0207652_116911382 | 64 |
| 789 | 3300025922 | Ga0207646_10344489 | Ga0207646_103444892 | 64 |
| 790 | 3300025922 | Ga0207646_10669247 | Ga0207646_106692472 | 64 |
| 791 | 3300025925 | Ga0207650_10856254 | Ga0207650_108562542 | 64 |
| 792 | 3300025926 | Ga0207659_11055178 | Ga0207659_110551782 | 64 |
| 793 | 3300025927 | Ga0207687_10046120 | Ga0207687_100461202 | 64 |
| 794 | 3300025927 | Ga0207687_10205866 | Ga0207687_102058662 | 64 |
| 795 | 3300025927 | Ga0207687_10245227 | Ga0207687_102452274 | 64 |
| 796 | 3300025931 | Ga0207644_10066480 | Ga0207644_100664802 | 64 |
| 797 | 3300025931 | Ga0207644_11103092 | Ga0207644_111030922 | 64 |
| 798 | 3300025932 | Ga0207690_10050244 | Ga0207690_100502444 | 64 |
| 799 | 3300025932 | Ga0207690_11293243 | Ga0207690_112932432 | 64 |
| 800 | 3300025933 | Ga0207706_10046490 | Ga0207706_100464904 | 64 |
| 801 | 3300025934 | Ga0207686_10663648 | Ga0207686_106636482 | 64 |
| 802 | 3300025935 | Ga0207709_10010646 | Ga0207709_100106462 | 64 |
| 803 | 3300025937 | Ga0207669_10005197 | Ga0207669_100051976 | 64 |
| 804 | 3300025937 | Ga0207669_10737737 | Ga0207669_107377374 | 64 |
| 805 | 3300025938 | Ga0207704_10533180 | Ga0207704_105331802 | 64 |
| 806 | 3300025938 | Ga0207704_10825826 | Ga0207704_108258264 | 64 |
| 807 | 3300025940 | Ga0207691_11758036 | Ga0207691_117580361 | 64 |
| 808 | 3300025941 | Ga0207711_10059034 | Ga0207711_100590344 | 64 |
| 809 | 3300025942 | Ga0207689_10662255 | Ga0207689_106622552 | 64 |
| 810 | 3300025942 | Ga0207689_10948874 | Ga0207689_109488743 | 64 |
| 811 | 3300025944 | Ga0207661_10436866 | Ga0207661_104368661 | 64 |
| 812 | 3300025960 | Ga0207651_11479702 | Ga0207651_114797022 | 64 |
| 813 | 3300025961 | Ga0207712_10634298 | Ga0207712_106342982 | 64 |
| 814 | 3300025961 | Ga0207712_11451262 | Ga0207712_114512623 | 64 |
| 815 | 3300025972 | Ga0207668_10856634 | Ga0207668_108566342 | 64 |
| 816 | 3300025981 | Ga0207640_10213275 | Ga0207640_102132753 | 64 |
| 817 | 3300025986 | Ga0207658_12070465 | Ga0207658_120704652 | 64 |
| 818 | 3300026023 | Ga0207677_10528251 | Ga0207677_105282512 | 64 |
| 819 | 3300026035 | Ga0207703_10065297 | Ga0207703_100652973 | 64 |
| 820 | 3300026035 | Ga0207703_10886928 | Ga0207703_108869282 | 64 |
| 821 | 3300026041 | Ga0207639_10907276 | Ga0207639_109072763 | 64 |
| 822 | 3300026041 | Ga0207639_10971666 | Ga0207639_109716662 | 64 |
| 823 | 3300026067 | Ga0207678_10017028 | Ga0207678_100170284 | 64 |
| 824 | 3300026067 | Ga0207678_11598135 | Ga0207678_115981352 | 64 |
| 825 | 3300026075 | Ga0207708_10017492 | Ga0207708_100174927 | 64 |
| 826 | 3300026075 | Ga0207708_10856134 | Ga0207708_108561344 | 64 |
| 827 | 3300026078 | Ga0207702_10729756 | Ga0207702_107297563 | 64 |
| 828 | 3300026088 | Ga0207641_11341754 | Ga0207641_113417544 | 64 |
| 829 | 3300026089 | Ga0207648_10799580 | Ga0207648_107995802 | 64 |
| 830 | 3300026095 | Ga0207676_10243897 | Ga0207676_102438973 | 64 |
| 831 | 3300026095 | Ga0207676_10508450 | Ga0207676_105084503 | 64 |
| 832 | 3300026095 | Ga0207676_11361056 | Ga0207676_113610562 | 64 |
| 833 | 3300026116 | Ga0207674_10850537 | Ga0207674_108505372 | 64 |
| 834 | 3300026116 | Ga0207674_11033956 | Ga0207674_110339562 | 64 |
| 835 | 3300026118 | Ga0207675_100573084 | Ga0207675_1005730843 | 64 |
| 836 | 3300026118 | Ga0207675_101054815 | Ga0207675_1010548152 | 64 |
| 837 | 3300026118 | Ga0207675_101383480 | Ga0207675_1013834802 | 64 |
| 838 | 3300026121 | Ga0207683_10486201 | Ga0207683_104862014 | 64 |
| 839 | 3300026121 | Ga0207683_10807356 | Ga0207683_108073562 | 64 |
| 840 | 3300026142 | Ga0207698_10020697 | Ga0207698_100206973 | 64 |
| 841 | 3300027717 | Ga0209998_10007548 | Ga0209998_100075482 | 64 |
| 842 | 3300027876 | Ga0209974_10028771 | Ga0209974_100287712 | 64 |
| 843 | 3300027907 | Ga0207428_10181308 | Ga0207428_101813083 | 64 |
| 844 | 3300028381 | Ga0268264_10274106 | Ga0268264_102741063 | 64 |
| 845 | 3300028381 | Ga0268264_12025853 | Ga0268264_120258532 | 64 |
| 846 | 3300028381 | Ga0268264_12453410 | Ga0268264_124534103 | 64 |
| 847 | 3300031824 | Ga0307413_10293782 | Ga0307413_102937823 | 64 |
| 848 | 3300031852 | Ga0307410_11673601 | Ga0307410_116736012 | 64 |
| 849 | 3300032002 | Ga0307416_100042187 | Ga0307416_1000421874 | 64 |
| 850 | 3300032126 | Ga0307415_100120780 | Ga0307415_1001207806 | 64 |
| 851 | 3300034817 | Ga0373948_0201665 | Ga0373948_0201665_248_442 | 64 |
| 852 | 3300034819 | Ga0373958_0041078 | Ga0373958_0041078_395_589 | 64 |
| 853 | 3300035090 | Ga0373949_0049115 | Ga0373949_0049115_431_625 | 64 |
| 854 | 3300035091 | Ga0373951_0233715 | Ga0373951_0233715_244_438 | 64 |
| 855 | 3300035112 | Ga0373932_0103774 | Ga0373932_0103774_343_537 | 64 |
| 856 | 3300035115 | Ga0373941_0131513 | Ga0373941_0131513_569_763 | 64 |
| 857 | 3300035115 | Ga0373941_0288517 | Ga0373941_0288517_366_560 | 64 |
| 858 | 3300035115 | Ga0373941_0392496 | Ga0373941_0392496_348_542 | 64 |
| 859 | 3300035121 | Ga0373960_0063732 | Ga0373960_0063732_748_942 | 64 |
| 860 | 3300035121 | Ga0373960_0282269 | Ga0373960_0282269_332_526 | 64 |
| 861 | 3300035241 | Ga0373961_0235479 | Ga0373961_0235479_392_586 | 64 |
| 862 | 3300035691 | Ga0373931_0194604 | Ga0373931_0194604_551_745 | 64 |
| 863 | 3300038698 | Ga0242419_005567 | Ga0242419_005567_598_792 | 64 |
| 864 | 3300038996 | Ga0242420_064558 | Ga0242420_064558_248_442 | 64 |
| 865 | 3300041408 | Ga0439453_0180418 | Ga0439453_0180418_171_365 | 64 |
| 866 | 3300042438 | Ga0439459_0033618 | Ga0439459_0033618_222_416 | 64 |
| 867 | 3300044673 | Ga0453683_0383037 | Ga0453683_0383037_606_800 | 64 |
| 868 | 3300046664 | Ga0495659_0293609 | Ga0495659_0293609_477_671 | 64 |
| 869 | 3300048904 | Ga0496101_0462519 | Ga0496101_0462519_677_871 | 64 |
| 870 | 3300048905 | Ga0496102_0765094 | Ga0496102_0765094_418_612 | 64 |
| 871 | 3300048905 | Ga0496102_0989738 | Ga0496102_0989738_380_574 | 64 |
| 872 | 3300048907 | Ga0496104_0897486 | Ga0496104_0897486_333_527 | 64 |
| 873 | 3300048909 | Ga0496106_0189802 | Ga0496106_0189802_1058_1252 | 64 |
| 874 | 3300048909 | Ga0496106_0787726 | Ga0496106_0787726_272_466 | 64 |
| 875 | 3300048910 | Ga0496107_1042464 | Ga0496107_1042464_234_428 | 64 |
| 876 | 3300048911 | Ga0496108_0152665 | Ga0496108_0152665_565_759 | 64 |
| 877 | 3300048912 | Ga0496109_0724174 | Ga0496109_0724174_281_475 | 64 |
| 878 | 3300048912 | Ga0496109_1214845 | Ga0496109_1214845_263_457 | 64 |
| 879 | 3300048913 | Ga0496110_0032784 | Ga0496110_0032784_3485_3679 | 64 |
| 880 | 3300048914 | Ga0496111_0974252 | Ga0496111_0974252_144_338 | 64 |
| 881 | 3300048915 | Ga0496112_0047852 | Ga0496112_0047852_3097_3291 | 64 |
| 882 | 3300048915 | Ga0496112_0246234 | Ga0496112_0246234_184_378 | 64 |
| 883 | 3300048915 | Ga0496112_1715513 | Ga0496112_1715513_251_445 | 64 |
| 884 | 3300048916 | Ga0496113_0324452 | Ga0496113_0324452_569_763 | 64 |
| 885 | 3300049127 | Ga0501306_039538 | Ga0501306_039538_497_691 | 64 |
| 886 | 3300049533 | Ga0501317_007952 | Ga0501317_007952_95_289 | 64 |
| 887 | 3300049534 | Ga0501318_080817 | Ga0501318_080817_262_456 | 64 |
| 888 | 3300049541 | Ga0501325_008381 | Ga0501325_008381_103_297 | 64 |
| 889 | 3300049574 | Ga0501038_0699934 | Ga0501038_0699934_375_569 | 64 |
| 890 | 3300049575 | Ga0501039_0719628 | Ga0501039_0719628_97_291 | 64 |
| 891 | 3300049576 | Ga0501040_0161072 | Ga0501040_0161072_859_1053 | 64 |
| 892 | 3300049576 | Ga0501040_0225921 | Ga0501040_0225921_309_503 | 64 |
| 893 | 3300049577 | Ga0501041_0113853 | Ga0501041_0113853_1276_1470 | 64 |
| 894 | 3300049577 | Ga0501041_0140295 | Ga0501041_0140295_954_1148 | 64 |
| 895 | 3300049578 | Ga0501042_1388916 | Ga0501042_1388916_92_286 | 64 |
| 896 | 3300049580 | Ga0501046_0237089 | Ga0501046_0237089_626_820 | 64 |
| 897 | 3300049582 | Ga0501048_0224285 | Ga0501048_0224285_939_1133 | 64 |
| 898 | 3300049583 | Ga0501067_0011868 | Ga0501067_0011868_4318_4515 | 64 |
| 899 | 3300049584 | Ga0501068_1139883 | Ga0501068_1139883_27_221 | 64 |
| 900 | 3300049585 | Ga0501069_0004365 | Ga0501069_0004365_183_380 | 64 |
| 901 | 3300049588 | Ga0501072_0284427 | Ga0501072_0284427_776_970 | 64 |
| 902 | 3300049590 | Ga0501074_0939660 | Ga0501074_0939660_146_340 | 64 |
| 903 | 3300049592 | Ga0501076_0137306 | Ga0501076_0137306_782_976 | 64 |
| 904 | 3300049592 | Ga0501076_0209492 | Ga0501076_0209492_799_993 | 64 |
| 905 | 3300049593 | Ga0501077_0209806 | Ga0501077_0209806_199_393 | 64 |
| 906 | 3300049672 | Ga0501239_024334 | Ga0501239_024334_30_224 | 64 |
| 907 | 3300049741 | Ga0501079_1466146 | Ga0501079_1466146_193_387 | 64 |
| 908 | 3300049743 | Ga0501081_0094214 | Ga0501081_0094214_141_335 | 64 |
| 909 | 3300049823 | Ga0501044_0998968 | Ga0501044_0998968_68_262 | 64 |
| 910 | 3300049824 | Ga0501045_0163446 | Ga0501045_0163446_86_280 | 64 |
| 911 | 3300049824 | Ga0501045_1050561 | Ga0501045_1050561_341_535 | 64 |
| 912 | 3300050492 | nmdc:mga0yw44_337332_c1 | nmdc:mga0yw44_337332_c1_269_463 | 64 |
| 913 | 3300050507 | nmdc:mga05p37_254741_c1 | nmdc:mga05p37_254741_c1_788_985 | 64 |
| 914 | 3300050507 | nmdc:mga05p37_609611_c1 | nmdc:mga05p37_609611_c1_490_684 | 64 |
| 915 | 3300050507 | nmdc:mga05p37_866448_c2 | nmdc:mga05p37_866448_c2_295_492 | 64 |
| 916 | 3300050508 | nmdc:mga09592_1639545_c1 | nmdc:mga09592_1639545_c1_223_417 | 64 |
| 917 | 3300050510 | nmdc:mga06r32_84995_c1 | nmdc:mga06r32_84995_c1_126_320 | 64 |
| 918 | 3300050511 | nmdc:mga08y16_65151_c1 | nmdc:mga08y16_65151_c1_3122_3316 | 64 |
| 919 | 3300050511 | nmdc:mga08y16_772377_c1 | nmdc:mga08y16_772377_c1_491_685 | 64 |
| 920 | 3300050512 | nmdc:mga0n895_1943878_c1 | nmdc:mga0n895_1943878_c1_144_338 | 64 |
| 921 | 3300050512 | nmdc:mga0n895_2029175_c1 | nmdc:mga0n895_2029175_c1_33_227 | 64 |
| 922 | 3300050512 | nmdc:mga0n895_220821_c1 | nmdc:mga0n895_220821_c1_1199_1393 | 64 |
| 923 | 3300050512 | nmdc:mga0n895_426803_c1 | nmdc:mga0n895_426803_c1_1110_1307 | 64 |
| 924 | 3300050513 | nmdc:mga0rr50_1175421_c1 | nmdc:mga0rr50_1175421_c1_303_497 | 64 |
| 925 | 3300050513 | nmdc:mga0rr50_627379_c1 | nmdc:mga0rr50_627379_c1_408_605 | 64 |
| 926 | 3300050513 | nmdc:mga0rr50_670906_c1 | nmdc:mga0rr50_670906_c1_102_296 | 64 |
| 927 | 3300050514 | nmdc:mga08x19_1002929_c1 | nmdc:mga08x19_1002929_c1_96_290 | 64 |
| 928 | 3300050514 | nmdc:mga08x19_157770_c1 | nmdc:mga08x19_157770_c1_1059_1256 | 64 |
| 929 | 3300050514 | nmdc:mga08x19_480054_c1 | nmdc:mga08x19_480054_c1_578_772 | 64 |
| 930 | 3300050515 | nmdc:mga0a205_143170_c1 | nmdc:mga0a205_143170_c1_1537_1734 | 64 |
| 931 | 3300050515 | nmdc:mga0a205_182722_c1 | nmdc:mga0a205_182722_c1_239_433 | 64 |
| 932 | 3300050515 | nmdc:mga0a205_456320_c1 | nmdc:mga0a205_456320_c1_441_635 | 64 |
| 933 | 3300050515 | nmdc:mga0a205_62566_c1 | nmdc:mga0a205_62566_c1_464_658 | 64 |
| 934 | 3300054114 | Ga0501084_0046030 | Ga0501084_0046030_516_710 | 64 |
| 935 | 3300059643 | Ga0587072_114303 | Ga0587072_114303_342_536 | 64 |
| 936 | 3300059652 | Ga0587107_077363 | Ga0587107_077363_100_294 | 64 |
| 937 | 3300060353 | Ga0501082_0316052 | Ga0501082_0316052_326_520 | 64 |
| 938 | 3300060353 | Ga0501082_0605213 | Ga0501082_0605213_331_525 | 64 |
| 939 | 3300061734 | Ga0530510_1122535 | Ga0530510_1122535_174_371 | 64 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar