F486281

General Info

Members Datasets Scaffolds Average Seq Length
939 383 939 62

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10944981|Ga0075433_109449813
Length 68
Sequence VDRLRRLGASIRRNIDEAWSELKKVSWPTVLQTRNLTVLVFAVSFGIGVFITFFDSIFLNAVKFLSNG

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
124 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
223 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
224 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
240 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
241 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
242 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
243 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
244 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
245 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
246 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
247 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
248 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
251 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
252 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
253 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
254 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
255 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
294 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
295 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
296 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
326 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
327 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
328 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
329 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
330 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
331 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
332 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
333 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
334 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
335 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
336 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
337 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
338 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
339 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
345 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
346 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
347 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
348 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
367 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 3.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 7.14
Rhizosphere 92.12
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1060694 3300001976 Bacteria 522
2 JGI24747J21853_1033409 3300001978 Bacteria 594
3 JGI24743J22301_10055653 3300001991 Bacteria 810
4 JGI24738J21930_10125194 3300002075 Bacteria 560
5 JGI24749J21850_1056825 3300002076 Bacteria 590
6 JGI24744J21845_10077481 3300002077 Bacteria 607
7 JGI24033J26618_1036890 3300002155 Bacteria 672
8 JGI24034J26672_10052766 3300002239 Bacteria 702
9 JGI24751J29686_10008660 3300002459 Bacteria 2084
10 JGI24751J29686_10013331 3300002459 Bacteria 1696
11 JGI25406J46586_10009666 3300003203 Bacteria 4312
12 Ga0058859_10030995 3300004798 Bacteria 1123
13 Ga0058859_11829737 3300004798 Bacteria 2189
14 Ga0058861_12053711 3300004800 Bacteria 600
15 Ga0058860_10027684 3300004801 Bacteria 887
16 Ga0058860_10072498 3300004801 Bacteria 2469
17 Ga0058862_10027267 3300004803 Bacteria 872
18 Ga0065704_10372827 3300005289 Bacteria 783
19 Ga0065712_10401795 3300005290 Bacteria 730
20 Ga0065712_10470215 3300005290 Bacteria 671
21 Ga0065715_10635613 3300005293 Bacteria 687
22 Ga0065707_10879597 3300005295 Bacteria 527
23 Ga0070676_10934862 3300005328 Bacteria 647
24 Ga0070683_100507299 3300005329 Bacteria 1152
25 Ga0070683_100736430 3300005329 Bacteria 944
26 Ga0070683_101674936 3300005329 Bacteria 612
27 Ga0070690_100162217 3300005330 Bacteria 1532
28 Ga0070690_100326368 3300005330 Bacteria 1107
29 Ga0070690_100518175 3300005330 Bacteria 894
30 Ga0070690_100838012 3300005330 Bacteria 715
31 Ga0070670_100669920 3300005331 Bacteria 932
32 Ga0070670_100741920 3300005331 Bacteria 884
33 Ga0070670_101323924 3300005331 Bacteria 660
34 Ga0068869_100840343 3300005334 Bacteria 791
35 Ga0068869_101146566 3300005334 Bacteria 681
36 Ga0068869_101365169 3300005334 Bacteria 626
37 Ga0070666_10084589 3300005335 Bacteria 2171
38 Ga0070666_10262112 3300005335 Bacteria 1225
39 Ga0070666_10599745 3300005335 Bacteria 803
40 Ga0070666_11458733 3300005335 Bacteria 512
41 Ga0070680_100020531 3300005336 Bacteria 5243
42 Ga0070680_100321120 3300005336 Bacteria 1314
43 Ga0070680_100576128 3300005336 Bacteria 965
44 Ga0070680_100580712 3300005336 Bacteria 961
45 Ga0070680_100682548 3300005336 Bacteria 883
46 Ga0070680_101458830 3300005336 Bacteria 593
47 Ga0070682_100641078 3300005337 Bacteria 844
48 Ga0070682_100805663 3300005337 Bacteria 763
49 Ga0068868_100325958 3300005338 Bacteria 1309
50 Ga0068868_100349188 3300005338 Bacteria 1266
51 Ga0068868_101244518 3300005338 Bacteria 690
52 Ga0068868_101630724 3300005338 Bacteria 606
53 Ga0068868_102089699 3300005338 Bacteria 539
54 Ga0070689_100304847 3300005340 Bacteria 1326
55 Ga0070689_100493916 3300005340 Bacteria 1047
56 Ga0070689_100541992 3300005340 Bacteria 1001
57 Ga0070689_100917548 3300005340 Bacteria 776
58 Ga0070691_10273603 3300005341 Bacteria 913
59 Ga0070691_10299909 3300005341 Bacteria 877
60 Ga0070691_10350481 3300005341 Bacteria 820
61 Ga0070691_10407414 3300005341 Bacteria 767
62 Ga0070687_100221259 3300005343 Bacteria 1159
63 Ga0070687_100394638 3300005343 Bacteria 905
64 Ga0070687_100641959 3300005343 Bacteria 735
65 Ga0070661_100569102 3300005344 Bacteria 913
66 Ga0070692_10232284 3300005345 Bacteria 1095
67 Ga0070692_10459666 3300005345 Bacteria 816
68 Ga0070692_10943177 3300005345 Bacteria 600
69 Ga0070668_100302628 3300005347 Bacteria 1341
70 Ga0070669_101174249 3300005353 Bacteria 662
71 Ga0070669_101916647 3300005353 Bacteria 518
72 Ga0070669_101924034 3300005353 Bacteria 517
73 Ga0070675_100471991 3300005354 Bacteria 1127
74 Ga0070675_100894687 3300005354 Bacteria 813
75 Ga0070675_101344378 3300005354 Bacteria 659
76 Ga0070675_101519746 3300005354 Bacteria 618
77 Ga0070671_100071958 3300005355 Bacteria 2886
78 Ga0070674_100103993 3300005356 Bacteria 2074
79 Ga0070674_100628650 3300005356 Bacteria 910
80 Ga0070674_101320877 3300005356 Bacteria 644
81 Ga0070673_100076409 3300005364 Bacteria 2704
82 Ga0070673_100839966 3300005364 Bacteria 849
83 Ga0070688_100362033 3300005365 Bacteria 1064
84 Ga0070688_100480838 3300005365 Bacteria 934
85 Ga0070659_100642432 3300005366 Bacteria 914
86 Ga0070659_100729270 3300005366 Bacteria 858
87 Ga0070667_100075769 3300005367 Bacteria 2872
88 Ga0070667_100259161 3300005367 Bacteria 1556
89 Ga0070667_100329789 3300005367 Bacteria 1378
90 Ga0070667_100556519 3300005367 Bacteria 1054
91 Ga0070703_10186047 3300005406 Bacteria 805
92 Ga0070713_101648358 3300005436 Bacteria 623
93 Ga0070710_11343549 3300005437 Bacteria 533
94 Ga0070701_10024455 3300005438 Bacteria 2922
95 Ga0070701_10054367 3300005438 Bacteria 2087
96 Ga0070701_10489370 3300005438 Bacteria 796
97 Ga0070711_100677549 3300005439 Bacteria 866
98 Ga0070705_100028430 3300005440 Bacteria 3062
99 Ga0070705_100280402 3300005440 Bacteria 1184
100 Ga0070705_101054690 3300005440 Bacteria 663
101 Ga0070705_101740219 3300005440 Bacteria 527
102 Ga0070700_100036116 3300005441 Bacteria 2995
103 Ga0070700_100732067 3300005441 Bacteria 789
104 Ga0070700_100773600 3300005441 Bacteria 770
105 Ga0070700_100796730 3300005441 Bacteria 760
106 Ga0070700_100883108 3300005441 Bacteria 727
107 Ga0070700_101261422 3300005441 Bacteria 619
108 Ga0070700_101992676 3300005441 Bacteria 503
109 Ga0070694_100607329 3300005444 Bacteria 881
110 Ga0070694_100678039 3300005444 Bacteria 836
111 Ga0070694_100794457 3300005444 Bacteria 775
112 Ga0070694_101080886 3300005444 Bacteria 668
113 Ga0070694_101422324 3300005444 Bacteria 585
114 Ga0070708_100021693 3300005445 Bacteria 5437
115 Ga0070708_100083016 3300005445 Bacteria 2903
116 Ga0070708_100173962 3300005445 Bacteria 2011
117 Ga0070708_100342283 3300005445 Bacteria 1409
118 Ga0070708_100941451 3300005445 Bacteria 810
119 Ga0070708_101091673 3300005445 Bacteria 747
120 Ga0070708_101173597 3300005445 Bacteria 718
121 Ga0070663_100004558 3300005455 Bacteria 8167
122 Ga0070663_100504094 3300005455 Bacteria 1005
123 Ga0070663_100995753 3300005455 Bacteria 728
124 Ga0070678_100159402 3300005456 Bacteria 1826
125 Ga0070678_100765070 3300005456 Bacteria 874
126 Ga0070678_102065119 3300005456 Bacteria 540
127 Ga0070662_101509288 3300005457 Bacteria 579
128 Ga0070681_10283178 3300005458 Bacteria 1568
129 Ga0070681_11076664 3300005458 Bacteria 724
130 Ga0068867_100260956 3300005459 Bacteria 1412
131 Ga0068867_101750357 3300005459 Bacteria 583
132 Ga0068867_102087865 3300005459 Bacteria 537
133 Ga0068867_102343798 3300005459 Bacteria 508
134 Ga0070685_10336638 3300005466 Bacteria 1028
135 Ga0070685_10438397 3300005466 Bacteria 912
136 Ga0070685_10618241 3300005466 Bacteria 781
137 Ga0070706_100040516 3300005467 Bacteria 4300
138 Ga0070706_100484590 3300005467 Bacteria 1150
139 Ga0070706_100902145 3300005467 Bacteria 816
140 Ga0070706_101628946 3300005467 Bacteria 589
141 Ga0070707_100098692 3300005468 Bacteria 2829
142 Ga0070707_100291996 3300005468 Bacteria 1584
143 Ga0070707_101085172 3300005468 Bacteria 766
144 Ga0070707_101436453 3300005468 Bacteria 656
145 Ga0070707_101628786 3300005468 Bacteria 612
146 Ga0070707_102323121 3300005468 Bacteria 503
147 Ga0070698_100045715 3300005471 Bacteria 4480
148 Ga0070698_100084781 3300005471 Bacteria 3156
149 Ga0070698_100128772 3300005471 Bacteria 2487
150 Ga0070698_100920159 3300005471 Bacteria 820
151 Ga0070698_100926067 3300005471 Bacteria 817
152 Ga0070698_100993079 3300005471 Bacteria 786
153 Ga0070698_101065374 3300005471 Bacteria 756
154 Ga0070698_101118251 3300005471 Bacteria 736
155 Ga0070698_101356538 3300005471 Bacteria 662
156 Ga0070698_101814622 3300005471 Bacteria 563
157 Ga0070699_100077369 3300005518 Bacteria 2896
158 Ga0070699_100181167 3300005518 Bacteria 1869
159 Ga0070699_100773320 3300005518 Bacteria 878
160 Ga0070699_100855497 3300005518 Bacteria 833
161 Ga0070699_100875053 3300005518 Bacteria 823
162 Ga0070699_101092972 3300005518 Bacteria 731
163 Ga0070699_101445732 3300005518 Bacteria 630
164 Ga0070699_101794379 3300005518 Bacteria 561
165 Ga0070699_102051599 3300005518 Bacteria 522
166 Ga0070679_100562028 3300005530 Bacteria 1084
167 Ga0070679_101089076 3300005530 Bacteria 744
168 Ga0070679_101767495 3300005530 Bacteria 567
169 Ga0070679_102106117 3300005530 Bacteria 513
170 Ga0070684_100182697 3300005535 Bacteria 1907
171 Ga0070684_100320665 3300005535 Bacteria 1423
172 Ga0070684_100754584 3300005535 Bacteria 908
173 Ga0070684_101589770 3300005535 Bacteria 617
174 Ga0070697_100012567 3300005536 Bacteria 6633
175 Ga0070697_100081282 3300005536 Bacteria 2670
176 Ga0070697_100105328 3300005536 Bacteria 2346
177 Ga0070697_100184681 3300005536 Bacteria 1768
178 Ga0070697_100481821 3300005536 Bacteria 1083
179 Ga0070697_100723975 3300005536 Bacteria 878
180 Ga0070697_101123849 3300005536 Bacteria 699
181 Ga0070697_101429689 3300005536 Bacteria 618
182 Ga0070697_101653937 3300005536 Bacteria 573
183 Ga0068853_101848543 3300005539 Bacteria 585
184 Ga0070672_101958419 3300005543 Bacteria 527
185 Ga0070686_100117462 3300005544 Bacteria 1821
186 Ga0070686_100240245 3300005544 Bacteria 1318
187 Ga0070686_100521042 3300005544 Bacteria 925
188 Ga0070686_100829016 3300005544 Bacteria 747
189 Ga0070686_101232466 3300005544 Bacteria 622
190 Ga0070686_101609910 3300005544 Bacteria 550
191 Ga0070686_101666956 3300005544 Bacteria 541
192 Ga0070695_100039268 3300005545 Bacteria 2991
193 Ga0070695_100080457 3300005545 Bacteria 2153
194 Ga0070695_100395406 3300005545 Bacteria 1046
195 Ga0070695_100482640 3300005545 Bacteria 955
196 Ga0070695_101218731 3300005545 Bacteria 619
197 Ga0070696_100048649 3300005546 Bacteria 2943
198 Ga0070696_100275622 3300005546 Bacteria 1280
199 Ga0070696_100296747 3300005546 Bacteria 1236
200 Ga0070696_100367818 3300005546 Bacteria 1117
201 Ga0070696_100752543 3300005546 Bacteria 798
202 Ga0070696_100811911 3300005546 Bacteria 770
203 Ga0070696_101222000 3300005546 Bacteria 635
204 Ga0070696_101650052 3300005546 Bacteria 552
205 Ga0070696_101790118 3300005546 Bacteria 530
206 Ga0070693_100448998 3300005547 Bacteria 904
207 Ga0070693_100992972 3300005547 Bacteria 635
208 Ga0070693_101400411 3300005547 Bacteria 543
209 Ga0070704_100202396 3300005549 Bacteria 1603
210 Ga0070704_100338901 3300005549 Bacteria 1265
211 Ga0070704_100439002 3300005549 Bacteria 1121
212 Ga0070704_100842662 3300005549 Bacteria 821
213 Ga0070704_101833780 3300005549 Bacteria 561
214 Ga0070704_101979963 3300005549 Bacteria 540
215 Ga0070704_102071092 3300005549 Bacteria 528
216 Ga0068855_101000371 3300005563 Bacteria 878
217 Ga0070664_100705157 3300005564 Bacteria 940
218 Ga0070664_100724302 3300005564 Bacteria 928
219 Ga0068857_100137897 3300005577 Bacteria 2203
220 Ga0068857_100298521 3300005577 Bacteria 1485
221 Ga0068857_100487636 3300005577 Bacteria 1155
222 Ga0068857_100773477 3300005577 Bacteria 915
223 Ga0068857_101146947 3300005577 Bacteria 751
224 Ga0068854_101023035 3300005578 Bacteria 732
225 Ga0068854_101618104 3300005578 Bacteria 590
226 Ga0068854_101708474 3300005578 Bacteria 575
227 Ga0068854_101956811 3300005578 Bacteria 540
228 Ga0068856_100307662 3300005614 Bacteria 1602
229 Ga0068856_101835619 3300005614 Bacteria 618
230 Ga0068856_102722090 3300005614 Bacteria 500
231 Ga0070702_100086340 3300005615 Bacteria 1892
232 Ga0070702_100366736 3300005615 Bacteria 1019
233 Ga0070702_100421618 3300005615 Bacteria 960
234 Ga0070702_100539905 3300005615 Bacteria 863
235 Ga0070702_101783717 3300005615 Bacteria 513
236 Ga0068852_100217744 3300005616 Bacteria 1814
237 Ga0068852_100866168 3300005616 Bacteria 919
238 Ga0068859_100551157 3300005617 Bacteria 1247
239 Ga0068859_101456537 3300005617 Bacteria 756
240 Ga0068864_100118277 3300005618 Bacteria 2366
241 Ga0068864_100457461 3300005618 Bacteria 1221
242 Ga0068866_10279534 3300005718 Bacteria 1034
243 Ga0068866_11338054 3300005718 Bacteria 522
244 Ga0068861_100043615 3300005719 Bacteria 3368
245 Ga0068861_100485872 3300005719 Bacteria 1113
246 Ga0068861_100724626 3300005719 Bacteria 926
247 Ga0068861_101021100 3300005719 Bacteria 791
248 Ga0068861_101044093 3300005719 Bacteria 782
249 Ga0068861_101214951 3300005719 Bacteria 729
250 Ga0068851_10264226 3300005834 Bacteria 980
251 Ga0068870_10219194 3300005840 Bacteria 1163
252 Ga0068870_10735801 3300005840 Bacteria 684
253 Ga0068863_100982498 3300005841 Bacteria 847
254 Ga0068863_101413859 3300005841 Bacteria 703
255 Ga0068858_100027244 3300005842 Bacteria 5310
256 Ga0068858_100477059 3300005842 Bacteria 1204
257 Ga0068858_101075074 3300005842 Bacteria 789
258 Ga0068858_101514665 3300005842 Bacteria 661
259 Ga0068860_100024658 3300005843 Bacteria 5808
260 Ga0068860_100531553 3300005843 Bacteria 1176
261 Ga0068862_101281327 3300005844 Bacteria 734
262 Ga0081539_10002087 3300005985 Bacteria 29854
263 Ga0081539_10318578 3300005985 Bacteria 662
264 Ga0075365_10279193 3300006038 Bacteria 1175
265 Ga0075364_10962093 3300006051 Bacteria 581
266 Ga0075432_10037946 3300006058 Bacteria 1677
267 Ga0070715_10558793 3300006163 Bacteria 665
268 Ga0070716_100263972 3300006173 Bacteria 1179
269 Ga0070716_101271664 3300006173 Bacteria 594
270 Ga0070716_101721500 3300006173 Bacteria 517
271 Ga0070712_100981020 3300006175 Bacteria 731
272 Ga0097621_100150529 3300006237 Bacteria 1995
273 Ga0097621_100361892 3300006237 Bacteria 1292
274 Ga0097621_100807415 3300006237 Bacteria 869
275 Ga0097621_102328181 3300006237 Bacteria 512
276 Ga0068871_100103647 3300006358 Bacteria 2385
277 Ga0068871_100434328 3300006358 Bacteria 1174
278 Ga0068871_100896880 3300006358 Bacteria 821
279 Ga0075428_100731357 3300006844 Bacteria 1053
280 Ga0075428_101943549 3300006844 Bacteria 611
281 Ga0075431_100254993 3300006847 Bacteria 1781
282 Ga0075433_10019795 3300006852 Bacteria 5616
283 Ga0075433_10163918 3300006852 Bacteria 1978
284 Ga0075433_10271267 3300006852 Bacteria 1503
285 Ga0075433_10944981 3300006852 Bacteria 752
286 Ga0075434_100807010 3300006871 Bacteria 954
287 Ga0075434_101116554 3300006871 Bacteria 801
288 Ga0068865_100159465 3300006881 Bacteria 1719
289 Ga0068865_100226429 3300006881 Bacteria 1464
290 Ga0068865_100288295 3300006881 Bacteria 1309
291 Ga0068865_100575930 3300006881 Bacteria 948
292 Ga0068865_101826023 3300006881 Bacteria 550
293 Ga0075436_100122500 3300006914 Bacteria 1820
294 Ga0097620_100551131 3300006931 Bacteria 1247
295 Ga0097620_101456521 3300006931 Bacteria 756
296 Ga0075435_100232450 3300007076 Bacteria 1567
297 Ga0075435_100463524 3300007076 Bacteria 1093
298 Ga0075435_100522835 3300007076 Bacteria 1026
299 Ga0075435_100659383 3300007076 Bacteria 908
300 Ga0075435_100756312 3300007076 Bacteria 845
301 Ga0099795_10303707 3300007788 Bacteria 702
302 Ga0105251_10066999 3300009011 Bacteria 1678
303 Ga0105244_10186311 3300009036 Bacteria 983
304 Ga0105250_10605431 3300009092 Bacteria 508
305 Ga0105240_11120153 3300009093 Bacteria 837
306 Ga0105240_11173332 3300009093 Bacteria 814
307 Ga0111539_10628948 3300009094 Bacteria 1250
308 Ga0111539_11331570 3300009094 Bacteria 833
309 Ga0111539_11404096 3300009094 Bacteria 810
310 Ga0111539_12267385 3300009094 Bacteria 630
311 Ga0105245_10220019 3300009098 Bacteria 1832
312 Ga0105245_10746505 3300009098 Bacteria 1014
313 Ga0105245_10755149 3300009098 Bacteria 1009
314 Ga0105245_11166052 3300009098 Bacteria 818
315 Ga0105245_11570092 3300009098 Bacteria 710
316 Ga0105245_13253944 3300009098 Bacteria 503
317 Ga0105247_10170111 3300009101 Bacteria 1448
318 Ga0105247_10861632 3300009101 Bacteria 696
319 Ga0105247_11201884 3300009101 Bacteria 604
320 Ga0105247_11692624 3300009101 Bacteria 523
321 Ga0114129_10181666 3300009147 Bacteria 2862
322 Ga0114129_11118621 3300009147 Bacteria 985
323 Ga0114129_11611101 3300009147 Bacteria 794
324 Ga0114129_12174935 3300009147 Bacteria 668
325 Ga0105243_10585040 3300009148 Bacteria 1072
326 Ga0105243_10637014 3300009148 Bacteria 1031
327 Ga0105243_10781936 3300009148 Bacteria 939
328 Ga0105243_10789027 3300009148 Bacteria 935
329 Ga0105243_11139061 3300009148 Bacteria 790
330 Ga0105243_11924829 3300009148 Bacteria 624
331 Ga0105243_12518553 3300009148 Bacteria 554
332 Ga0105243_12597863 3300009148 Bacteria 546
333 Ga0105241_10558779 3300009174 Bacteria 1029
334 Ga0105241_12571318 3300009174 Bacteria 511
335 Ga0105242_10245777 3300009176 Bacteria 1610
336 Ga0105242_10297351 3300009176 Bacteria 1472
337 Ga0105242_10463114 3300009176 Bacteria 1198
338 Ga0105242_10839274 3300009176 Bacteria 913
339 Ga0105242_11050225 3300009176 Bacteria 826
340 Ga0105242_11318241 3300009176 Bacteria 746
341 Ga0105248_10041220 3300009177 Bacteria 5176
342 Ga0105248_10784244 3300009177 Bacteria 1075
343 Ga0105248_11178129 3300009177 Bacteria 866
344 Ga0105248_11510176 3300009177 Bacteria 761
345 Ga0105248_12261881 3300009177 Bacteria 619
346 Ga0105248_13313266 3300009177 Bacteria 512
347 Ga0105237_10611139 3300009545 Bacteria 1097
348 Ga0105237_10966472 3300009545 Bacteria 859
349 Ga0105238_10328716 3300009551 Bacteria 1515
350 Ga0105238_10825244 3300009551 Bacteria 943
351 Ga0105238_11131346 3300009551 Bacteria 806
352 Ga0105249_10019204 3300009553 Bacteria 6095
353 Ga0105249_10492138 3300009553 Bacteria 1270
354 Ga0105249_11308605 3300009553 Bacteria 796
355 Ga0105249_11369838 3300009553 Bacteria 779
356 Ga0105249_11885749 3300009553 Bacteria 670
357 Ga0105249_12278481 3300009553 Bacteria 614
358 Ga0105249_12829331 3300009553 Bacteria 557
359 Ga0105249_13079667 3300009553 Bacteria 536
360 Ga0105239_10319281 3300010375 Bacteria 1751
361 Ga0105239_11173510 3300010375 Bacteria 885
362 Ga0105239_12166299 3300010375 Bacteria 646
363 Ga0105239_12265214 3300010375 Bacteria 632
364 Ga0105239_12812473 3300010375 Bacteria 568
365 Ga0105246_10041027 3300011119 Bacteria 3127
366 Ga0105246_10329895 3300011119 Bacteria 1243
367 Ga0105246_10942752 3300011119 Bacteria 777
368 Ga0105246_10968939 3300011119 Bacteria 768
369 Ga0105246_11456342 3300011119 Bacteria 641
370 Ga0105246_12110491 3300011119 Bacteria 546
371 Ga0157343_1007894 3300012488 Bacteria 753
372 Ga0157323_1004802 3300012495 Bacteria 880
373 Ga0157371_10337438 3300013102 Bacteria 1096
374 Ga0157370_11061661 3300013104 Bacteria 732
375 Ga0157374_10155022 3300013296 Bacteria 2229
376 Ga0157374_10265742 3300013296 Bacteria 1691
377 Ga0157374_10728428 3300013296 Bacteria 1006
378 Ga0157378_10015276 3300013297 Bacteria 6724
379 Ga0157378_10913110 3300013297 Bacteria 909
380 Ga0157378_11259696 3300013297 Bacteria 780
381 Ga0157378_11553276 3300013297 Bacteria 707
382 Ga0163162_10088800 3300013306 Bacteria 3170
383 Ga0163162_11255603 3300013306 Bacteria 841
384 Ga0163162_11783920 3300013306 Bacteria 703
385 Ga0163162_12848112 3300013306 Bacteria 557
386 Ga0163162_13123335 3300013306 Bacteria 532
387 Ga0157372_10800022 3300013307 Bacteria 1095
388 Ga0157372_11560230 3300013307 Bacteria 760
389 Ga0157375_10912092 3300013308 Bacteria 1022
390 Ga0157375_11151575 3300013308 Bacteria 909
391 Ga0157375_13454274 3300013308 Bacteria 526
392 Ga0157375_13675404 3300013308 Bacteria 510
393 Ga0163163_10259786 3300014325 Bacteria 1788
394 Ga0163163_10526117 3300014325 Bacteria 1245
395 Ga0163163_10743049 3300014325 Bacteria 1044
396 Ga0163163_11444496 3300014325 Bacteria 749
397 Ga0163163_11756174 3300014325 Bacteria 681
398 Ga0163163_11812411 3300014325 Bacteria 670
399 Ga0163163_12069663 3300014325 Bacteria 629
400 Ga0163163_13043396 3300014325 Bacteria 523
401 Ga0157380_10012801 3300014326 Bacteria 6096
402 Ga0157380_11037451 3300014326 Bacteria 856
403 Ga0157380_11040742 3300014326 Bacteria 854
404 Ga0157380_11514832 3300014326 Bacteria 724
405 Ga0157380_12996746 3300014326 Bacteria 538
406 Ga0157380_13364968 3300014326 Bacteria 511
407 Ga0157377_10076167 3300014745 Bacteria 1950
408 Ga0157377_10417560 3300014745 Bacteria 918
409 Ga0157377_10483225 3300014745 Bacteria 862
410 Ga0157379_10549666 3300014968 Bacteria 1074
411 Ga0157379_11122397 3300014968 Bacteria 754
412 Ga0157379_11441509 3300014968 Bacteria 668
413 Ga0157379_11449126 3300014968 Bacteria 667
414 Ga0157376_10148277 3300014969 Bacteria 2113
415 Ga0157376_11024663 3300014969 Bacteria 849
416 Ga0157376_11898288 3300014969 Bacteria 632
417 Ga0163161_10605041 3300017792 Bacteria 904
418 Ga0163161_10623128 3300017792 Bacteria 892
419 Ga0163161_10735802 3300017792 Bacteria 824
420 Ga0206356_10505645 3300020070 Bacteria 746
421 Ga0206352_11256669 3300020078 Bacteria 501
422 Ga0206354_10678292 3300020081 Bacteria 527
423 Ga0207697_10103881 3300025315 Bacteria 1213
424 Ga0207656_10221892 3300025321 Bacteria 919
425 Ga0207713_1061982 3300025735 Bacteria 1420
426 Ga0207653_10063012 3300025885 Bacteria 1254
427 Ga0207653_10158204 3300025885 Bacteria 837
428 Ga0207653_10346741 3300025885 Bacteria 580
429 Ga0207692_11071524 3300025898 Bacteria 533
430 Ga0207710_10551947 3300025900 Bacteria 600
431 Ga0207688_10728680 3300025901 Bacteria 627
432 Ga0207688_10794965 3300025901 Bacteria 599
433 Ga0207680_10238277 3300025903 Bacteria 1253
434 Ga0207680_10345252 3300025903 Bacteria 1045
435 Ga0207647_10022808 3300025904 Bacteria 4152
436 Ga0207685_10132869 3300025905 Bacteria 1107
437 Ga0207645_10140018 3300025907 Bacteria 1576
438 Ga0207645_10472654 3300025907 Bacteria 847
439 Ga0207643_10391655 3300025908 Bacteria 877
440 Ga0207684_10023984 3300025910 Bacteria 5205
441 Ga0207684_10393037 3300025910 Bacteria 1192
442 Ga0207707_10224487 3300025912 Bacteria 1635
443 Ga0207707_10290941 3300025912 Bacteria 1413
444 Ga0207695_10853129 3300025913 Bacteria 791
445 Ga0207671_10281017 3300025914 Bacteria 1313
446 Ga0207693_10691971 3300025915 Bacteria 790
447 Ga0207660_10000002 3300025917 Bacteria 883566
448 Ga0207662_10451250 3300025918 Bacteria 879
449 Ga0207662_10551726 3300025918 Bacteria 798
450 Ga0207657_10381984 3300025919 Bacteria 1109
451 Ga0207649_10417978 3300025920 Bacteria 1006
452 Ga0207649_11343857 3300025920 Bacteria 565
453 Ga0207652_11691138 3300025921 Bacteria 537
454 Ga0207646_10004216 3300025922 Bacteria 15739
455 Ga0207646_10344489 3300025922 Bacteria 1346
456 Ga0207646_10430443 3300025922 Bacteria 1191
457 Ga0207646_10669247 3300025922 Bacteria 929
458 Ga0207646_11308692 3300025922 Bacteria 633
459 Ga0207650_10856254 3300025925 Bacteria 771
460 Ga0207659_10608607 3300025926 Bacteria 932
461 Ga0207659_11055178 3300025926 Bacteria 699
462 Ga0207687_10046120 3300025927 Bacteria 3016
463 Ga0207687_10205866 3300025927 Bacteria 1541
464 Ga0207687_10245227 3300025927 Bacteria 1422
465 Ga0207687_10541964 3300025927 Bacteria 975
466 Ga0207687_10665427 3300025927 Bacteria 882
467 Ga0207644_10066480 3300025931 Bacteria 2625
468 Ga0207644_10855190 3300025931 Bacteria 762
469 Ga0207644_11103092 3300025931 Unclassified 667
470 Ga0207690_10050244 3300025932 Bacteria 2783
471 Ga0207690_11293243 3300025932 Bacteria 609
472 Ga0207706_10046490 3300025933 Bacteria 3842
473 Ga0207706_11053782 3300025933 Bacteria 681
474 Ga0207686_10341698 3300025934 Bacteria 1124
475 Ga0207686_10657768 3300025934 Bacteria 829
476 Ga0207686_10663648 3300025934 Bacteria 826
477 Ga0207709_10010646 3300025935 Bacteria 5066
478 Ga0207709_10080062 3300025935 Bacteria 2102
479 Ga0207709_10969481 3300025935 Bacteria 694
480 Ga0207670_10754289 3300025936 Bacteria 808
481 Ga0207670_11314009 3300025936 Bacteria 613
482 Ga0207669_10005197 3300025937 Bacteria 5815
483 Ga0207669_10022441 3300025937 Bacteria 3353
484 Ga0207669_10737737 3300025937 Bacteria 812
485 Ga0207669_10850612 3300025937 Bacteria 759
486 Ga0207704_10153708 3300025938 Bacteria 1627
487 Ga0207704_10533180 3300025938 Bacteria 951
488 Ga0207704_10825826 3300025938 Bacteria 775
489 Ga0207665_10412618 3300025939 Bacteria 1030
490 Ga0207665_11414374 3300025939 Bacteria 554
491 Ga0207691_11758036 3300025940 Bacteria 501
492 Ga0207711_10059034 3300025941 Bacteria 3302
493 Ga0207711_10408907 3300025941 Bacteria 1261
494 Ga0207689_10662255 3300025942 Bacteria 880
495 Ga0207689_10948874 3300025942 Bacteria 726
496 Ga0207661_10212042 3300025944 Bacteria 1707
497 Ga0207661_10436866 3300025944 Bacteria 1190
498 Ga0207667_10791170 3300025949 Bacteria 946
499 Ga0207651_11479702 3300025960 Bacteria 611
500 Ga0207712_10634298 3300025961 Bacteria 927
501 Ga0207712_11290679 3300025961 Bacteria 652
502 Ga0207712_11451262 3300025961 Bacteria 614
503 Ga0207668_10856634 3300025972 Bacteria 807
504 Ga0207640_10213275 3300025981 Bacteria 1472
505 Ga0207640_11872801 3300025981 Bacteria 543
506 Ga0207658_10302443 3300025986 Bacteria 1378
507 Ga0207658_12070465 3300025986 Bacteria 517
508 Ga0207677_10528251 3300026023 Bacteria 1025
509 Ga0207677_10728964 3300026023 Bacteria 882
510 Ga0207677_11417490 3300026023 Bacteria 640
511 Ga0207703_10065297 3300026035 Bacteria 2990
512 Ga0207703_10886928 3300026035 Bacteria 854
513 Ga0207703_12275174 3300026035 Bacteria 518
514 Ga0207639_10907276 3300026041 Bacteria 824
515 Ga0207639_10971666 3300026041 Bacteria 795
516 Ga0207678_10017028 3300026067 Bacteria 6382
517 Ga0207678_10276342 3300026067 Bacteria 1441
518 Ga0207678_11598135 3300026067 Bacteria 574
519 Ga0207708_10017492 3300026075 Bacteria 5396
520 Ga0207708_10524672 3300026075 Bacteria 996
521 Ga0207708_10856134 3300026075 Bacteria 785
522 Ga0207708_11777193 3300026075 Bacteria 541
523 Ga0207702_10729756 3300026078 Bacteria 977
524 Ga0207702_11057120 3300026078 Bacteria 805
525 Ga0207641_11341754 3300026088 Bacteria 716
526 Ga0207648_10799580 3300026089 Bacteria 878
527 Ga0207676_10243897 3300026095 Bacteria 1613
528 Ga0207676_10508450 3300026095 Bacteria 1145
529 Ga0207676_11361056 3300026095 Bacteria 705
530 Ga0207674_10096522 3300026116 Bacteria 2941
531 Ga0207674_10850537 3300026116 Bacteria 880
532 Ga0207674_11033956 3300026116 Bacteria 791
533 Ga0207675_100573084 3300026118 Bacteria 1130
534 Ga0207675_100822742 3300026118 Bacteria 943
535 Ga0207675_101054815 3300026118 Bacteria 832
536 Ga0207675_101383480 3300026118 Bacteria 724
537 Ga0207683_10114781 3300026121 Bacteria 2414
538 Ga0207683_10486201 3300026121 Bacteria 1140
539 Ga0207683_10807356 3300026121 Bacteria 871
540 Ga0207698_10020697 3300026142 Bacteria 4534
541 Ga0209973_1020358 3300027252 Bacteria 876
542 Ga0209984_1038469 3300027424 Bacteria 686
543 Ga0209968_1005468 3300027526 Bacteria 1911
544 Ga0209982_1006777 3300027552 Bacteria 1670
545 Ga0210002_1049075 3300027617 Bacteria 726
546 Ga0209983_1020600 3300027665 Bacteria 1375
547 Ga0209983_1044215 3300027665 Bacteria 967
548 Ga0209983_1050545 3300027665 Bacteria 910
549 Ga0209971_1019669 3300027682 Bacteria 1603
550 Ga0209971_1179172 3300027682 Bacteria 522
551 Ga0209966_1091951 3300027695 Bacteria 680
552 Ga0209998_10007548 3300027717 Bacteria 2257
553 Ga0209974_10016162 3300027876 Bacteria 2478
554 Ga0209974_10028771 3300027876 Bacteria 1840
555 Ga0209974_10090696 3300027876 Bacteria 1060
556 Ga0209974_10424313 3300027876 Bacteria 525
557 Ga0209974_10429919 3300027876 Bacteria 522
558 Ga0207428_10181308 3300027907 Bacteria 1591
559 Ga0268264_10274106 3300028381 Bacteria 1577
560 Ga0268264_12025853 3300028381 Bacteria 585
561 Ga0268264_12453410 3300028381 Bacteria 527
562 Ga0307408_100041695 3300031548 Bacteria 3255
563 Ga0307408_101944643 3300031548 Bacteria 565
564 Ga0307405_10476490 3300031731 Bacteria 995
565 Ga0307413_10078953 3300031824 Bacteria 2102
566 Ga0307413_10293782 3300031824 Bacteria 1229
567 Ga0307413_11278474 3300031824 Bacteria 641
568 Ga0307410_11539614 3300031852 Bacteria 586
569 Ga0307410_11673601 3300031852 Bacteria 563
570 Ga0307406_11402688 3300031901 Bacteria 612
571 Ga0307407_10154985 3300031903 Bacteria 1493
572 Ga0307412_10158459 3300031911 Bacteria 1679
573 Ga0307409_100044842 3300031995 Bacteria 3333
574 Ga0307409_100318090 3300031995 Bacteria 1455
575 Ga0307409_100852074 3300031995 Bacteria 922
576 Ga0307416_100042187 3300032002 Bacteria 3559
577 Ga0307416_100307797 3300032002 Bacteria 1579
578 Ga0307416_101333408 3300032002 Bacteria 823
579 Ga0307416_102548829 3300032002 Bacteria 609
580 Ga0307414_10782384 3300032004 Bacteria 869
581 Ga0307414_10952636 3300032004 Bacteria 789
582 Ga0307415_100063143 3300032126 Bacteria 2572
583 Ga0307415_100120780 3300032126 Bacteria 1964
584 Ga0307415_101454292 3300032126 Bacteria 654
585 Ga0373948_0167434 3300034817 Bacteria 558
586 Ga0373948_0201665 3300034817 Bacteria 519
587 Ga0373950_0120545 3300034818 Bacteria 580
588 Ga0373958_0041078 3300034819 Bacteria 946
589 Ga0373926_0098127 3300035083 Bacteria 1094
590 Ga0373929_0147805 3300035085 Bacteria 628
591 Ga0373949_0049115 3300035090 Bacteria 1059
592 Ga0373951_0233715 3300035091 Bacteria 547
593 Ga0373932_0103774 3300035112 Bacteria 929
594 Ga0373941_0131513 3300035115 Bacteria 902
595 Ga0373941_0288517 3300035115 Bacteria 651
596 Ga0373941_0392496 3300035115 Bacteria 572
597 Ga0373960_0063732 3300035121 Bacteria 1124
598 Ga0373960_0282269 3300035121 Bacteria 612
599 Ga0373946_0507291 3300035171 Bacteria 619
600 Ga0373955_0332584 3300035172 Bacteria 919
601 Ga0373961_0235479 3300035241 Bacteria 658
602 Ga0373962_0072589 3300035242 Bacteria 1031
603 Ga0373931_0194604 3300035691 Bacteria 1208
604 Ga0373931_1020186 3300035691 Bacteria 561
605 Ga0373933_0757909 3300035724 Bacteria 639
606 Ga0395901_0312615 3300038443 Bacteria 1627
607 Ga0242419_005567 3300038698 Bacteria 900
608 Ga0242420_064558 3300038996 Bacteria 735
609 Ga0439453_0180418 3300041408 Bacteria 515
610 Ga0439466_0041798 3300041411 Bacteria 1528
611 Ga0451807_0415819 3300041486 Bacteria 863
612 Ga0439431_0178426 3300041997 Bacteria 612
613 Ga0450914_034842 3300042118 Bacteria 620
614 Ga0450920_131719 3300042122 Bacteria 527
615 Ga0450923_015004 3300042125 Bacteria 1443
616 Ga0450897_034538 3300042128 Bacteria 582
617 Ga0450906_013042 3300042145 Bacteria 1536
618 Ga0450910_060232 3300042147 Bacteria 640
619 Ga0450910_068298 3300042147 Bacteria 608
620 Ga0450908_044198 3300042184 Bacteria 772
621 Ga0450909_021128 3300042185 Bacteria 972
622 Ga0439434_0085821 3300042435 Bacteria 1003
623 Ga0439434_0088566 3300042435 Bacteria 988
624 Ga0439459_0033618 3300042438 Bacteria 1057
625 Ga0450916_073568 3300042530 Bacteria 574
626 Ga0451577_0060452 3300042876 Bacteria 3378
627 Ga0451577_1377332 3300042876 Bacteria 626
628 Ga0453683_0018052 3300044673 Bacteria 4531
629 Ga0453683_0383037 3300044673 Bacteria 905
630 Ga0453684_0794841 3300044712 Bacteria 1021
631 Ga0453684_1421790 3300044712 Bacteria 718
632 Ga0451576_0040408 3300045051 Bacteria 4937
633 Ga0466967_1874688 3300045976 Bacteria 596
634 Ga0495603_0220251 3300046455 Bacteria 1095
635 Ga0495582_0264675 3300046473 Bacteria 986
636 Ga0495582_0387772 3300046473 Bacteria 805
637 Ga0495662_0258322 3300046476 Bacteria 858
638 Ga0495644_0073999 3300046523 Bacteria 1281
639 Ga0495663_0086016 3300046525 Bacteria 1019
640 Ga0495609_0313839 3300046538 Bacteria 637
641 Ga0495656_0779253 3300046615 Bacteria 516
642 Ga0495611_0230567 3300046648 Bacteria 861
643 Ga0495659_0221644 3300046664 Bacteria 781
644 Ga0495659_0293609 3300046664 Bacteria 685
645 Ga0495647_0122158 3300046681 Bacteria 1096
646 Ga0495658_0951817 3300046683 Bacteria 549
647 Ga0495613_1013100 3300046689 Bacteria 533
648 Ga0495624_0867277 3300046690 Bacteria 532
649 Ga0495649_0236389 3300046694 Bacteria 942
650 Ga0495676_0412536 3300047321 Bacteria 895
651 Ga0495614_0426175 3300048089 Bacteria 626
652 Ga0495614_0652200 3300048089 Bacteria 508
653 Ga0496100_0891638 3300048903 Bacteria 698
654 Ga0496101_0462519 3300048904 Bacteria 1001
655 Ga0496101_0777076 3300048904 Bacteria 755
656 Ga0496101_0844817 3300048904 Bacteria 721
657 Ga0496101_0945591 3300048904 Bacteria 678
658 Ga0496101_1414834 3300048904 Bacteria 542
659 Ga0496102_0221210 3300048905 Bacteria 1785
660 Ga0496102_0406039 3300048905 Bacteria 1280
661 Ga0496102_0765094 3300048905 Bacteria 888
662 Ga0496102_0989738 3300048905 Bacteria 761
663 Ga0496102_1128921 3300048905 Bacteria 703
664 Ga0496103_0011651 3300048906 Bacteria 5215
665 Ga0496103_0511251 3300048906 Bacteria 768
666 Ga0496103_0772581 3300048906 Bacteria 607
667 Ga0496104_0022038 3300048907 Bacteria 5854
668 Ga0496104_0048572 3300048907 Bacteria 4000
669 Ga0496104_0173708 3300048907 Bacteria 2065
670 Ga0496104_0257888 3300048907 Bacteria 1656
671 Ga0496104_0897486 3300048907 Bacteria 791
672 Ga0496105_0079537 3300048908 Bacteria 2707
673 Ga0496105_0202168 3300048908 Bacteria 1621
674 Ga0496105_0326202 3300048908 Bacteria 1229
675 Ga0496106_0189802 3300048909 Bacteria 1633
676 Ga0496106_0244933 3300048909 Bacteria 1432
677 Ga0496106_0245719 3300048909 Bacteria 1430
678 Ga0496106_0787726 3300048909 Bacteria 754
679 Ga0496106_1055409 3300048909 Bacteria 638
680 Ga0496107_0692959 3300048910 Bacteria 749
681 Ga0496107_1042464 3300048910 Bacteria 592
682 Ga0496107_1266685 3300048910 Bacteria 528
683 Ga0496107_1270194 3300048910 Bacteria 527
684 Ga0496108_0005881 3300048911 Bacteria 9945
685 Ga0496108_0021720 3300048911 Bacteria 5277
686 Ga0496108_0133733 3300048911 Bacteria 2132
687 Ga0496108_0152665 3300048911 Bacteria 1993
688 Ga0496109_0007365 3300048912 Bacteria 9312
689 Ga0496109_0069348 3300048912 Bacteria 3233
690 Ga0496109_0122176 3300048912 Bacteria 2426
691 Ga0496109_0416989 3300048912 Bacteria 1268
692 Ga0496109_0724174 3300048912 Bacteria 932
693 Ga0496109_1214845 3300048912 Bacteria 690
694 Ga0496109_1731753 3300048912 Bacteria 558
695 Ga0496110_0032222 3300048913 Bacteria 4525
696 Ga0496110_0032784 3300048913 Bacteria 4490
697 Ga0496110_0411793 3300048913 Bacteria 1232
698 Ga0496110_1577385 3300048913 Bacteria 566
699 Ga0496111_0031782 3300048914 Bacteria 3761
700 Ga0496111_0070108 3300048914 Bacteria 2549
701 Ga0496111_0158088 3300048914 Bacteria 1682
702 Ga0496111_0198587 3300048914 Bacteria 1491
703 Ga0496111_0974252 3300048914 Bacteria 608
704 Ga0496112_0002921 3300048915 Bacteria 13922
705 Ga0496112_0047852 3300048915 Bacteria 4195
706 Ga0496112_0246234 3300048915 Bacteria 1739
707 Ga0496112_0367774 3300048915 Bacteria 1379
708 Ga0496112_0962457 3300048915 Bacteria 774
709 Ga0496112_1342087 3300048915 Bacteria 630
710 Ga0496112_1715513 3300048915 Bacteria 540
711 Ga0496113_0010238 3300048916 Bacteria 6192
712 Ga0496113_0233291 3300048916 Bacteria 1467
713 Ga0496113_0324452 3300048916 Bacteria 1234
714 Ga0496113_0697451 3300048916 Bacteria 810
715 Ga0496114_0165095 3300048917 Bacteria 1927
716 Ga0496114_0182212 3300048917 Bacteria 1835
717 Ga0496114_0689443 3300048917 Bacteria 896
718 Ga0496114_0997559 3300048917 Bacteria 720
719 Ga0501306_039538 3300049127 Bacteria 727
720 Ga0501292_030302 3300049515 Bacteria 907
721 Ga0501297_013444 3300049520 Bacteria 961
722 Ga0501298_138082 3300049521 Bacteria 587
723 Ga0501311_043854 3300049527 Bacteria 685
724 Ga0501316_050421 3300049532 Bacteria 598
725 Ga0501317_007952 3300049533 Bacteria 1210
726 Ga0501318_080817 3300049534 Bacteria 526
727 Ga0501325_008381 3300049541 Bacteria 896
728 Ga0501325_016689 3300049541 Bacteria 736
729 Ga0501031_0012970 3300049568 Bacteria 5439
730 Ga0501031_0197050 3300049568 Bacteria 1314
731 Ga0501031_0324091 3300049568 Bacteria 998
732 Ga0501032_0110492 3300049569 Bacteria 1819
733 Ga0501032_0183002 3300049569 Bacteria 1371
734 Ga0501033_0568113 3300049570 Bacteria 780
735 Ga0501033_0616993 3300049570 Bacteria 743
736 Ga0501034_0276328 3300049571 Bacteria 1620
737 Ga0501036_0013129 3300049572 Bacteria 6880
738 Ga0501036_0165028 3300049572 Bacteria 1867
739 Ga0501036_0462525 3300049572 Bacteria 1056
740 Ga0501036_0550955 3300049572 Bacteria 958
741 Ga0501037_0076034 3300049573 Bacteria 2438
742 Ga0501037_0463857 3300049573 Bacteria 863
743 Ga0501037_0685506 3300049573 Bacteria 683
744 Ga0501038_0059905 3300049574 Bacteria 3259
745 Ga0501038_0699934 3300049574 Bacteria 759
746 Ga0501038_0824239 3300049574 Bacteria 688
747 Ga0501038_0944003 3300049574 Bacteria 635
748 Ga0501039_0069732 3300049575 Bacteria 2730
749 Ga0501039_0511992 3300049575 Bacteria 942
750 Ga0501039_0719628 3300049575 Bacteria 780
751 Ga0501039_0788581 3300049575 Bacteria 741
752 Ga0501039_1067909 3300049575 Bacteria 626
753 Ga0501040_0011743 3300049576 Bacteria 5728
754 Ga0501040_0141185 3300049576 Bacteria 1697
755 Ga0501040_0161072 3300049576 Bacteria 1586
756 Ga0501040_0225921 3300049576 Bacteria 1332
757 Ga0501040_0387918 3300049576 Bacteria 1002
758 Ga0501040_0813457 3300049576 Bacteria 676
759 Ga0501041_0020309 3300049577 Bacteria 3970
760 Ga0501041_0049911 3300049577 Bacteria 2549
761 Ga0501041_0113853 3300049577 Bacteria 1679
762 Ga0501041_0140295 3300049577 Bacteria 1507
763 Ga0501041_0411664 3300049577 Bacteria 857
764 Ga0501041_0671731 3300049577 Bacteria 662
765 Ga0501041_1050999 3300049577 Bacteria 524
766 Ga0501042_0074548 3300049578 Bacteria 2428
767 Ga0501042_0522630 3300049578 Bacteria 862
768 Ga0501042_0542931 3300049578 Bacteria 845
769 Ga0501042_1388916 3300049578 Bacteria 512
770 Ga0501042_1443820 3300049578 Bacteria 502
771 Ga0501043_0831378 3300049579 Bacteria 666
772 Ga0501043_1091685 3300049579 Bacteria 564
773 Ga0501046_0237089 3300049580 Bacteria 1346
774 Ga0501046_0288148 3300049580 Bacteria 1201
775 Ga0501046_0446722 3300049580 Bacteria 930
776 Ga0501046_0586255 3300049580 Bacteria 792
777 Ga0501046_0620260 3300049580 Bacteria 766
778 Ga0501048_0012332 3300049582 Bacteria 6359
779 Ga0501048_0069814 3300049582 Bacteria 2481
780 Ga0501048_0173849 3300049582 Bacteria 1526
781 Ga0501048_0224285 3300049582 Bacteria 1333
782 Ga0501048_0564750 3300049582 Bacteria 817
783 Ga0501067_0011868 3300049583 Bacteria 4829
784 Ga0501067_0358212 3300049583 Bacteria 813
785 Ga0501068_0013746 3300049584 Bacteria 4612
786 Ga0501068_0515690 3300049584 Bacteria 776
787 Ga0501068_0861721 3300049584 Bacteria 595
788 Ga0501068_1139883 3300049584 Bacteria 516
789 Ga0501069_0004365 3300049585 Bacteria 7300
790 Ga0501069_0022378 3300049585 Bacteria 3438
791 Ga0501069_0806667 3300049585 Bacteria 569
792 Ga0501070_0100767 3300049586 Bacteria 2389
793 Ga0501071_0016406 3300049587 Bacteria 5092
794 Ga0501071_0448364 3300049587 Bacteria 987
795 Ga0501071_0855269 3300049587 Bacteria 701
796 Ga0501071_1366397 3300049587 Bacteria 547
797 Ga0501072_0284427 3300049588 Bacteria 1315
798 Ga0501072_0298988 3300049588 Bacteria 1279
799 Ga0501072_0365326 3300049588 Bacteria 1145
800 Ga0501072_0517392 3300049588 Bacteria 943
801 Ga0501072_0897159 3300049588 Bacteria 692
802 Ga0501072_0899607 3300049588 Bacteria 691
803 Ga0501072_1049087 3300049588 Bacteria 635
804 Ga0501072_1149706 3300049588 Bacteria 603
805 Ga0501073_0078522 3300049589 Bacteria 2297
806 Ga0501073_0467456 3300049589 Bacteria 872
807 Ga0501073_0521317 3300049589 Bacteria 821
808 Ga0501074_0074160 3300049590 Bacteria 2443
809 Ga0501074_0939660 3300049590 Bacteria 608
810 Ga0501074_1001522 3300049590 Bacteria 587
811 Ga0501075_0037524 3300049591 Bacteria 3620
812 Ga0501075_0097340 3300049591 Bacteria 2233
813 Ga0501075_0715528 3300049591 Bacteria 762
814 Ga0501075_1304411 3300049591 Bacteria 550
815 Ga0501075_1551587 3300049591 Bacteria 501
816 Ga0501076_0069984 3300049592 Bacteria 2804
817 Ga0501076_0107435 3300049592 Bacteria 2253
818 Ga0501076_0136338 3300049592 Bacteria 1992
819 Ga0501076_0137306 3300049592 Bacteria 1985
820 Ga0501076_0209492 3300049592 Bacteria 1592
821 Ga0501076_0610213 3300049592 Bacteria 900
822 Ga0501076_1595835 3300049592 Bacteria 535
823 Ga0501077_0058278 3300049593 Bacteria 2451
824 Ga0501077_0209806 3300049593 Bacteria 1238
825 Ga0501077_0792412 3300049593 Bacteria 609
826 Ga0501199_048697 3300049650 Bacteria 567
827 Ga0501202_064865 3300049652 Bacteria 832
828 Ga0501208_112977 3300049655 Bacteria 593
829 Ga0501209_056512 3300049656 Bacteria 1084
830 Ga0501211_022121 3300049658 Bacteria 673
831 Ga0501214_073368 3300049659 Bacteria 563
832 Ga0501228_037647 3300049666 Bacteria 618
833 Ga0501233_147379 3300049668 Bacteria 654
834 Ga0501235_052929 3300049669 Bacteria 943
835 Ga0501239_024334 3300049672 Bacteria 762
836 Ga0501239_048475 3300049672 Bacteria 608
837 Ga0501243_016601 3300049675 Bacteria 1189
838 Ga0501251_057662 3300049681 Bacteria 632
839 Ga0501261_037271 3300049690 Bacteria 755
840 Ga0501225_0218887 3300049705 Bacteria 612
841 Ga0501079_0033531 3300049741 Bacteria 3950
842 Ga0501079_0050830 3300049741 Bacteria 3198
843 Ga0501079_1466146 3300049741 Bacteria 537
844 Ga0501080_0090497 3300049742 Bacteria 2842
845 Ga0501080_0248500 3300049742 Bacteria 1622
846 Ga0501080_0401276 3300049742 Bacteria 1233
847 Ga0501081_0025332 3300049743 Bacteria 3990
848 Ga0501081_0026245 3300049743 Bacteria 3926
849 Ga0501081_0094214 3300049743 Bacteria 2109
850 Ga0501081_0428909 3300049743 Bacteria 981
851 Ga0501083_0026775 3300049744 Bacteria 3984
852 Ga0501083_0686370 3300049744 Bacteria 666
853 Ga0501265_036451 3300049762 Bacteria 728
854 Ga0501271_035068 3300049768 Bacteria 634
855 Ga0501275_034329 3300049772 Bacteria 685
856 Ga0501280_112236 3300049776 Bacteria 533
857 Ga0501283_096921 3300049779 Bacteria 570
858 Ga0501035_0026873 3300049822 Bacteria 5263
859 Ga0501044_0998968 3300049823 Bacteria 709
860 Ga0501044_1072297 3300049823 Bacteria 676
861 Ga0501044_1379829 3300049823 Bacteria 570
862 Ga0501045_0096174 3300049824 Bacteria 2191
863 Ga0501045_0103098 3300049824 Bacteria 2112
864 Ga0501045_0163446 3300049824 Bacteria 1657
865 Ga0501045_0179419 3300049824 Bacteria 1578
866 Ga0501045_0289912 3300049824 Bacteria 1218
867 Ga0501045_1050561 3300049824 Bacteria 596
868 Ga0501045_1054204 3300049824 Bacteria 595
869 Ga0501212_022700 3300049851 Bacteria 980
870 nmdc:mga0yw44_337332_c1 3300050492 Bacteria 1014
871 nmdc:mga05p37_254741_c1 3300050507 Bacteria 2104
872 nmdc:mga05p37_609611_c1 3300050507 Bacteria 1231
873 nmdc:mga05p37_866448_c2 3300050507 Bacteria 658
874 nmdc:mga09592_1639545_c1 3300050508 Bacteria 520
875 nmdc:mga06r32_84995_c1 3300050510 Bacteria 3085
876 nmdc:mga08y16_1251634_c1 3300050511 Bacteria 711
877 nmdc:mga08y16_65151_c1 3300050511 Bacteria 3804
878 nmdc:mga08y16_772377_c1 3300050511 Bacteria 956
879 nmdc:mga0n895_1943878_c1 3300050512 Bacteria 547
880 nmdc:mga0n895_2029175_c1 3300050512 Bacteria 533
881 nmdc:mga0n895_220821_c1 3300050512 Bacteria 1924
882 nmdc:mga0n895_426803_c1 3300050512 Bacteria 1340
883 nmdc:mga0rr50_1175421_c1 3300050513 Bacteria 652
884 nmdc:mga0rr50_627379_c1 3300050513 Bacteria 917
885 nmdc:mga0rr50_670906_c1 3300050513 Bacteria 885
886 nmdc:mga08x19_1002929_c1 3300050514 Bacteria 593
887 nmdc:mga08x19_157770_c1 3300050514 Bacteria 1540
888 nmdc:mga08x19_480054_c1 3300050514 Bacteria 876
889 nmdc:mga0a205_143170_c1 3300050515 Bacteria 2291
890 nmdc:mga0a205_182722_c1 3300050515 Bacteria 1991
891 nmdc:mga0a205_456320_c1 3300050515 Bacteria 1138
892 nmdc:mga0a205_62566_c1 3300050515 Bacteria 3596
893 Ga0495601_0183820 3300053077 Bacteria 1366
894 Ga0495595_0469754 3300053084 Bacteria 640
895 Ga0495619_0252467 3300053085 Bacteria 1222
896 Ga0501084_0029119 3300054114 Bacteria 4618
897 Ga0501084_0046030 3300054114 Bacteria 3653
898 Ga0501084_0050245 3300054114 Bacteria 3490
899 Ga0501084_0210828 3300054114 Bacteria 1639
900 Ga0501084_0305614 3300054114 Bacteria 1343
901 Ga0501084_1037797 3300054114 Bacteria 689
902 Ga0501084_1046972 3300054114 Bacteria 685
903 Ga0501084_1375258 3300054114 Bacteria 591
904 Ga0501084_1738268 3300054114 Bacteria 521
905 Ga0590071_000248 3300059421 Bacteria 15569
906 Ga0590075_017008 3300059424 Bacteria 1790
907 Ga0590077_003053 3300059426 Bacteria 3505
908 Ga0587070_107059 3300059491 Bacteria 651
909 Ga0587083_0116511 3300059505 Bacteria 685
910 Ga0587085_015084 3300059506 Bacteria 1099
911 Ga0587085_131928 3300059506 Bacteria 559
912 Ga0587088_180709 3300059508 Bacteria 528
913 Ga0587091_179412 3300059511 Bacteria 556
914 Ga0587115_119155 3300059626 Bacteria 506
915 Ga0587068_056768 3300059641 Bacteria 745
916 Ga0587072_114303 3300059643 Bacteria 619
917 Ga0587075_060704 3300059644 Bacteria 681
918 Ga0587076_031031 3300059645 Bacteria 947
919 Ga0587076_072166 3300059645 Bacteria 719
920 Ga0587105_031174 3300059651 Bacteria 509
921 Ga0587107_077363 3300059652 Bacteria 619
922 Ga0587107_095147 3300059652 Bacteria 581
923 Ga0587107_155323 3300059652 Bacteria 500
924 Ga0587111_0140164 3300060346 Bacteria 640
925 Ga0501082_0036718 3300060353 Bacteria 4221
926 Ga0501082_0168911 3300060353 Bacteria 1901
927 Ga0501082_0208907 3300060353 Bacteria 1698
928 Ga0501082_0316052 3300060353 Bacteria 1360
929 Ga0501082_0390122 3300060353 Bacteria 1215
930 Ga0501082_0458266 3300060353 Bacteria 1114
931 Ga0501082_0605213 3300060353 Bacteria 959
932 Ga0501082_0749769 3300060353 Bacteria 854
933 Ga0501082_1786186 3300060353 Bacteria 536
934 Ga0530510_0009759 3300061734 Bacteria 6736
935 Ga0530510_0011210 3300061734 Bacteria 6290
936 Ga0530510_0015703 3300061734 Bacteria 5352
937 Ga0530510_0118231 3300061734 Bacteria 1944
938 Ga0530510_0491830 3300061734 Bacteria 930
939 Ga0530510_1122535 3300061734 Bacteria 602

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059505 Ga0587083_0116511 Ga0587083_0116511_311_520 49
2 3300048909 Ga0496106_1055409 Ga0496106_1055409_147_308 53
3 3300049583 Ga0501067_0358212 Ga0501067_0358212_556_717 53
4 3300009148 Ga0105243_10585040 Ga0105243_105850404 58
5 3300009553 Ga0105249_12829331 Ga0105249_128293312 58
6 3300013297 Ga0157378_11259696 Ga0157378_112596963 58
7 3300048906 Ga0496103_0011651 Ga0496103_0011651_419_595 58
8 3300048909 Ga0496106_0244933 Ga0496106_0244933_253_429 58
9 3300048910 Ga0496107_1266685 Ga0496107_1266685_190_366 58
10 3300004803 Ga0058862_10027267 Ga0058862_100272672 59
11 3300005289 Ga0065704_10372827 Ga0065704_103728273 59
12 3300005336 Ga0070680_100321120 Ga0070680_1003211202 59
13 3300005406 Ga0070703_10186047 Ga0070703_101860472 59
14 3300005444 Ga0070694_100678039 Ga0070694_1006780394 59
15 3300005471 Ga0070698_100920159 Ga0070698_1009201594 59
16 3300005518 Ga0070699_101445732 Ga0070699_1014457322 59
17 3300005530 Ga0070679_101767495 Ga0070679_1017674953 59
18 3300005536 Ga0070697_101123849 Ga0070697_1011238492 59
19 3300005545 Ga0070695_100039268 Ga0070695_1000392684 59
20 3300005546 Ga0070696_100296747 Ga0070696_1002967472 59
21 3300005549 Ga0070704_100202396 Ga0070704_1002023962 59
22 3300014326 Ga0157380_11037451 Ga0157380_110374512 59
23 3300025885 Ga0207653_10063012 Ga0207653_100630123 59
24 3300025910 Ga0207684_10393037 Ga0207684_103930372 59
25 3300025912 Ga0207707_10290941 Ga0207707_102909413 59
26 3300031548 Ga0307408_101944643 Ga0307408_1019446432 59
27 3300032126 Ga0307415_101454292 Ga0307415_1014542922 59
28 3300042435 Ga0439434_0085821 Ga0439434_0085821_597_776 59
29 3300049568 Ga0501031_0197050 Ga0501031_0197050_447_626 59
30 3300049569 Ga0501032_0110492 Ga0501032_0110492_109_288 59
31 3300049570 Ga0501033_0568113 Ga0501033_0568113_72_251 59
32 3300049573 Ga0501037_0463857 Ga0501037_0463857_414_593 59
33 3300049574 Ga0501038_0944003 Ga0501038_0944003_335_514 59
34 3300049575 Ga0501039_1067909 Ga0501039_1067909_86_265 59
35 3300049577 Ga0501041_0411664 Ga0501041_0411664_370_549 59
36 3300049578 Ga0501042_0542931 Ga0501042_0542931_354_533 59
37 3300049580 Ga0501046_0620260 Ga0501046_0620260_340_519 59
38 3300049582 Ga0501048_0069814 Ga0501048_0069814_2166_2345 59
39 3300049585 Ga0501069_0806667 Ga0501069_0806667_157_336 59
40 3300049587 Ga0501071_0448364 Ga0501071_0448364_356_535 59
41 3300049588 Ga0501072_0517392 Ga0501072_0517392_51_230 59
42 3300049589 Ga0501073_0467456 Ga0501073_0467456_505_684 59
43 3300049589 Ga0501073_0521317 Ga0501073_0521317_177_356 59
44 3300049591 Ga0501075_0037524 Ga0501075_0037524_245_424 59
45 3300049592 Ga0501076_1595835 Ga0501076_1595835_176_355 59
46 3300049742 Ga0501080_0401276 Ga0501080_0401276_436_615 59
47 3300049743 Ga0501081_0428909 Ga0501081_0428909_533_712 59
48 3300049823 Ga0501044_1072297 Ga0501044_1072297_107_286 59
49 3300049824 Ga0501045_0096174 Ga0501045_0096174_1548_1727 59
50 3300054114 Ga0501084_1046972 Ga0501084_1046972_221_400 59
51 3300054114 Ga0501084_1375258 Ga0501084_1375258_134_313 59
52 3300060353 Ga0501082_0458266 Ga0501082_0458266_590_769 59
53 3300004798 Ga0058859_10030995 Ga0058859_100309952 60
54 3300005290 Ga0065712_10401795 Ga0065712_104017953 60
55 3300005293 Ga0065715_10635613 Ga0065715_106356133 60
56 3300005330 Ga0070690_100326368 Ga0070690_1003263682 60
57 3300005338 Ga0068868_101244518 Ga0068868_1012445183 60
58 3300005343 Ga0070687_100641959 Ga0070687_1006419592 60
59 3300005367 Ga0070667_100329789 Ga0070667_1003297891 60
60 3300005437 Ga0070710_11343549 Ga0070710_113435492 60
61 3300005440 Ga0070705_100028430 Ga0070705_1000284303 60
62 3300005441 Ga0070700_101261422 Ga0070700_1012614222 60
63 3300005444 Ga0070694_101422324 Ga0070694_1014223242 60
64 3300005445 Ga0070708_100021693 Ga0070708_1000216933 60
65 3300005445 Ga0070708_100173962 Ga0070708_1001739623 60
66 3300005459 Ga0068867_102087865 Ga0068867_1020878652 60
67 3300005466 Ga0070685_10618241 Ga0070685_106182412 60
68 3300005467 Ga0070706_100040516 Ga0070706_1000405168 60
69 3300005467 Ga0070706_100484590 Ga0070706_1004845903 60
70 3300005468 Ga0070707_100098692 Ga0070707_1000986924 60
71 3300005468 Ga0070707_100291996 Ga0070707_1002919963 60
72 3300005471 Ga0070698_100045715 Ga0070698_1000457153 60
73 3300005471 Ga0070698_100084781 Ga0070698_1000847813 60
74 3300005471 Ga0070698_101356538 Ga0070698_1013565382 60
75 3300005518 Ga0070699_100181167 Ga0070699_1001811672 60
76 3300005518 Ga0070699_100855497 Ga0070699_1008554972 60
77 3300005518 Ga0070699_101794379 Ga0070699_1017943792 60
78 3300005518 Ga0070699_102051599 Ga0070699_1020515992 60
79 3300005535 Ga0070684_101589770 Ga0070684_1015897701 60
80 3300005536 Ga0070697_100012567 Ga0070697_1000125673 60
81 3300005536 Ga0070697_100105328 Ga0070697_1001053284 60
82 3300005536 Ga0070697_100184681 Ga0070697_1001846812 60
83 3300005544 Ga0070686_100240245 Ga0070686_1002402451 60
84 3300005545 Ga0070695_100080457 Ga0070695_1000804573 60
85 3300005546 Ga0070696_101650052 Ga0070696_1016500522 60
86 3300005549 Ga0070704_100338901 Ga0070704_1003389013 60
87 3300005549 Ga0070704_100439002 Ga0070704_1004390024 60
88 3300005614 Ga0068856_102722090 Ga0068856_1027220901 60
89 3300005616 Ga0068852_100217744 Ga0068852_1002177444 60
90 3300005718 Ga0068866_11338054 Ga0068866_113380541 60
91 3300005834 Ga0068851_10264226 Ga0068851_102642264 60
92 3300005842 Ga0068858_101514665 Ga0068858_1015146652 60
93 3300006163 Ga0070715_10558793 Ga0070715_105587933 60
94 3300006173 Ga0070716_100263972 Ga0070716_1002639723 60
95 3300006173 Ga0070716_101271664 Ga0070716_1012716642 60
96 3300006173 Ga0070716_101721500 Ga0070716_1017215002 60
97 3300006175 Ga0070712_100981020 Ga0070712_1009810201 60
98 3300006237 Ga0097621_100807415 Ga0097621_1008074152 60
99 3300006358 Ga0068871_100896880 Ga0068871_1008968801 60
100 3300006881 Ga0068865_100226429 Ga0068865_1002264291 60
101 3300009011 Ga0105251_10066999 Ga0105251_100669994 60
102 3300009093 Ga0105240_11173332 Ga0105240_111733322 60
103 3300009098 Ga0105245_10746505 Ga0105245_107465052 60
104 3300009098 Ga0105245_11166052 Ga0105245_111660523 60
105 3300009101 Ga0105247_10861632 Ga0105247_108616323 60
106 3300009101 Ga0105247_11692624 Ga0105247_116926242 60
107 3300009148 Ga0105243_10637014 Ga0105243_106370142 60
108 3300009148 Ga0105243_12518553 Ga0105243_125185533 60
109 3300009176 Ga0105242_10839274 Ga0105242_108392742 60
110 3300009177 Ga0105248_11510176 Ga0105248_115101764 60
111 3300009551 Ga0105238_10825244 Ga0105238_108252442 60
112 3300010375 Ga0105239_12265214 Ga0105239_122652143 60
113 3300010375 Ga0105239_12812473 Ga0105239_128124733 60
114 3300011119 Ga0105246_11456342 Ga0105246_114563423 60
115 3300013296 Ga0157374_10265742 Ga0157374_102657424 60
116 3300013297 Ga0157378_10913110 Ga0157378_109131101 60
117 3300013306 Ga0163162_11255603 Ga0163162_112556033 60
118 3300013306 Ga0163162_12848112 Ga0163162_128481122 60
119 3300013308 Ga0157375_13454274 Ga0157375_134542742 60
120 3300014325 Ga0163163_10526117 Ga0163163_105261174 60
121 3300014968 Ga0157379_11441509 Ga0157379_114415094 60
122 3300014968 Ga0157379_11449126 Ga0157379_114491262 60
123 3300014969 Ga0157376_11024663 Ga0157376_110246632 60
124 3300014969 Ga0157376_11898288 Ga0157376_118982882 60
125 3300025321 Ga0207656_10221892 Ga0207656_102218921 60
126 3300025898 Ga0207692_11071524 Ga0207692_110715242 60
127 3300025903 Ga0207680_10238277 Ga0207680_102382774 60
128 3300025905 Ga0207685_10132869 Ga0207685_101328692 60
129 3300025910 Ga0207684_10023984 Ga0207684_100239844 60
130 3300025913 Ga0207695_10853129 Ga0207695_108531292 60
131 3300025922 Ga0207646_10004216 Ga0207646_100042164 60
132 3300025922 Ga0207646_10430443 Ga0207646_104304432 60
133 3300025927 Ga0207687_10541964 Ga0207687_105419642 60
134 3300025927 Ga0207687_10665427 Ga0207687_106654272 60
135 3300025935 Ga0207709_10969481 Ga0207709_109694813 60
136 3300025939 Ga0207665_10412618 Ga0207665_104126182 60
137 3300025939 Ga0207665_11414374 Ga0207665_114143741 60
138 3300025941 Ga0207711_10408907 Ga0207711_104089072 60
139 3300026023 Ga0207677_11417490 Ga0207677_114174902 60
140 3300026035 Ga0207703_12275174 Ga0207703_122751743 60
141 3300026067 Ga0207678_10276342 Ga0207678_102763422 60
142 3300035083 Ga0373926_0098127 Ga0373926_0098127_119_301 60
143 3300035171 Ga0373946_0507291 Ga0373946_0507291_174_356 60
144 3300035172 Ga0373955_0332584 Ga0373955_0332584_245_427 60
145 3300035724 Ga0373933_0757909 Ga0373933_0757909_333_515 60
146 3300041997 Ga0439431_0178426 Ga0439431_0178426_238_420 60
147 3300046473 Ga0495582_0264675 Ga0495582_0264675_182_364 60
148 3300046473 Ga0495582_0387772 Ga0495582_0387772_423_605 60
149 3300046476 Ga0495662_0258322 Ga0495662_0258322_202_384 60
150 3300046523 Ga0495644_0073999 Ga0495644_0073999_39_221 60
151 3300046538 Ga0495609_0313839 Ga0495609_0313839_273_455 60
152 3300046664 Ga0495659_0221644 Ga0495659_0221644_94_276 60
153 3300046681 Ga0495647_0122158 Ga0495647_0122158_175_357 60
154 3300046683 Ga0495658_0951817 Ga0495658_0951817_65_247 60
155 3300046689 Ga0495613_1013100 Ga0495613_1013100_176_358 60
156 3300046690 Ga0495624_0867277 Ga0495624_0867277_126_308 60
157 3300047321 Ga0495676_0412536 Ga0495676_0412536_412_594 60
158 3300048089 Ga0495614_0426175 Ga0495614_0426175_80_262 60
159 3300048089 Ga0495614_0652200 Ga0495614_0652200_49_231 60
160 3300048904 Ga0496101_0844817 Ga0496101_0844817_324_506 60
161 3300048904 Ga0496101_1414834 Ga0496101_1414834_166_348 60
162 3300048905 Ga0496102_1128921 Ga0496102_1128921_132_314 60
163 3300048906 Ga0496103_0511251 Ga0496103_0511251_411_593 60
164 3300048907 Ga0496104_0022038 Ga0496104_0022038_1451_1633 60
165 3300048907 Ga0496104_0048572 Ga0496104_0048572_701_883 60
166 3300048908 Ga0496105_0202168 Ga0496105_0202168_1029_1211 60
167 3300048908 Ga0496105_0326202 Ga0496105_0326202_824_1006 60
168 3300048909 Ga0496106_0245719 Ga0496106_0245719_474_656 60
169 3300048910 Ga0496107_0692959 Ga0496107_0692959_144_326 60
170 3300048911 Ga0496108_0005881 Ga0496108_0005881_3592_3774 60
171 3300048911 Ga0496108_0133733 Ga0496108_0133733_299_481 60
172 3300048912 Ga0496109_0007365 Ga0496109_0007365_4340_4522 60
173 3300048912 Ga0496109_0416989 Ga0496109_0416989_658_840 60
174 3300048912 Ga0496109_1731753 Ga0496109_1731753_271_453 60
175 3300048913 Ga0496110_0411793 Ga0496110_0411793_688_870 60
176 3300048914 Ga0496111_0158088 Ga0496111_0158088_243_425 60
177 3300048914 Ga0496111_0198587 Ga0496111_0198587_887_1069 60
178 3300048915 Ga0496112_0002921 Ga0496112_0002921_8029_8211 60
179 3300048915 Ga0496112_1342087 Ga0496112_1342087_399_581 60
180 3300048916 Ga0496113_0010238 Ga0496113_0010238_4073_4255 60
181 3300048916 Ga0496113_0697451 Ga0496113_0697451_423_605 60
182 3300048917 Ga0496114_0182212 Ga0496114_0182212_1481_1663 60
183 3300048917 Ga0496114_0997559 Ga0496114_0997559_115_297 60
184 3300049568 Ga0501031_0324091 Ga0501031_0324091_621_803 60
185 3300049572 Ga0501036_0165028 Ga0501036_0165028_1504_1686 60
186 3300053077 Ga0495601_0183820 Ga0495601_0183820_801_983 60
187 3300053084 Ga0495595_0469754 Ga0495595_0469754_385_567 60
188 3300053085 Ga0495619_0252467 Ga0495619_0252467_554_736 60
189 3300059421 Ga0590071_000248 Ga0590071_000248_14999_15181 60
190 3300059424 Ga0590075_017008 Ga0590075_017008_1224_1406 60
191 3300059426 Ga0590077_003053 Ga0590077_003053_371_553 60
192 3300059491 Ga0587070_107059 Ga0587070_107059_90_272 60
193 3300059508 Ga0587088_180709 Ga0587088_180709_108_290 60
194 3300059511 Ga0587091_179412 Ga0587091_179412_285_467 60
195 3300059644 Ga0587075_060704 Ga0587075_060704_156_338 60
196 3300059645 Ga0587076_072166 Ga0587076_072166_124_306 60
197 3300003203 JGI25406J46586_10009666 JGI25406J46586_100096666 61
198 3300004801 Ga0058860_10027684 Ga0058860_100276844 61
199 3300005337 Ga0070682_100805663 Ga0070682_1008056632 61
200 3300005338 Ga0068868_100349188 Ga0068868_1003491883 61
201 3300005340 Ga0070689_100917548 Ga0070689_1009175481 61
202 3300005353 Ga0070669_101916647 Ga0070669_1019166472 61
203 3300005354 Ga0070675_101344378 Ga0070675_1013443781 61
204 3300005438 Ga0070701_10054367 Ga0070701_100543673 61
205 3300005440 Ga0070705_100280402 Ga0070705_1002804022 61
206 3300005441 Ga0070700_100883108 Ga0070700_1008831081 61
207 3300005444 Ga0070694_100794457 Ga0070694_1007944572 61
208 3300005455 Ga0070663_100504094 Ga0070663_1005040942 61
209 3300005456 Ga0070678_102065119 Ga0070678_1020651192 61
210 3300005468 Ga0070707_101628786 Ga0070707_1016287861 61
211 3300005468 Ga0070707_102323121 Ga0070707_1023231212 61
212 3300005471 Ga0070698_100926067 Ga0070698_1009260673 61
213 3300005518 Ga0070699_101092972 Ga0070699_1010929723 61
214 3300005536 Ga0070697_100723975 Ga0070697_1007239753 61
215 3300005544 Ga0070686_101666956 Ga0070686_1016669562 61
216 3300005545 Ga0070695_101218731 Ga0070695_1012187312 61
217 3300005546 Ga0070696_100275622 Ga0070696_1002756224 61
218 3300005547 Ga0070693_101400411 Ga0070693_1014004112 61
219 3300005549 Ga0070704_101833780 Ga0070704_1018337802 61
220 3300005563 Ga0068855_101000371 Ga0068855_1010003714 61
221 3300005578 Ga0068854_101708474 Ga0068854_1017084742 61
222 3300005615 Ga0070702_101783717 Ga0070702_1017837172 61
223 3300005617 Ga0068859_101456537 Ga0068859_1014565374 61
224 3300005718 Ga0068866_10279534 Ga0068866_102795341 61
225 3300005719 Ga0068861_100724626 Ga0068861_1007246262 61
226 3300005719 Ga0068861_101021100 Ga0068861_1010211002 61
227 3300005840 Ga0068870_10735801 Ga0068870_107358011 61
228 3300005844 Ga0068862_101281327 Ga0068862_1012813272 61
229 3300005985 Ga0081539_10002087 Ga0081539_1000208719 61
230 3300006852 Ga0075433_10944981 Ga0075433_109449813 61
231 3300006931 Ga0097620_101456521 Ga0097620_1014565214 61
232 3300007076 Ga0075435_100522835 Ga0075435_1005228352 61
233 3300009094 Ga0111539_11331570 Ga0111539_113315703 61
234 3300009148 Ga0105243_12597863 Ga0105243_125978632 61
235 3300009553 Ga0105249_10492138 Ga0105249_104921382 61
236 3300009553 Ga0105249_11885749 Ga0105249_118857493 61
237 3300010375 Ga0105239_12166299 Ga0105239_121662992 61
238 3300011119 Ga0105246_10968939 Ga0105246_109689392 61
239 3300014326 Ga0157380_11040742 Ga0157380_110407424 61
240 3300014745 Ga0157377_10483225 Ga0157377_104832254 61
241 3300025885 Ga0207653_10158204 Ga0207653_101582042 61
242 3300025922 Ga0207646_11308692 Ga0207646_113086923 61
243 3300025933 Ga0207706_11053782 Ga0207706_110537823 61
244 3300025936 Ga0207670_10754289 Ga0207670_107542893 61
245 3300025949 Ga0207667_10791170 Ga0207667_107911702 61
246 3300025981 Ga0207640_11872801 Ga0207640_118728012 61
247 3300026023 Ga0207677_10728964 Ga0207677_107289642 61
248 3300026075 Ga0207708_10524672 Ga0207708_105246724 61
249 3300027252 Ga0209973_1020358 Ga0209973_10203584 61
250 3300027552 Ga0209982_1006777 Ga0209982_10067772 61
251 3300027617 Ga0210002_1049075 Ga0210002_10490753 61
252 3300027665 Ga0209983_1020600 Ga0209983_10206002 61
253 3300027682 Ga0209971_1019669 Ga0209971_10196693 61
254 3300027876 Ga0209974_10016162 Ga0209974_100161624 61
255 3300027876 Ga0209974_10429919 Ga0209974_104299192 61
256 3300031824 Ga0307413_10078953 Ga0307413_100789532 61
257 3300031852 Ga0307410_11539614 Ga0307410_115396143 61
258 3300031995 Ga0307409_100318090 Ga0307409_1003180902 61
259 3300032002 Ga0307416_101333408 Ga0307416_1013334082 61
260 3300032004 Ga0307414_10952636 Ga0307414_109526362 61
261 3300038443 Ga0395901_0312615 Ga0395901_0312615_1043_1228 61
262 3300042530 Ga0450916_073568 Ga0450916_073568_351_536 61
263 3300046525 Ga0495663_0086016 Ga0495663_0086016_427_612 61
264 3300046615 Ga0495656_0779253 Ga0495656_0779253_19_204 61
265 3300046648 Ga0495611_0230567 Ga0495611_0230567_476_661 61
266 3300049568 Ga0501031_0012970 Ga0501031_0012970_5164_5349 61
267 3300049569 Ga0501032_0183002 Ga0501032_0183002_270_455 61
268 3300049570 Ga0501033_0616993 Ga0501033_0616993_203_388 61
269 3300049571 Ga0501034_0276328 Ga0501034_0276328_412_597 61
270 3300049572 Ga0501036_0013129 Ga0501036_0013129_801_986 61
271 3300049573 Ga0501037_0076034 Ga0501037_0076034_1070_1255 61
272 3300049574 Ga0501038_0059905 Ga0501038_0059905_128_313 61
273 3300049575 Ga0501039_0069732 Ga0501039_0069732_2078_2263 61
274 3300049576 Ga0501040_0011743 Ga0501040_0011743_5044_5229 61
275 3300049577 Ga0501041_0020309 Ga0501041_0020309_410_595 61
276 3300049578 Ga0501042_0074548 Ga0501042_0074548_2129_2314 61
277 3300049580 Ga0501046_0288148 Ga0501046_0288148_538_723 61
278 3300049582 Ga0501048_0012332 Ga0501048_0012332_3383_3568 61
279 3300049584 Ga0501068_0013746 Ga0501068_0013746_1014_1199 61
280 3300049585 Ga0501069_0022378 Ga0501069_0022378_2891_3076 61
281 3300049586 Ga0501070_0100767 Ga0501070_0100767_2091_2276 61
282 3300049587 Ga0501071_0016406 Ga0501071_0016406_199_384 61
283 3300049588 Ga0501072_0365326 Ga0501072_0365326_248_433 61
284 3300049589 Ga0501073_0078522 Ga0501073_0078522_2068_2253 61
285 3300049590 Ga0501074_0074160 Ga0501074_0074160_1932_2117 61
286 3300049591 Ga0501075_0715528 Ga0501075_0715528_110_295 61
287 3300049592 Ga0501076_0107435 Ga0501076_0107435_827_1012 61
288 3300049593 Ga0501077_0058278 Ga0501077_0058278_1799_1984 61
289 3300049741 Ga0501079_0050830 Ga0501079_0050830_495_680 61
290 3300049742 Ga0501080_0090497 Ga0501080_0090497_1174_1359 61
291 3300049743 Ga0501081_0026245 Ga0501081_0026245_3486_3671 61
292 3300049744 Ga0501083_0026775 Ga0501083_0026775_3597_3782 61
293 3300049822 Ga0501035_0026873 Ga0501035_0026873_4965_5150 61
294 3300049823 Ga0501044_1379829 Ga0501044_1379829_44_229 61
295 3300049824 Ga0501045_0103098 Ga0501045_0103098_500_685 61
296 3300050511 nmdc:mga08y16_1251634_c1 nmdc:mga08y16_1251634_c1_155_340 61
297 3300054114 Ga0501084_0029119 Ga0501084_0029119_3151_3336 61
298 3300060353 Ga0501082_0208907 Ga0501082_0208907_188_373 61
299 3300061734 Ga0530510_0009759 Ga0530510_0009759_449_634 61
300 3300005336 Ga0070680_100682548 Ga0070680_1006825482 62
301 3300005356 Ga0070674_100103993 Ga0070674_1001039934 62
302 3300005356 Ga0070674_101320877 Ga0070674_1013208772 62
303 3300005365 Ga0070688_100480838 Ga0070688_1004808381 62
304 3300005436 Ga0070713_101648358 Ga0070713_1016483582 62
305 3300005441 Ga0070700_100773600 Ga0070700_1007736004 62
306 3300005445 Ga0070708_100342283 Ga0070708_1003422834 62
307 3300005458 Ga0070681_10283178 Ga0070681_102831782 62
308 3300005466 Ga0070685_10336638 Ga0070685_103366384 62
309 3300005467 Ga0070706_101628946 Ga0070706_1016289461 62
310 3300005471 Ga0070698_101065374 Ga0070698_1010653741 62
311 3300005536 Ga0070697_101653937 Ga0070697_1016539373 62
312 3300005544 Ga0070686_101609910 Ga0070686_1016099102 62
313 3300005546 Ga0070696_100367818 Ga0070696_1003678184 62
314 3300005547 Ga0070693_100992972 Ga0070693_1009929722 62
315 3300005719 Ga0068861_100043615 Ga0068861_1000436154 62
316 3300006881 Ga0068865_100575930 Ga0068865_1005759304 62
317 3300006881 Ga0068865_101826023 Ga0068865_1018260231 62
318 3300009098 Ga0105245_13253944 Ga0105245_132539442 62
319 3300009148 Ga0105243_10781936 Ga0105243_107819362 62
320 3300009176 Ga0105242_10297351 Ga0105242_102973513 62
321 3300009545 Ga0105237_10966472 Ga0105237_109664722 62
322 3300009553 Ga0105249_12278481 Ga0105249_122784812 62
323 3300013296 Ga0157374_10728428 Ga0157374_107284283 62
324 3300014325 Ga0163163_13043396 Ga0163163_130433962 62
325 3300014326 Ga0157380_11514832 Ga0157380_115148322 62
326 3300017792 Ga0163161_10735802 Ga0163161_107358022 62
327 3300025912 Ga0207707_10224487 Ga0207707_102244872 62
328 3300025926 Ga0207659_10608607 Ga0207659_106086073 62
329 3300025934 Ga0207686_10657768 Ga0207686_106577682 62
330 3300025937 Ga0207669_10022441 Ga0207669_100224413 62
331 3300025937 Ga0207669_10850612 Ga0207669_108506122 62
332 3300025938 Ga0207704_10153708 Ga0207704_101537082 62
333 3300026075 Ga0207708_11777193 Ga0207708_117771932 62
334 3300026118 Ga0207675_100822742 Ga0207675_1008227422 62
335 3300027424 Ga0209984_1038469 Ga0209984_10384691 62
336 3300027665 Ga0209983_1044215 Ga0209983_10442153 62
337 3300027665 Ga0209983_1050545 Ga0209983_10505452 62
338 3300027682 Ga0209971_1179172 Ga0209971_11791722 62
339 3300027695 Ga0209966_1091951 Ga0209966_10919512 62
340 3300027876 Ga0209974_10090696 Ga0209974_100906963 62
341 3300027876 Ga0209974_10424313 Ga0209974_104243132 62
342 3300031995 Ga0307409_100852074 Ga0307409_1008520742 62
343 3300035691 Ga0373931_1020186 Ga0373931_1020186_210_398 62
344 3300041486 Ga0451807_0415819 Ga0451807_0415819_19_207 62
345 3300042118 Ga0450914_034842 Ga0450914_034842_151_339 62
346 3300042125 Ga0450923_015004 Ga0450923_015004_381_569 62
347 3300042145 Ga0450906_013042 Ga0450906_013042_1276_1464 62
348 3300042147 Ga0450910_068298 Ga0450910_068298_83_271 62
349 3300042184 Ga0450908_044198 Ga0450908_044198_534_722 62
350 3300046694 Ga0495649_0236389 Ga0495649_0236389_234_422 62
351 3300048903 Ga0496100_0891638 Ga0496100_0891638_71_259 62
352 3300048904 Ga0496101_0777076 Ga0496101_0777076_396_584 62
353 3300048907 Ga0496104_0173708 Ga0496104_0173708_1626_1814 62
354 3300048912 Ga0496109_0069348 Ga0496109_0069348_441_629 62
355 3300048913 Ga0496110_1577385 Ga0496110_1577385_291_482 62
356 3300048914 Ga0496111_0070108 Ga0496111_0070108_984_1172 62
357 3300048917 Ga0496114_0165095 Ga0496114_0165095_1209_1397 62
358 3300048917 Ga0496114_0689443 Ga0496114_0689443_371_559 62
359 3300049521 Ga0501298_138082 Ga0501298_138082_305_493 62
360 3300049572 Ga0501036_0462525 Ga0501036_0462525_52_240 62
361 3300049574 Ga0501038_0824239 Ga0501038_0824239_158_346 62
362 3300049575 Ga0501039_0511992 Ga0501039_0511992_610_798 62
363 3300049575 Ga0501039_0788581 Ga0501039_0788581_514_702 62
364 3300049576 Ga0501040_0387918 Ga0501040_0387918_320_508 62
365 3300049577 Ga0501041_0049911 Ga0501041_0049911_817_1005 62
366 3300049577 Ga0501041_0671731 Ga0501041_0671731_23_211 62
367 3300049578 Ga0501042_1443820 Ga0501042_1443820_84_272 62
368 3300049579 Ga0501043_0831378 Ga0501043_0831378_192_380 62
369 3300049580 Ga0501046_0586255 Ga0501046_0586255_37_225 62
370 3300049582 Ga0501048_0173849 Ga0501048_0173849_931_1119 62
371 3300049584 Ga0501068_0861721 Ga0501068_0861721_126_314 62
372 3300049587 Ga0501071_0855269 Ga0501071_0855269_392_580 62
373 3300049588 Ga0501072_0298988 Ga0501072_0298988_414_602 62
374 3300049588 Ga0501072_0897159 Ga0501072_0897159_290_478 62
375 3300049590 Ga0501074_1001522 Ga0501074_1001522_178_366 62
376 3300049592 Ga0501076_0069984 Ga0501076_0069984_2439_2627 62
377 3300049592 Ga0501076_0136338 Ga0501076_0136338_510_698 62
378 3300049705 Ga0501225_0218887 Ga0501225_0218887_195_383 62
379 3300049741 Ga0501079_0033531 Ga0501079_0033531_3031_3219 62
380 3300049743 Ga0501081_0025332 Ga0501081_0025332_3074_3262 62
381 3300049824 Ga0501045_0179419 Ga0501045_0179419_949_1137 62
382 3300049824 Ga0501045_1054204 Ga0501045_1054204_197_385 62
383 3300054114 Ga0501084_0050245 Ga0501084_0050245_211_399 62
384 3300054114 Ga0501084_0210828 Ga0501084_0210828_348_536 62
385 3300054114 Ga0501084_1738268 Ga0501084_1738268_100_288 62
386 3300059626 Ga0587115_119155 Ga0587115_119155_200_388 62
387 3300060353 Ga0501082_0168911 Ga0501082_0168911_140_328 62
388 3300060353 Ga0501082_0749769 Ga0501082_0749769_397_585 62
389 3300060353 Ga0501082_1786186 Ga0501082_1786186_119_307 62
390 3300061734 Ga0530510_0015703 Ga0530510_0015703_3882_4070 62
391 3300061734 Ga0530510_0118231 Ga0530510_0118231_1739_1927 62
392 3300061734 Ga0530510_0491830 Ga0530510_0491830_88_276 62
393 3300002459 JGI24751J29686_10013331 JGI24751J29686_100133313 63
394 3300005295 Ga0065707_10879597 Ga0065707_108795972 63
395 3300005329 Ga0070683_100507299 Ga0070683_1005072992 63
396 3300005330 Ga0070690_100162217 Ga0070690_1001622174 63
397 3300005334 Ga0068869_100840343 Ga0068869_1008403432 63
398 3300005335 Ga0070666_10599745 Ga0070666_105997454 63
399 3300005336 Ga0070680_101458830 Ga0070680_1014588302 63
400 3300005338 Ga0068868_100325958 Ga0068868_1003259584 63
401 3300005340 Ga0070689_100304847 Ga0070689_1003048472 63
402 3300005341 Ga0070691_10350481 Ga0070691_103504812 63
403 3300005344 Ga0070661_100569102 Ga0070661_1005691024 63
404 3300005354 Ga0070675_100894687 Ga0070675_1008946872 63
405 3300005367 Ga0070667_100075769 Ga0070667_1000757697 63
406 3300005438 Ga0070701_10489370 Ga0070701_104893702 63
407 3300005439 Ga0070711_100677549 Ga0070711_1006775493 63
408 3300005440 Ga0070705_101054690 Ga0070705_1010546903 63
409 3300005441 Ga0070700_101992676 Ga0070700_1019926762 63
410 3300005444 Ga0070694_100607329 Ga0070694_1006073292 63
411 3300005445 Ga0070708_101091673 Ga0070708_1010916732 63
412 3300005456 Ga0070678_100159402 Ga0070678_1001594022 63
413 3300005471 Ga0070698_100993079 Ga0070698_1009930792 63
414 3300005518 Ga0070699_100077369 Ga0070699_1000773693 63
415 3300005518 Ga0070699_100773320 Ga0070699_1007733202 63
416 3300005518 Ga0070699_100875053 Ga0070699_1008750532 63
417 3300005530 Ga0070679_100562028 Ga0070679_1005620282 63
418 3300005535 Ga0070684_100182697 Ga0070684_1001826973 63
419 3300005535 Ga0070684_100320665 Ga0070684_1003206654 63
420 3300005544 Ga0070686_100521042 Ga0070686_1005210424 63
421 3300005544 Ga0070686_100829016 Ga0070686_1008290162 63
422 3300005546 Ga0070696_100752543 Ga0070696_1007525434 63
423 3300005546 Ga0070696_100811911 Ga0070696_1008119114 63
424 3300005546 Ga0070696_101222000 Ga0070696_1012220001 63
425 3300005549 Ga0070704_101979963 Ga0070704_1019799632 63
426 3300005577 Ga0068857_100137897 Ga0068857_1001378972 63
427 3300005577 Ga0068857_100298521 Ga0068857_1002985211 63
428 3300005578 Ga0068854_101956811 Ga0068854_1019568111 63
429 3300005614 Ga0068856_100307662 Ga0068856_1003076624 63
430 3300005615 Ga0070702_100086340 Ga0070702_1000863404 63
431 3300005842 Ga0068858_101075074 Ga0068858_1010750741 63
432 3300006237 Ga0097621_100361892 Ga0097621_1003618924 63
433 3300006237 Ga0097621_102328181 Ga0097621_1023281812 63
434 3300006358 Ga0068871_100103647 Ga0068871_1001036475 63
435 3300007788 Ga0099795_10303707 Ga0099795_103037072 63
436 3300009036 Ga0105244_10186311 Ga0105244_101863113 63
437 3300009101 Ga0105247_11201884 Ga0105247_112018842 63
438 3300009148 Ga0105243_11139061 Ga0105243_111390612 63
439 3300009174 Ga0105241_12571318 Ga0105241_125713181 63
440 3300009176 Ga0105242_10463114 Ga0105242_104631144 63
441 3300009177 Ga0105248_11178129 Ga0105248_111781292 63
442 3300009177 Ga0105248_13313266 Ga0105248_133132662 63
443 3300009551 Ga0105238_10328716 Ga0105238_103287162 63
444 3300009553 Ga0105249_11308605 Ga0105249_113086052 63
445 3300011119 Ga0105246_12110491 Ga0105246_121104912 63
446 3300013104 Ga0157370_11061661 Ga0157370_110616612 63
447 3300013297 Ga0157378_11553276 Ga0157378_115532763 63
448 3300013308 Ga0157375_11151575 Ga0157375_111515754 63
449 3300014325 Ga0163163_10259786 Ga0163163_102597862 63
450 3300014325 Ga0163163_11444496 Ga0163163_114444963 63
451 3300014325 Ga0163163_11756174 Ga0163163_117561742 63
452 3300014325 Ga0163163_11812411 Ga0163163_118124112 63
453 3300014745 Ga0157377_10417560 Ga0157377_104175604 63
454 3300014969 Ga0157376_10148277 Ga0157376_101482772 63
455 3300020070 Ga0206356_10505645 Ga0206356_105056453 63
456 3300020078 Ga0206352_11256669 Ga0206352_112566693 63
457 3300025735 Ga0207713_1061982 Ga0207713_10619822 63
458 3300025901 Ga0207688_10794965 Ga0207688_107949652 63
459 3300025915 Ga0207693_10691971 Ga0207693_106919711 63
460 3300025920 Ga0207649_10417978 Ga0207649_104179784 63
461 3300025931 Ga0207644_10855190 Ga0207644_108551902 63
462 3300025934 Ga0207686_10341698 Ga0207686_103416984 63
463 3300025935 Ga0207709_10080062 Ga0207709_100800622 63
464 3300025936 Ga0207670_11314009 Ga0207670_113140092 63
465 3300025944 Ga0207661_10212042 Ga0207661_102120424 63
466 3300025961 Ga0207712_11290679 Ga0207712_112906792 63
467 3300025986 Ga0207658_10302443 Ga0207658_103024434 63
468 3300026078 Ga0207702_11057120 Ga0207702_110571204 63
469 3300026116 Ga0207674_10096522 Ga0207674_100965223 63
470 3300026121 Ga0207683_10114781 Ga0207683_101147812 63
471 3300027526 Ga0209968_1005468 Ga0209968_10054684 63
472 3300031548 Ga0307408_100041695 Ga0307408_1000416958 63
473 3300031731 Ga0307405_10476490 Ga0307405_104764902 63
474 3300031824 Ga0307413_11278474 Ga0307413_112784742 63
475 3300031901 Ga0307406_11402688 Ga0307406_114026882 63
476 3300031903 Ga0307407_10154985 Ga0307407_101549853 63
477 3300031911 Ga0307412_10158459 Ga0307412_101584594 63
478 3300031995 Ga0307409_100044842 Ga0307409_1000448427 63
479 3300032002 Ga0307416_100307797 Ga0307416_1003077972 63
480 3300032002 Ga0307416_102548829 Ga0307416_1025488293 63
481 3300032004 Ga0307414_10782384 Ga0307414_107823842 63
482 3300032126 Ga0307415_100063143 Ga0307415_1000631434 63
483 3300034817 Ga0373948_0167434 Ga0373948_0167434_106_297 63
484 3300034818 Ga0373950_0120545 Ga0373950_0120545_309_500 63
485 3300035085 Ga0373929_0147805 Ga0373929_0147805_195_386 63
486 3300035242 Ga0373962_0072589 Ga0373962_0072589_21_212 63
487 3300041411 Ga0439466_0041798 Ga0439466_0041798_351_542 63
488 3300042122 Ga0450920_131719 Ga0450920_131719_267_458 63
489 3300042128 Ga0450897_034538 Ga0450897_034538_275_466 63
490 3300042147 Ga0450910_060232 Ga0450910_060232_156_347 63
491 3300042185 Ga0450909_021128 Ga0450909_021128_82_273 63
492 3300042435 Ga0439434_0088566 Ga0439434_0088566_431_622 63
493 3300042876 Ga0451577_0060452 Ga0451577_0060452_58_249 63
494 3300042876 Ga0451577_1377332 Ga0451577_1377332_49_240 63
495 3300044673 Ga0453683_0018052 Ga0453683_0018052_1262_1453 63
496 3300044712 Ga0453684_0794841 Ga0453684_0794841_382_573 63
497 3300044712 Ga0453684_1421790 Ga0453684_1421790_138_329 63
498 3300045051 Ga0451576_0040408 Ga0451576_0040408_1100_1291 63
499 3300045976 Ga0466967_1874688 Ga0466967_1874688_202_393 63
500 3300046455 Ga0495603_0220251 Ga0495603_0220251_543_734 63
501 3300048904 Ga0496101_0945591 Ga0496101_0945591_46_237 63
502 3300048905 Ga0496102_0221210 Ga0496102_0221210_1481_1672 63
503 3300048905 Ga0496102_0406039 Ga0496102_0406039_100_291 63
504 3300048906 Ga0496103_0772581 Ga0496103_0772581_233_424 63
505 3300048907 Ga0496104_0257888 Ga0496104_0257888_1100_1291 63
506 3300048908 Ga0496105_0079537 Ga0496105_0079537_2048_2239 63
507 3300048910 Ga0496107_1270194 Ga0496107_1270194_222_413 63
508 3300048911 Ga0496108_0021720 Ga0496108_0021720_413_604 63
509 3300048912 Ga0496109_0122176 Ga0496109_0122176_1099_1290 63
510 3300048913 Ga0496110_0032222 Ga0496110_0032222_3937_4128 63
511 3300048914 Ga0496111_0031782 Ga0496111_0031782_203_394 63
512 3300048915 Ga0496112_0367774 Ga0496112_0367774_469_660 63
513 3300048915 Ga0496112_0962457 Ga0496112_0962457_168_359 63
514 3300048916 Ga0496113_0233291 Ga0496113_0233291_314_505 63
515 3300049515 Ga0501292_030302 Ga0501292_030302_639_830 63
516 3300049520 Ga0501297_013444 Ga0501297_013444_246_437 63
517 3300049527 Ga0501311_043854 Ga0501311_043854_258_449 63
518 3300049532 Ga0501316_050421 Ga0501316_050421_228_419 63
519 3300049541 Ga0501325_016689 Ga0501325_016689_379_570 63
520 3300049572 Ga0501036_0550955 Ga0501036_0550955_579_770 63
521 3300049573 Ga0501037_0685506 Ga0501037_0685506_48_239 63
522 3300049576 Ga0501040_0141185 Ga0501040_0141185_508_699 63
523 3300049576 Ga0501040_0813457 Ga0501040_0813457_335_526 63
524 3300049577 Ga0501041_1050999 Ga0501041_1050999_219_410 63
525 3300049578 Ga0501042_0522630 Ga0501042_0522630_468_659 63
526 3300049579 Ga0501043_1091685 Ga0501043_1091685_153_344 63
527 3300049580 Ga0501046_0446722 Ga0501046_0446722_607_798 63
528 3300049582 Ga0501048_0564750 Ga0501048_0564750_208_399 63
529 3300049584 Ga0501068_0515690 Ga0501068_0515690_437_628 63
530 3300049587 Ga0501071_1366397 Ga0501071_1366397_255_446 63
531 3300049588 Ga0501072_0899607 Ga0501072_0899607_42_233 63
532 3300049588 Ga0501072_1049087 Ga0501072_1049087_325_516 63
533 3300049588 Ga0501072_1149706 Ga0501072_1149706_186_377 63
534 3300049591 Ga0501075_0097340 Ga0501075_0097340_1114_1305 63
535 3300049591 Ga0501075_1304411 Ga0501075_1304411_213_404 63
536 3300049591 Ga0501075_1551587 Ga0501075_1551587_263_454 63
537 3300049592 Ga0501076_0610213 Ga0501076_0610213_652_843 63
538 3300049593 Ga0501077_0792412 Ga0501077_0792412_216_407 63
539 3300049650 Ga0501199_048697 Ga0501199_048697_19_210 63
540 3300049652 Ga0501202_064865 Ga0501202_064865_285_476 63
541 3300049655 Ga0501208_112977 Ga0501208_112977_384_575 63
542 3300049656 Ga0501209_056512 Ga0501209_056512_351_542 63
543 3300049658 Ga0501211_022121 Ga0501211_022121_215_406 63
544 3300049659 Ga0501214_073368 Ga0501214_073368_357_548 63
545 3300049666 Ga0501228_037647 Ga0501228_037647_315_506 63
546 3300049668 Ga0501233_147379 Ga0501233_147379_276_467 63
547 3300049669 Ga0501235_052929 Ga0501235_052929_599_790 63
548 3300049672 Ga0501239_048475 Ga0501239_048475_77_268 63
549 3300049675 Ga0501243_016601 Ga0501243_016601_357_548 63
550 3300049681 Ga0501251_057662 Ga0501251_057662_409_600 63
551 3300049690 Ga0501261_037271 Ga0501261_037271_320_511 63
552 3300049742 Ga0501080_0248500 Ga0501080_0248500_55_246 63
553 3300049744 Ga0501083_0686370 Ga0501083_0686370_156_347 63
554 3300049762 Ga0501265_036451 Ga0501265_036451_22_213 63
555 3300049768 Ga0501271_035068 Ga0501271_035068_297_488 63
556 3300049772 Ga0501275_034329 Ga0501275_034329_219_410 63
557 3300049776 Ga0501280_112236 Ga0501280_112236_22_213 63
558 3300049779 Ga0501283_096921 Ga0501283_096921_18_209 63
559 3300049824 Ga0501045_0289912 Ga0501045_0289912_837_1028 63
560 3300049851 Ga0501212_022700 Ga0501212_022700_591_782 63
561 3300054114 Ga0501084_0305614 Ga0501084_0305614_885_1076 63
562 3300054114 Ga0501084_1037797 Ga0501084_1037797_39_230 63
563 3300059506 Ga0587085_015084 Ga0587085_015084_48_239 63
564 3300059506 Ga0587085_131928 Ga0587085_131928_279_470 63
565 3300059641 Ga0587068_056768 Ga0587068_056768_141_332 63
566 3300059645 Ga0587076_031031 Ga0587076_031031_327_518 63
567 3300059651 Ga0587105_031174 Ga0587105_031174_44_235 63
568 3300059652 Ga0587107_095147 Ga0587107_095147_320_511 63
569 3300059652 Ga0587107_155323 Ga0587107_155323_40_231 63
570 3300060346 Ga0587111_0140164 Ga0587111_0140164_254_445 63
571 3300060353 Ga0501082_0036718 Ga0501082_0036718_684_875 63
572 3300060353 Ga0501082_0390122 Ga0501082_0390122_109_300 63
573 3300061734 Ga0530510_0011210 Ga0530510_0011210_2806_2997 63
574 3300001976 JGI24752J21851_1060694 JGI24752J21851_10606942 64
575 3300001978 JGI24747J21853_1033409 JGI24747J21853_10334091 64
576 3300001991 JGI24743J22301_10055653 JGI24743J22301_100556532 64
577 3300002075 JGI24738J21930_10125194 JGI24738J21930_101251941 64
578 3300002076 JGI24749J21850_1056825 JGI24749J21850_10568252 64
579 3300002077 JGI24744J21845_10077481 JGI24744J21845_100774812 64
580 3300002155 JGI24033J26618_1036890 JGI24033J26618_10368902 64
581 3300002239 JGI24034J26672_10052766 JGI24034J26672_100527661 64
582 3300002459 JGI24751J29686_10008660 JGI24751J29686_100086604 64
583 3300004798 Ga0058859_11829737 Ga0058859_118297374 64
584 3300004800 Ga0058861_12053711 Ga0058861_120537111 64
585 3300004801 Ga0058860_10072498 Ga0058860_100724986 64
586 3300005290 Ga0065712_10470215 Ga0065712_104702153 64
587 3300005328 Ga0070676_10934862 Ga0070676_109348621 64
588 3300005329 Ga0070683_100736430 Ga0070683_1007364302 64
589 3300005329 Ga0070683_101674936 Ga0070683_1016749361 64
590 3300005330 Ga0070690_100518175 Ga0070690_1005181752 64
591 3300005330 Ga0070690_100838012 Ga0070690_1008380124 64
592 3300005331 Ga0070670_100669920 Ga0070670_1006699202 64
593 3300005331 Ga0070670_100741920 Ga0070670_1007419202 64
594 3300005331 Ga0070670_101323924 Ga0070670_1013239242 64
595 3300005334 Ga0068869_101146566 Ga0068869_1011465661 64
596 3300005334 Ga0068869_101365169 Ga0068869_1013651693 64
597 3300005335 Ga0070666_10084589 Ga0070666_100845893 64
598 3300005335 Ga0070666_10262112 Ga0070666_102621123 64
599 3300005335 Ga0070666_11458733 Ga0070666_114587333 64
600 3300005336 Ga0070680_100020531 Ga0070680_1000205314 64
601 3300005336 Ga0070680_100576128 Ga0070680_1005761284 64
602 3300005336 Ga0070680_100580712 Ga0070680_1005807124 64
603 3300005337 Ga0070682_100641078 Ga0070682_1006410782 64
604 3300005338 Ga0068868_101630724 Ga0068868_1016307242 64
605 3300005338 Ga0068868_102089699 Ga0068868_1020896992 64
606 3300005340 Ga0070689_100493916 Ga0070689_1004939162 64
607 3300005340 Ga0070689_100541992 Ga0070689_1005419922 64
608 3300005341 Ga0070691_10273603 Ga0070691_102736033 64
609 3300005341 Ga0070691_10299909 Ga0070691_102999092 64
610 3300005341 Ga0070691_10407414 Ga0070691_104074143 64
611 3300005343 Ga0070687_100221259 Ga0070687_1002212594 64
612 3300005343 Ga0070687_100394638 Ga0070687_1003946383 64
613 3300005345 Ga0070692_10232284 Ga0070692_102322842 64
614 3300005345 Ga0070692_10459666 Ga0070692_104596662 64
615 3300005345 Ga0070692_10943177 Ga0070692_109431773 64
616 3300005347 Ga0070668_100302628 Ga0070668_1003026283 64
617 3300005353 Ga0070669_101174249 Ga0070669_1011742494 64
618 3300005353 Ga0070669_101924034 Ga0070669_1019240341 64
619 3300005354 Ga0070675_100471991 Ga0070675_1004719913 64
620 3300005354 Ga0070675_101519746 Ga0070675_1015197462 64
621 3300005355 Ga0070671_100071958 Ga0070671_1000719588 64
622 3300005356 Ga0070674_100628650 Ga0070674_1006286503 64
623 3300005364 Ga0070673_100076409 Ga0070673_1000764094 64
624 3300005364 Ga0070673_100839966 Ga0070673_1008399662 64
625 3300005365 Ga0070688_100362033 Ga0070688_1003620332 64
626 3300005366 Ga0070659_100642432 Ga0070659_1006424322 64
627 3300005366 Ga0070659_100729270 Ga0070659_1007292702 64
628 3300005367 Ga0070667_100259161 Ga0070667_1002591613 64
629 3300005367 Ga0070667_100556519 Ga0070667_1005565194 64
630 3300005438 Ga0070701_10024455 Ga0070701_100244553 64
631 3300005440 Ga0070705_101740219 Ga0070705_1017402192 64
632 3300005441 Ga0070700_100036116 Ga0070700_1000361165 64
633 3300005441 Ga0070700_100732067 Ga0070700_1007320671 64
634 3300005441 Ga0070700_100796730 Ga0070700_1007967301 64
635 3300005444 Ga0070694_101080886 Ga0070694_1010808862 64
636 3300005445 Ga0070708_100083016 Ga0070708_1000830164 64
637 3300005445 Ga0070708_100941451 Ga0070708_1009414514 64
638 3300005445 Ga0070708_101173597 Ga0070708_1011735972 64
639 3300005455 Ga0070663_100004558 Ga0070663_1000045588 64
640 3300005455 Ga0070663_100995753 Ga0070663_1009957534 64
641 3300005456 Ga0070678_100765070 Ga0070678_1007650703 64
642 3300005457 Ga0070662_101509288 Ga0070662_1015092882 64
643 3300005458 Ga0070681_11076664 Ga0070681_110766642 64
644 3300005459 Ga0068867_100260956 Ga0068867_1002609562 64
645 3300005459 Ga0068867_101750357 Ga0068867_1017503571 64
646 3300005459 Ga0068867_102343798 Ga0068867_1023437981 64
647 3300005466 Ga0070685_10438397 Ga0070685_104383972 64
648 3300005467 Ga0070706_100902145 Ga0070706_1009021452 64
649 3300005468 Ga0070707_101085172 Ga0070707_1010851723 64
650 3300005468 Ga0070707_101436453 Ga0070707_1014364532 64
651 3300005471 Ga0070698_100128772 Ga0070698_1001287724 64
652 3300005471 Ga0070698_101118251 Ga0070698_1011182512 64
653 3300005471 Ga0070698_101814622 Ga0070698_1018146222 64
654 3300005530 Ga0070679_101089076 Ga0070679_1010890761 64
655 3300005530 Ga0070679_102106117 Ga0070679_1021061172 64
656 3300005535 Ga0070684_100754584 Ga0070684_1007545843 64
657 3300005536 Ga0070697_100081282 Ga0070697_1000812824 64
658 3300005536 Ga0070697_100481821 Ga0070697_1004818212 64
659 3300005536 Ga0070697_101429689 Ga0070697_1014296891 64
660 3300005539 Ga0068853_101848543 Ga0068853_1018485432 64
661 3300005543 Ga0070672_101958419 Ga0070672_1019584191 64
662 3300005544 Ga0070686_100117462 Ga0070686_1001174623 64
663 3300005544 Ga0070686_101232466 Ga0070686_1012324664 64
664 3300005545 Ga0070695_100395406 Ga0070695_1003954062 64
665 3300005545 Ga0070695_100482640 Ga0070695_1004826404 64
666 3300005546 Ga0070696_100048649 Ga0070696_1000486497 64
667 3300005546 Ga0070696_101790118 Ga0070696_1017901182 64
668 3300005547 Ga0070693_100448998 Ga0070693_1004489982 64
669 3300005549 Ga0070704_100842662 Ga0070704_1008426624 64
670 3300005549 Ga0070704_102071092 Ga0070704_1020710922 64
671 3300005564 Ga0070664_100705157 Ga0070664_1007051574 64
672 3300005564 Ga0070664_100724302 Ga0070664_1007243024 64
673 3300005577 Ga0068857_100487636 Ga0068857_1004876364 64
674 3300005577 Ga0068857_100773477 Ga0068857_1007734772 64
675 3300005577 Ga0068857_101146947 Ga0068857_1011469473 64
676 3300005578 Ga0068854_101023035 Ga0068854_1010230354 64
677 3300005578 Ga0068854_101618104 Ga0068854_1016181042 64
678 3300005614 Ga0068856_101835619 Ga0068856_1018356192 64
679 3300005615 Ga0070702_100366736 Ga0070702_1003667362 64
680 3300005615 Ga0070702_100421618 Ga0070702_1004216182 64
681 3300005615 Ga0070702_100539905 Ga0070702_1005399054 64
682 3300005616 Ga0068852_100866168 Ga0068852_1008661682 64
683 3300005617 Ga0068859_100551157 Ga0068859_1005511574 64
684 3300005618 Ga0068864_100118277 Ga0068864_1001182774 64
685 3300005618 Ga0068864_100457461 Ga0068864_1004574614 64
686 3300005719 Ga0068861_100485872 Ga0068861_1004858722 64
687 3300005719 Ga0068861_101044093 Ga0068861_1010440932 64
688 3300005719 Ga0068861_101214951 Ga0068861_1012149512 64
689 3300005840 Ga0068870_10219194 Ga0068870_102191943 64
690 3300005841 Ga0068863_100982498 Ga0068863_1009824984 64
691 3300005841 Ga0068863_101413859 Ga0068863_1014138592 64
692 3300005842 Ga0068858_100027244 Ga0068858_1000272444 64
693 3300005842 Ga0068858_100477059 Ga0068858_1004770594 64
694 3300005843 Ga0068860_100024658 Ga0068860_1000246585 64
695 3300005843 Ga0068860_100531553 Ga0068860_1005315534 64
696 3300005985 Ga0081539_10318578 Ga0081539_103185782 64
697 3300006038 Ga0075365_10279193 Ga0075365_102791932 64
698 3300006051 Ga0075364_10962093 Ga0075364_109620932 64
699 3300006058 Ga0075432_10037946 Ga0075432_100379464 64
700 3300006237 Ga0097621_100150529 Ga0097621_1001505293 64
701 3300006358 Ga0068871_100434328 Ga0068871_1004343282 64
702 3300006844 Ga0075428_100731357 Ga0075428_1007313572 64
703 3300006844 Ga0075428_101943549 Ga0075428_1019435491 64
704 3300006847 Ga0075431_100254993 Ga0075431_1002549934 64
705 3300006852 Ga0075433_10019795 Ga0075433_100197954 64
706 3300006852 Ga0075433_10163918 Ga0075433_101639184 64
707 3300006852 Ga0075433_10271267 Ga0075433_102712672 64
708 3300006871 Ga0075434_100807010 Ga0075434_1008070104 64
709 3300006871 Ga0075434_101116554 Ga0075434_1011165544 64
710 3300006881 Ga0068865_100159465 Ga0068865_1001594653 64
711 3300006881 Ga0068865_100288295 Ga0068865_1002882954 64
712 3300006914 Ga0075436_100122500 Ga0075436_1001225002 64
713 3300006931 Ga0097620_100551131 Ga0097620_1005511314 64
714 3300007076 Ga0075435_100232450 Ga0075435_1002324504 64
715 3300007076 Ga0075435_100463524 Ga0075435_1004635244 64
716 3300007076 Ga0075435_100659383 Ga0075435_1006593832 64
717 3300007076 Ga0075435_100756312 Ga0075435_1007563122 64
718 3300009092 Ga0105250_10605431 Ga0105250_106054313 64
719 3300009093 Ga0105240_11120153 Ga0105240_111201532 64
720 3300009094 Ga0111539_10628948 Ga0111539_106289482 64
721 3300009094 Ga0111539_11404096 Ga0111539_114040962 64
722 3300009094 Ga0111539_12267385 Ga0111539_122673852 64
723 3300009098 Ga0105245_10220019 Ga0105245_102200194 64
724 3300009098 Ga0105245_10755149 Ga0105245_107551492 64
725 3300009098 Ga0105245_11570092 Ga0105245_115700922 64
726 3300009101 Ga0105247_10170111 Ga0105247_101701112 64
727 3300009147 Ga0114129_10181666 Ga0114129_101816664 64
728 3300009147 Ga0114129_11118621 Ga0114129_111186213 64
729 3300009147 Ga0114129_11611101 Ga0114129_116111013 64
730 3300009147 Ga0114129_12174935 Ga0114129_121749353 64
731 3300009148 Ga0105243_10789027 Ga0105243_107890272 64
732 3300009148 Ga0105243_11924829 Ga0105243_119248292 64
733 3300009174 Ga0105241_10558779 Ga0105241_105587792 64
734 3300009176 Ga0105242_10245777 Ga0105242_102457774 64
735 3300009176 Ga0105242_11050225 Ga0105242_110502253 64
736 3300009176 Ga0105242_11318241 Ga0105242_113182412 64
737 3300009177 Ga0105248_10041220 Ga0105248_100412207 64
738 3300009177 Ga0105248_10784244 Ga0105248_107842442 64
739 3300009177 Ga0105248_12261881 Ga0105248_122618812 64
740 3300009545 Ga0105237_10611139 Ga0105237_106111394 64
741 3300009551 Ga0105238_11131346 Ga0105238_111313462 64
742 3300009553 Ga0105249_10019204 Ga0105249_100192043 64
743 3300009553 Ga0105249_11369838 Ga0105249_113698384 64
744 3300009553 Ga0105249_13079667 Ga0105249_130796672 64
745 3300010375 Ga0105239_10319281 Ga0105239_103192814 64
746 3300010375 Ga0105239_11173510 Ga0105239_111735102 64
747 3300011119 Ga0105246_10041027 Ga0105246_100410273 64
748 3300011119 Ga0105246_10329895 Ga0105246_103298952 64
749 3300011119 Ga0105246_10942752 Ga0105246_109427523 64
750 3300012488 Ga0157343_1007894 Ga0157343_10078941 64
751 3300012495 Ga0157323_1004802 Ga0157323_10048022 64
752 3300013102 Ga0157371_10337438 Ga0157371_103374382 64
753 3300013296 Ga0157374_10155022 Ga0157374_101550222 64
754 3300013297 Ga0157378_10015276 Ga0157378_100152764 64
755 3300013306 Ga0163162_10088800 Ga0163162_100888004 64
756 3300013306 Ga0163162_11783920 Ga0163162_117839204 64
757 3300013306 Ga0163162_13123335 Ga0163162_131233353 64
758 3300013307 Ga0157372_10800022 Ga0157372_108000222 64
759 3300013307 Ga0157372_11560230 Ga0157372_115602302 64
760 3300013308 Ga0157375_10912092 Ga0157375_109120924 64
761 3300013308 Ga0157375_13675404 Ga0157375_136754042 64
762 3300014325 Ga0163163_10743049 Ga0163163_107430492 64
763 3300014325 Ga0163163_12069663 Ga0163163_120696632 64
764 3300014326 Ga0157380_10012801 Ga0157380_100128013 64
765 3300014326 Ga0157380_12996746 Ga0157380_129967462 64
766 3300014326 Ga0157380_13364968 Ga0157380_133649682 64
767 3300014745 Ga0157377_10076167 Ga0157377_100761672 64
768 3300014968 Ga0157379_10549666 Ga0157379_105496663 64
769 3300014968 Ga0157379_11122397 Ga0157379_111223972 64
770 3300017792 Ga0163161_10605041 Ga0163161_106050412 64
771 3300017792 Ga0163161_10623128 Ga0163161_106231282 64
772 3300020081 Ga0206354_10678292 Ga0206354_106782922 64
773 3300025315 Ga0207697_10103881 Ga0207697_101038813 64
774 3300025885 Ga0207653_10346741 Ga0207653_103467413 64
775 3300025900 Ga0207710_10551947 Ga0207710_105519472 64
776 3300025901 Ga0207688_10728680 Ga0207688_107286801 64
777 3300025903 Ga0207680_10345252 Ga0207680_103452524 64
778 3300025904 Ga0207647_10022808 Ga0207647_100228085 64
779 3300025907 Ga0207645_10140018 Ga0207645_101400182 64
780 3300025907 Ga0207645_10472654 Ga0207645_104726543 64
781 3300025908 Ga0207643_10391655 Ga0207643_103916554 64
782 3300025914 Ga0207671_10281017 Ga0207671_102810172 64
783 3300025917 Ga0207660_10000002 Ga0207660_10000002372 64
784 3300025918 Ga0207662_10451250 Ga0207662_104512504 64
785 3300025918 Ga0207662_10551726 Ga0207662_105517264 64
786 3300025919 Ga0207657_10381984 Ga0207657_103819842 64
787 3300025920 Ga0207649_11343857 Ga0207649_113438572 64
788 3300025921 Ga0207652_11691138 Ga0207652_116911382 64
789 3300025922 Ga0207646_10344489 Ga0207646_103444892 64
790 3300025922 Ga0207646_10669247 Ga0207646_106692472 64
791 3300025925 Ga0207650_10856254 Ga0207650_108562542 64
792 3300025926 Ga0207659_11055178 Ga0207659_110551782 64
793 3300025927 Ga0207687_10046120 Ga0207687_100461202 64
794 3300025927 Ga0207687_10205866 Ga0207687_102058662 64
795 3300025927 Ga0207687_10245227 Ga0207687_102452274 64
796 3300025931 Ga0207644_10066480 Ga0207644_100664802 64
797 3300025931 Ga0207644_11103092 Ga0207644_111030922 64
798 3300025932 Ga0207690_10050244 Ga0207690_100502444 64
799 3300025932 Ga0207690_11293243 Ga0207690_112932432 64
800 3300025933 Ga0207706_10046490 Ga0207706_100464904 64
801 3300025934 Ga0207686_10663648 Ga0207686_106636482 64
802 3300025935 Ga0207709_10010646 Ga0207709_100106462 64
803 3300025937 Ga0207669_10005197 Ga0207669_100051976 64
804 3300025937 Ga0207669_10737737 Ga0207669_107377374 64
805 3300025938 Ga0207704_10533180 Ga0207704_105331802 64
806 3300025938 Ga0207704_10825826 Ga0207704_108258264 64
807 3300025940 Ga0207691_11758036 Ga0207691_117580361 64
808 3300025941 Ga0207711_10059034 Ga0207711_100590344 64
809 3300025942 Ga0207689_10662255 Ga0207689_106622552 64
810 3300025942 Ga0207689_10948874 Ga0207689_109488743 64
811 3300025944 Ga0207661_10436866 Ga0207661_104368661 64
812 3300025960 Ga0207651_11479702 Ga0207651_114797022 64
813 3300025961 Ga0207712_10634298 Ga0207712_106342982 64
814 3300025961 Ga0207712_11451262 Ga0207712_114512623 64
815 3300025972 Ga0207668_10856634 Ga0207668_108566342 64
816 3300025981 Ga0207640_10213275 Ga0207640_102132753 64
817 3300025986 Ga0207658_12070465 Ga0207658_120704652 64
818 3300026023 Ga0207677_10528251 Ga0207677_105282512 64
819 3300026035 Ga0207703_10065297 Ga0207703_100652973 64
820 3300026035 Ga0207703_10886928 Ga0207703_108869282 64
821 3300026041 Ga0207639_10907276 Ga0207639_109072763 64
822 3300026041 Ga0207639_10971666 Ga0207639_109716662 64
823 3300026067 Ga0207678_10017028 Ga0207678_100170284 64
824 3300026067 Ga0207678_11598135 Ga0207678_115981352 64
825 3300026075 Ga0207708_10017492 Ga0207708_100174927 64
826 3300026075 Ga0207708_10856134 Ga0207708_108561344 64
827 3300026078 Ga0207702_10729756 Ga0207702_107297563 64
828 3300026088 Ga0207641_11341754 Ga0207641_113417544 64
829 3300026089 Ga0207648_10799580 Ga0207648_107995802 64
830 3300026095 Ga0207676_10243897 Ga0207676_102438973 64
831 3300026095 Ga0207676_10508450 Ga0207676_105084503 64
832 3300026095 Ga0207676_11361056 Ga0207676_113610562 64
833 3300026116 Ga0207674_10850537 Ga0207674_108505372 64
834 3300026116 Ga0207674_11033956 Ga0207674_110339562 64
835 3300026118 Ga0207675_100573084 Ga0207675_1005730843 64
836 3300026118 Ga0207675_101054815 Ga0207675_1010548152 64
837 3300026118 Ga0207675_101383480 Ga0207675_1013834802 64
838 3300026121 Ga0207683_10486201 Ga0207683_104862014 64
839 3300026121 Ga0207683_10807356 Ga0207683_108073562 64
840 3300026142 Ga0207698_10020697 Ga0207698_100206973 64
841 3300027717 Ga0209998_10007548 Ga0209998_100075482 64
842 3300027876 Ga0209974_10028771 Ga0209974_100287712 64
843 3300027907 Ga0207428_10181308 Ga0207428_101813083 64
844 3300028381 Ga0268264_10274106 Ga0268264_102741063 64
845 3300028381 Ga0268264_12025853 Ga0268264_120258532 64
846 3300028381 Ga0268264_12453410 Ga0268264_124534103 64
847 3300031824 Ga0307413_10293782 Ga0307413_102937823 64
848 3300031852 Ga0307410_11673601 Ga0307410_116736012 64
849 3300032002 Ga0307416_100042187 Ga0307416_1000421874 64
850 3300032126 Ga0307415_100120780 Ga0307415_1001207806 64
851 3300034817 Ga0373948_0201665 Ga0373948_0201665_248_442 64
852 3300034819 Ga0373958_0041078 Ga0373958_0041078_395_589 64
853 3300035090 Ga0373949_0049115 Ga0373949_0049115_431_625 64
854 3300035091 Ga0373951_0233715 Ga0373951_0233715_244_438 64
855 3300035112 Ga0373932_0103774 Ga0373932_0103774_343_537 64
856 3300035115 Ga0373941_0131513 Ga0373941_0131513_569_763 64
857 3300035115 Ga0373941_0288517 Ga0373941_0288517_366_560 64
858 3300035115 Ga0373941_0392496 Ga0373941_0392496_348_542 64
859 3300035121 Ga0373960_0063732 Ga0373960_0063732_748_942 64
860 3300035121 Ga0373960_0282269 Ga0373960_0282269_332_526 64
861 3300035241 Ga0373961_0235479 Ga0373961_0235479_392_586 64
862 3300035691 Ga0373931_0194604 Ga0373931_0194604_551_745 64
863 3300038698 Ga0242419_005567 Ga0242419_005567_598_792 64
864 3300038996 Ga0242420_064558 Ga0242420_064558_248_442 64
865 3300041408 Ga0439453_0180418 Ga0439453_0180418_171_365 64
866 3300042438 Ga0439459_0033618 Ga0439459_0033618_222_416 64
867 3300044673 Ga0453683_0383037 Ga0453683_0383037_606_800 64
868 3300046664 Ga0495659_0293609 Ga0495659_0293609_477_671 64
869 3300048904 Ga0496101_0462519 Ga0496101_0462519_677_871 64
870 3300048905 Ga0496102_0765094 Ga0496102_0765094_418_612 64
871 3300048905 Ga0496102_0989738 Ga0496102_0989738_380_574 64
872 3300048907 Ga0496104_0897486 Ga0496104_0897486_333_527 64
873 3300048909 Ga0496106_0189802 Ga0496106_0189802_1058_1252 64
874 3300048909 Ga0496106_0787726 Ga0496106_0787726_272_466 64
875 3300048910 Ga0496107_1042464 Ga0496107_1042464_234_428 64
876 3300048911 Ga0496108_0152665 Ga0496108_0152665_565_759 64
877 3300048912 Ga0496109_0724174 Ga0496109_0724174_281_475 64
878 3300048912 Ga0496109_1214845 Ga0496109_1214845_263_457 64
879 3300048913 Ga0496110_0032784 Ga0496110_0032784_3485_3679 64
880 3300048914 Ga0496111_0974252 Ga0496111_0974252_144_338 64
881 3300048915 Ga0496112_0047852 Ga0496112_0047852_3097_3291 64
882 3300048915 Ga0496112_0246234 Ga0496112_0246234_184_378 64
883 3300048915 Ga0496112_1715513 Ga0496112_1715513_251_445 64
884 3300048916 Ga0496113_0324452 Ga0496113_0324452_569_763 64
885 3300049127 Ga0501306_039538 Ga0501306_039538_497_691 64
886 3300049533 Ga0501317_007952 Ga0501317_007952_95_289 64
887 3300049534 Ga0501318_080817 Ga0501318_080817_262_456 64
888 3300049541 Ga0501325_008381 Ga0501325_008381_103_297 64
889 3300049574 Ga0501038_0699934 Ga0501038_0699934_375_569 64
890 3300049575 Ga0501039_0719628 Ga0501039_0719628_97_291 64
891 3300049576 Ga0501040_0161072 Ga0501040_0161072_859_1053 64
892 3300049576 Ga0501040_0225921 Ga0501040_0225921_309_503 64
893 3300049577 Ga0501041_0113853 Ga0501041_0113853_1276_1470 64
894 3300049577 Ga0501041_0140295 Ga0501041_0140295_954_1148 64
895 3300049578 Ga0501042_1388916 Ga0501042_1388916_92_286 64
896 3300049580 Ga0501046_0237089 Ga0501046_0237089_626_820 64
897 3300049582 Ga0501048_0224285 Ga0501048_0224285_939_1133 64
898 3300049583 Ga0501067_0011868 Ga0501067_0011868_4318_4515 64
899 3300049584 Ga0501068_1139883 Ga0501068_1139883_27_221 64
900 3300049585 Ga0501069_0004365 Ga0501069_0004365_183_380 64
901 3300049588 Ga0501072_0284427 Ga0501072_0284427_776_970 64
902 3300049590 Ga0501074_0939660 Ga0501074_0939660_146_340 64
903 3300049592 Ga0501076_0137306 Ga0501076_0137306_782_976 64
904 3300049592 Ga0501076_0209492 Ga0501076_0209492_799_993 64
905 3300049593 Ga0501077_0209806 Ga0501077_0209806_199_393 64
906 3300049672 Ga0501239_024334 Ga0501239_024334_30_224 64
907 3300049741 Ga0501079_1466146 Ga0501079_1466146_193_387 64
908 3300049743 Ga0501081_0094214 Ga0501081_0094214_141_335 64
909 3300049823 Ga0501044_0998968 Ga0501044_0998968_68_262 64
910 3300049824 Ga0501045_0163446 Ga0501045_0163446_86_280 64
911 3300049824 Ga0501045_1050561 Ga0501045_1050561_341_535 64
912 3300050492 nmdc:mga0yw44_337332_c1 nmdc:mga0yw44_337332_c1_269_463 64
913 3300050507 nmdc:mga05p37_254741_c1 nmdc:mga05p37_254741_c1_788_985 64
914 3300050507 nmdc:mga05p37_609611_c1 nmdc:mga05p37_609611_c1_490_684 64
915 3300050507 nmdc:mga05p37_866448_c2 nmdc:mga05p37_866448_c2_295_492 64
916 3300050508 nmdc:mga09592_1639545_c1 nmdc:mga09592_1639545_c1_223_417 64
917 3300050510 nmdc:mga06r32_84995_c1 nmdc:mga06r32_84995_c1_126_320 64
918 3300050511 nmdc:mga08y16_65151_c1 nmdc:mga08y16_65151_c1_3122_3316 64
919 3300050511 nmdc:mga08y16_772377_c1 nmdc:mga08y16_772377_c1_491_685 64
920 3300050512 nmdc:mga0n895_1943878_c1 nmdc:mga0n895_1943878_c1_144_338 64
921 3300050512 nmdc:mga0n895_2029175_c1 nmdc:mga0n895_2029175_c1_33_227 64
922 3300050512 nmdc:mga0n895_220821_c1 nmdc:mga0n895_220821_c1_1199_1393 64
923 3300050512 nmdc:mga0n895_426803_c1 nmdc:mga0n895_426803_c1_1110_1307 64
924 3300050513 nmdc:mga0rr50_1175421_c1 nmdc:mga0rr50_1175421_c1_303_497 64
925 3300050513 nmdc:mga0rr50_627379_c1 nmdc:mga0rr50_627379_c1_408_605 64
926 3300050513 nmdc:mga0rr50_670906_c1 nmdc:mga0rr50_670906_c1_102_296 64
927 3300050514 nmdc:mga08x19_1002929_c1 nmdc:mga08x19_1002929_c1_96_290 64
928 3300050514 nmdc:mga08x19_157770_c1 nmdc:mga08x19_157770_c1_1059_1256 64
929 3300050514 nmdc:mga08x19_480054_c1 nmdc:mga08x19_480054_c1_578_772 64
930 3300050515 nmdc:mga0a205_143170_c1 nmdc:mga0a205_143170_c1_1537_1734 64
931 3300050515 nmdc:mga0a205_182722_c1 nmdc:mga0a205_182722_c1_239_433 64
932 3300050515 nmdc:mga0a205_456320_c1 nmdc:mga0a205_456320_c1_441_635 64
933 3300050515 nmdc:mga0a205_62566_c1 nmdc:mga0a205_62566_c1_464_658 64
934 3300054114 Ga0501084_0046030 Ga0501084_0046030_516_710 64
935 3300059643 Ga0587072_114303 Ga0587072_114303_342_536 64
936 3300059652 Ga0587107_077363 Ga0587107_077363_100_294 64
937 3300060353 Ga0501082_0316052 Ga0501082_0316052_326_520 64
938 3300060353 Ga0501082_0605213 Ga0501082_0605213_331_525 64
939 3300061734 Ga0530510_1122535 Ga0530510_1122535_174_371 64

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00584

SecE

SecE/Sec61-gamma subunits of protein translocation complex

12

66

0.96

Feature Viewer

pLDDT pTM Quality
89.54 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map