F486279

General Info

Members Datasets Scaffolds Average Seq Length
939 422 901 497

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100049579|Ga0068860_1000495793
Length 503
Sequence MATDTQSGAPAIAYPGGEPMEAIGAVTPLPPHVLCIFGATGDLARRKLLPGLLHLCQAGLMPEFRVVGISMEELSDAQFREFAAEACREFGHHEFDQEEWHDFAQRLSYLPVSEAPKALKGVVEATCEELGEETRLLHYLSVPPKAAGDVIELLGEAGLNERARVVMEKPFGTDLASAQRLNEMVHEVFREEQVFRIDHFLGKEAALNILALRFANGLFEPIWNRDHIDHIQIDVPETIGVGSRAGFYDQTGAYRDMVVTHLFQILAFVAMEPPTALAPEPITEEKNKVFRSLRPLDPEWVVRGQYEGYAEEVGVESSSTETFVALRNEIDNWRWSGVKFYLRTGKRMGEGGRIISIAFREPPQSMFPAHSRVGRYGPDHLTFDLDESSRVSLSFYGKRPGMGMVLDKASMQFSLDETAYRGETLEAYERLLRDAMAGDRTLFTTARDIERLWEISEPLLRDPAPVKPYPQGSWGPAEIGALIAPNSWRLPFARRWREHHVNP

Samples

Sample ID Description Type Environment
1 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
2 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
3 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
6 2643221711 Terrabacter sp. Root85 Isolate Unclassified
7 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
8 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
9 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
10 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
11 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
12 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
13 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
14 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
15 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
16 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
17 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
18 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
19 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
20 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
21 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
22 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
23 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
24 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
25 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
26 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
27 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
28 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
29 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
30 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
31 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
32 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
33 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
34 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
35 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
36 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
37 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
38 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
39 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
44 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
45 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
46 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
47 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
48 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
49 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
214 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
215 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
216 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
217 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
218 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
224 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
230 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
233 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
262 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
273 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
274 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
275 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
276 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
277 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
278 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
279 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
280 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
281 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
282 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
283 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
284 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
285 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
286 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
287 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
288 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
289 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
290 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
291 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
292 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
304 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
332 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
355 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
356 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
357 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
358 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
364 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
384 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
387 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
388 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
396 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
397 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
398 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
403 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
411 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
412 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
413 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
417 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
418 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
419 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
420 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.85
Metatranscriptomes 0.11
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 11.93
Rhizosphere 72.95
Stem 0
Stem Tuber 0
Unclassified 7.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004231 3300001915 Bacteria 3224
2 JGI24740J21852_10012686 3300001979 Bacteria 3170
3 JGI24739J22299_10007492 3300001989 Bacteria 4092
4 JGI24737J22298_10014225 3300001990 Bacteria 2584
5 JGI24735J21928_10014328 3300002067 Bacteria 2484
6 JGI24750J21931_1003282 3300002070 Bacteria 1941
7 JGI24745J21846_1001386 3300002073 Bacteria 2342
8 JGI24744J21845_10002686 3300002077 Bacteria 3628
9 JGI24033J26618_1000922 3300002155 Bacteria 2828
10 JGI24751J29686_10002325 3300002459 Bacteria 3839
11 JGI24751J29686_10006759 3300002459 Bacteria 2338
12 JGI25406J46586_10005948 3300003203 Bacteria 5644
13 JGI25407J50210_10000047 3300003373 Bacteria 13908
14 JGI25407J50210_10011902 3300003373 Bacteria 2228
15 Ga0055540_1000065 3300003792 Bacteria 126812
16 Ga0055540_1001113 3300003792 Bacteria 16948
17 Ga0055540_1001796 3300003792 Bacteria 12202
18 Ga0055540_1003135 3300003792 Bacteria 8186
19 Ga0070658_10077740 3300005327 Bacteria 2723
20 Ga0070658_10093759 3300005327 Bacteria 2476
21 Ga0070676_10008718 3300005328 Bacteria 5471
22 Ga0070683_100000527 3300005329 Bacteria 26899
23 Ga0070683_100079610 3300005329 Bacteria 3066
24 Ga0070683_100207572 3300005329 Bacteria 1860
25 Ga0070690_100021595 3300005330 Bacteria 3932
26 Ga0070670_100105668 3300005331 Bacteria 2426
27 Ga0068869_100014020 3300005334 Bacteria 5347
28 Ga0070666_10055053 3300005335 Bacteria 2684
29 Ga0070682_100001211 3300005337 Bacteria 14715
30 Ga0070682_100006610 3300005337 Bacteria 6504
31 Ga0070682_100090917 3300005337 Bacteria 1997
32 Ga0068868_100019969 3300005338 Bacteria 5026
33 Ga0068868_100048728 3300005338 Bacteria 3324
34 Ga0068868_100177504 3300005338 Bacteria 1766
35 Ga0070689_100016786 3300005340 Bacteria 5364
36 Ga0070661_100000110 3300005344 Bacteria 68106
37 Ga0070661_100013458 3300005344 Bacteria 5742
38 Ga0070661_100071708 3300005344 Bacteria 2549
39 Ga0070661_100129182 3300005344 Bacteria 1897
40 Ga0070692_10012228 3300005345 Bacteria 3965
41 Ga0070668_100001430 3300005347 Bacteria 17221
42 Ga0070668_100002698 3300005347 Bacteria 13056
43 Ga0070668_100007667 3300005347 Bacteria 8011
44 Ga0070668_100028160 3300005347 Bacteria 4266
45 Ga0070668_100028625 3300005347 Bacteria 4229
46 Ga0070668_100045992 3300005347 Bacteria 3350
47 Ga0070668_100063880 3300005347 Bacteria 2853
48 Ga0070668_100106218 3300005347 Bacteria 2230
49 Ga0070669_100016048 3300005353 Bacteria 5344
50 Ga0070671_100002337 3300005355 Bacteria 14646
51 Ga0070674_100000153 3300005356 Bacteria 32199
52 Ga0070688_100000053 3300005365 Bacteria 55064
53 Ga0070659_100000013 3300005366 Bacteria 178795
54 Ga0070659_100016187 3300005366 Bacteria 5595
55 Ga0070667_100000840 3300005367 Bacteria 28497
56 Ga0070667_100008468 3300005367 Bacteria 8529
57 Ga0070667_100028629 3300005367 Bacteria 4639
58 Ga0070667_100053878 3300005367 Bacteria 3395
59 Ga0070714_100011637 3300005435 Bacteria 6986
60 Ga0070714_100149830 3300005435 Bacteria 2101
61 Ga0070713_100133350 3300005436 Bacteria 2192
62 Ga0070710_10001412 3300005437 Bacteria 11329
63 Ga0070710_10012538 3300005437 Bacteria 4212
64 Ga0070701_10022358 3300005438 Bacteria 3031
65 Ga0070711_100000205 3300005439 Bacteria 31303
66 Ga0070711_100010610 3300005439 Bacteria 5707
67 Ga0070705_100018204 3300005440 Bacteria 3678
68 Ga0070694_100048154 3300005444 Bacteria 2867
69 Ga0070663_100031238 3300005455 Bacteria 3659
70 Ga0070663_100083040 3300005455 Bacteria 2358
71 Ga0070678_100004645 3300005456 Bacteria 7810
72 Ga0070678_100021506 3300005456 Bacteria 4255
73 Ga0070662_100020708 3300005457 Bacteria 4484
74 Ga0070662_100096833 3300005457 Bacteria 2226
75 Ga0070662_100124614 3300005457 Bacteria 1979
76 Ga0070681_10043343 3300005458 Bacteria 4508
77 Ga0068867_100006760 3300005459 Bacteria 8108
78 Ga0068867_100026849 3300005459 Bacteria 4136
79 Ga0068867_100156717 3300005459 Bacteria 1793
80 Ga0070685_10000086 3300005466 Bacteria 57017
81 Ga0070685_10014773 3300005466 Bacteria 4139
82 Ga0070685_10033305 3300005466 Bacteria 2893
83 Ga0070707_100165503 3300005468 Bacteria 2155
84 Ga0070679_100002668 3300005530 Bacteria 16241
85 Ga0068853_100033816 3300005539 Bacteria 4337
86 Ga0068853_100071658 3300005539 Bacteria 3018
87 Ga0068853_100149071 3300005539 Bacteria 2104
88 Ga0070686_100048679 3300005544 Bacteria 2686
89 Ga0070696_100034595 3300005546 Bacteria 3476
90 Ga0070696_100166725 3300005546 Bacteria 1626
91 Ga0070693_100019527 3300005547 Bacteria 3555
92 Ga0070665_100004960 3300005548 Bacteria 13801
93 Ga0070665_100032045 3300005548 Bacteria 5291
94 Ga0070665_100043787 3300005548 Bacteria 4497
95 Ga0070665_100075978 3300005548 Bacteria 3366
96 Ga0070704_100000289 3300005549 Bacteria 22086
97 Ga0070704_100064102 3300005549 Bacteria 2640
98 Ga0068857_100084732 3300005577 Bacteria 2832
99 Ga0068854_100025337 3300005578 Bacteria 4069
100 Ga0068856_100001228 3300005614 Bacteria 26877
101 Ga0070702_100029922 3300005615 Bacteria 2966
102 Ga0070702_100031581 3300005615 Bacteria 2899
103 Ga0068852_100059236 3300005616 Bacteria 3320
104 Ga0068859_100002544 3300005617 Bacteria 18515
105 Ga0068859_100023558 3300005617 Bacteria 6178
106 Ga0068859_100107717 3300005617 Bacteria 2847
107 Ga0068866_10001088 3300005718 Bacteria 11980
108 Ga0068861_100002774 3300005719 Bacteria 11496
109 Ga0068863_100000373 3300005841 Bacteria 45591
110 Ga0068863_100024127 3300005841 Bacteria 5802
111 Ga0068863_100093058 3300005841 Bacteria 2861
112 Ga0068858_100003979 3300005842 Bacteria 14586
113 Ga0068858_100046913 3300005842 Bacteria 4005
114 Ga0068858_100058513 3300005842 Bacteria 3564
115 Ga0068860_100000011 3300005843 Bacteria 328172
116 Ga0068860_100033567 3300005843 Bacteria 4923
117 Ga0068860_100049579 3300005843 Bacteria 3998
118 Ga0068860_100107761 3300005843 Bacteria 2662
119 Ga0068862_100000139 3300005844 Bacteria 82475
120 Ga0068862_100000366 3300005844 Bacteria 49032
121 Ga0068862_100005265 3300005844 Bacteria 10850
122 Ga0068862_100021554 3300005844 Bacteria 5385
123 Ga0068862_100129428 3300005844 Bacteria 2231
124 Ga0081455_10000106 3300005937 Bacteria 93286
125 Ga0081455_10002738 3300005937 Bacteria 20795
126 Ga0081455_10027460 3300005937 Bacteria 5216
127 Ga0081455_10037772 3300005937 Bacteria 4282
128 Ga0081455_10084826 3300005937 Bacteria 2584
129 Ga0081538_10000763 3300005981 Bacteria 35158
130 Ga0081538_10000973 3300005981 Bacteria 30622
131 Ga0081540_1000046 3300005983 Bacteria 131375
132 Ga0081540_1011454 3300005983 Bacteria 5924
133 Ga0081540_1013115 3300005983 Bacteria 5411
134 Ga0081539_10000236 3300005985 Bacteria 129646
135 Ga0081539_10001074 3300005985 Bacteria 49797
136 Ga0081539_10001710 3300005985 Bacteria 35211
137 Ga0081539_10004566 3300005985 Bacteria 15131
138 Ga0081539_10010378 3300005985 Bacteria 7574
139 Ga0070717_10000059 3300006028 Bacteria 92958
140 Ga0070717_10118149 3300006028 Bacteria 2269
141 Ga0075365_10000193 3300006038 Bacteria 20067
142 Ga0075365_10000898 3300006038 Bacteria 12474
143 Ga0075365_10009502 3300006038 Bacteria 5595
144 Ga0075363_100000427 3300006048 Bacteria 13107
145 Ga0075363_100002846 3300006048 Bacteria 7200
146 Ga0075363_100016916 3300006048 Bacteria 3608
147 Ga0075363_100040584 3300006048 Bacteria 2453
148 Ga0075364_10000577 3300006051 Bacteria 18886
149 Ga0075364_10000892 3300006051 Bacteria 15760
150 Ga0075364_10001241 3300006051 Bacteria 13684
151 Ga0075364_10003280 3300006051 Bacteria 9173
152 Ga0075364_10052920 3300006051 Bacteria 2654
153 Ga0075364_10062082 3300006051 Bacteria 2452
154 Ga0075364_10105557 3300006051 Bacteria 1877
155 Ga0075432_10000398 3300006058 Bacteria 12679
156 Ga0070716_100019063 3300006173 Bacteria 3582
157 Ga0070716_100025057 3300006173 Bacteria 3178
158 Ga0070712_100021922 3300006175 Bacteria 4200
159 Ga0075367_10016382 3300006178 Bacteria 4047
160 Ga0075369_10002193 3300006186 Bacteria 6904
161 Ga0075369_10011109 3300006186 Bacteria 3533
162 Ga0075369_10014500 3300006186 Bacteria 3149
163 Ga0075369_10046765 3300006186 Bacteria 1864
164 Ga0075370_10007355 3300006353 Bacteria 5605
165 Ga0075370_10009536 3300006353 Bacteria 5046
166 Ga0075370_10038551 3300006353 Bacteria 2689
167 Ga0075428_100016930 3300006844 Bacteria 8050
168 Ga0075428_100020281 3300006844 Bacteria 7362
169 Ga0075431_100012901 3300006847 Bacteria 8434
170 Ga0075431_100019604 3300006847 Bacteria 6899
171 Ga0075431_100034685 3300006847 Bacteria 5198
172 Ga0075433_10001708 3300006852 Bacteria 16382
173 Ga0075433_10070863 3300006852 Bacteria 3064
174 Ga0075434_100004328 3300006871 Bacteria 12772
175 Ga0075434_100004603 3300006871 Bacteria 12453
176 Ga0075434_100019309 3300006871 Bacteria 6595
177 Ga0075429_100003236 3300006880 Bacteria 13858
178 Ga0068865_100014483 3300006881 Bacteria 5011
179 Ga0068865_100049452 3300006881 Bacteria 2898
180 Ga0068865_100103041 3300006881 Bacteria 2092
181 Ga0075436_100002186 3300006914 Bacteria 13483
182 Ga0075436_100059928 3300006914 Bacteria 2629
183 Ga0097620_100002544 3300006931 Bacteria 18515
184 Ga0097620_100023557 3300006931 Bacteria 6178
185 Ga0097620_100107709 3300006931 Bacteria 2847
186 Ga0075435_100000562 3300007076 Bacteria 22817
187 Ga0075435_100061086 3300007076 Bacteria 3057
188 Ga0105251_10053118 3300009011 Bacteria 1927
189 Ga0111539_10001351 3300009094 Bacteria 32652
190 Ga0111539_10010304 3300009094 Bacteria 11767
191 Ga0111539_10017096 3300009094 Bacteria 8978
192 Ga0111539_10072393 3300009094 Bacteria 4064
193 Ga0105245_10004802 3300009098 Bacteria 11924
194 Ga0105245_10015520 3300009098 Bacteria 6642
195 Ga0105245_10018530 3300009098 Bacteria 6088
196 Ga0105245_10027146 3300009098 Bacteria 5044
197 Ga0105245_10072901 3300009098 Bacteria 3121
198 Ga0105245_10093030 3300009098 Bacteria 2778
199 Ga0105247_10000067 3300009101 Bacteria 118585
200 Ga0114129_10018395 3300009147 Bacteria 9952
201 Ga0114129_10085188 3300009147 Bacteria 4384
202 Ga0105243_10003878 3300009148 Bacteria 11951
203 Ga0105243_10027691 3300009148 Bacteria 4345
204 Ga0105243_10029456 3300009148 Bacteria 4222
205 Ga0105243_10049144 3300009148 Bacteria 3327
206 Ga0105241_10015475 3300009174 Bacteria 5588
207 Ga0105242_10000052 3300009176 Bacteria 79244
208 Ga0105242_10003061 3300009176 Bacteria 13067
209 Ga0105248_10000040 3300009177 Bacteria 172452
210 Ga0105248_10007307 3300009177 Bacteria 12120
211 Ga0105248_10046307 3300009177 Bacteria 4874
212 Ga0105248_10174132 3300009177 Bacteria 2426
213 Ga0105248_10256461 3300009177 Bacteria 1969
214 Ga0105237_10016854 3300009545 Bacteria 7582
215 Ga0105237_10051342 3300009545 Bacteria 4142
216 Ga0105237_10137143 3300009545 Bacteria 2441
217 Ga0105237_10164528 3300009545 Bacteria 2217
218 Ga0105237_10264593 3300009545 Bacteria 1722
219 Ga0105238_10192262 3300009551 Bacteria 2017
220 Ga0105249_10000001 3300009553 Bacteria 504948
221 Ga0105249_10000916 3300009553 Bacteria 26081
222 Ga0105249_10013603 3300009553 Bacteria 7186
223 Ga0105249_10020446 3300009553 Bacteria 5917
224 Ga0105239_10033519 3300010375 Bacteria 5639
225 Ga0105239_10046182 3300010375 Bacteria 4772
226 Ga0105239_10090887 3300010375 Bacteria 3368
227 Ga0105239_10108668 3300010375 Bacteria 3073
228 Ga0105246_10051975 3300011119 Bacteria 2815
229 Ga0105246_10072007 3300011119 Bacteria 2435
230 Ga0105246_10082776 3300011119 Bacteria 2291
231 Ga0157371_10002739 3300013102 Bacteria 16585
232 Ga0157369_10106863 3300013105 Bacteria 2978
233 Ga0157374_10033593 3300013296 Bacteria 4681
234 Ga0157374_10228830 3300013296 Bacteria 1826
235 Ga0157374_10233194 3300013296 Bacteria 1808
236 Ga0157378_10012869 3300013297 Bacteria 7324
237 Ga0157378_10104429 3300013297 Bacteria 2590
238 Ga0163162_10009929 3300013306 Bacteria 9260
239 Ga0163162_10029767 3300013306 Bacteria 5404
240 Ga0163162_10072586 3300013306 Bacteria 3497
241 Ga0163162_10074024 3300013306 Bacteria 3464
242 Ga0163162_10079151 3300013306 Bacteria 3353
243 Ga0163162_10097729 3300013306 Bacteria 3025
244 Ga0163162_10134826 3300013306 Bacteria 2580
245 Ga0163162_10348824 3300013306 Bacteria 1613
246 Ga0157372_10000284 3300013307 Bacteria 56386
247 Ga0157372_10005924 3300013307 Bacteria 13002
248 Ga0157372_10064155 3300013307 Bacteria 4121
249 Ga0157372_10168658 3300013307 Bacteria 2532
250 Ga0157375_10000945 3300013308 Bacteria 25164
251 Ga0157375_10005034 3300013308 Bacteria 11478
252 Ga0157375_10072195 3300013308 Bacteria 3467
253 Ga0157380_10000186 3300014326 Bacteria 35981
254 Ga0157380_10003827 3300014326 Bacteria 10365
255 Ga0157380_10074409 3300014326 Bacteria 2757
256 Ga0157377_10080449 3300014745 Bacteria 1903
257 Ga0157379_10025482 3300014968 Bacteria 5254
258 Ga0157376_10055880 3300014969 Bacteria 3295
259 Ga0163161_10005342 3300017792 Bacteria 8929
260 Ga0206353_10643868 3300020082 Bacteria 4538
261 Ga0213876_10001770 3300021384 Bacteria 13089
262 Ga0213876_10015187 3300021384 Bacteria 4079
263 Ga0213875_10007089 3300021388 Bacteria 5825
264 Ga0209673_1008850 3300025273 Bacteria 4433
265 Ga0209051_1000042 3300025303 Bacteria 308486
266 Ga0209051_1001272 3300025303 Bacteria 22502
267 Ga0209051_1003310 3300025303 Bacteria 10672
268 Ga0209051_1003693 3300025303 Bacteria 9880
269 Ga0207692_10016442 3300025898 Bacteria 3277
270 Ga0207692_10017629 3300025898 Bacteria 3188
271 Ga0207642_10000670 3300025899 Bacteria 10550
272 Ga0207642_10013194 3300025899 Bacteria 3008
273 Ga0207710_10000094 3300025900 Bacteria 118590
274 Ga0207688_10001311 3300025901 Bacteria 12918
275 Ga0207688_10001662 3300025901 Bacteria 11760
276 Ga0207688_10009551 3300025901 Bacteria 5280
277 Ga0207688_10015696 3300025901 Bacteria 4108
278 Ga0207688_10060428 3300025901 Bacteria 2135
279 Ga0207680_10004733 3300025903 Bacteria 6475
280 Ga0207680_10046470 3300025903 Bacteria 2566
281 Ga0207647_10016099 3300025904 Bacteria 5108
282 Ga0207647_10023770 3300025904 Bacteria 4049
283 Ga0207647_10027662 3300025904 Bacteria 3694
284 Ga0207647_10053948 3300025904 Bacteria 2474
285 Ga0207699_10006259 3300025906 Bacteria 5749
286 Ga0207645_10058212 3300025907 Bacteria 2467
287 Ga0207643_10023963 3300025908 Bacteria 3368
288 Ga0207705_10025934 3300025909 Bacteria 4183
289 Ga0207705_10040140 3300025909 Bacteria 3355
290 Ga0207707_10031607 3300025912 Bacteria 4632
291 Ga0207671_10009287 3300025914 Bacteria 8236
292 Ga0207671_10077218 3300025914 Bacteria 2493
293 Ga0207671_10087953 3300025914 Bacteria 2337
294 Ga0207693_10003676 3300025915 Bacteria 13100
295 Ga0207693_10012194 3300025915 Bacteria 6943
296 Ga0207693_10019923 3300025915 Bacteria 5335
297 Ga0207693_10043212 3300025915 Bacteria 3546
298 Ga0207663_10007388 3300025916 Bacteria 5695
299 Ga0207663_10054819 3300025916 Bacteria 2498
300 Ga0207662_10005997 3300025918 Bacteria 6529
301 Ga0207657_10023952 3300025919 Bacteria 5668
302 Ga0207657_10138233 3300025919 Bacteria 1992
303 Ga0207649_10000015 3300025920 Bacteria 245662
304 Ga0207649_10006432 3300025920 Bacteria 6380
305 Ga0207652_10009781 3300025921 Bacteria 7717
306 Ga0207652_10157724 3300025921 Bacteria 2033
307 Ga0207681_10002134 3300025923 Bacteria 12626
308 Ga0207659_10000707 3300025926 Bacteria 19793
309 Ga0207687_10002110 3300025927 Bacteria 13589
310 Ga0207687_10007569 3300025927 Bacteria 7143
311 Ga0207687_10024556 3300025927 Bacteria 4028
312 Ga0207687_10026230 3300025927 Bacteria 3900
313 Ga0207687_10119107 3300025927 Bacteria 1972
314 Ga0207700_10000003 3300025928 Bacteria 500797
315 Ga0207664_10008731 3300025929 Bacteria 7084
316 Ga0207644_10083867 3300025931 Bacteria 2361
317 Ga0207690_10000075 3300025932 Bacteria 85885
318 Ga0207690_10006804 3300025932 Bacteria 6781
319 Ga0207690_10032483 3300025932 Bacteria 3349
320 Ga0207706_10012125 3300025933 Bacteria 7850
321 Ga0207706_10017268 3300025933 Bacteria 6503
322 Ga0207706_10117753 3300025933 Bacteria 2336
323 Ga0207686_10000119 3300025934 Bacteria 64297
324 Ga0207686_10034284 3300025934 Bacteria 3037
325 Ga0207709_10013184 3300025935 Bacteria 4559
326 Ga0207709_10036710 3300025935 Bacteria 2906
327 Ga0207669_10030356 3300025937 Bacteria 3003
328 Ga0207669_10070907 3300025937 Bacteria 2187
329 Ga0207704_10008206 3300025938 Bacteria 4977
330 Ga0207704_10024642 3300025938 Bacteria 3267
331 Ga0207704_10025069 3300025938 Bacteria 3248
332 Ga0207665_10009146 3300025939 Bacteria 6503
333 Ga0207711_10000011 3300025941 Bacteria 518817
334 Ga0207711_10000419 3300025941 Bacteria 44875
335 Ga0207711_10007828 3300025941 Bacteria 8931
336 Ga0207711_10015373 3300025941 Bacteria 6352
337 Ga0207689_10006344 3300025942 Bacteria 10474
338 Ga0207689_10010392 3300025942 Bacteria 8018
339 Ga0207689_10028771 3300025942 Bacteria 4647
340 Ga0207689_10043062 3300025942 Bacteria 3732
341 Ga0207661_10000438 3300025944 Bacteria 26840
342 Ga0207661_10001594 3300025944 Bacteria 15404
343 Ga0207661_10179866 3300025944 Bacteria 1847
344 Ga0207679_10006499 3300025945 Bacteria 7388
345 Ga0207712_10000006 3300025961 Bacteria 573204
346 Ga0207712_10000994 3300025961 Bacteria 20219
347 Ga0207712_10027061 3300025961 Bacteria 3826
348 Ga0207712_10043652 3300025961 Bacteria 3094
349 Ga0207712_10082501 3300025961 Bacteria 2344
350 Ga0207712_10088424 3300025961 Bacteria 2275
351 Ga0207668_10000972 3300025972 Bacteria 17220
352 Ga0207668_10004404 3300025972 Bacteria 8272
353 Ga0207668_10069075 3300025972 Bacteria 2514
354 Ga0207668_10119262 3300025972 Bacteria 1994
355 Ga0207658_10000513 3300025986 Bacteria 35348
356 Ga0207658_10001083 3300025986 Bacteria 22062
357 Ga0207658_10004107 3300025986 Bacteria 10155
358 Ga0207658_10011128 3300025986 Bacteria 6127
359 Ga0207677_10017030 3300026023 Bacteria 4320
360 Ga0207677_10068318 3300026023 Bacteria 2493
361 Ga0207677_10083694 3300026023 Bacteria 2297
362 Ga0207703_10008803 3300026035 Bacteria 7958
363 Ga0207639_10042649 3300026041 Bacteria 3401
364 Ga0207639_10042898 3300026041 Bacteria 3393
365 Ga0207678_10018936 3300026067 Bacteria 6050
366 Ga0207678_10036639 3300026067 Bacteria 4270
367 Ga0207678_10042158 3300026067 Bacteria 3956
368 Ga0207678_10058204 3300026067 Bacteria 3325
369 Ga0207678_10181705 3300026067 Bacteria 1796
370 Ga0207708_10009808 3300026075 Bacteria 7106
371 Ga0207702_10000419 3300026078 Bacteria 48574
372 Ga0207702_10100883 3300026078 Bacteria 2548
373 Ga0207702_10111204 3300026078 Bacteria 2436
374 Ga0207641_10000489 3300026088 Bacteria 44684
375 Ga0207641_10022045 3300026088 Bacteria 5238
376 Ga0207648_10006599 3300026089 Bacteria 11521
377 Ga0207676_10003416 3300026095 Bacteria 11230
378 Ga0207674_10029086 3300026116 Bacteria 5824
379 Ga0207674_10036548 3300026116 Bacteria 5115
380 Ga0207675_100000896 3300026118 Bacteria 29755
381 Ga0207675_100002895 3300026118 Bacteria 16878
382 Ga0207675_100018303 3300026118 Bacteria 6532
383 Ga0207675_100055105 3300026118 Bacteria 3709
384 Ga0207683_10003700 3300026121 Bacteria 13285
385 Ga0207683_10012181 3300026121 Bacteria 7341
386 Ga0207683_10097115 3300026121 Bacteria 2627
387 Ga0207698_10000015 3300026142 Bacteria 207368
388 Ga0207698_10096122 3300026142 Bacteria 2441
389 Ga0207428_10001010 3300027907 Bacteria 31237
390 Ga0207428_10011064 3300027907 Bacteria 8017
391 Ga0207428_10036585 3300027907 Bacteria 4003
392 Ga0207428_10108580 3300027907 Bacteria 2137
393 Ga0207428_10113006 3300027907 Bacteria 2088
394 Ga0268266_10000485 3300028379 Bacteria 57051
395 Ga0268266_10001186 3300028379 Bacteria 32148
396 Ga0268266_10016797 3300028379 Bacteria 6257
397 Ga0268266_10031366 3300028379 Bacteria 4512
398 Ga0268266_10121722 3300028379 Bacteria 2322
399 Ga0268265_10000032 3300028380 Bacteria 225953
400 Ga0268265_10003823 3300028380 Bacteria 10667
401 Ga0268265_10039720 3300028380 Bacteria 3470
402 Ga0268265_10128307 3300028380 Bacteria 2103
403 Ga0268265_10186493 3300028380 Bacteria 1787
404 Ga0268265_10219233 3300028380 Bacteria 1663
405 Ga0268264_10000026 3300028381 Bacteria 459088
406 Ga0268264_10081582 3300028381 Bacteria 2764
407 Ga0268264_10287849 3300028381 Bacteria 1542
408 Ga0265337_1000012 3300028556 Bacteria 85395
409 Ga0265326_10000007 3300028558 Bacteria 223057
410 Ga0265319_1001040 3300028563 Bacteria 17346
411 Ga0265334_10000094 3300028573 Bacteria 63340
412 Ga0265322_10000001 3300028654 Bacteria 543854
413 Ga0265336_10004740 3300028666 Bacteria 5100
414 Ga0265336_10008731 3300028666 Bacteria 3536
415 Ga0265338_10003073 3300028800 Bacteria 23964
416 Ga0265338_10039663 3300028800 Bacteria 4438
417 Ga0265324_10001935 3300029957 Bacteria 11108
418 Ga0265324_10011287 3300029957 Bacteria 3409
419 Ga0265332_10009702 3300031238 Bacteria 4295
420 Ga0265328_10000659 3300031239 Bacteria 16018
421 Ga0265320_10000002 3300031240 Bacteria 542875
422 Ga0265329_10002237 3300031242 Bacteria 8915
423 Ga0265331_10000919 3300031250 Bacteria 23588
424 Ga0265327_10000011 3300031251 Bacteria 543807
425 Ga0265327_10000626 3300031251 Bacteria 58052
426 Ga0265327_10017384 3300031251 Bacteria 4515
427 Ga0265327_10067674 3300031251 Bacteria 1798
428 Ga0307513_10004621 3300031456 Bacteria 18332
429 Ga0307408_100009103 3300031548 Bacteria 6550
430 Ga0316575_10000856 3300031665 Bacteria 9329
431 Ga0316579_10000197 3300031691 Bacteria 17803
432 Ga0265314_10000224 3300031711 Bacteria 84325
433 Ga0265314_10087093 3300031711 Bacteria 2043
434 Ga0316576_10000472 3300031727 Bacteria 18887
435 Ga0316576_10071005 3300031727 Bacteria 2568
436 Ga0316578_10002095 3300031728 Bacteria 8556
437 Ga0316578_10029750 3300031728 Bacteria 3101
438 Ga0307405_10012822 3300031731 Bacteria 4453
439 Ga0307405_10021001 3300031731 Bacteria 3662
440 Ga0307413_10003082 3300031824 Bacteria 6931
441 Ga0307413_10008230 3300031824 Bacteria 4908
442 Ga0307413_10013804 3300031824 Bacteria 4078
443 Ga0307410_10048177 3300031852 Bacteria 2852
444 Ga0326468_10000144 3300031889 Bacteria 6750
445 Ga0307406_10000212 3300031901 Bacteria 35056
446 Ga0307406_10003159 3300031901 Bacteria 8964
447 Ga0307406_10008888 3300031901 Bacteria 5614
448 Ga0307407_10011467 3300031903 Bacteria 4219
449 Ga0307407_10023004 3300031903 Bacteria 3244
450 Ga0307412_10020831 3300031911 Bacteria 3997
451 Ga0307409_100000273 3300031995 Bacteria 20946
452 Ga0307409_100039242 3300031995 Bacteria 3511
453 Ga0307409_100069954 3300031995 Bacteria 2783
454 Ga0307409_100114239 3300031995 Bacteria 2271
455 Ga0307416_100024902 3300032002 Bacteria 4377
456 Ga0307416_100100022 3300032002 Bacteria 2520
457 Ga0307416_100333315 3300032002 Bacteria 1526
458 Ga0307414_10043440 3300032004 Bacteria 3061
459 Ga0307414_10060645 3300032004 Bacteria 2676
460 Ga0307414_10065657 3300032004 Bacteria 2590
461 Ga0307411_10030039 3300032005 Bacteria 3327
462 Ga0307411_10066141 3300032005 Bacteria 2427
463 Ga0307411_10089911 3300032005 Bacteria 2140
464 Ga0307411_10116855 3300032005 Bacteria 1921
465 Ga0307415_100002934 3300032126 Bacteria 8555
466 Ga0307415_100014609 3300032126 Bacteria 4623
467 Ga0307507_10116584 3300033179 Bacteria 2157
468 Ga0373926_0018656 3300035083 Bacteria 2388
469 Ga0373940_0015452 3300035088 Bacteria 1878
470 Ga0373923_0025185 3300035111 Bacteria 2356
471 Ga0373936_0038871 3300035113 Bacteria 1903
472 Ga0373945_0034978 3300035116 Bacteria 1793
473 Ga0373943_0019111 3300035170 Bacteria 3150
474 Ga0373946_0027023 3300035171 Bacteria 2267
475 Ga0373962_0012023 3300035242 Bacteria 2177
476 Ga0316574_0021377 3300035398 Bacteria 3841
477 Ga0316574_0050231 3300035398 Bacteria 2595
478 Ga0316574_0059543 3300035398 Bacteria 2395
479 Ga0373931_0011804 3300035691 Bacteria 4223
480 Ga0373931_0049431 3300035691 Bacteria 2233
481 Ga0373935_0012382 3300035692 Bacteria 5132
482 Ga0373927_0058976 3300035695 Bacteria 2482
483 Ga0373947_0025273 3300035725 Bacteria 3463
484 Ga0373937_0012589 3300036401 Bacteria 7444
485 Ga0316582_0000099 3300036647 Bacteria 23809
486 Ga0316584_0011486 3300036712 Bacteria 6224
487 Ga0316584_0017792 3300036712 Bacteria 5117
488 Ga0316584_0032919 3300036712 Bacteria 3837
489 Ga0373925_0114583 3300037068 Bacteria 2086
490 Ga0395899_0031667 3300037312 Bacteria 3974
491 Ga0395900_0008269 3300037418 Bacteria 10715
492 Ga0395900_0113694 3300037418 Bacteria 2778
493 Ga0395898_0005178 3300037466 Bacteria 14109
494 Ga0395898_0006290 3300037466 Bacteria 12693
495 Ga0395898_0011426 3300037466 Bacteria 9222
496 Ga0395898_0048546 3300037466 Bacteria 4162
497 Ga0395905_0004214 3300037471 Bacteria 15037
498 Ga0395905_0041668 3300037471 Bacteria 4309
499 Ga0395905_0053436 3300037471 Bacteria 3781
500 Ga0395905_0123278 3300037471 Bacteria 2437
501 Ga0436364_0908867 3300037853 Bacteria 5649
502 Ga0436364_1011521 3300037853 Bacteria 14844
503 Ga0436364_1192519 3300037853 Bacteria 17220
504 Ga0436364_1442254 3300037853 Bacteria 7087
505 Ga0395901_0003473 3300038443 Bacteria 15871
506 Ga0395901_0012501 3300038443 Bacteria 8614
507 Ga0395901_0045998 3300038443 Bacteria 4531
508 Ga0395901_0074150 3300038443 Bacteria 3550
509 Ga0395901_0170831 3300038443 Bacteria 2281
510 Ga0242420_004140 3300038996 Bacteria 2180
511 Ga0436365_0064899 3300039437 Bacteria 12232
512 Ga0436365_0641890 3300039437 Bacteria 23847
513 Ga0436365_1856170 3300039437 Bacteria 22649
514 Ga0436362_1177671 3300039453 Bacteria 2709
515 Ga0439466_0001181 3300041411 Bacteria 10165
516 Ga0439466_0006248 3300041411 Bacteria 4533
517 Ga0439466_0010202 3300041411 Bacteria 3493
518 Ga0439465_0001503 3300041413 Bacteria 7562
519 Ga0439465_0026450 3300041413 Bacteria 1835
520 Ga0451833_0918545 3300041491 Bacteria 4797
521 Ga0451837_0394872 3300041494 Bacteria 1923
522 Ga0439450_001482 3300042008 Bacteria 3454
523 Ga0439463_003079 3300042016 Bacteria 4234
524 Ga0439459_0009821 3300042438 Bacteria 1658
525 Ga0439464_0014935 3300042439 Bacteria 2093
526 Ga0439440_0003643 3300042993 Bacteria 2986
527 Ga0466972_0007601 3300044658 Bacteria 5442
528 Ga0466972_0013868 3300044658 Bacteria 4045
529 Ga0466965_0005448 3300044683 Bacteria 5735
530 Ga0466966_0016384 3300044684 Bacteria 4898
531 Ga0466966_0031501 3300044684 Bacteria 3438
532 Ga0466966_0033360 3300044684 Bacteria 3334
533 Ga0466961_0008896 3300044693 Bacteria 6404
534 Ga0466961_0057918 3300044693 Bacteria 2465
535 Ga0466963_0003743 3300044694 Bacteria 8759
536 Ga0466968_0001398 3300044735 Bacteria 8636
537 Ga0466970_0009706 3300044765 Bacteria 4869
538 Ga0466970_0025734 3300044765 Bacteria 3082
539 Ga0466970_0030982 3300044765 Bacteria 2823
540 Ga0466970_0032132 3300044765 Bacteria 2773
541 Ga0466957_0008957 3300044842 Bacteria 5705
542 Ga0466957_0037436 3300044842 Bacteria 2921
543 Ga0466957_0058481 3300044842 Bacteria 2362
544 Ga0466960_0006440 3300044901 Bacteria 4710
545 Ga0466960_0010724 3300044901 Bacteria 3812
546 Ga0466960_0081961 3300044901 Bacteria 1628
547 Ga0466959_0063426 3300045049 Bacteria 2683
548 Ga0466959_0105976 3300045049 Bacteria 2010
549 Ga0466958_0001373 3300045836 Bacteria 11504
550 Ga0466958_0067657 3300045836 Bacteria 2182
551 Ga0466958_0075000 3300045836 Bacteria 2074
552 Ga0466958_0075647 3300045836 Bacteria 2066
553 Ga0466967_0010537 3300045976 Bacteria 6942
554 Ga0466967_0038601 3300045976 Bacteria 4097
555 Ga0466967_0043750 3300045976 Bacteria 3879
556 Ga0466967_0047433 3300045976 Bacteria 3745
557 Ga0466967_0088839 3300045976 Bacteria 2805
558 Ga0466967_0090174 3300045976 Bacteria 2785
559 Ga0466967_0096159 3300045976 Bacteria 2701
560 Ga0495592_0057277 3300046454 Bacteria 2877
561 Ga0495629_0000899 3300046459 Bacteria 23864
562 Ga0495629_0051881 3300046459 Bacteria 2870
563 Ga0495638_0019649 3300046460 Bacteria 4468
564 Ga0495641_0027036 3300046461 Bacteria 2794
565 Ga0495641_0040289 3300046461 Bacteria 2173
566 Ga0495651_0004912 3300046462 Bacteria 10227
567 Ga0495651_0070075 3300046462 Bacteria 2669
568 Ga0495653_0049986 3300046463 Bacteria 3217
569 Ga0495662_0040659 3300046476 Bacteria 2245
570 Ga0495664_0041217 3300046477 Bacteria 2731
571 Ga0495594_0000012 3300046499 Bacteria 105133
572 Ga0495608_0016334 3300046511 Bacteria 5136
573 Ga0495620_0036222 3300046515 Bacteria 2209
574 Ga0495630_0001450 3300046517 Bacteria 16430
575 Ga0495630_0089710 3300046517 Bacteria 2322
576 Ga0495637_0043437 3300046520 Bacteria 1918
577 Ga0495652_0032691 3300046529 Bacteria 4547
578 Ga0495665_0041579 3300046531 Bacteria 2447
579 Ga0495622_0000076 3300046557 Bacteria 86777
580 Ga0495667_0001386 3300046559 Bacteria 15954
581 Ga0495668_0099388 3300046616 Bacteria 1592
582 Ga0495611_0028032 3300046648 Bacteria 2466
583 Ga0495635_0035246 3300046663 Bacteria 3470
584 Ga0495661_0081058 3300046665 Bacteria 1871
585 Ga0495588_0000247 3300046674 Bacteria 45295
586 Ga0495657_0099895 3300046675 Bacteria 1850
587 Ga0495599_0032632 3300046678 Bacteria 3269
588 Ga0495647_0000307 3300046681 Bacteria 13755
589 Ga0495647_0040683 3300046681 Bacteria 1767
590 Ga0495613_0000132 3300046689 Bacteria 74233
591 Ga0495624_0000196 3300046690 Bacteria 46319
592 Ga0495624_0041006 3300046690 Bacteria 2963
593 Ga0495671_0054600 3300046692 Bacteria 1980
594 Ga0495649_0090744 3300046694 Bacteria 1629
595 Ga0495589_0059270 3300046794 Bacteria 1882
596 Ga0495600_0010574 3300046809 Bacteria 5730
597 Ga0495581_0078165 3300047315 Bacteria 1915
598 Ga0495604_0000448 3300047317 Bacteria 36537
599 Ga0495672_0008631 3300047320 Bacteria 7495
600 Ga0495676_0045128 3300047321 Bacteria 3590
601 Ga0495680_0012579 3300047322 Bacteria 7437
602 Ga0495680_0079033 3300047322 Bacteria 2488
603 Ga0495680_0165455 3300047322 Bacteria 1604
604 Ga0495675_0109406 3300047444 Bacteria 1726
605 Ga0495677_0019440 3300047445 Bacteria 2463
606 Ga0495673_0016778 3300047469 Bacteria 3734
607 Ga0495684_0107659 3300047471 Bacteria 2105
608 Ga0495686_0085374 3300047472 Bacteria 1922
609 Ga0495593_0053739 3300047673 Bacteria 2125
610 Ga0495602_0034328 3300048088 Bacteria 4747
611 Ga0495626_0044170 3300048091 Bacteria 2087
612 Ga0496100_0000115 3300048903 Bacteria 45942
613 Ga0496100_0000248 3300048903 Bacteria 28219
614 Ga0496100_0002933 3300048903 Bacteria 8767
615 Ga0496100_0016650 3300048903 Bacteria 4322
616 Ga0496100_0041825 3300048903 Bacteria 2924
617 Ga0496100_0073614 3300048903 Bacteria 2287
618 Ga0496101_0000031 3300048904 Bacteria 195195
619 Ga0496101_0000262 3300048904 Bacteria 37343
620 Ga0496101_0001407 3300048904 Bacteria 14398
621 Ga0496101_0010040 3300048904 Bacteria 6238
622 Ga0496101_0012992 3300048904 Bacteria 5570
623 Ga0496101_0027119 3300048904 Bacteria 3986
624 Ga0496101_0044251 3300048904 Bacteria 3185
625 Ga0496102_0000011 3300048905 Bacteria 321716
626 Ga0496102_0000129 3300048905 Bacteria 104478
627 Ga0496102_0000427 3300048905 Bacteria 48669
628 Ga0496102_0000473 3300048905 Bacteria 44556
629 Ga0496102_0002046 3300048905 Bacteria 17412
630 Ga0496102_0002055 3300048905 Bacteria 17349
631 Ga0496102_0006363 3300048905 Bacteria 10069
632 Ga0496102_0011131 3300048905 Bacteria 7747
633 Ga0496102_0011180 3300048905 Bacteria 7730
634 Ga0496102_0051271 3300048905 Bacteria 3759
635 Ga0496102_0073611 3300048905 Bacteria 3139
636 Ga0496102_0096456 3300048905 Bacteria 2741
637 Ga0496102_0101390 3300048905 Bacteria 2674
638 Ga0496102_0174137 3300048905 Bacteria 2026
639 Ga0496102_0236043 3300048905 Bacteria 1724
640 Ga0496103_0000087 3300048906 Bacteria 104566
641 Ga0496103_0000124 3300048906 Bacteria 83703
642 Ga0496103_0000228 3300048906 Bacteria 54634
643 Ga0496103_0000577 3300048906 Bacteria 28994
644 Ga0496103_0000826 3300048906 Bacteria 22737
645 Ga0496103_0004385 3300048906 Bacteria 8563
646 Ga0496103_0009160 3300048906 Bacteria 5862
647 Ga0496103_0013663 3300048906 Bacteria 4817
648 Ga0496103_0020956 3300048906 Bacteria 3930
649 Ga0496103_0063027 3300048906 Bacteria 2308
650 Ga0496103_0074754 3300048906 Bacteria 2124
651 Ga0496104_0000004 3300048907 Bacteria 641830
652 Ga0496104_0001982 3300048907 Bacteria 17745
653 Ga0496104_0004190 3300048907 Bacteria 12525
654 Ga0496104_0012997 3300048907 Bacteria 7494
655 Ga0496104_0017430 3300048907 Bacteria 6539
656 Ga0496104_0047233 3300048907 Bacteria 4058
657 Ga0496104_0058256 3300048907 Bacteria 3656
658 Ga0496104_0199897 3300048907 Bacteria 1911
659 Ga0496105_0000001 3300048908 Bacteria 1328178
660 Ga0496105_0004544 3300048908 Bacteria 10454
661 Ga0496105_0004639 3300048908 Bacteria 10358
662 Ga0496105_0011165 3300048908 Bacteria 7085
663 Ga0496105_0029867 3300048908 Bacteria 4463
664 Ga0496105_0071975 3300048908 Bacteria 2857
665 Ga0496105_0087370 3300048908 Bacteria 2576
666 Ga0496106_0003914 3300048909 Bacteria 11116
667 Ga0496106_0008140 3300048909 Bacteria 7744
668 Ga0496106_0008855 3300048909 Bacteria 7439
669 Ga0496106_0056607 3300048909 Bacteria 2964
670 Ga0496106_0132073 3300048909 Bacteria 1959
671 Ga0496107_0006162 3300048910 Bacteria 8238
672 Ga0496107_0033034 3300048910 Bacteria 3701
673 Ga0496107_0056099 3300048910 Bacteria 2846
674 Ga0496107_0079709 3300048910 Bacteria 2387
675 Ga0496107_0082343 3300048910 Bacteria 2347
676 Ga0496107_0092966 3300048910 Bacteria 2205
677 Ga0496108_0000005 3300048911 Bacteria 535059
678 Ga0496108_0002448 3300048911 Bacteria 14844
679 Ga0496108_0002714 3300048911 Bacteria 14144
680 Ga0496108_0013790 3300048911 Bacteria 6592
681 Ga0496108_0015909 3300048911 Bacteria 6132
682 Ga0496108_0176697 3300048911 Bacteria 1848
683 Ga0496109_0000002 3300048912 Bacteria 443393
684 Ga0496109_0000882 3300048912 Bacteria 25056
685 Ga0496109_0002062 3300048912 Bacteria 16675
686 Ga0496109_0029930 3300048912 Bacteria 4880
687 Ga0496109_0041287 3300048912 Bacteria 4179
688 Ga0496109_0042404 3300048912 Bacteria 4121
689 Ga0496109_0061436 3300048912 Bacteria 3435
690 Ga0496109_0095485 3300048912 Bacteria 2753
691 Ga0496109_0153541 3300048912 Bacteria 2156
692 Ga0496109_0160547 3300048912 Bacteria 2106
693 Ga0496110_0000185 3300048913 Bacteria 39094
694 Ga0496110_0000649 3300048913 Bacteria 23779
695 Ga0496110_0022898 3300048913 Bacteria 5309
696 Ga0496110_0041812 3300048913 Bacteria 4001
697 Ga0496110_0046947 3300048913 Bacteria 3779
698 Ga0496111_0000119 3300048914 Bacteria 34223
699 Ga0496111_0002441 3300048914 Bacteria 11230
700 Ga0496111_0024253 3300048914 Bacteria 4268
701 Ga0496111_0086151 3300048914 Bacteria 2298
702 Ga0496112_0001010 3300048915 Bacteria 20632
703 Ga0496112_0002266 3300048915 Bacteria 15385
704 Ga0496112_0016420 3300048915 Bacteria 6935
705 Ga0496112_0032910 3300048915 Bacteria 5035
706 Ga0496112_0057285 3300048915 Bacteria 3836
707 Ga0496112_0086219 3300048915 Bacteria 3107
708 Ga0496113_0000017 3300048916 Bacteria 74327
709 Ga0496114_0000153 3300048917 Bacteria 50028
710 Ga0496114_0000178 3300048917 Bacteria 45143
711 Ga0496114_0004178 3300048917 Bacteria 11181
712 Ga0496114_0008010 3300048917 Bacteria 8360
713 Ga0496114_0015102 3300048917 Bacteria 6209
714 Ga0496114_0018264 3300048917 Bacteria 5668
715 Ga0496114_0028182 3300048917 Bacteria 4606
716 Ga0496114_0049855 3300048917 Bacteria 3484
717 Ga0496114_0065222 3300048917 Bacteria 3051
718 Ga0496114_0074918 3300048917 Bacteria 2850
719 Ga0496114_0131567 3300048917 Bacteria 2161
720 Ga0496114_0146011 3300048917 Bacteria 2050
721 Ga0496115_0004346 3300048918 Bacteria 10254
722 Ga0496115_0061463 3300048918 Bacteria 3028
723 Ga0496115_0093219 3300048918 Bacteria 2462
724 Ga0496116_0000297 3300048919 Bacteria 83713
725 Ga0496116_0005593 3300048919 Bacteria 11581
726 Ga0496116_0076529 3300048919 Bacteria 2095
727 Ga0496117_0000039 3300048920 Bacteria 322143
728 Ga0496117_0001007 3300048920 Bacteria 43130
729 Ga0496118_0000035 3300048921 Bacteria 322143
730 Ga0496118_0000857 3300048921 Bacteria 48262
731 Ga0496118_0001227 3300048921 Bacteria 39393
732 Ga0496118_0001272 3300048921 Bacteria 38676
733 Ga0496119_0000286 3300048922 Bacteria 70906
734 Ga0496119_0001211 3300048922 Bacteria 32228
735 Ga0496119_0006092 3300048922 Bacteria 11298
736 Ga0496119_0013479 3300048922 Bacteria 6505
737 Ga0496120_0001566 3300048923 Bacteria 26762
738 Ga0496120_0032496 3300048923 Bacteria 3146
739 Ga0496121_0000014 3300048924 Bacteria 609379
740 Ga0496121_0000425 3300048924 Bacteria 82887
741 Ga0496121_0001945 3300048924 Bacteria 32921
742 Ga0496121_0033354 3300048924 Bacteria 4660
743 Ga0496122_0000132 3300048925 Bacteria 172228
744 Ga0496122_0021059 3300048925 Bacteria 5856
745 Ga0496123_0006535 3300048926 Bacteria 11261
746 Ga0496123_0009503 3300048926 Bacteria 8750
747 Ga0496123_0031449 3300048926 Bacteria 3861
748 Ga0496124_0000106 3300048927 Bacteria 172511
749 Ga0496124_0049234 3300048927 Bacteria 3595
750 Ga0496124_0119605 3300048927 Bacteria 2107
751 Ga0496125_0000014 3300048928 Bacteria 610124
752 Ga0496125_0005528 3300048928 Bacteria 13995
753 Ga0496126_0000017 3300048929 Bacteria 610676
754 Ga0496126_0000666 3300048929 Bacteria 63592
755 Ga0496126_0002345 3300048929 Bacteria 25883
756 Ga0496126_0002811 3300048929 Bacteria 22838
757 Ga0496126_0030074 3300048929 Bacteria 5152
758 Ga0496126_0127491 3300048929 Bacteria 2202
759 Ga0496126_0132159 3300048929 Bacteria 2156
760 Ga0501031_0000115 3300049568 Bacteria 43139
761 Ga0501031_0000689 3300049568 Bacteria 20159
762 Ga0501032_0000052 3300049569 Bacteria 101001
763 Ga0501032_0003025 3300049569 Bacteria 13037
764 Ga0501033_0003226 3300049570 Bacteria 13490
765 Ga0501033_0081573 3300049570 Bacteria 2372
766 Ga0501034_0003913 3300049571 Bacteria 16733
767 Ga0501034_0007479 3300049571 Bacteria 11623
768 Ga0501034_0007562 3300049571 Bacteria 11562
769 Ga0501034_0009939 3300049571 Bacteria 9944
770 Ga0501034_0018093 3300049571 Bacteria 7231
771 Ga0501034_0042719 3300049571 Bacteria 4589
772 Ga0501034_0077054 3300049571 Bacteria 3340
773 Ga0501036_0000061 3300049572 Bacteria 71856
774 Ga0501036_0007304 3300049572 Bacteria 9001
775 Ga0501036_0007724 3300049572 Bacteria 8787
776 Ga0501037_0000046 3300049573 Bacteria 116524
777 Ga0501037_0000759 3300049573 Bacteria 24321
778 Ga0501037_0009351 3300049573 Bacteria 7195
779 Ga0501037_0032693 3300049573 Bacteria 3843
780 Ga0501038_0000068 3300049574 Bacteria 84886
781 Ga0501038_0001047 3300049574 Bacteria 24924
782 Ga0501038_0037505 3300049574 Bacteria 4249
783 Ga0501039_0000292 3300049575 Bacteria 35532
784 Ga0501039_0007114 3300049575 Bacteria 8525
785 Ga0501039_0015833 3300049575 Bacteria 5774
786 Ga0501039_0017339 3300049575 Bacteria 5525
787 Ga0501039_0089429 3300049575 Bacteria 2400
788 Ga0501039_0125632 3300049575 Bacteria 2012
789 Ga0501041_0018231 3300049577 Bacteria 4180
790 Ga0501041_0089571 3300049577 Bacteria 1899
791 Ga0501042_0083451 3300049578 Bacteria 2291
792 Ga0501043_0000340 3300049579 Bacteria 42317
793 Ga0501043_0006218 3300049579 Bacteria 9591
794 Ga0501043_0012119 3300049579 Bacteria 6741
795 Ga0501043_0019541 3300049579 Bacteria 5317
796 Ga0501043_0119895 3300049579 Bacteria 2063
797 Ga0501046_0000102 3300049580 Bacteria 89938
798 Ga0501046_0000695 3300049580 Bacteria 32596
799 Ga0501046_0013449 3300049580 Bacteria 6928
800 Ga0501047_0001039 3300049581 Bacteria 27771
801 Ga0501047_0005250 3300049581 Bacteria 12168
802 Ga0501047_0006620 3300049581 Bacteria 10899
803 Ga0501048_0000006 3300049582 Bacteria 93252
804 Ga0501048_0001635 3300049582 Bacteria 17071
805 Ga0501048_0086500 3300049582 Bacteria 2211
806 Ga0501067_0001571 3300049583 Bacteria 12490
807 Ga0501067_0008217 3300049583 Bacteria 5795
808 Ga0501068_0014755 3300049584 Bacteria 4471
809 Ga0501068_0021950 3300049584 Bacteria 3731
810 Ga0501069_0005606 3300049585 Bacteria 6529
811 Ga0501069_0052816 3300049585 Bacteria 2264
812 Ga0501070_0000139 3300049586 Bacteria 65962
813 Ga0501070_0001449 3300049586 Bacteria 21219
814 Ga0501071_0028813 3300049587 Bacteria 3915
815 Ga0501071_0048989 3300049587 Bacteria 3040
816 Ga0501072_0001960 3300049588 Bacteria 15333
817 Ga0501072_0005664 3300049588 Bacteria 9511
818 Ga0501074_0000256 3300049590 Bacteria 30065
819 Ga0501074_0007580 3300049590 Bacteria 7853
820 Ga0501075_0013424 3300049591 Bacteria 5844
821 Ga0501076_0001319 3300049592 Bacteria 16559
822 Ga0501076_0124969 3300049592 Bacteria 2084
823 Ga0501077_0002277 3300049593 Bacteria 11562
824 Ga0501079_0003278 3300049741 Bacteria 11859
825 Ga0501080_0000051 3300049742 Bacteria 75804
826 Ga0501081_0007069 3300049743 Bacteria 7297
827 Ga0501081_0009280 3300049743 Bacteria 6408
828 Ga0501083_0002108 3300049744 Bacteria 13653
829 Ga0501035_0000321 3300049822 Bacteria 55455
830 Ga0501035_0021506 3300049822 Bacteria 5930
831 Ga0501035_0137976 3300049822 Bacteria 2122
832 Ga0501044_0000137 3300049823 Bacteria 89352
833 Ga0501044_0014259 3300049823 Bacteria 8582
834 Ga0501044_0093370 3300049823 Bacteria 3034
835 Ga0501044_0098533 3300049823 Bacteria 2943
836 Ga0501045_0000759 3300049824 Bacteria 20665
837 Ga0501045_0004172 3300049824 Bacteria 9983
838 nmdc:mga03n38_2544_c1 3300050490 Bacteria 5659
839 nmdc:mga03n38_2774_c1 3300050490 Bacteria 5501
840 nmdc:mga03n38_43742_c1 3300050490 Bacteria 1964
841 nmdc:mga00v17_1112_c1 3300050491 Bacteria 14123
842 nmdc:mga00v17_1395_c1 3300050491 Bacteria 11472
843 nmdc:mga00v17_18036_c1 3300050491 Bacteria 4006
844 nmdc:mga00v17_21287_c1 3300050491 Bacteria 3726
845 nmdc:mga00v17_26340_c1 3300050491 Bacteria 3387
846 nmdc:mga00v17_55615_c1 3300050491 Bacteria 2417
847 nmdc:mga0yw44_17378_c1 3300050492 Bacteria 3913
848 nmdc:mga0yw44_1762_c1 3300050492 Bacteria 8818
849 nmdc:mga0yw44_3292_c1 3300050492 Bacteria 7141
850 nmdc:mga0yw44_34620_c1 3300050492 Bacteria 2960
851 nmdc:mga0yw44_4326_c1 3300050492 Bacteria 6486
852 nmdc:mga0yw44_4737_c1 3300050492 Bacteria 6300
853 nmdc:mga06z11_10749_c1 3300050494 Bacteria 3915
854 nmdc:mga04h51_21315_c1 3300050495 Bacteria 1948
855 nmdc:mga07m45_23424_c1 3300050496 Bacteria 3375
856 nmdc:mga07m45_41212_c1 3300050496 Bacteria 2585
857 nmdc:mga07m45_6183_c1 3300050496 Bacteria 6039
858 nmdc:mga07m45_8326_c1 3300050496 Bacteria 5326
859 nmdc:mga05p37_22514_c1 3300050507 Bacteria 7642
860 nmdc:mga05p37_60697_c1 3300050507 Bacteria 4655
861 nmdc:mga09592_105574_c1 3300050508 Bacteria 2415
862 nmdc:mga06r32_166033_c1 3300050510 Bacteria 2190
863 nmdc:mga06r32_181758_c1 3300050510 Bacteria 2089
864 nmdc:mga06r32_25842_c1 3300050510 Bacteria 5466
865 nmdc:mga06r32_36408_c1 3300050510 Bacteria 4649
866 nmdc:mga06r32_6628_c1 3300050510 Bacteria 10407
867 nmdc:mga08y16_101120_c1 3300050511 Bacteria 3001
868 nmdc:mga08y16_132329_c1 3300050511 Bacteria 2593
869 nmdc:mga08y16_6449_c1 3300050511 Bacteria 12306
870 nmdc:mga08y16_7008_c1 3300050511 Bacteria 11820
871 nmdc:mga08y16_80980_c1 3300050511 Bacteria 3386
872 nmdc:mga0n895_70602_c1 3300050512 Bacteria 3462
873 nmdc:mga0n895_74334_c1 3300050512 Bacteria 3376
874 nmdc:mga0n895_8375_c1 3300050512 Bacteria 8950
875 nmdc:mga0rr50_1370_c1 3300050513 Bacteria 13349
876 nmdc:mga0rr50_42753_c1 3300050513 Bacteria 3311
877 nmdc:mga08x19_1536_c1 3300050514 Bacteria 14321
878 nmdc:mga08x19_51315_c1 3300050514 Bacteria 2649
879 nmdc:mga0a205_34993_c1 3300050515 Bacteria 4823
880 nmdc:mga0a205_783_c2 3300050515 Bacteria 17242
881 nmdc:mga0sz30_1720_c1 3300050516 Bacteria 7765
882 nmdc:mga0sz30_31391_c1 3300050516 Bacteria 2198
883 nmdc:mga0sz30_9291_c1 3300050516 Bacteria 3167
884 Ga0495601_0000029 3300053077 Bacteria 111437
885 Ga0500610_0001987 3300053079 Bacteria 7296
886 Ga0495655_0000010 3300053083 Bacteria 125615
887 Ga0500641_0000526 3300053096 Bacteria 13777
888 Ga0500641_0004436 3300053096 Bacteria 4963
889 Ga0500562_001179 3300053108 Bacteria 6445
890 Ga0500628_000024 3300053129 Bacteria 64538
891 Ga0500568_0000039 3300053139 Bacteria 134018
892 Ga0500616_0000535 3300053153 Bacteria 47523
893 Ga0500616_0002876 3300053153 Bacteria 13812
894 Ga0500616_0007902 3300053153 Bacteria 6684
895 Ga0500616_0038579 3300053153 Bacteria 2580
896 Ga0500645_000063 3300053730 Bacteria 85018
897 Ga0501084_0001328 3300054114 Bacteria 19507
898 Ga0501084_0116680 3300054114 Bacteria 2244
899 Ga0501082_0003048 3300060353 Bacteria 14621
900 Ga0501082_0065353 3300060353 Bacteria 3133
901 Ga0466962_0014986 3300061719 Bacteria 3736

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100032045 Ga0070665_1000320452 436
2 3300025903 Ga0207680_10004733 Ga0207680_100047334 436
3 3300028379 Ga0268266_10001186 Ga0268266_1000118622 436
4 3300013308 Ga0157375_10000945 Ga0157375_100009459 444
5 3300005937 Ga0081455_10000106 Ga0081455_1000010634 453
6 3300048927 Ga0496124_0119605 Ga0496124_0119605_554_1990 456
7 3300048905 Ga0496102_0000129 Ga0496102_0000129_14809_16248 458
8 3300048906 Ga0496103_0000087 Ga0496103_0000087_14807_16246 458
9 3300049590 Ga0501074_0007580 Ga0501074_0007580_6213_7652 458
10 3300044684 Ga0466966_0031501 Ga0466966_0031501_1036_2436 460
11 3300044693 Ga0466961_0057918 Ga0466961_0057918_385_1785 460
12 3300037853 Ga0436364_1192519 Ga0436364_1192519_2423_3838 461
13 3300046459 Ga0495629_0000899 Ga0495629_0000899_16452_17921 461
14 3300005329 Ga0070683_100000527 Ga0070683_10000052714 462
15 3300005435 Ga0070714_100149830 Ga0070714_1001498302 462
16 3300009098 Ga0105245_10018530 Ga0105245_100185304 462
17 3300009098 Ga0105245_10093030 Ga0105245_100930303 462
18 3300013308 Ga0157375_10072195 Ga0157375_100721952 462
19 3300046461 Ga0495641_0027036 Ga0495641_0027036_1194_2621 462
20 3300047315 Ga0495581_0078165 Ga0495581_0078165_413_1840 462
21 3300047321 Ga0495676_0045128 Ga0495676_0045128_2022_3449 462
22 3300048905 Ga0496102_0096456 Ga0496102_0096456_627_2054 462
23 3300048905 Ga0496102_0174137 Ga0496102_0174137_31_1437 462
24 3300048906 Ga0496103_0074754 Ga0496103_0074754_14_1441 462
25 3300048909 Ga0496106_0008855 Ga0496106_0008855_569_1996 462
26 3300048910 Ga0496107_0092966 Ga0496107_0092966_275_1702 462
27 3300048911 Ga0496108_0015909 Ga0496108_0015909_2055_3470 462
28 3300048911 Ga0496108_0176697 Ga0496108_0176697_180_1607 462
29 3300048913 Ga0496110_0041812 Ga0496110_0041812_1907_3322 462
30 3300048914 Ga0496111_0024253 Ga0496111_0024253_462_1889 462
31 3300048915 Ga0496112_0032910 Ga0496112_0032910_357_1772 462
32 3300048917 Ga0496114_0146011 Ga0496114_0146011_348_1775 462
33 3300048918 Ga0496115_0093219 Ga0496115_0093219_760_2187 462
34 3300050496 nmdc:mga07m45_23424_c1 nmdc:mga07m45_23424_c1_344_1759 462
35 3300053153 Ga0500616_0000535 Ga0500616_0000535_24539_25945 462
36 iso_pu_bacteria 2643221711 2644609989 463
37 3300011119 Ga0105246_10051975 Ga0105246_100519751 464
38 3300025934 Ga0207686_10000119 Ga0207686_100001197 464
39 3300028556 Ga0265337_1000012 Ga0265337_100001265 464
40 3300028558 Ga0265326_10000007 Ga0265326_10000007229 464
41 3300028563 Ga0265319_1001040 Ga0265319_10010402 464
42 3300028654 Ga0265322_10000001 Ga0265322_1000000174 464
43 3300028666 Ga0265336_10008731 Ga0265336_100087311 464
44 3300028800 Ga0265338_10039663 Ga0265338_100396633 464
45 3300029957 Ga0265324_10011287 Ga0265324_100112872 464
46 3300031238 Ga0265332_10009702 Ga0265332_100097023 464
47 3300031239 Ga0265328_10000659 Ga0265328_1000065914 464
48 3300031240 Ga0265320_10000002 Ga0265320_1000000274 464
49 3300031242 Ga0265329_10002237 Ga0265329_100022377 464
50 3300031250 Ga0265331_10000919 Ga0265331_1000091921 464
51 3300031251 Ga0265327_10000011 Ga0265327_1000001174 464
52 3300031711 Ga0265314_10000224 Ga0265314_1000022420 464
53 3300053083 Ga0495655_0000010 Ga0495655_0000010_55749_57173 464
54 3300053129 Ga0500628_000024 Ga0500628_000024_52232_53656 464
55 iso_pu_bacteria 2984592036 2984593939 464
56 iso_pu_bacteria 2643221681 2644456039 465
57 iso_pu_bacteria 2643221697 2644538700 465
58 iso_pu_bacteria 2643221961 2645720701 465
59 iso_pu_bacteria 2643221962 2645723719 465
60 3300047472 Ga0495686_0085374 Ga0495686_0085374_179_1714 466
61 3300005458 Ga0070681_10043343 Ga0070681_100433432 467
62 3300005530 Ga0070679_100002668 Ga0070679_1000026688 467
63 3300005841 Ga0068863_100093058 Ga0068863_1000930584 467
64 3300005842 Ga0068858_100058513 Ga0068858_1000585131 467
65 3300025904 Ga0207647_10023770 Ga0207647_100237703 467
66 3300025909 Ga0207705_10040140 Ga0207705_100401402 467
67 3300025912 Ga0207707_10031607 Ga0207707_100316075 467
68 3300025921 Ga0207652_10009781 Ga0207652_100097812 467
69 3300037418 Ga0395900_0113694 Ga0395900_0113694_621_2054 467
70 3300037466 Ga0395898_0048546 Ga0395898_0048546_2309_3742 467
71 3300037471 Ga0395905_0053436 Ga0395905_0053436_1345_2778 467
72 3300037471 Ga0395905_0123278 Ga0395905_0123278_618_2051 467
73 3300038443 Ga0395901_0045998 Ga0395901_0045998_1060_2493 467
74 3300044684 Ga0466966_0033360 Ga0466966_0033360_249_1682 467
75 3300045049 Ga0466959_0105976 Ga0466959_0105976_567_2000 467
76 3300045976 Ga0466967_0090174 Ga0466967_0090174_67_1500 467
77 3300048903 Ga0496100_0016650 Ga0496100_0016650_2071_3504 467
78 3300048904 Ga0496101_0010040 Ga0496101_0010040_2225_3658 467
79 3300048905 Ga0496102_0011180 Ga0496102_0011180_3522_4955 467
80 3300048906 Ga0496103_0004385 Ga0496103_0004385_6932_8365 467
81 3300048907 Ga0496104_0012997 Ga0496104_0012997_3030_4463 467
82 3300048907 Ga0496104_0017430 Ga0496104_0017430_4319_5752 467
83 3300048908 Ga0496105_0004639 Ga0496105_0004639_2446_3879 467
84 3300048908 Ga0496105_0071975 Ga0496105_0071975_730_2163 467
85 3300048912 Ga0496109_0095485 Ga0496109_0095485_1256_2689 467
86 3300048917 Ga0496114_0018264 Ga0496114_0018264_16_1449 467
87 3300048917 Ga0496114_0028182 Ga0496114_0028182_1665_3098 467
88 3300005329 Ga0070683_100079610 Ga0070683_1000796104 468
89 3300025944 Ga0207661_10179866 Ga0207661_101798661 468
90 3300026067 Ga0207678_10181705 Ga0207678_101817052 468
91 3300031665 Ga0316575_10000856 Ga0316575_100008568 468
92 3300031691 Ga0316579_10000197 Ga0316579_1000019717 468
93 3300031727 Ga0316576_10000472 Ga0316576_1000047211 468
94 3300031728 Ga0316578_10002095 Ga0316578_1000209510 468
95 3300035398 Ga0316574_0059543 Ga0316574_0059543_598_2028 468
96 3300036647 Ga0316582_0000099 Ga0316582_0000099_12972_14402 468
97 3300036712 Ga0316584_0017792 Ga0316584_0017792_3675_5105 468
98 3300041491 Ga0451833_0918545 Ga0451833_0918545_1369_2796 468
99 3300044901 Ga0466960_0010724 Ga0466960_0010724_1855_3303 468
100 3300048905 Ga0496102_0051271 Ga0496102_0051271_2259_3710 468
101 3300048906 Ga0496103_0009160 Ga0496103_0009160_438_1889 468
102 3300048917 Ga0496114_0074918 Ga0496114_0074918_118_1566 468
103 3300048926 Ga0496123_0031449 Ga0496123_0031449_103_1539 468
104 3300049583 Ga0501067_0008217 Ga0501067_0008217_431_1882 468
105 3300050496 nmdc:mga07m45_8326_c1 nmdc:mga07m45_8326_c1_348_1784 468
106 3300053096 Ga0500641_0000526 Ga0500641_0000526_3952_5388 468
107 3300005985 Ga0081539_10010378 Ga0081539_100103783 469
108 3300025904 Ga0207647_10016099 Ga0207647_100160995 469
109 3300037471 Ga0395905_0041668 Ga0395905_0041668_1016_2452 469
110 3300041413 Ga0439465_0026450 Ga0439465_0026450_355_1800 469
111 3300044765 Ga0466970_0032132 Ga0466970_0032132_1253_2689 469
112 3300046689 Ga0495613_0000132 Ga0495613_0000132_56299_57771 469
113 3300005327 Ga0070658_10077740 Ga0070658_100777402 470
114 3300005344 Ga0070661_100000110 Ga0070661_10000011015 470
115 3300005367 Ga0070667_100053878 Ga0070667_1000538781 470
116 3300005614 Ga0068856_100001228 Ga0068856_10000122818 470
117 3300009148 Ga0105243_10027691 Ga0105243_100276913 470
118 3300009176 Ga0105242_10000052 Ga0105242_1000005221 470
119 3300013102 Ga0157371_10002739 Ga0157371_100027395 470
120 3300013307 Ga0157372_10000284 Ga0157372_1000028443 470
121 3300014326 Ga0157380_10000186 Ga0157380_1000018615 470
122 3300025915 Ga0207693_10043212 Ga0207693_100432124 470
123 3300025920 Ga0207649_10000015 Ga0207649_10000015197 470
124 3300025926 Ga0207659_10000707 Ga0207659_1000070716 470
125 3300025935 Ga0207709_10013184 Ga0207709_100131843 470
126 3300025941 Ga0207711_10000011 Ga0207711_10000011278 470
127 3300025944 Ga0207661_10000438 Ga0207661_1000043813 470
128 3300025986 Ga0207658_10011128 Ga0207658_100111285 470
129 3300026078 Ga0207702_10000419 Ga0207702_1000041920 470
130 3300026121 Ga0207683_10012181 Ga0207683_100121813 470
131 3300026142 Ga0207698_10000015 Ga0207698_10000015197 470
132 3300044765 Ga0466970_0030982 Ga0466970_0030982_61_1494 470
133 3300044842 Ga0466957_0008957 Ga0466957_0008957_76_1560 470
134 3300046517 Ga0495630_0001450 Ga0495630_0001450_6760_8220 470
135 3300046674 Ga0495588_0000247 Ga0495588_0000247_1583_3055 470
136 3300046681 Ga0495647_0000307 Ga0495647_0000307_5632_7092 470
137 3300046690 Ga0495624_0000196 Ga0495624_0000196_4184_5644 470
138 3300046809 Ga0495600_0010574 Ga0495600_0010574_3334_4806 470
139 3300047317 Ga0495604_0000448 Ga0495604_0000448_14854_16329 470
140 3300048907 Ga0496104_0000004 Ga0496104_0000004_452476_453915 470
141 3300048907 Ga0496104_0047233 Ga0496104_0047233_2491_3966 470
142 3300048908 Ga0496105_0000001 Ga0496105_0000001_187916_189355 470
143 3300048911 Ga0496108_0000005 Ga0496108_0000005_523058_524542 470
144 3300048912 Ga0496109_0000002 Ga0496109_0000002_10550_12034 470
145 3300048913 Ga0496110_0000185 Ga0496110_0000185_31242_32717 470
146 3300048914 Ga0496111_0002441 Ga0496111_0002441_6825_8300 470
147 3300048915 Ga0496112_0001010 Ga0496112_0001010_2435_3910 470
148 3300048916 Ga0496113_0000017 Ga0496113_0000017_30090_31565 470
149 3300048923 Ga0496120_0032496 Ga0496120_0032496_1072_2511 470
150 3300053077 Ga0495601_0000029 Ga0495601_0000029_37552_39027 470
151 iso_pu_bacteria 2984576629 2984578042 470
152 iso_pu_bacteria 2990256926 2990257556 470
153 3300005347 Ga0070668_100063880 Ga0070668_1000638803 471
154 3300005365 Ga0070688_100000053 Ga0070688_10000005319 471
155 3300005466 Ga0070685_10000086 Ga0070685_1000008641 471
156 3300006058 Ga0075432_10000398 Ga0075432_100003982 471
157 3300006844 Ga0075428_100016930 Ga0075428_1000169308 471
158 3300006847 Ga0075431_100019604 Ga0075431_1000196043 471
159 3300006852 Ga0075433_10001708 Ga0075433_100017084 471
160 3300006852 Ga0075433_10070863 Ga0075433_100708631 471
161 3300006871 Ga0075434_100004328 Ga0075434_1000043282 471
162 3300006871 Ga0075434_100004603 Ga0075434_1000046032 471
163 3300006880 Ga0075429_100003236 Ga0075429_1000032364 471
164 3300006914 Ga0075436_100002186 Ga0075436_10000218615 471
165 3300009094 Ga0111539_10010304 Ga0111539_100103042 471
166 3300009094 Ga0111539_10072393 Ga0111539_100723936 471
167 3300009098 Ga0105245_10072901 Ga0105245_100729012 471
168 3300009147 Ga0114129_10085188 Ga0114129_100851886 471
169 3300009553 Ga0105249_10013603 Ga0105249_100136035 471
170 3300010375 Ga0105239_10046182 Ga0105239_100461822 471
171 3300013306 Ga0163162_10097729 Ga0163162_100977294 471
172 3300025938 Ga0207704_10024642 Ga0207704_100246422 471
173 3300025961 Ga0207712_10082501 Ga0207712_100825012 471
174 3300026118 Ga0207675_100055105 Ga0207675_1000551054 471
175 3300027907 Ga0207428_10011064 Ga0207428_100110646 471
176 3300031903 Ga0307407_10011467 Ga0307407_100114673 471
177 3300035088 Ga0373940_0015452 Ga0373940_0015452_10_1455 471
178 3300042439 Ga0439464_0014935 Ga0439464_0014935_35_1471 471
179 3300050507 nmdc:mga05p37_60697_c1 nmdc:mga05p37_60697_c1_1057_2493 471
180 3300050508 nmdc:mga09592_105574_c1 nmdc:mga09592_105574_c1_400_1836 471
181 3300050510 nmdc:mga06r32_25842_c1 nmdc:mga06r32_25842_c1_3533_4990 471
182 3300050510 nmdc:mga06r32_36408_c1 nmdc:mga06r32_36408_c1_1408_2844 471
183 3300050511 nmdc:mga08y16_6449_c1 nmdc:mga08y16_6449_c1_9737_11173 471
184 3300050511 nmdc:mga08y16_80980_c1 nmdc:mga08y16_80980_c1_585_2021 471
185 3300050512 nmdc:mga0n895_70602_c1 nmdc:mga0n895_70602_c1_159_1595 471
186 3300050512 nmdc:mga0n895_74334_c1 nmdc:mga0n895_74334_c1_1029_2465 471
187 3300050513 nmdc:mga0rr50_1370_c1 nmdc:mga0rr50_1370_c1_2703_4139 471
188 3300050514 nmdc:mga08x19_1536_c1 nmdc:mga08x19_1536_c1_11003_12439 471
189 3300050514 nmdc:mga08x19_51315_c1 nmdc:mga08x19_51315_c1_616_2052 471
190 3300050515 nmdc:mga0a205_34993_c1 nmdc:mga0a205_34993_c1_1979_3415 471
191 3300050515 nmdc:mga0a205_783_c2 nmdc:mga0a205_783_c2_2360_3796 471
192 iso_pu_bacteria 2773857762 2774395152 471
193 iso_pu_bacteria 2808606439 2809194013 471
194 iso_pu_bacteria 2811994878 2812348750 471
195 iso_pu_bacteria 2891968417 2891973486 471
196 3300005985 Ga0081539_10001074 Ga0081539_1000107438 472
197 3300009011 Ga0105251_10053118 Ga0105251_100531181 472
198 3300009177 Ga0105248_10174132 Ga0105248_101741322 472
199 3300009545 Ga0105237_10137143 Ga0105237_101371432 472
200 3300013296 Ga0157374_10233194 Ga0157374_102331941 472
201 3300013306 Ga0163162_10072586 Ga0163162_100725862 472
202 3300013307 Ga0157372_10064155 Ga0157372_100641554 472
203 3300032002 Ga0307416_100333315 Ga0307416_1003333151 472
204 3300044765 Ga0466970_0025734 Ga0466970_0025734_1467_2915 472
205 3300048909 Ga0496106_0132073 Ga0496106_0132073_232_1665 472
206 3300046462 Ga0495651_0070075 Ga0495651_0070075_781_2217 473
207 3300031995 Ga0307409_100114239 Ga0307409_1001142392 474
208 3300002155 JGI24033J26618_1000922 JGI24033J26618_10009222 475
209 3300003373 JGI25407J50210_10011902 JGI25407J50210_100119022 475
210 3300005344 Ga0070661_100013458 Ga0070661_1000134583 475
211 3300005345 Ga0070692_10012228 Ga0070692_100122283 475
212 3300005466 Ga0070685_10033305 Ga0070685_100333052 475
213 3300020082 Ga0206353_10643868 Ga0206353_106438684 475
214 3300025945 Ga0207679_10006499 Ga0207679_100064997 475
215 3300026095 Ga0207676_10003416 Ga0207676_100034168 475
216 3300026116 Ga0207674_10029086 Ga0207674_100290865 475
217 3300041494 Ga0451837_0394872 Ga0451837_0394872_134_1639 475
218 3300048912 Ga0496109_0042404 Ga0496109_0042404_95_1522 475
219 3300049575 Ga0501039_0125632 Ga0501039_0125632_487_1950 475
220 iso_pu_bacteria 2852643534 2852643855 475
221 iso_pu_bacteria 2904765812 2904769979 475
222 iso_pu_bacteria 2904770941 2904771171 475
223 iso_pu_bacteria 2908811453 2908815215 475
224 iso_pu_bacteria 2919420072 2919423334 475
225 iso_pu_bacteria 2919432681 2919435942 475
226 3300036401 Ga0373937_0012589 Ga0373937_0012589_3922_5370 477
227 3300046462 Ga0495651_0004912 Ga0495651_0004912_1545_2993 477
228 3300046511 Ga0495608_0016334 Ga0495608_0016334_2511_3959 477
229 3300046559 Ga0495667_0001386 Ga0495667_0001386_10228_11676 477
230 3300047322 Ga0495680_0012579 Ga0495680_0012579_507_1955 477
231 3300048088 Ga0495602_0034328 Ga0495602_0034328_1598_3046 477
232 iso_pu_bacteria 2974315732 2974318556 477
233 iso_pu_bacteria 2984523437 2984526767 477
234 3300021388 Ga0213875_10007089 Ga0213875_100070892 478
235 3300048929 Ga0496126_0127491 Ga0496126_0127491_348_1805 478
236 3300049570 Ga0501033_0081573 Ga0501033_0081573_381_1838 478
237 3300049572 Ga0501036_0007304 Ga0501036_0007304_6451_7908 478
238 3300049575 Ga0501039_0015833 Ga0501039_0015833_2260_3717 478
239 3300049577 Ga0501041_0089571 Ga0501041_0089571_201_1658 478
240 3300049579 Ga0501043_0119895 Ga0501043_0119895_178_1635 478
241 3300049582 Ga0501048_0086500 Ga0501048_0086500_269_1726 478
242 3300049587 Ga0501071_0028813 Ga0501071_0028813_1824_3281 478
243 3300049588 Ga0501072_0001960 Ga0501072_0001960_359_1816 478
244 3300049592 Ga0501076_0124969 Ga0501076_0124969_243_1700 478
245 3300049593 Ga0501077_0002277 Ga0501077_0002277_2682_4139 478
246 3300049741 Ga0501079_0003278 Ga0501079_0003278_653_2110 478
247 3300049743 Ga0501081_0007069 Ga0501081_0007069_1385_2842 478
248 3300049822 Ga0501035_0137976 Ga0501035_0137976_244_1701 478
249 3300049824 Ga0501045_0004172 Ga0501045_0004172_371_1828 478
250 3300054114 Ga0501084_0116680 Ga0501084_0116680_609_2066 478
251 3300060353 Ga0501082_0003048 Ga0501082_0003048_12509_13966 478
252 iso_pu_bacteria 2966921586 2966923363 478
253 3300044842 Ga0466957_0037436 Ga0466957_0037436_91_1554 479
254 3300048912 Ga0496109_0160547 Ga0496109_0160547_49_1509 479
255 3300003373 JGI25407J50210_10000047 JGI25407J50210_100000474 480
256 3300005347 Ga0070668_100028625 Ga0070668_1000286253 480
257 3300005546 Ga0070696_100166725 Ga0070696_1001667251 480
258 3300005937 Ga0081455_10002738 Ga0081455_100027383 480
259 3300009094 Ga0111539_10001351 Ga0111539_100013512 480
260 3300013306 Ga0163162_10348824 Ga0163162_103488241 480
261 3300025961 Ga0207712_10027061 Ga0207712_100270612 480
262 3300027907 Ga0207428_10113006 Ga0207428_101130062 480
263 3300028380 Ga0268265_10219233 Ga0268265_102192331 480
264 3300028381 Ga0268264_10287849 Ga0268264_102878491 480
265 3300031251 Ga0265327_10017384 Ga0265327_100173844 480
266 3300031251 Ga0265327_10067674 Ga0265327_100676741 480
267 3300031727 Ga0316576_10071005 Ga0316576_100710053 480
268 3300031728 Ga0316578_10029750 Ga0316578_100297501 480
269 3300035398 Ga0316574_0021377 Ga0316574_0021377_941_2404 480
270 3300035398 Ga0316574_0050231 Ga0316574_0050231_994_2457 480
271 3300036712 Ga0316584_0011486 Ga0316584_0011486_3633_5096 480
272 3300036712 Ga0316584_0032919 Ga0316584_0032919_779_2242 480
273 3300042008 Ga0439450_001482 Ga0439450_001482_95_1585 480
274 3300048904 Ga0496101_0044251 Ga0496101_0044251_11_1477 480
275 3300048905 Ga0496102_0073611 Ga0496102_0073611_929_2392 480
276 3300048908 Ga0496105_0029867 Ga0496105_0029867_2252_3718 480
277 3300048915 Ga0496112_0002266 Ga0496112_0002266_58_1521 480
278 3300050495 nmdc:mga04h51_21315_c1 nmdc:mga04h51_21315_c1_303_1775 480
279 3300050510 nmdc:mga06r32_166033_c1 nmdc:mga06r32_166033_c1_178_1692 480
280 3300050510 nmdc:mga06r32_181758_c1 nmdc:mga06r32_181758_c1_458_1948 480
281 3300050511 nmdc:mga08y16_7008_c1 nmdc:mga08y16_7008_c1_10018_11490 480
282 3300050516 nmdc:mga0sz30_31391_c1 nmdc:mga0sz30_31391_c1_290_1762 480
283 3300053139 Ga0500568_0000039 Ga0500568_0000039_64511_65983 480
284 3300053153 Ga0500616_0007902 Ga0500616_0007902_3347_4810 480
285 3300009148 Ga0105243_10029456 Ga0105243_100294562 481
286 3300011119 Ga0105246_10082776 Ga0105246_100827761 481
287 3300026075 Ga0207708_10009808 Ga0207708_100098084 481
288 3300031711 Ga0265314_10087093 Ga0265314_100870931 481
289 3300005337 Ga0070682_100090917 Ga0070682_1000909171 482
290 3300005338 Ga0068868_100048728 Ga0068868_1000487282 482
291 3300005366 Ga0070659_100000013 Ga0070659_1000000135 482
292 3300005444 Ga0070694_100048154 Ga0070694_1000481543 482
293 3300005544 Ga0070686_100048679 Ga0070686_1000486792 482
294 3300005549 Ga0070704_100064102 Ga0070704_1000641022 482
295 3300006038 Ga0075365_10000193 Ga0075365_1000019313 482
296 3300006051 Ga0075364_10052920 Ga0075364_100529202 482
297 3300006051 Ga0075364_10062082 Ga0075364_100620822 482
298 3300006847 Ga0075431_100034685 Ga0075431_1000346858 482
299 3300006871 Ga0075434_100019309 Ga0075434_1000193099 482
300 3300007076 Ga0075435_100061086 Ga0075435_1000610862 482
301 3300009094 Ga0111539_10017096 Ga0111539_1001709615 482
302 3300025915 Ga0207693_10012194 Ga0207693_100121945 482
303 3300025919 Ga0207657_10023952 Ga0207657_100239523 482
304 3300025932 Ga0207690_10000075 Ga0207690_1000007538 482
305 3300037312 Ga0395899_0031667 Ga0395899_0031667_426_1922 482
306 3300037418 Ga0395900_0008269 Ga0395900_0008269_1290_2786 482
307 3300037466 Ga0395898_0005178 Ga0395898_0005178_11577_13073 482
308 3300037466 Ga0395898_0011426 Ga0395898_0011426_3256_4752 482
309 3300037471 Ga0395905_0004214 Ga0395905_0004214_11583_13079 482
310 3300038443 Ga0395901_0003473 Ga0395901_0003473_2720_4216 482
311 3300038443 Ga0395901_0170831 Ga0395901_0170831_407_1903 482
312 3300046499 Ga0495594_0000012 Ga0495594_0000012_30908_32407 482
313 3300049571 Ga0501034_0007479 Ga0501034_0007479_6248_7711 482
314 3300049571 Ga0501034_0009939 Ga0501034_0009939_4106_5569 482
315 3300049571 Ga0501034_0042719 Ga0501034_0042719_1293_2756 482
316 3300049823 Ga0501044_0098533 Ga0501044_0098533_879_2342 482
317 3300050490 nmdc:mga03n38_43742_c1 nmdc:mga03n38_43742_c1_390_1853 482
318 3300050491 nmdc:mga00v17_26340_c1 nmdc:mga00v17_26340_c1_93_1586 482
319 3300050491 nmdc:mga00v17_55615_c1 nmdc:mga00v17_55615_c1_333_1838 482
320 3300050492 nmdc:mga0yw44_1762_c1 nmdc:mga0yw44_1762_c1_617_2122 482
321 3300050492 nmdc:mga0yw44_4737_c1 nmdc:mga0yw44_4737_c1_3923_5416 482
322 3300050510 nmdc:mga06r32_6628_c1 nmdc:mga06r32_6628_c1_5801_7297 482
323 3300050511 nmdc:mga08y16_132329_c1 nmdc:mga08y16_132329_c1_56_1552 482
324 3300050512 nmdc:mga0n895_8375_c1 nmdc:mga0n895_8375_c1_5738_7234 482
325 3300050513 nmdc:mga0rr50_42753_c1 nmdc:mga0rr50_42753_c1_1256_2752 482
326 3300005435 Ga0070714_100011637 Ga0070714_1000116372 483
327 3300006028 Ga0070717_10000059 Ga0070717_1000005922 483
328 3300025929 Ga0207664_10008731 Ga0207664_100087312 483
329 3300038443 Ga0395901_0074150 Ga0395901_0074150_434_1906 484
330 3300044842 Ga0466957_0058481 Ga0466957_0058481_630_2105 484
331 3300048911 Ga0496108_0002714 Ga0496108_0002714_2555_4024 484
332 3300048913 Ga0496110_0022898 Ga0496110_0022898_3295_4764 484
333 3300005347 Ga0070668_100007667 Ga0070668_1000076672 485
334 3300005843 Ga0068860_100049579 Ga0068860_1000495793 485
335 3300005844 Ga0068862_100000366 Ga0068862_10000036613 485
336 3300009553 Ga0105249_10000916 Ga0105249_1000091623 485
337 3300025961 Ga0207712_10000994 Ga0207712_1000099421 485
338 3300025972 Ga0207668_10004404 Ga0207668_100044044 485
339 3300028380 Ga0268265_10003823 Ga0268265_100038239 485
340 3300045976 Ga0466967_0088839 Ga0466967_0088839_782_2296 485
341 3300048905 Ga0496102_0002055 Ga0496102_0002055_3031_4539 485
342 3300048907 Ga0496104_0004190 Ga0496104_0004190_7085_8593 485
343 3300048908 Ga0496105_0011165 Ga0496105_0011165_2198_3706 485
344 3300048911 Ga0496108_0002448 Ga0496108_0002448_5252_6760 485
345 3300048912 Ga0496109_0002062 Ga0496109_0002062_6680_8188 485
346 3300048913 Ga0496110_0000649 Ga0496110_0000649_9536_11044 485
347 3300048914 Ga0496111_0000119 Ga0496111_0000119_12878_14386 485
348 3300048915 Ga0496112_0086219 Ga0496112_0086219_1272_2780 485
349 3300048917 Ga0496114_0015102 Ga0496114_0015102_2476_3984 485
350 3300048918 Ga0496115_0061463 Ga0496115_0061463_1481_2977 485
351 3300005937 Ga0081455_10027460 Ga0081455_100274606 486
352 3300005981 Ga0081538_10000763 Ga0081538_100007637 486
353 iso_pu_bacteria 2731639228 2731909430 487
354 iso_pu_bacteria 2799112218 2799186767 487
355 3300005983 Ga0081540_1000046 Ga0081540_100004618 488
356 3300046557 Ga0495622_0000076 Ga0495622_0000076_20747_22276 488
357 3300053096 Ga0500641_0004436 Ga0500641_0004436_326_1828 488
358 iso_pu_bacteria 2816332119 2816427141 488
359 iso_pu_bacteria 2883821847 2883825819 488
360 iso_pu_bacteria 2902792274 2902797317 488
361 3300005347 Ga0070668_100028160 Ga0070668_1000281603 489
362 3300005457 Ga0070662_100020708 Ga0070662_1000207083 489
363 3300005981 Ga0081538_10000973 Ga0081538_100009735 489
364 3300006881 Ga0068865_100103041 Ga0068865_1001030412 489
365 3300007076 Ga0075435_100000562 Ga0075435_10000056210 489
366 3300009098 Ga0105245_10015520 Ga0105245_100155202 489
367 3300009148 Ga0105243_10049144 Ga0105243_100491441 489
368 3300009551 Ga0105238_10192262 Ga0105238_101922621 489
369 3300014326 Ga0157380_10074409 Ga0157380_100744092 489
370 3300025927 Ga0207687_10024556 Ga0207687_100245562 489
371 3300025928 Ga0207700_10000003 Ga0207700_1000000385 489
372 3300025932 Ga0207690_10006804 Ga0207690_100068044 489
373 3300025933 Ga0207706_10012125 Ga0207706_100121255 489
374 3300027907 Ga0207428_10001010 Ga0207428_1000101013 489
375 3300028379 Ga0268266_10000485 Ga0268266_1000048522 489
376 3300031548 Ga0307408_100009103 Ga0307408_1000091035 489
377 3300031731 Ga0307405_10021001 Ga0307405_100210013 489
378 3300031824 Ga0307413_10003082 Ga0307413_100030826 489
379 3300031824 Ga0307413_10013804 Ga0307413_100138043 489
380 3300031901 Ga0307406_10000212 Ga0307406_100002125 489
381 3300031901 Ga0307406_10003159 Ga0307406_100031594 489
382 3300031903 Ga0307407_10023004 Ga0307407_100230042 489
383 3300031995 Ga0307409_100000273 Ga0307409_10000027312 489
384 3300031995 Ga0307409_100039242 Ga0307409_1000392422 489
385 3300031995 Ga0307409_100069954 Ga0307409_1000699542 489
386 3300032002 Ga0307416_100100022 Ga0307416_1001000222 489
387 3300032004 Ga0307414_10043440 Ga0307414_100434402 489
388 3300032004 Ga0307414_10060645 Ga0307414_100606453 489
389 3300032004 Ga0307414_10065657 Ga0307414_100656573 489
390 3300032005 Ga0307411_10030039 Ga0307411_100300394 489
391 3300032005 Ga0307411_10066141 Ga0307411_100661412 489
392 3300032005 Ga0307411_10089911 Ga0307411_100899112 489
393 3300032126 Ga0307415_100002934 Ga0307415_1000029343 489
394 3300042016 Ga0439463_003079 Ga0439463_003079_2684_4183 489
395 3300042993 Ga0439440_0003643 Ga0439440_0003643_1436_2935 489
396 3300048906 Ga0496103_0020956 Ga0496103_0020956_2137_3684 489
397 3300048907 Ga0496104_0058256 Ga0496104_0058256_195_1742 489
398 3300048908 Ga0496105_0087370 Ga0496105_0087370_169_1716 489
399 3300048912 Ga0496109_0153541 Ga0496109_0153541_584_2131 489
400 3300048922 Ga0496119_0013479 Ga0496119_0013479_170_1717 489
401 3300048924 Ga0496121_0033354 Ga0496121_0033354_2961_4508 489
402 3300048929 Ga0496126_0132159 Ga0496126_0132159_305_1852 489
403 3300049581 Ga0501047_0005250 Ga0501047_0005250_6189_7739 489
404 iso_pu_bacteria 2643221715 2644636617 489
405 iso_pu_bacteria 2870782633 2870782933 489
406 iso_pu_bacteria 2902810491 2902814579 489
407 iso_pu_bacteria 2902837492 2902843024 489
408 3300001979 JGI24740J21852_10012686 JGI24740J21852_100126862 490
409 3300001989 JGI24739J22299_10007492 JGI24739J22299_100074924 490
410 3300001990 JGI24737J22298_10014225 JGI24737J22298_100142252 490
411 3300002067 JGI24735J21928_10014328 JGI24735J21928_100143282 490
412 3300005937 Ga0081455_10037772 Ga0081455_100377721 490
413 3300005985 Ga0081539_10000236 Ga0081539_1000023676 490
414 3300028573 Ga0265334_10000094 Ga0265334_1000009420 490
415 3300028666 Ga0265336_10004740 Ga0265336_100047403 490
416 3300028800 Ga0265338_10003073 Ga0265338_100030734 490
417 3300029957 Ga0265324_10001935 Ga0265324_100019357 490
418 3300033179 Ga0307507_10116584 Ga0307507_101165842 490
419 3300045836 Ga0466958_0067657 Ga0466958_0067657_670_2163 490
420 3300048917 Ga0496114_0131567 Ga0496114_0131567_366_1862 490
421 3300048929 Ga0496126_0002345 Ga0496126_0002345_5925_7421 490
422 iso_pu_bacteria 2643221567 2643851843 490
423 iso_pu_bacteria 2643221624 2644137568 490
424 3300003203 JGI25406J46586_10005948 JGI25406J46586_100059487 491
425 3300005983 Ga0081540_1013115 Ga0081540_10131152 491
426 3300005985 Ga0081539_10001710 Ga0081539_100017102 491
427 3300006051 Ga0075364_10000577 Ga0075364_1000057718 491
428 3300013105 Ga0157369_10106863 Ga0157369_101068631 491
429 3300026078 Ga0207702_10100883 Ga0207702_101008832 491
430 3300031456 Ga0307513_10004621 Ga0307513_100046219 491
431 3300041411 Ga0439466_0010202 Ga0439466_0010202_1295_2794 491
432 3300044658 Ga0466972_0007601 Ga0466972_0007601_3845_5350 491
433 3300044765 Ga0466970_0009706 Ga0466970_0009706_683_2188 491
434 3300045976 Ga0466967_0047433 Ga0466967_0047433_2046_3542 491
435 3300048917 Ga0496114_0008010 Ga0496114_0008010_1286_2791 491
436 3300049568 Ga0501031_0000115 Ga0501031_0000115_38311_39819 491
437 3300049569 Ga0501032_0000052 Ga0501032_0000052_48952_50460 491
438 3300049570 Ga0501033_0003226 Ga0501033_0003226_10484_11992 491
439 3300049571 Ga0501034_0007562 Ga0501034_0007562_6018_7526 491
440 3300049572 Ga0501036_0000061 Ga0501036_0000061_50056_51564 491
441 3300049573 Ga0501037_0000046 Ga0501037_0000046_62395_63903 491
442 3300049574 Ga0501038_0000068 Ga0501038_0000068_48327_49835 491
443 3300049575 Ga0501039_0000292 Ga0501039_0000292_11718_13226 491
444 3300049578 Ga0501042_0083451 Ga0501042_0083451_130_1638 491
445 3300049579 Ga0501043_0000340 Ga0501043_0000340_21847_23355 491
446 3300049580 Ga0501046_0000102 Ga0501046_0000102_53379_54887 491
447 3300049581 Ga0501047_0001039 Ga0501047_0001039_3321_4829 491
448 3300049582 Ga0501048_0000006 Ga0501048_0000006_53888_55396 491
449 3300049583 Ga0501067_0001571 Ga0501067_0001571_9260_10768 491
450 3300049584 Ga0501068_0021950 Ga0501068_0021950_1445_2953 491
451 3300049585 Ga0501069_0005606 Ga0501069_0005606_4634_6142 491
452 3300049586 Ga0501070_0000139 Ga0501070_0000139_13167_14675 491
453 3300049587 Ga0501071_0048989 Ga0501071_0048989_185_1693 491
454 3300049590 Ga0501074_0000256 Ga0501074_0000256_11733_13241 491
455 3300049742 Ga0501080_0000051 Ga0501080_0000051_65823_67331 491
456 3300049744 Ga0501083_0002108 Ga0501083_0002108_4157_5665 491
457 3300049822 Ga0501035_0021506 Ga0501035_0021506_3193_4701 491
458 3300049823 Ga0501044_0000137 Ga0501044_0000137_51430_52938 491
459 3300050491 nmdc:mga00v17_1112_c1 nmdc:mga00v17_1112_c1_2419_3915 491
460 3300054114 Ga0501084_0001328 Ga0501084_0001328_927_2435 491
461 3300060353 Ga0501082_0065353 Ga0501082_0065353_741_2249 491
462 3300006186 Ga0075369_10002193 Ga0075369_100021933 492
463 3300009545 Ga0105237_10016854 Ga0105237_100168542 492
464 3300025914 Ga0207671_10009287 Ga0207671_100092875 492
465 3300047320 Ga0495672_0008631 Ga0495672_0008631_3484_4977 492
466 3300047469 Ga0495673_0016778 Ga0495673_0016778_963_2456 492
467 3300048903 Ga0496100_0002933 Ga0496100_0002933_2557_4050 492
468 3300048904 Ga0496101_0000031 Ga0496101_0000031_161387_162880 492
469 3300048905 Ga0496102_0000011 Ga0496102_0000011_49590_51083 492
470 3300048906 Ga0496103_0000124 Ga0496103_0000124_49590_51083 492
471 3300048909 Ga0496106_0008140 Ga0496106_0008140_5159_6652 492
472 3300048910 Ga0496107_0082343 Ga0496107_0082343_75_1568 492
473 3300048917 Ga0496114_0065222 Ga0496114_0065222_830_2416 492
474 3300048919 Ga0496116_0000297 Ga0496116_0000297_49590_51083 492
475 3300048920 Ga0496117_0000039 Ga0496117_0000039_271061_272554 492
476 3300048921 Ga0496118_0000035 Ga0496118_0000035_49590_51083 492
477 3300048922 Ga0496119_0000286 Ga0496119_0000286_61093_62586 492
478 3300048923 Ga0496120_0001566 Ga0496120_0001566_21543_23036 492
479 3300048924 Ga0496121_0000425 Ga0496121_0000425_48796_50289 492
480 3300048929 Ga0496126_0000666 Ga0496126_0000666_17446_18939 492
481 3300049568 Ga0501031_0000689 Ga0501031_0000689_16070_17623 492
482 3300049575 Ga0501039_0017339 Ga0501039_0017339_888_2441 492
483 3300049577 Ga0501041_0018231 Ga0501041_0018231_1017_2570 492
484 3300049579 Ga0501043_0019541 Ga0501043_0019541_3699_5252 492
485 3300049580 Ga0501046_0013449 Ga0501046_0013449_2603_4156 492
486 3300049584 Ga0501068_0014755 Ga0501068_0014755_775_2328 492
487 3300049588 Ga0501072_0005664 Ga0501072_0005664_5380_6933 492
488 3300049591 Ga0501075_0013424 Ga0501075_0013424_2791_4344 492
489 3300049592 Ga0501076_0001319 Ga0501076_0001319_587_2140 492
490 3300049743 Ga0501081_0009280 Ga0501081_0009280_3411_4964 492
491 3300049824 Ga0501045_0000759 Ga0501045_0000759_6254_7807 492
492 3300050516 nmdc:mga0sz30_1720_c1 nmdc:mga0sz30_1720_c1_4114_5610 492
493 iso_pu_bacteria 2738541264 2738666841 492
494 iso_pu_bacteria 2738541356 2739145685 492
495 iso_pu_bacteria 2939582691 2939585034 492
496 3300002070 JGI24750J21931_1003282 JGI24750J21931_10032821 493
497 3300002073 JGI24745J21846_1001386 JGI24745J21846_10013862 493
498 3300002077 JGI24744J21845_10002686 JGI24744J21845_100026866 493
499 3300002459 JGI24751J29686_10006759 JGI24751J29686_100067592 493
500 3300003792 Ga0055540_1000065 Ga0055540_100006545 493
501 3300003792 Ga0055540_1001113 Ga0055540_10011139 493
502 3300003792 Ga0055540_1001796 Ga0055540_10017969 493
503 3300003792 Ga0055540_1003135 Ga0055540_10031358 493
504 3300005330 Ga0070690_100021595 Ga0070690_1000215954 493
505 3300005331 Ga0070670_100105668 Ga0070670_1001056682 493
506 3300005334 Ga0068869_100014020 Ga0068869_1000140206 493
507 3300005335 Ga0070666_10055053 Ga0070666_100550532 493
508 3300005337 Ga0070682_100006610 Ga0070682_1000066104 493
509 3300005338 Ga0068868_100019969 Ga0068868_1000199695 493
510 3300005340 Ga0070689_100016786 Ga0070689_1000167866 493
511 3300005344 Ga0070661_100071708 Ga0070661_1000717082 493
512 3300005347 Ga0070668_100001430 Ga0070668_10000143020 493
513 3300005347 Ga0070668_100002698 Ga0070668_1000026987 493
514 3300005347 Ga0070668_100106218 Ga0070668_1001062182 493
515 3300005353 Ga0070669_100016048 Ga0070669_1000160486 493
516 3300005355 Ga0070671_100002337 Ga0070671_1000023377 493
517 3300005356 Ga0070674_100000153 Ga0070674_1000001534 493
518 3300005367 Ga0070667_100000840 Ga0070667_10000084025 493
519 3300005367 Ga0070667_100008468 Ga0070667_1000084687 493
520 3300005367 Ga0070667_100028629 Ga0070667_1000286293 493
521 3300005436 Ga0070713_100133350 Ga0070713_1001333502 493
522 3300005437 Ga0070710_10001412 Ga0070710_100014125 493
523 3300005437 Ga0070710_10012538 Ga0070710_100125381 493
524 3300005438 Ga0070701_10022358 Ga0070701_100223582 493
525 3300005439 Ga0070711_100000205 Ga0070711_10000020536 493
526 3300005439 Ga0070711_100010610 Ga0070711_1000106103 493
527 3300005440 Ga0070705_100018204 Ga0070705_1000182041 493
528 3300005455 Ga0070663_100031238 Ga0070663_1000312381 493
529 3300005456 Ga0070678_100004645 Ga0070678_1000046453 493
530 3300005456 Ga0070678_100021506 Ga0070678_1000215066 493
531 3300005457 Ga0070662_100124614 Ga0070662_1001246142 493
532 3300005459 Ga0068867_100006760 Ga0068867_1000067609 493
533 3300005459 Ga0068867_100026849 Ga0068867_1000268493 493
534 3300005459 Ga0068867_100156717 Ga0068867_1001567172 493
535 3300005539 Ga0068853_100033816 Ga0068853_1000338165 493
536 3300005539 Ga0068853_100149071 Ga0068853_1001490712 493
537 3300005546 Ga0070696_100034595 Ga0070696_1000345956 493
538 3300005547 Ga0070693_100019527 Ga0070693_1000195273 493
539 3300005548 Ga0070665_100004960 Ga0070665_1000049602 493
540 3300005548 Ga0070665_100043787 Ga0070665_1000437872 493
541 3300005548 Ga0070665_100075978 Ga0070665_1000759786 493
542 3300005549 Ga0070704_100000289 Ga0070704_10000028926 493
543 3300005577 Ga0068857_100084732 Ga0068857_1000847323 493
544 3300005615 Ga0070702_100029922 Ga0070702_1000299223 493
545 3300005615 Ga0070702_100031581 Ga0070702_1000315812 493
546 3300005616 Ga0068852_100059236 Ga0068852_1000592364 493
547 3300005617 Ga0068859_100002544 Ga0068859_10000254413 493
548 3300005617 Ga0068859_100023558 Ga0068859_1000235581 493
549 3300005617 Ga0068859_100107717 Ga0068859_1001077173 493
550 3300005718 Ga0068866_10001088 Ga0068866_100010887 493
551 3300005719 Ga0068861_100002774 Ga0068861_1000027744 493
552 3300005841 Ga0068863_100000373 Ga0068863_10000037330 493
553 3300005841 Ga0068863_100024127 Ga0068863_1000241273 493
554 3300005842 Ga0068858_100003979 Ga0068858_10000397916 493
555 3300005843 Ga0068860_100000011 Ga0068860_10000001181 493
556 3300005843 Ga0068860_100033567 Ga0068860_1000335674 493
557 3300005843 Ga0068860_100107761 Ga0068860_1001077612 493
558 3300005844 Ga0068862_100000139 Ga0068862_1000001394 493
559 3300005844 Ga0068862_100005265 Ga0068862_1000052656 493
560 3300005844 Ga0068862_100021554 Ga0068862_1000215543 493
561 3300005844 Ga0068862_100129428 Ga0068862_1001294282 493
562 3300005937 Ga0081455_10084826 Ga0081455_100848262 493
563 3300006028 Ga0070717_10118149 Ga0070717_101181492 493
564 3300006038 Ga0075365_10000898 Ga0075365_1000089810 493
565 3300006038 Ga0075365_10009502 Ga0075365_100095025 493
566 3300006048 Ga0075363_100000427 Ga0075363_1000004273 493
567 3300006048 Ga0075363_100002846 Ga0075363_1000028464 493
568 3300006048 Ga0075363_100016916 Ga0075363_1000169162 493
569 3300006048 Ga0075363_100040584 Ga0075363_1000405842 493
570 3300006051 Ga0075364_10000892 Ga0075364_100008929 493
571 3300006051 Ga0075364_10001241 Ga0075364_100012412 493
572 3300006051 Ga0075364_10003280 Ga0075364_100032806 493
573 3300006051 Ga0075364_10105557 Ga0075364_101055572 493
574 3300006173 Ga0070716_100019063 Ga0070716_1000190634 493
575 3300006173 Ga0070716_100025057 Ga0070716_1000250574 493
576 3300006175 Ga0070712_100021922 Ga0070712_1000219223 493
577 3300006178 Ga0075367_10016382 Ga0075367_100163824 493
578 3300006186 Ga0075369_10011109 Ga0075369_100111091 493
579 3300006186 Ga0075369_10014500 Ga0075369_100145001 493
580 3300006186 Ga0075369_10046765 Ga0075369_100467651 493
581 3300006353 Ga0075370_10007355 Ga0075370_100073554 493
582 3300006353 Ga0075370_10009536 Ga0075370_100095363 493
583 3300006353 Ga0075370_10038551 Ga0075370_100385512 493
584 3300006844 Ga0075428_100020281 Ga0075428_1000202816 493
585 3300006847 Ga0075431_100012901 Ga0075431_1000129016 493
586 3300006881 Ga0068865_100014483 Ga0068865_1000144834 493
587 3300006881 Ga0068865_100049452 Ga0068865_1000494523 493
588 3300006931 Ga0097620_100002544 Ga0097620_10000254413 493
589 3300006931 Ga0097620_100023557 Ga0097620_10002355710 493
590 3300006931 Ga0097620_100107709 Ga0097620_1001077093 493
591 3300009098 Ga0105245_10004802 Ga0105245_100048027 493
592 3300009101 Ga0105247_10000067 Ga0105247_1000006710 493
593 3300009147 Ga0114129_10018395 Ga0114129_100183958 493
594 3300009148 Ga0105243_10003878 Ga0105243_100038785 493
595 3300009174 Ga0105241_10015475 Ga0105241_100154756 493
596 3300009176 Ga0105242_10003061 Ga0105242_1000306114 493
597 3300009177 Ga0105248_10000040 Ga0105248_10000040162 493
598 3300009177 Ga0105248_10007307 Ga0105248_100073074 493
599 3300009177 Ga0105248_10046307 Ga0105248_100463074 493
600 3300009177 Ga0105248_10256461 Ga0105248_102564612 493
601 3300009545 Ga0105237_10051342 Ga0105237_100513424 493
602 3300009545 Ga0105237_10164528 Ga0105237_101645282 493
603 3300009553 Ga0105249_10000001 Ga0105249_10000001130 493
604 3300010375 Ga0105239_10033519 Ga0105239_100335192 493
605 3300010375 Ga0105239_10108668 Ga0105239_101086681 493
606 3300013296 Ga0157374_10033593 Ga0157374_100335932 493
607 3300013297 Ga0157378_10012869 Ga0157378_100128697 493
608 3300013297 Ga0157378_10104429 Ga0157378_101044293 493
609 3300013306 Ga0163162_10029767 Ga0163162_100297676 493
610 3300013306 Ga0163162_10074024 Ga0163162_100740242 493
611 3300013306 Ga0163162_10079151 Ga0163162_100791514 493
612 3300013306 Ga0163162_10134826 Ga0163162_101348262 493
613 3300013307 Ga0157372_10005924 Ga0157372_100059248 493
614 3300013308 Ga0157375_10005034 Ga0157375_1000503410 493
615 3300014326 Ga0157380_10003827 Ga0157380_100038274 493
616 3300014968 Ga0157379_10025482 Ga0157379_100254826 493
617 3300014969 Ga0157376_10055880 Ga0157376_100558802 493
618 3300017792 Ga0163161_10005342 Ga0163161_100053426 493
619 3300021384 Ga0213876_10001770 Ga0213876_1000177012 493
620 3300021384 Ga0213876_10015187 Ga0213876_100151873 493
621 3300025273 Ga0209673_1008850 Ga0209673_10088503 493
622 3300025303 Ga0209051_1000042 Ga0209051_100004245 493
623 3300025303 Ga0209051_1001272 Ga0209051_100127214 493
624 3300025303 Ga0209051_1003310 Ga0209051_100331011 493
625 3300025303 Ga0209051_1003693 Ga0209051_10036936 493
626 3300025898 Ga0207692_10016442 Ga0207692_100164422 493
627 3300025898 Ga0207692_10017629 Ga0207692_100176294 493
628 3300025899 Ga0207642_10000670 Ga0207642_1000067010 493
629 3300025899 Ga0207642_10013194 Ga0207642_100131941 493
630 3300025900 Ga0207710_10000094 Ga0207710_1000009411 493
631 3300025901 Ga0207688_10001311 Ga0207688_1000131116 493
632 3300025901 Ga0207688_10001662 Ga0207688_100016624 493
633 3300025901 Ga0207688_10015696 Ga0207688_100156963 493
634 3300025901 Ga0207688_10060428 Ga0207688_100604282 493
635 3300025903 Ga0207680_10046470 Ga0207680_100464702 493
636 3300025904 Ga0207647_10027662 Ga0207647_100276622 493
637 3300025908 Ga0207643_10023963 Ga0207643_100239632 493
638 3300025914 Ga0207671_10077218 Ga0207671_100772182 493
639 3300025915 Ga0207693_10003676 Ga0207693_100036766 493
640 3300025915 Ga0207693_10019923 Ga0207693_100199232 493
641 3300025916 Ga0207663_10007388 Ga0207663_100073883 493
642 3300025918 Ga0207662_10005997 Ga0207662_100059974 493
643 3300025919 Ga0207657_10138233 Ga0207657_101382331 493
644 3300025923 Ga0207681_10002134 Ga0207681_100021343 493
645 3300025927 Ga0207687_10002110 Ga0207687_100021103 493
646 3300025927 Ga0207687_10007569 Ga0207687_100075694 493
647 3300025927 Ga0207687_10119107 Ga0207687_101191072 493
648 3300025933 Ga0207706_10117753 Ga0207706_101177531 493
649 3300025934 Ga0207686_10034284 Ga0207686_100342843 493
650 3300025935 Ga0207709_10036710 Ga0207709_100367102 493
651 3300025937 Ga0207669_10030356 Ga0207669_100303563 493
652 3300025938 Ga0207704_10008206 Ga0207704_100082063 493
653 3300025938 Ga0207704_10025069 Ga0207704_100250693 493
654 3300025939 Ga0207665_10009146 Ga0207665_100091466 493
655 3300025941 Ga0207711_10000419 Ga0207711_1000041918 493
656 3300025941 Ga0207711_10007828 Ga0207711_100078287 493
657 3300025941 Ga0207711_10015373 Ga0207711_100153737 493
658 3300025942 Ga0207689_10006344 Ga0207689_100063444 493
659 3300025942 Ga0207689_10028771 Ga0207689_100287713 493
660 3300025942 Ga0207689_10043062 Ga0207689_100430621 493
661 3300025961 Ga0207712_10000006 Ga0207712_10000006363 493
662 3300025961 Ga0207712_10043652 Ga0207712_100436524 493
663 3300025972 Ga0207668_10000972 Ga0207668_1000097220 493
664 3300025972 Ga0207668_10119262 Ga0207668_101192622 493
665 3300025986 Ga0207658_10000513 Ga0207658_1000051337 493
666 3300025986 Ga0207658_10001083 Ga0207658_1000108311 493
667 3300025986 Ga0207658_10004107 Ga0207658_1000410710 493
668 3300026041 Ga0207639_10042649 Ga0207639_100426491 493
669 3300026041 Ga0207639_10042898 Ga0207639_100428983 493
670 3300026067 Ga0207678_10036639 Ga0207678_100366393 493
671 3300026067 Ga0207678_10042158 Ga0207678_100421582 493
672 3300026067 Ga0207678_10058204 Ga0207678_100582046 493
673 3300026088 Ga0207641_10000489 Ga0207641_1000048929 493
674 3300026088 Ga0207641_10022045 Ga0207641_100220454 493
675 3300026089 Ga0207648_10006599 Ga0207648_1000659910 493
676 3300026116 Ga0207674_10036548 Ga0207674_100365482 493
677 3300026118 Ga0207675_100000896 Ga0207675_1000008967 493
678 3300026118 Ga0207675_100018303 Ga0207675_1000183032 493
679 3300026121 Ga0207683_10003700 Ga0207683_100037006 493
680 3300026121 Ga0207683_10097115 Ga0207683_100971152 493
681 3300026142 Ga0207698_10096122 Ga0207698_100961224 493
682 3300028379 Ga0268266_10016797 Ga0268266_100167975 493
683 3300028379 Ga0268266_10031366 Ga0268266_100313662 493
684 3300028380 Ga0268265_10000032 Ga0268265_10000032156 493
685 3300028380 Ga0268265_10039720 Ga0268265_100397206 493
686 3300028380 Ga0268265_10186493 Ga0268265_101864931 493
687 3300028381 Ga0268264_10000026 Ga0268264_10000026359 493
688 3300028381 Ga0268264_10081582 Ga0268264_100815822 493
689 3300031251 Ga0265327_10000626 Ga0265327_1000062630 493
690 3300035691 Ga0373931_0011804 Ga0373931_0011804_2487_4004 493
691 3300035691 Ga0373931_0049431 Ga0373931_0049431_213_1721 493
692 3300037466 Ga0395898_0006290 Ga0395898_0006290_7655_9160 493
693 3300037853 Ga0436364_0908867 Ga0436364_0908867_3098_4636 493
694 3300037853 Ga0436364_1011521 Ga0436364_1011521_11335_12834 493
695 3300037853 Ga0436364_1442254 Ga0436364_1442254_3807_5333 493
696 3300038443 Ga0395901_0012501 Ga0395901_0012501_5134_6639 493
697 3300039437 Ga0436365_0064899 Ga0436365_0064899_10384_11880 493
698 3300039437 Ga0436365_0641890 Ga0436365_0641890_9497_10996 493
699 3300039437 Ga0436365_1856170 Ga0436365_1856170_7665_9194 493
700 3300039453 Ga0436362_1177671 Ga0436362_1177671_1097_2623 493
701 3300041411 Ga0439466_0001181 Ga0439466_0001181_1569_3086 493
702 3300041411 Ga0439466_0006248 Ga0439466_0006248_2851_4368 493
703 3300041413 Ga0439465_0001503 Ga0439465_0001503_4111_5628 493
704 3300044658 Ga0466972_0013868 Ga0466972_0013868_893_2404 493
705 3300044683 Ga0466965_0005448 Ga0466965_0005448_939_2510 493
706 3300044684 Ga0466966_0016384 Ga0466966_0016384_588_2099 493
707 3300044693 Ga0466961_0008896 Ga0466961_0008896_918_2432 493
708 3300044694 Ga0466963_0003743 Ga0466963_0003743_305_1804 493
709 3300044735 Ga0466968_0001398 Ga0466968_0001398_6665_8236 493
710 3300044901 Ga0466960_0006440 Ga0466960_0006440_2600_4171 493
711 3300044901 Ga0466960_0081961 Ga0466960_0081961_23_1534 493
712 3300045049 Ga0466959_0063426 Ga0466959_0063426_16_1530 493
713 3300045836 Ga0466958_0001373 Ga0466958_0001373_2728_4239 493
714 3300045836 Ga0466958_0075000 Ga0466958_0075000_44_1543 493
715 3300045836 Ga0466958_0075647 Ga0466958_0075647_205_1776 493
716 3300045976 Ga0466967_0010537 Ga0466967_0010537_525_2024 493
717 3300045976 Ga0466967_0038601 Ga0466967_0038601_22_1593 493
718 3300045976 Ga0466967_0043750 Ga0466967_0043750_71_1570 493
719 3300045976 Ga0466967_0096159 Ga0466967_0096159_505_2022 493
720 3300046459 Ga0495629_0051881 Ga0495629_0051881_1254_2762 493
721 3300046460 Ga0495638_0019649 Ga0495638_0019649_500_1999 493
722 3300046463 Ga0495653_0049986 Ga0495653_0049986_235_1755 493
723 3300046616 Ga0495668_0099388 Ga0495668_0099388_75_1577 493
724 3300046694 Ga0495649_0090744 Ga0495649_0090744_19_1521 493
725 3300047322 Ga0495680_0165455 Ga0495680_0165455_29_1537 493
726 3300048091 Ga0495626_0044170 Ga0495626_0044170_320_1822 493
727 3300048903 Ga0496100_0000115 Ga0496100_0000115_4139_5650 493
728 3300048903 Ga0496100_0000248 Ga0496100_0000248_10330_11829 493
729 3300048903 Ga0496100_0041825 Ga0496100_0041825_1235_2752 493
730 3300048903 Ga0496100_0073614 Ga0496100_0073614_572_2080 493
731 3300048904 Ga0496101_0000262 Ga0496101_0000262_23193_24692 493
732 3300048904 Ga0496101_0001407 Ga0496101_0001407_8997_10508 493
733 3300048904 Ga0496101_0012992 Ga0496101_0012992_2715_4223 493
734 3300048904 Ga0496101_0027119 Ga0496101_0027119_852_2360 493
735 3300048905 Ga0496102_0000427 Ga0496102_0000427_43711_45225 493
736 3300048905 Ga0496102_0000473 Ga0496102_0000473_9188_10696 493
737 3300048905 Ga0496102_0002046 Ga0496102_0002046_6349_7866 493
738 3300048905 Ga0496102_0006363 Ga0496102_0006363_6609_8120 493
739 3300048905 Ga0496102_0011131 Ga0496102_0011131_3267_4775 493
740 3300048905 Ga0496102_0101390 Ga0496102_0101390_681_2198 493
741 3300048905 Ga0496102_0236043 Ga0496102_0236043_93_1595 493
742 3300048906 Ga0496103_0000228 Ga0496103_0000228_12034_13545 493
743 3300048906 Ga0496103_0000577 Ga0496103_0000577_21292_22806 493
744 3300048906 Ga0496103_0000826 Ga0496103_0000826_3290_4798 493
745 3300048906 Ga0496103_0013663 Ga0496103_0013663_1330_2838 493
746 3300048906 Ga0496103_0063027 Ga0496103_0063027_745_2262 493
747 3300048907 Ga0496104_0001982 Ga0496104_0001982_6505_8004 493
748 3300048907 Ga0496104_0199897 Ga0496104_0199897_202_1719 493
749 3300048908 Ga0496105_0004544 Ga0496105_0004544_1322_2821 493
750 3300048909 Ga0496106_0003914 Ga0496106_0003914_1156_2664 493
751 3300048909 Ga0496106_0056607 Ga0496106_0056607_38_1555 493
752 3300048910 Ga0496107_0006162 Ga0496107_0006162_3826_5337 493
753 3300048910 Ga0496107_0033034 Ga0496107_0033034_586_2094 493
754 3300048910 Ga0496107_0056099 Ga0496107_0056099_665_2173 493
755 3300048910 Ga0496107_0079709 Ga0496107_0079709_802_2319 493
756 3300048911 Ga0496108_0013790 Ga0496108_0013790_4316_5827 493
757 3300048912 Ga0496109_0000882 Ga0496109_0000882_2097_3608 493
758 3300048912 Ga0496109_0029930 Ga0496109_0029930_2622_4139 493
759 3300048912 Ga0496109_0041287 Ga0496109_0041287_2490_4007 493
760 3300048914 Ga0496111_0086151 Ga0496111_0086151_11_1522 493
761 3300048915 Ga0496112_0016420 Ga0496112_0016420_760_2277 493
762 3300048915 Ga0496112_0057285 Ga0496112_0057285_344_1852 493
763 3300048917 Ga0496114_0000153 Ga0496114_0000153_28610_30118 493
764 3300048917 Ga0496114_0000178 Ga0496114_0000178_3875_5386 493
765 3300048917 Ga0496114_0004178 Ga0496114_0004178_1123_2622 493
766 3300048917 Ga0496114_0049855 Ga0496114_0049855_466_1974 493
767 3300048918 Ga0496115_0004346 Ga0496115_0004346_1064_2563 493
768 3300048919 Ga0496116_0005593 Ga0496116_0005593_8262_9773 493
769 3300048919 Ga0496116_0076529 Ga0496116_0076529_570_2084 493
770 3300048920 Ga0496117_0001007 Ga0496117_0001007_39794_41305 493
771 3300048921 Ga0496118_0000857 Ga0496118_0000857_10796_12310 493
772 3300048921 Ga0496118_0001227 Ga0496118_0001227_31488_32999 493
773 3300048921 Ga0496118_0001272 Ga0496118_0001272_8606_10105 493
774 3300048922 Ga0496119_0001211 Ga0496119_0001211_8126_9637 493
775 3300048922 Ga0496119_0006092 Ga0496119_0006092_3960_5474 493
776 3300048924 Ga0496121_0000014 Ga0496121_0000014_568019_569530 493
777 3300048924 Ga0496121_0001945 Ga0496121_0001945_12762_14276 493
778 3300048925 Ga0496122_0000132 Ga0496122_0000132_130880_132391 493
779 3300048925 Ga0496122_0021059 Ga0496122_0021059_1007_2515 493
780 3300048926 Ga0496123_0006535 Ga0496123_0006535_3843_5354 493
781 3300048926 Ga0496123_0009503 Ga0496123_0009503_1007_2515 493
782 3300048927 Ga0496124_0000106 Ga0496124_0000106_39850_41361 493
783 3300048927 Ga0496124_0049234 Ga0496124_0049234_1370_2884 493
784 3300048928 Ga0496125_0000014 Ga0496125_0000014_568019_569530 493
785 3300048928 Ga0496125_0005528 Ga0496125_0005528_6849_8363 493
786 3300048929 Ga0496126_0000017 Ga0496126_0000017_41147_42658 493
787 3300048929 Ga0496126_0002811 Ga0496126_0002811_6914_8422 493
788 3300048929 Ga0496126_0030074 Ga0496126_0030074_1766_3280 493
789 3300049569 Ga0501032_0003025 Ga0501032_0003025_3106_4605 493
790 3300049571 Ga0501034_0003913 Ga0501034_0003913_2979_4478 493
791 3300049571 Ga0501034_0018093 Ga0501034_0018093_2284_3783 493
792 3300049571 Ga0501034_0077054 Ga0501034_0077054_1034_2539 493
793 3300049572 Ga0501036_0007724 Ga0501036_0007724_3480_4979 493
794 3300049573 Ga0501037_0000759 Ga0501037_0000759_14519_16018 493
795 3300049573 Ga0501037_0009351 Ga0501037_0009351_3713_5212 493
796 3300049573 Ga0501037_0032693 Ga0501037_0032693_111_1616 493
797 3300049574 Ga0501038_0001047 Ga0501038_0001047_8934_10433 493
798 3300049574 Ga0501038_0037505 Ga0501038_0037505_968_2473 493
799 3300049575 Ga0501039_0007114 Ga0501039_0007114_5496_6995 493
800 3300049575 Ga0501039_0089429 Ga0501039_0089429_327_1832 493
801 3300049579 Ga0501043_0006218 Ga0501043_0006218_3013_4512 493
802 3300049579 Ga0501043_0012119 Ga0501043_0012119_3643_5142 493
803 3300049580 Ga0501046_0000695 Ga0501046_0000695_14307_15806 493
804 3300049581 Ga0501047_0006620 Ga0501047_0006620_5128_6627 493
805 3300049582 Ga0501048_0001635 Ga0501048_0001635_2478_3977 493
806 3300049585 Ga0501069_0052816 Ga0501069_0052816_622_2121 493
807 3300049586 Ga0501070_0001449 Ga0501070_0001449_15631_17130 493
808 3300049822 Ga0501035_0000321 Ga0501035_0000321_36464_37963 493
809 3300049823 Ga0501044_0014259 Ga0501044_0014259_2511_4010 493
810 3300049823 Ga0501044_0093370 Ga0501044_0093370_283_1782 493
811 3300050490 nmdc:mga03n38_2544_c1 nmdc:mga03n38_2544_c1_4147_5646 493
812 3300050490 nmdc:mga03n38_2774_c1 nmdc:mga03n38_2774_c1_2732_4249 493
813 3300050491 nmdc:mga00v17_1395_c1 nmdc:mga00v17_1395_c1_9538_11058 493
814 3300050491 nmdc:mga00v17_18036_c1 nmdc:mga00v17_18036_c1_833_2350 493
815 3300050491 nmdc:mga00v17_21287_c1 nmdc:mga00v17_21287_c1_552_2099 493
816 3300050492 nmdc:mga0yw44_17378_c1 nmdc:mga0yw44_17378_c1_1811_3328 493
817 3300050492 nmdc:mga0yw44_3292_c1 nmdc:mga0yw44_3292_c1_4023_5540 493
818 3300050492 nmdc:mga0yw44_34620_c1 nmdc:mga0yw44_34620_c1_228_1775 493
819 3300050492 nmdc:mga0yw44_4326_c1 nmdc:mga0yw44_4326_c1_3102_4622 493
820 3300050494 nmdc:mga06z11_10749_c1 nmdc:mga06z11_10749_c1_515_2032 493
821 3300050496 nmdc:mga07m45_41212_c1 nmdc:mga07m45_41212_c1_245_1774 493
822 3300050496 nmdc:mga07m45_6183_c1 nmdc:mga07m45_6183_c1_2388_3905 493
823 3300050507 nmdc:mga05p37_22514_c1 nmdc:mga05p37_22514_c1_2334_3851 493
824 3300050516 nmdc:mga0sz30_9291_c1 nmdc:mga0sz30_9291_c1_1620_3137 493
825 3300053079 Ga0500610_0001987 Ga0500610_0001987_2467_3969 493
826 3300053108 Ga0500562_001179 Ga0500562_001179_965_2467 493
827 3300053153 Ga0500616_0002876 Ga0500616_0002876_9281_10852 493
828 3300053153 Ga0500616_0038579 Ga0500616_0038579_343_1845 493
829 3300053730 Ga0500645_000063 Ga0500645_000063_64612_66126 493
830 3300061719 Ga0466962_0014986 Ga0466962_0014986_1058_2569 493
831 iso_pu_bacteria 2643221687 2644491205 493
832 iso_pu_bacteria 2919446982 2919448712 493
833 iso_pu_bacteria 2929212328 2929218388 493
834 3300006914 Ga0075436_100059928 Ga0075436_1000599282 495
835 3300009098 Ga0105245_10027146 Ga0105245_100271464 496
836 3300009553 Ga0105249_10020446 Ga0105249_100204464 496
837 3300010375 Ga0105239_10090887 Ga0105239_100908873 496
838 3300013296 Ga0157374_10228830 Ga0157374_102288301 496
839 3300013306 Ga0163162_10009929 Ga0163162_100099293 496
840 3300013307 Ga0157372_10168658 Ga0157372_101686582 496
841 3300048912 Ga0496109_0061436 Ga0496109_0061436_1215_2717 496
842 3300050511 nmdc:mga08y16_101120_c1 nmdc:mga08y16_101120_c1_718_2220 496
843 3300005457 Ga0070662_100096833 Ga0070662_1000968332 503
844 3300046515 Ga0495620_0036222 Ga0495620_0036222_94_1626 503
845 3300046520 Ga0495637_0043437 Ga0495637_0043437_264_1796 503
846 3300046648 Ga0495611_0028032 Ga0495611_0028032_91_1623 503
847 3300046665 Ga0495661_0081058 Ga0495661_0081058_267_1799 503
848 3300046692 Ga0495671_0054600 Ga0495671_0054600_120_1652 503
849 3300046794 Ga0495589_0059270 Ga0495589_0059270_35_1567 503
850 3300047445 Ga0495677_0019440 Ga0495677_0019440_643_2175 503
851 3300001915 JGI24741J21665_1004231 JGI24741J21665_10042312 504
852 3300002459 JGI24751J29686_10002325 JGI24751J29686_100023252 504
853 3300005327 Ga0070658_10093759 Ga0070658_100937592 504
854 3300005328 Ga0070676_10008718 Ga0070676_100087185 504
855 3300005329 Ga0070683_100207572 Ga0070683_1002075721 504
856 3300005337 Ga0070682_100001211 Ga0070682_1000012112 504
857 3300005338 Ga0068868_100177504 Ga0068868_1001775042 504
858 3300005344 Ga0070661_100129182 Ga0070661_1001291821 504
859 3300005347 Ga0070668_100045992 Ga0070668_1000459921 504
860 3300005366 Ga0070659_100016187 Ga0070659_1000161874 504
861 3300005455 Ga0070663_100083040 Ga0070663_1000830402 504
862 3300005466 Ga0070685_10014773 Ga0070685_100147733 504
863 3300005468 Ga0070707_100165503 Ga0070707_1001655032 504
864 3300005539 Ga0068853_100071658 Ga0068853_1000716583 504
865 3300005578 Ga0068854_100025337 Ga0068854_1000253374 504
866 3300005842 Ga0068858_100046913 Ga0068858_1000469134 504
867 3300005983 Ga0081540_1011454 Ga0081540_10114544 504
868 3300005985 Ga0081539_10004566 Ga0081539_100045663 504
869 3300009545 Ga0105237_10264593 Ga0105237_102645931 504
870 3300011119 Ga0105246_10072007 Ga0105246_100720072 504
871 3300014745 Ga0157377_10080449 Ga0157377_100804492 504
872 3300025901 Ga0207688_10009551 Ga0207688_100095512 504
873 3300025904 Ga0207647_10053948 Ga0207647_100539482 504
874 3300025906 Ga0207699_10006259 Ga0207699_100062591 504
875 3300025907 Ga0207645_10058212 Ga0207645_100582122 504
876 3300025909 Ga0207705_10025934 Ga0207705_100259343 504
877 3300025914 Ga0207671_10087953 Ga0207671_100879531 504
878 3300025916 Ga0207663_10054819 Ga0207663_100548192 504
879 3300025920 Ga0207649_10006432 Ga0207649_100064325 504
880 3300025921 Ga0207652_10157724 Ga0207652_101577241 504
881 3300025927 Ga0207687_10026230 Ga0207687_100262303 504
882 3300025931 Ga0207644_10083867 Ga0207644_100838673 504
883 3300025932 Ga0207690_10032483 Ga0207690_100324833 504
884 3300025933 Ga0207706_10017268 Ga0207706_100172682 504
885 3300025937 Ga0207669_10070907 Ga0207669_100709073 504
886 3300025942 Ga0207689_10010392 Ga0207689_100103927 504
887 3300025944 Ga0207661_10001594 Ga0207661_1000159411 504
888 3300025961 Ga0207712_10088424 Ga0207712_100884242 504
889 3300025972 Ga0207668_10069075 Ga0207668_100690751 504
890 3300026023 Ga0207677_10017030 Ga0207677_100170302 504
891 3300026023 Ga0207677_10068318 Ga0207677_100683181 504
892 3300026023 Ga0207677_10083694 Ga0207677_100836942 504
893 3300026035 Ga0207703_10008803 Ga0207703_100088031 504
894 3300026067 Ga0207678_10018936 Ga0207678_100189365 504
895 3300026078 Ga0207702_10111204 Ga0207702_101112042 504
896 3300026118 Ga0207675_100002895 Ga0207675_1000028957 504
897 3300027907 Ga0207428_10036585 Ga0207428_100365851 504
898 3300027907 Ga0207428_10108580 Ga0207428_101085802 504
899 3300028379 Ga0268266_10121722 Ga0268266_101217223 504
900 3300028380 Ga0268265_10128307 Ga0268265_101283072 504
901 3300031731 Ga0307405_10012822 Ga0307405_100128222 504
902 3300031824 Ga0307413_10008230 Ga0307413_100082302 504
903 3300031852 Ga0307410_10048177 Ga0307410_100481772 504
904 3300031889 Ga0326468_10000144 Ga0326468_100001442 504
905 3300031901 Ga0307406_10008888 Ga0307406_100088884 504
906 3300031911 Ga0307412_10020831 Ga0307412_100208313 504
907 3300032002 Ga0307416_100024902 Ga0307416_1000249023 504
908 3300032005 Ga0307411_10116855 Ga0307411_101168551 504
909 3300032126 Ga0307415_100014609 Ga0307415_1000146092 504
910 3300035083 Ga0373926_0018656 Ga0373926_0018656_135_1679 504
911 3300035111 Ga0373923_0025185 Ga0373923_0025185_488_2032 504
912 3300035113 Ga0373936_0038871 Ga0373936_0038871_308_1852 504
913 3300035116 Ga0373945_0034978 Ga0373945_0034978_214_1758 504
914 3300035170 Ga0373943_0019111 Ga0373943_0019111_453_1997 504
915 3300035171 Ga0373946_0027023 Ga0373946_0027023_250_1794 504
916 3300035242 Ga0373962_0012023 Ga0373962_0012023_444_1988 504
917 3300035692 Ga0373935_0012382 Ga0373935_0012382_1188_2732 504
918 3300035695 Ga0373927_0058976 Ga0373927_0058976_308_1852 504
919 3300035725 Ga0373947_0025273 Ga0373947_0025273_847_2391 504
920 3300037068 Ga0373925_0114583 Ga0373925_0114583_514_2058 504
921 3300038996 Ga0242420_004140 Ga0242420_004140_253_1797 504
922 3300042438 Ga0439459_0009821 Ga0439459_0009821_40_1554 504
923 3300046454 Ga0495592_0057277 Ga0495592_0057277_109_1653 504
924 3300046461 Ga0495641_0040289 Ga0495641_0040289_481_2025 504
925 3300046476 Ga0495662_0040659 Ga0495662_0040659_625_2169 504
926 3300046477 Ga0495664_0041217 Ga0495664_0041217_294_1838 504
927 3300046517 Ga0495630_0089710 Ga0495630_0089710_644_2188 504
928 3300046529 Ga0495652_0032691 Ga0495652_0032691_139_1683 504
929 3300046531 Ga0495665_0041579 Ga0495665_0041579_129_1673 504
930 3300046663 Ga0495635_0035246 Ga0495635_0035246_277_1821 504
931 3300046675 Ga0495657_0099895 Ga0495657_0099895_261_1805 504
932 3300046678 Ga0495599_0032632 Ga0495599_0032632_1612_3156 504
933 3300046681 Ga0495647_0040683 Ga0495647_0040683_29_1573 504
934 3300046690 Ga0495624_0041006 Ga0495624_0041006_660_2204 504
935 3300047322 Ga0495680_0079033 Ga0495680_0079033_228_1772 504
936 3300047444 Ga0495675_0109406 Ga0495675_0109406_83_1627 504
937 3300047471 Ga0495684_0107659 Ga0495684_0107659_418_1962 504
938 3300047673 Ga0495593_0053739 Ga0495593_0053739_504_2045 504
939 3300048913 Ga0496110_0046947 Ga0496110_0046947_198_1742 504

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

210

497

0.94

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

35

208

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8797 27 499
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8704 27 499
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8639 27 500
4lgv-assembly1.cif.gz_A x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8612 27 499
5aq1-assembly1.cif.gz_B trypanosoma cruzi glucose-6-phosphate dehydrogenase in complex with g6p and nadph 0.8549 25 499
ID Description Score Start End Superfamily
af_A0A0R0IPN1_4_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8784 124 208 3.40.50.720
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8663 33 207 3.40.50.720
4lgvC02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8654 211 500 3.30.360.10
4lgvD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8602 27 204 3.40.50.720
af_Q10M94_152_326_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8568 28 204 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A534WCE8-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9758 28 197 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A6N9V909-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9737 245 359 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A0R3WUZ6-F1-model_v4 glucose-6-phosphate dehydrogenase (NADP(+)) (EC 1.1.1.49) 0.9698 226 355 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-T1B9F9-F1-model_v4 Glucose-6-phosphate 1-dehydrogenase 0.9615 216 372 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A2M7FSM5-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9545 232 372 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Feature Viewer

pLDDT pTM Quality
79.59 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map